>6v96_Q mol:protein length:440  Glucose-1-phosphate adenylyltransferase
MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVY
FGGKARIIDFALSNALNSGIRRIGVATQYKAHELIRHLQRGWDFFRPERNESFDILPAS
QRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVT
IGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFL
MEALRRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDA
YWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIIS
GAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDP
ELDAKRFRRTESGICLITQSMIDKLDL