>6w01_B mol:protein length:370  Uridylate-specific endoribonuclease
MHHHHHHSSGVDLGTENLYFQSNMSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKV
DGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPA
HISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQP
SVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEID
FLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPM
DSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFM
LWCKDGHVETFYPKLQ