>6xxd_F mol:protein length:125  PilA
FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTS
NQAALISLGLKSTPANVTFSIVSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTS
SQPESCP