>6sef_V mol:protein length:124  Centromere protein C
GPLGSPEFGRATMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDC
VSKKQMPPVGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWW
VVKSEE