>7cal_B mol:protein length:677  Potassium channel KAT1
MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRY
RAWEMWLVLLVIYSAWICPFQFAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSH
SYLLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGSELGFRILSMLRLWRLRR
VSSLFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYP
NFKEASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNM
TNLVVHWTSRTRTFRDSVRAASEFASRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNN
LPKAIRSSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPPKEDIILQNEAPTD
LYILVSGAVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISR
TSLMSAMHAHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRK
DGYGLDVTNPTSDTALMDAIHKEDTEMVKKILKEQKIERAKVERSSSETAGRSYANDSS
KKDPYCSSSNQIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLASEKFGGCNF
TKITNADNAEIDDLDVIWDGDHLYFSSN