>6wyg_B mol:protein length:182  Ferritin heavy chain
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELH
KLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRCMGAPESGLAEYLFDKHTLGD
SDNES