>6xxd_N mol:protein length:125  PilA
FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTS
NQAALISLGLKSTPANVTFSIVSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTS
SQPESCP