>7khe_E mol:protein length:91  DNA-directed RNA polymerase subunit omega
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLI
NNQILDVRERQEQQEQEAAELQAVTAIAEGRR