>6psu_N mol:protein length:72  Protein TraR
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVE
CQAYQERQRKHYA