>6t7b_K mol:protein length:89  Transcription factor SOX-2
SNANSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFI
DEAKRLRALHMKEHPDYKYRPRRKTKTLMK