>6pax_A mol:protein length:133  HOMEOBOX PROTEIN PAX-6
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYA
TGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVS
SINRVLRNLASEKQQ