>6uq2_E mol:protein length:215  DNA-directed RNA polymerases I, II, and III subunit RPABC1
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMS
FQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITP
SAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPR
IQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM