>6r1t_H mol:protein length:96  Histone H2B
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRS
TITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA