>6yov_B mol:protein length:105  Histone H4
GSHMSGRGKGGKGLGKGGAKRHRVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG
VLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG