>6qpa_B mol:protein length:314  Sulfur oxygenase/reductase
MSNENPIIAINMAKIANKPDSYETMMKVGPKVCITTASHPGFLGFEQLLQTGIHPMAGR
YGGGAVDMRETLNPMGMFQYTVWKDVHSHEEMHHDNFKEIFELCSGCLGMVIEGPWEPY
FEVVKSDLPQIMSMTDVPQVLGDSFAKQERVPKVALSSQRTVVIGDHWVMDGHEKAFEQ
GATETLEWMKANVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLGANPPEYNTNYG
NKVHDKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNGVLAHLDKGPY
YMFFSPMMEQGLWRKHLKQ