>6upy_F mol:protein length:155  DNA-directed RNA polymerases I, II, and III subunit RPABC2
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQ
QHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPL
RIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL