>6xxd_B mol:protein length:125  PilA
FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTS
NQAALISLGLKSTPANVTFSIVSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTS
SQPESCP