>6q8w_5 mol:protein length:207  NADH-quinone oxidoreductase subunit 5
MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLT
YPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREV
YDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGK
DPGLTFYKGGSRKGYRSLWADLKKAREVKG