>6vvt_D mol:protein length:1317  DNA-directed RNA polymerase subunit beta'
MLDVNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWE
CYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLL
DLAPKDLEKIIYFAAYVITSVDDEMRHNELSTLEAEMAVEKKAVEDQRDADLEARAQKL
EADLAELEAEGAKSDVRRKVRDSGEREMRQLRDRAQRELDRLDEIWNTFTKLAPKQLIV
DEVLYRELQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRSGKGQKKLRALKR
LKVVAAFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRL
KRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRF
RQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSA
KRMVERQRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEA
FNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILSPASGKPLAMPRLDMVTGLYYLTT
LVEGATGEYQAATKDAPEQGVYSSPAEAIMAMDRGALSVRAKIKVRLTELRPPTDLEAQ
LFENGWKPGDAWTAETTLGRVMFNELLPKSYPFVNEQMHKKVQARIINDLAERFPMIVV
AQTVDKLKDAGFYWATRSGVTVSMADVLVPPQKQEILERHEAEADAIERKYQRGALNHT
ERNESLVKIWQDATEEVGKALEEFYPADNPIITIVKSGATGNLTQTRTLAGMKGLVTNP
KGEFIPRPIKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIV
REHDCETERGINVTLAERGPDGTLIRDAHVETSAFARTLATDAVDANGNVIIERGHDLG
DPAIDALLAAGITTVKVRSVLTCTSATGVCAMCYGRSMATGKLVDIGEAVGIVAAQSIG
EPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARVPRNKAPIADVAGRVRLEESDKF
FKITIVPDDGGEEVVYDKLSKRQRLRVITHEDGTEGVLSDGDHVEVGDQLMEGAADPHE
VLRVQGPREVQIHLVKEVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGS
LTERAEFEAENRRVVAEGGEPAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAI
NCRSDKLNGLKENVIIGKLIPAGTGISRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDF
GQATGAAVPLDDYGYSDYR