>6pax_B mol:na length:26  26 NUCLEOTIDE DNA
AAGCATTTTCACGCATGAGTGCACAG
>6pax_C mol:na length:26  26 NUCLEOTIDE DNA
TTCTGTGCACTCATGCGTGAAAATGC
>6pax_A mol:protein length:133  HOMEOBOX PROTEIN PAX-6
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYA
TGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVS
SINRVLRNLASEKQQ
>6pax_C mol:na length:26  26 NUCLEOTIDE DNA
TTCTGTGCACTCATGCGTGAAAATGC