>6r1t_A mol:protein length:99  Histone H3
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA
SEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA