>8rxn_A mol:protein length:52  RUBREDOXIN
MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA