>6upx_H mol:protein length:146  DNA-directed RNA polymerases I, II, and III subunit RPABC3
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTI
ASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSF
GGLLMRLEGNYRNLNNLKQENAYLLIRR