>6u9d_P mol:protein length:297  Acetolactate synthase small subunit, mitochondrial
MGSSHHHHHHSSGLVPRGSHMENLYFQGATRPPLPTLDTPSWNANSAVSSIIYETPAPS
RQPRKQHVLNCLVQNEPGVLSRVSGTLAARGFNIDSLVVCNTEVKDLSRMTIVLQGQDG
VIEQARRQIEDLVPVYAVLDYTNSEIIKRELVMARISLLGTEYFEDLLLHHHTSTNAGA
ADSQELVAEIREKQFHPANLPASEVLRLKHEHLNDITNLTNNFGGRVVDISETSCIVEL
SAKPTRISAFLKLVEPFGVLECARSGMMALPRTPLKTSTEEAADEDEKISEIVDISQLP
PG