>6wyg_C mol:protein length:182  Ferritin heavy chain
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELH
KLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRCMGAPESGLAEYLFDKHTLGD
SDNES