>6qnw_A mol:protein length:716  Polymerase acidic protein
MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGE
SIVVELDDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFI
EIGVTRREVHIYYLEKANKIKSENTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFT
IRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSCLENFRAYVDGF
EPNGYIEGKLSQMSKEVNAKIEPFLKTTPRPIRLPDGPPCFQRSKFLLMDALKLSIEDP
SHEGEGIPLYDAIKCMRTFFGWKEPYIVKPHEKGINPNYLLSWKQVLAELQDIENEEKI
PRTKNMKKTSQLKWALGENMAPEKVDFDNCRDVSDLKQYDSDEPELRSLSSWIQNEFNK
ACELTDSTWIELDEIGEDVAPIEYIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNA
SCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPR
LEPHKWEKYCVLEIGDMLLRSAIGQMSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQ
QIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEDGSIGKVCRTLLAKSVFNSL
YASPQLEGFSAESRKLLLVVQALRDNLEPGTFDLEGLYEAIEECLINDPWVLLNASWFN
SFLTHALR