>6qx2_b mol:protein length:186  DNA gyrase subunit B,DNA gyrase subunit B
GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILN
NNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIE
AGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENR
RQFIEDNAV