>6vvt_B mol:protein length:350  DNA-directed RNA polymerase subunit alpha
MLISQRPTLSEETVAENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGV
LHEFTTVPGVKEDVTDIILNLKGLVVSSDDDEPVTMYLRKQGPGVVTAGDIVPPAGVTV
HNPDMHIATLNDKGKLEVELVVERGRGYVPAVQNKASGAEIGRIPVDSIYSPVLKVTYK
VEATRVEQRTDFDKLIIDVETKNSISPRDALASAGGTLVELFGLARELNADSEHIEIGP
SPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSID
EVKIKLHQLGLSLKDSPATFDPSEVAGYDAATGTWTSDAGYDLDDNQDYAETEQL