>6qx2_K mol:protein length:187  DNA gyrase subunit B,DNA gyrase subunit B
GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILN
NNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIE
AGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENR
RQFIEDNAVY