>6v9a_H mol:protein length:440  Glucose-1-phosphate adenylyltransferase
MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVY
FGGKARIIDFALSNALNSGIRRIGVATQYKAHDLIRHLQRGWDFFRPERNESFDILPAS
QRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVT
IGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFL
MEALRRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDA
YWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIIS
GAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDP
ELDAKRFRRTESGICLITQSMIDKLDL