data_1A4J
# 
_entry.id   1A4J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A4J         
WWPDB D_1000170383 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A4J 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Spiller, B.W.'   1 
'Romesburg, F.E.' 2 
'Schultz, P.G.'   3 
'Stevens, R.C.'   4 
# 
_citation.id                        primary 
_citation.title                     'Immunological origins of binding and catalysis in a Diels-Alderase antibody.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            279 
_citation.page_first                1929 
_citation.page_last                 1933 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9506942 
_citation.pdbx_database_id_DOI      10.1126/science.279.5358.1929 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Romesberg, F.E.' 1 
primary 'Spiller, B.'     2 
primary 'Schultz, P.G.'   3 
primary 'Stevens, R.C.'   4 
# 
_cell.entry_id           1A4J 
_cell.length_a           158.900 
_cell.length_b           49.330 
_cell.length_c           145.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.74 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A4J 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (LIGHT CHAIN)' 23706.475 2   ? ? FAB ? 
2 polymer man 'IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY (HEAVY CHAIN)' 23593.459 2   ? ? FAB ? 
3 water   nat water                                                          18.015    264 ? ? ?   ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCSQSTHVPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
;
;ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCSQSTHVPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
;
L,A ? 
2 'polypeptide(L)' no no 
;QVQLLESGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAY
LQINNLKNEDTATYFCVQAERLRRTFDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
;
;QVQLLESGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAY
LQINNLKNEDTATYFCVQAERLRRTFDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
;
H,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   LEU n 
1 3   VAL n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   THR n 
1 8   PRO n 
1 9   LEU n 
1 10  SER n 
1 11  LEU n 
1 12  PRO n 
1 13  VAL n 
1 14  SER n 
1 15  LEU n 
1 16  GLY n 
1 17  ASP n 
1 18  GLN n 
1 19  ALA n 
1 20  SER n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  LEU n 
1 30  VAL n 
1 31  HIS n 
1 32  SER n 
1 33  ASN n 
1 34  GLY n 
1 35  ASN n 
1 36  THR n 
1 37  TYR n 
1 38  LEU n 
1 39  HIS n 
1 40  TRP n 
1 41  TYR n 
1 42  LEU n 
1 43  GLN n 
1 44  LYS n 
1 45  PRO n 
1 46  GLY n 
1 47  GLN n 
1 48  SER n 
1 49  PRO n 
1 50  LYS n 
1 51  LEU n 
1 52  LEU n 
1 53  ILE n 
1 54  TYR n 
1 55  LYS n 
1 56  VAL n 
1 57  SER n 
1 58  ASN n 
1 59  ARG n 
1 60  PHE n 
1 61  SER n 
1 62  GLY n 
1 63  VAL n 
1 64  PRO n 
1 65  ASP n 
1 66  ARG n 
1 67  PHE n 
1 68  SER n 
1 69  GLY n 
1 70  SER n 
1 71  GLY n 
1 72  SER n 
1 73  GLY n 
1 74  THR n 
1 75  ASP n 
1 76  PHE n 
1 77  THR n 
1 78  LEU n 
1 79  LYS n 
1 80  ILE n 
1 81  SER n 
1 82  ARG n 
1 83  VAL n 
1 84  GLU n 
1 85  ALA n 
1 86  GLU n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  VAL n 
1 91  TYR n 
1 92  PHE n 
1 93  CYS n 
1 94  SER n 
1 95  GLN n 
1 96  SER n 
1 97  THR n 
1 98  HIS n 
1 99  VAL n 
1 100 PRO n 
1 101 PRO n 
1 102 THR n 
1 103 PHE n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 THR n 
1 108 LYS n 
1 109 LEU n 
1 110 GLU n 
1 111 ILE n 
1 112 LYS n 
1 113 ARG n 
1 114 THR n 
1 115 VAL n 
1 116 ALA n 
1 117 ALA n 
1 118 PRO n 
1 119 SER n 
1 120 VAL n 
1 121 PHE n 
1 122 ILE n 
1 123 PHE n 
1 124 PRO n 
1 125 PRO n 
1 126 SER n 
1 127 ASP n 
1 128 GLU n 
1 129 GLN n 
1 130 LEU n 
1 131 LYS n 
1 132 SER n 
1 133 GLY n 
1 134 THR n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 VAL n 
1 139 CYS n 
1 140 LEU n 
1 141 LEU n 
1 142 ASN n 
1 143 ASN n 
1 144 PHE n 
1 145 TYR n 
1 146 PRO n 
1 147 ARG n 
1 148 GLU n 
1 149 ALA n 
1 150 LYS n 
1 151 VAL n 
1 152 GLN n 
1 153 TRP n 
1 154 LYS n 
1 155 VAL n 
1 156 ASP n 
1 157 ASN n 
1 158 ALA n 
1 159 LEU n 
1 160 GLN n 
1 161 SER n 
1 162 GLY n 
1 163 ASN n 
1 164 SER n 
1 165 GLN n 
1 166 GLU n 
1 167 SER n 
1 168 VAL n 
1 169 THR n 
1 170 GLU n 
1 171 GLN n 
1 172 ASP n 
1 173 SER n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 TYR n 
1 179 SER n 
1 180 LEU n 
1 181 SER n 
1 182 SER n 
1 183 THR n 
1 184 LEU n 
1 185 THR n 
1 186 LEU n 
1 187 SER n 
1 188 LYS n 
1 189 ALA n 
1 190 ASP n 
1 191 TYR n 
1 192 GLU n 
1 193 LYS n 
1 194 HIS n 
1 195 LYS n 
1 196 VAL n 
1 197 TYR n 
1 198 ALA n 
1 199 CYS n 
1 200 GLU n 
1 201 VAL n 
1 202 THR n 
1 203 HIS n 
1 204 GLN n 
1 205 GLY n 
1 206 LEU n 
1 207 SER n 
1 208 SER n 
1 209 PRO n 
1 210 VAL n 
1 211 THR n 
1 212 LYS n 
1 213 SER n 
1 214 PHE n 
1 215 ASN n 
1 216 ARG n 
1 217 GLY n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   LEU n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASN n 
2 32  TYR n 
2 33  GLY n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  LYS n 
2 47  TRP n 
2 48  MET n 
2 49  GLY n 
2 50  TRP n 
2 51  ILE n 
2 52  ASN n 
2 53  THR n 
2 54  TYR n 
2 55  THR n 
2 56  GLY n 
2 57  GLU n 
2 58  PRO n 
2 59  THR n 
2 60  TYR n 
2 61  ALA n 
2 62  ASP n 
2 63  ASP n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  ALA n 
2 70  PHE n 
2 71  SER n 
2 72  LEU n 
2 73  GLU n 
2 74  THR n 
2 75  SER n 
2 76  ALA n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  ILE n 
2 84  ASN n 
2 85  ASN n 
2 86  LEU n 
2 87  LYS n 
2 88  ASN n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  THR n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  VAL n 
2 98  GLN n 
2 99  ALA n 
2 100 GLU n 
2 101 ARG n 
2 102 LEU n 
2 103 ARG n 
2 104 ARG n 
2 105 THR n 
2 106 PHE n 
2 107 ASP n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 ALA n 
2 112 GLY n 
2 113 THR n 
2 114 THR n 
2 115 VAL n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
2 119 SER n 
2 120 ALA n 
2 121 SER n 
2 122 THR n 
2 123 LYS n 
2 124 GLY n 
2 125 PRO n 
2 126 SER n 
2 127 VAL n 
2 128 PHE n 
2 129 PRO n 
2 130 LEU n 
2 131 ALA n 
2 132 PRO n 
2 133 SER n 
2 134 SER n 
2 135 LYS n 
2 136 SER n 
2 137 THR n 
2 138 SER n 
2 139 GLY n 
2 140 GLY n 
2 141 THR n 
2 142 ALA n 
2 143 ALA n 
2 144 LEU n 
2 145 GLY n 
2 146 CYS n 
2 147 LEU n 
2 148 VAL n 
2 149 LYS n 
2 150 ASP n 
2 151 TYR n 
2 152 PHE n 
2 153 PRO n 
2 154 GLU n 
2 155 PRO n 
2 156 VAL n 
2 157 THR n 
2 158 VAL n 
2 159 SER n 
2 160 TRP n 
2 161 ASN n 
2 162 SER n 
2 163 GLY n 
2 164 ALA n 
2 165 LEU n 
2 166 THR n 
2 167 SER n 
2 168 GLY n 
2 169 VAL n 
2 170 HIS n 
2 171 THR n 
2 172 PHE n 
2 173 PRO n 
2 174 ALA n 
2 175 VAL n 
2 176 LEU n 
2 177 GLN n 
2 178 SER n 
2 179 SER n 
2 180 GLY n 
2 181 LEU n 
2 182 TYR n 
2 183 SER n 
2 184 LEU n 
2 185 SER n 
2 186 SER n 
2 187 VAL n 
2 188 VAL n 
2 189 THR n 
2 190 VAL n 
2 191 PRO n 
2 192 SER n 
2 193 SER n 
2 194 SER n 
2 195 LEU n 
2 196 GLY n 
2 197 THR n 
2 198 GLN n 
2 199 THR n 
2 200 TYR n 
2 201 ILE n 
2 202 CYS n 
2 203 ASN n 
2 204 VAL n 
2 205 ASN n 
2 206 HIS n 
2 207 LYS n 
2 208 PRO n 
2 209 SER n 
2 210 ASN n 
2 211 THR n 
2 212 LYS n 
2 213 VAL n 
2 214 ASP n 
2 215 LYS n 
2 216 LYS n 
2 217 VAL n 
2 218 GLU n 
2 219 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? BALB/C ? ? ? ? 'Mus musculus' 10090 ? 25F2 ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 25F2 ? ? ? ? ? ? ? PLASMID ? ? ? P4XH ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? BALB/C ? ? ? ? 'Mus musculus' 10090 ? 25F2 ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 25F2 ? ? ? ? ? ? ? PLASMID ? ? ? P4XH ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP KAC_HUMAN 1 P01834 1 
;TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
;
? 
2 PDB 1A4J      2 1A4J   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A4J L 114 ? 217 ? P01834 1 ? 104 ? 114 217 
2 1 1A4J A 114 ? 217 ? P01834 1 ? 104 ? 114 217 
3 2 1A4J H 1   ? 219 ? 1A4J   1 ? 219 ? 1   219 
4 2 1A4J B 1   ? 219 ? 1A4J   1 ? 219 ? 1   219 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1A4J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   51.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '19% PEG 8K, 20% GLYCEROL, 200MM MG(CH3COO)2, 10MM CDS04 100MM BISTRIS PH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-11 
_diffrn_detector.details                WIGGLER 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MONOCHROMATOR 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             0.87 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A4J 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   63217 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.044 
_reflns.pdbx_netI_over_sigmaI        16. 
_reflns.B_iso_Wilson_estimate        33.7 
_reflns.pdbx_redundancy              6.7 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.17 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A4J 
_refine.ls_number_reflns_obs                     49380 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    98.5 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.292 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  4197 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               36.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1A4K' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6902 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             274 
_refine_hist.number_atoms_total               7178 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.383 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      30.6  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.749 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        2.2 
_refine_ls_shell.number_reflns_R_work             4049 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               95.4 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             473 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PR 'X-RAY DIFFRACTION' 
2 ?            ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A4J 
_struct.title                     'DIELS ALDER CATALYTIC ANTIBODY GERMLINE PRECURSOR' 
_struct.pdbx_descriptor           'IMMUNOGLOBULIN, DIELS ALDER CATALYTIC ANTIBODY' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A4J 
_struct_keywords.pdbx_keywords   IMMUNOGLOBULIN 
_struct_keywords.text            'IMMUNOGLOBULIN, ANTIBODY, CATALYTIC ANTIBODY, DIELS ALDER, GERMLINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 85  ? ASP A 87  ? ALA L 85  ASP L 87  5 ? 3 
HELX_P HELX_P2  2  ASP A 127 ? SER A 132 ? ASP L 127 SER L 132 1 ? 6 
HELX_P HELX_P3  3  LYS A 188 ? LYS A 193 ? LYS L 188 LYS L 193 1 ? 6 
HELX_P HELX_P4  4  PHE B 29  ? ASN B 31  ? PHE H 29  ASN H 31  5 ? 3 
HELX_P HELX_P5  5  ASP B 62  ? PHE B 64  ? ASP H 62  PHE H 64  5 ? 3 
HELX_P HELX_P6  6  ASN B 88  ? ASP B 90  ? ASN H 88  ASP H 90  5 ? 3 
HELX_P HELX_P7  7  ASN B 161 ? GLY B 163 ? ASN H 161 GLY H 163 5 ? 3 
HELX_P HELX_P8  8  SER B 192 ? SER B 194 ? SER H 192 SER H 194 5 ? 3 
HELX_P HELX_P9  9  ALA C 85  ? ASP C 87  ? ALA A 85  ASP A 87  5 ? 3 
HELX_P HELX_P10 10 ASP C 127 ? SER C 132 ? ASP A 127 SER A 132 1 ? 6 
HELX_P HELX_P11 11 LYS C 188 ? LYS C 193 ? LYS A 188 LYS A 193 1 ? 6 
HELX_P HELX_P12 12 ASP D 62  ? PHE D 64  ? ASP B 62  PHE B 64  5 ? 3 
HELX_P HELX_P13 13 THR D 74  ? ALA D 76  ? THR B 74  ALA B 76  5 ? 3 
HELX_P HELX_P14 14 ASN D 88  ? ASP D 90  ? ASN B 88  ASP B 90  5 ? 3 
HELX_P HELX_P15 15 ASN D 161 ? GLY D 163 ? ASN B 161 GLY B 163 5 ? 3 
HELX_P HELX_P16 16 SER D 192 ? SER D 194 ? SER B 192 SER B 194 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 93  SG ? ? L CYS 23  L CYS 93  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2 disulf ? ? A CYS 139 SG ? ? ? 1_555 A CYS 199 SG ? ? L CYS 139 L CYS 199 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf4 disulf ? ? B CYS 146 SG ? ? ? 1_555 B CYS 202 SG ? ? H CYS 146 H CYS 202 1_555 ? ? ? ? ? ? ? 2.046 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 145 A . ? TYR 145 L PRO 146 A ? PRO 146 L 1 -0.16 
2 PHE 152 B . ? PHE 152 H PRO 153 B ? PRO 153 H 1 -0.92 
3 GLU 154 B . ? GLU 154 H PRO 155 B ? PRO 155 H 1 -0.05 
4 TYR 145 C . ? TYR 145 A PRO 146 C ? PRO 146 A 1 -0.43 
5 PHE 152 D . ? PHE 152 B PRO 153 D ? PRO 153 B 1 -0.79 
6 GLU 154 D . ? GLU 154 B PRO 155 D ? PRO 155 B 1 -0.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
K ? 4 ? 
L ? 2 ? 
M ? 3 ? 
N ? 4 ? 
O ? 3 ? 
P ? 6 ? 
Q ? 3 ? 
R ? 3 ? 
S ? 3 ? 
T ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
P 5 6 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
T 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? GLN A 6   ? MET L 4   GLN L 6   
A 2 ALA A 19  ? SER A 25  ? ALA L 19  SER L 25  
A 3 ASP A 75  ? ILE A 80  ? ASP L 75  ILE L 80  
A 4 PHE A 67  ? GLY A 71  ? PHE L 67  GLY L 71  
B 1 SER A 10  ? VAL A 13  ? SER L 10  VAL L 13  
B 2 LYS A 108 ? ILE A 111 ? LYS L 108 ILE L 111 
C 1 VAL A 90  ? GLN A 95  ? VAL L 90  GLN L 95  
C 2 LEU A 38  ? GLN A 43  ? LEU L 38  GLN L 43  
C 3 LYS A 50  ? ILE A 53  ? LYS L 50  ILE L 53  
D 1 SER A 119 ? PHE A 123 ? SER L 119 PHE L 123 
D 2 THR A 134 ? ASN A 142 ? THR L 134 ASN L 142 
D 3 LEU A 180 ? SER A 187 ? LEU L 180 SER L 187 
D 4 SER A 164 ? VAL A 168 ? SER L 164 VAL L 168 
E 1 VAL A 151 ? VAL A 155 ? VAL L 151 VAL L 155 
E 2 TYR A 197 ? VAL A 201 ? TYR L 197 VAL L 201 
E 3 VAL A 210 ? PHE A 214 ? VAL L 210 PHE L 214 
F 1 LEU B 4   ? GLU B 6   ? LEU H 4   GLU H 6   
F 2 VAL B 18  ? ALA B 24  ? VAL H 18  ALA H 24  
F 3 THR B 78  ? ILE B 83  ? THR H 78  ILE H 83  
F 4 PHE B 68  ? GLU B 73  ? PHE H 68  GLU H 73  
G 1 GLU B 10  ? LYS B 12  ? GLU H 10  LYS H 12  
G 2 THR B 113 ? VAL B 117 ? THR H 113 VAL H 117 
G 3 ALA B 92  ? ALA B 99  ? ALA H 92  ALA H 99  
G 4 GLY B 33  ? GLN B 39  ? GLY H 33  GLN H 39  
G 5 LYS B 46  ? ILE B 51  ? LYS H 46  ILE H 51  
G 6 PRO B 58  ? TYR B 60  ? PRO H 58  TYR H 60  
H 1 SER B 126 ? LEU B 130 ? SER H 126 LEU H 130 
H 2 GLY B 145 ? TYR B 151 ? GLY H 145 TYR H 151 
H 3 TYR B 182 ? VAL B 187 ? TYR H 182 VAL H 187 
I 1 THR B 157 ? TRP B 160 ? THR H 157 TRP H 160 
I 2 ILE B 201 ? HIS B 206 ? ILE H 201 HIS H 206 
I 3 THR B 211 ? LYS B 216 ? THR H 211 LYS H 216 
J 1 VAL B 97  ? GLU B 100 ? VAL H 97  GLU H 100 
J 2 THR B 105 ? TRP B 109 ? THR H 105 TRP H 109 
K 1 MET C 4   ? GLN C 6   ? MET A 4   GLN A 6   
K 2 ALA C 19  ? SER C 25  ? ALA A 19  SER A 25  
K 3 ASP C 75  ? ILE C 80  ? ASP A 75  ILE A 80  
K 4 PHE C 67  ? GLY C 71  ? PHE A 67  GLY A 71  
L 1 SER C 10  ? VAL C 13  ? SER A 10  VAL A 13  
L 2 LYS C 108 ? ILE C 111 ? LYS A 108 ILE A 111 
M 1 VAL C 90  ? GLN C 95  ? VAL A 90  GLN A 95  
M 2 LEU C 38  ? GLN C 43  ? LEU A 38  GLN A 43  
M 3 LYS C 50  ? ILE C 53  ? LYS A 50  ILE A 53  
N 1 SER C 119 ? PHE C 123 ? SER A 119 PHE A 123 
N 2 THR C 134 ? ASN C 142 ? THR A 134 ASN A 142 
N 3 LEU C 180 ? SER C 187 ? LEU A 180 SER A 187 
N 4 SER C 164 ? VAL C 168 ? SER A 164 VAL A 168 
O 1 VAL C 151 ? VAL C 155 ? VAL A 151 VAL A 155 
O 2 TYR C 197 ? VAL C 201 ? TYR A 197 VAL A 201 
O 3 VAL C 210 ? PHE C 214 ? VAL A 210 PHE A 214 
P 1 GLU D 10  ? LYS D 12  ? GLU B 10  LYS B 12  
P 2 THR D 113 ? VAL D 117 ? THR B 113 VAL B 117 
P 3 ALA D 92  ? ALA D 99  ? ALA B 92  ALA B 99  
P 4 GLY D 33  ? GLN D 39  ? GLY B 33  GLN B 39  
P 5 LYS D 46  ? ILE D 51  ? LYS B 46  ILE B 51  
P 6 PRO D 58  ? TYR D 60  ? PRO B 58  TYR B 60  
Q 1 VAL D 18  ? LYS D 23  ? VAL B 18  LYS B 23  
Q 2 THR D 78  ? ILE D 83  ? THR B 78  ILE B 83  
Q 3 PHE D 68  ? GLU D 73  ? PHE B 68  GLU B 73  
R 1 SER D 126 ? LEU D 130 ? SER B 126 LEU B 130 
R 2 GLY D 145 ? TYR D 151 ? GLY B 145 TYR B 151 
R 3 TYR D 182 ? VAL D 187 ? TYR B 182 VAL B 187 
S 1 THR D 157 ? TRP D 160 ? THR B 157 TRP B 160 
S 2 ILE D 201 ? HIS D 206 ? ILE B 201 HIS B 206 
S 3 THR D 211 ? LYS D 216 ? THR B 211 LYS B 216 
T 1 VAL D 97  ? GLU D 100 ? VAL B 97  GLU B 100 
T 2 THR D 105 ? TRP D 109 ? THR B 105 TRP B 109 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR L 5   N ARG A 24  ? N ARG L 24  
A 2 3 O ALA A 19  ? O ALA L 19  N ILE A 80  ? N ILE L 80  
A 3 4 O THR A 77  ? O THR L 77  N SER A 70  ? N SER L 70  
B 1 2 O LEU A 11  ? O LEU L 11  N LYS A 108 ? N LYS L 108 
C 1 2 O VAL A 90  ? O VAL L 90  N GLN A 43  ? N GLN L 43  
C 2 3 O TRP A 40  ? O TRP L 40  N ILE A 53  ? N ILE L 53  
D 1 2 O SER A 119 ? O SER L 119 N ASN A 142 ? N ASN L 142 
D 2 3 O ALA A 135 ? O ALA L 135 N LEU A 186 ? N LEU L 186 
D 3 4 O SER A 181 ? O SER L 181 N SER A 167 ? N SER L 167 
E 1 2 O GLN A 152 ? O GLN L 152 N GLU A 200 ? N GLU L 200 
E 2 3 O TYR A 197 ? O TYR L 197 N PHE A 214 ? N PHE L 214 
F 1 2 O LEU B 5   ? O LEU H 5   N LYS B 23  ? N LYS H 23  
F 2 3 O VAL B 18  ? O VAL H 18  N ILE B 83  ? N ILE H 83  
F 3 4 O THR B 78  ? O THR H 78  N GLU B 73  ? N GLU H 73  
G 1 2 O GLU B 10  ? O GLU H 10  N THR B 116 ? N THR H 116 
G 2 3 O THR B 113 ? O THR H 113 N TYR B 94  ? N TYR H 94  
G 3 4 O THR B 93  ? O THR H 93  N GLN B 39  ? N GLN H 39  
G 4 5 O MET B 34  ? O MET H 34  N ILE B 51  ? N ILE H 51  
G 5 6 O TRP B 50  ? O TRP H 50  N THR B 59  ? N THR H 59  
H 1 2 O SER B 126 ? O SER H 126 N LYS B 149 ? N LYS H 149 
H 2 3 O CYS B 146 ? O CYS H 146 N SER B 186 ? N SER H 186 
I 1 2 O THR B 157 ? O THR H 157 N ASN B 205 ? N ASN H 205 
I 2 3 O CYS B 202 ? O CYS H 202 N LYS B 215 ? N LYS H 215 
J 1 2 O GLN B 98  ? O GLN H 98  N TYR B 108 ? N TYR H 108 
K 1 2 O THR C 5   ? O THR A 5   N ARG C 24  ? N ARG A 24  
K 2 3 O ALA C 19  ? O ALA A 19  N ILE C 80  ? N ILE A 80  
K 3 4 O THR C 77  ? O THR A 77  N SER C 70  ? N SER A 70  
L 1 2 O LEU C 11  ? O LEU A 11  N LYS C 108 ? N LYS A 108 
M 1 2 O VAL C 90  ? O VAL A 90  N GLN C 43  ? N GLN A 43  
M 2 3 O TRP C 40  ? O TRP A 40  N ILE C 53  ? N ILE A 53  
N 1 2 O SER C 119 ? O SER A 119 N ASN C 142 ? N ASN A 142 
N 2 3 O ALA C 135 ? O ALA A 135 N LEU C 186 ? N LEU A 186 
N 3 4 O SER C 181 ? O SER A 181 N SER C 167 ? N SER A 167 
O 1 2 O GLN C 152 ? O GLN A 152 N GLU C 200 ? N GLU A 200 
O 2 3 O TYR C 197 ? O TYR A 197 N PHE C 214 ? N PHE A 214 
P 1 2 O GLU D 10  ? O GLU B 10  N THR D 116 ? N THR B 116 
P 2 3 O THR D 113 ? O THR B 113 N TYR D 94  ? N TYR B 94  
P 3 4 O THR D 93  ? O THR B 93  N GLN D 39  ? N GLN B 39  
P 4 5 O MET D 34  ? O MET B 34  N ILE D 51  ? N ILE B 51  
P 5 6 O TRP D 50  ? O TRP B 50  N THR D 59  ? N THR B 59  
Q 1 2 O VAL D 18  ? O VAL B 18  N ILE D 83  ? N ILE B 83  
Q 2 3 O THR D 78  ? O THR B 78  N GLU D 73  ? N GLU B 73  
R 1 2 O SER D 126 ? O SER B 126 N LYS D 149 ? N LYS B 149 
R 2 3 O CYS D 146 ? O CYS B 146 N SER D 186 ? N SER B 186 
S 1 2 O THR D 157 ? O THR B 157 N ASN D 205 ? N ASN B 205 
S 2 3 O CYS D 202 ? O CYS B 202 N LYS D 215 ? N LYS B 215 
T 1 2 O GLN D 98  ? O GLN B 98  N TYR D 108 ? N TYR B 108 
# 
_database_PDB_matrix.entry_id          1A4J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A4J 
_atom_sites.fract_transf_matrix[1][1]   0.006293 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002135 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007283 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 2.790   -13.533 -13.909 1.00 78.19  ? 1   GLU L N   1 
ATOM   2    C CA  . GLU A 1 1   ? 4.194   -13.159 -13.575 1.00 77.64  ? 1   GLU L CA  1 
ATOM   3    C C   . GLU A 1 1   ? 5.007   -14.362 -13.091 1.00 72.26  ? 1   GLU L C   1 
ATOM   4    O O   . GLU A 1 1   ? 4.524   -15.200 -12.327 1.00 72.89  ? 1   GLU L O   1 
ATOM   5    C CB  . GLU A 1 1   ? 4.206   -12.049 -12.512 1.00 83.08  ? 1   GLU L CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 4.477   -12.517 -11.087 1.00 91.54  ? 1   GLU L CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 3.309   -13.283 -10.483 1.00 95.61  ? 1   GLU L CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 2.695   -14.103 -11.198 1.00 97.58  ? 1   GLU L OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 3.006   -13.067 -9.290  1.00 96.91  ? 1   GLU L OE2 1 
