>6sef_E mol:protein length:140  Histone H3-like centromeric protein A
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH
LLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGR
VTLFPKDVQLARRIRGLEEGLG