>6vvt_E mol:protein length:107  DNA-directed RNA polymerase subunit omega
MSTPHADAQLNAADDLGIDSSAASAYDTPLGITNPPIDELLSRASSKYALVIYAAKRAR
QINDYYNQLGDGILEYVGPLVEPGLQEKPLSIALREIHGDLLEHTEGE