>6t7b_C mol:protein length:151  Histone H2A type 1-B/E
MGSSHHHHHHENLYFQSNAPWMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKG
NYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL
LGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK