>9ins_B mol:protein length:30  INSULIN (CHAIN B)
FVNQHLCGSHLVEALYLVCGERGFFYTPKA