>6uxw_I mol:protein length:179  Transcription regulatory protein SNF6
MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSA
GMNGRSLTYAQQQLNKQRQDFERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAF
NMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQHXXXXXXXXXXXXXXXXXXXXXXXXXXX
XX