>6t8g_A mol:protein length:491  DNA translocase FtsK
MVPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAP
LFVDTAVEGTLPPLSLLDPAEVKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGP
VITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGKTTVGIEIPNEDRQMVR
FSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLL
SILFKSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYR
LMAAMGVRNLAGFNRKVKDAEEAGTPLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFAD
MMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRIAFQVSSKI
DSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYI
EDILAGVDEGGKLHHHHHH