>6txa_O mol:protein length:520  Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
GSQIHVDTMKVINDPIHGHIELHPLLVRIINTPQFQRLRYIKQLGGGYYVFPGASHNRF
EHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPL
ARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPVEDS
LWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCE
VDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITG
AGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGET
QPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVS
FYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNF
TKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM