>6rin_F mol:protein length:158  Transcription elongation factor GreB
MKTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYNKKRLREID
RRVRYLTKCMENLKIVDYSPQQEGKVFFGAWVEIENDDGVTHRFRIVGYDEIFGRKDYI
SIDSPMARALLKKEVGDLAVVNTPAGEASWYVNAIEYVKP