>6pai_E mol:protein length:102  DET1- and DDB1-associated protein 1
MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYL
HQQWDKKNAAKKRDQEQVELEGESSAPPRKVARTDSPDMHEDT