ATOM   10   N N   . LEU A 1 2   ? 6.248   -14.441 -13.554 1.00 64.61  ? 2   LEU L N   1 
ATOM   11   C CA  . LEU A 1 2   ? 7.140   -15.522 -13.172 1.00 56.41  ? 2   LEU L CA  1 
ATOM   12   C C   . LEU A 1 2   ? 7.887   -15.125 -11.899 1.00 51.35  ? 2   LEU L C   1 
ATOM   13   O O   . LEU A 1 2   ? 8.361   -13.997 -11.784 1.00 49.56  ? 2   LEU L O   1 
ATOM   14   C CB  . LEU A 1 2   ? 8.132   -15.781 -14.301 1.00 54.10  ? 2   LEU L CB  1 
ATOM   15   C CG  . LEU A 1 2   ? 8.931   -17.065 -14.154 1.00 54.63  ? 2   LEU L CG  1 
ATOM   16   C CD1 . LEU A 1 2   ? 8.635   -17.981 -15.314 1.00 55.34  ? 2   LEU L CD1 1 
ATOM   17   C CD2 . LEU A 1 2   ? 10.403  -16.731 -14.085 1.00 56.94  ? 2   LEU L CD2 1 
ATOM   18   N N   . VAL A 1 3   ? 7.980   -16.042 -10.939 1.00 48.30  ? 3   VAL L N   1 
ATOM   19   C CA  . VAL A 1 3   ? 8.674   -15.757 -9.684  1.00 45.73  ? 3   VAL L CA  1 
ATOM   20   C C   . VAL A 1 3   ? 10.066  -16.386 -9.593  1.00 44.35  ? 3   VAL L C   1 
ATOM   21   O O   . VAL A 1 3   ? 10.249  -17.578 -9.841  1.00 38.90  ? 3   VAL L O   1 
ATOM   22   C CB  . VAL A 1 3   ? 7.873   -16.240 -8.451  1.00 48.53  ? 3   VAL L CB  1 
ATOM   23   C CG1 . VAL A 1 3   ? 7.998   -15.219 -7.331  1.00 48.46  ? 3   VAL L CG1 1 
ATOM   24   C CG2 . VAL A 1 3   ? 6.414   -16.465 -8.818  1.00 50.46  ? 3   VAL L CG2 1 
ATOM   25   N N   . MET A 1 4   ? 11.045  -15.568 -9.225  1.00 41.80  ? 4   MET L N   1 
ATOM   26   C CA  . MET A 1 4   ? 12.421  -16.037 -9.085  1.00 40.41  ? 4   MET L CA  1 
ATOM   27   C C   . MET A 1 4   ? 12.795  -15.972 -7.615  1.00 35.70  ? 4   MET L C   1 
ATOM   28   O O   . MET A 1 4   ? 12.819  -14.901 -7.020  1.00 36.93  ? 4   MET L O   1 
ATOM   29   C CB  . MET A 1 4   ? 13.364  -15.156 -9.896  1.00 43.62  ? 4   MET L CB  1 
ATOM   30   C CG  . MET A 1 4   ? 12.797  -14.726 -11.231 1.00 37.05  ? 4   MET L CG  1 
ATOM   31   S SD  . MET A 1 4   ? 13.469  -15.636 -12.611 1.00 44.58  ? 4   MET L SD  1 
ATOM   32   C CE  . MET A 1 4   ? 14.417  -16.909 -11.801 1.00 44.80  ? 4   MET L CE  1 
ATOM   33   N N   . THR A 1 5   ? 13.075  -17.129 -7.034  1.00 31.74  ? 5   THR L N   1 
ATOM   34   C CA  . THR A 1 5   ? 13.433  -17.209 -5.635  1.00 36.77  ? 5   THR L CA  1 
ATOM   35   C C   . THR A 1 5   ? 14.918  -17.516 -5.431  1.00 39.63  ? 5   THR L C   1 
ATOM   36   O O   . THR A 1 5   ? 15.383  -18.617 -5.730  1.00 37.54  ? 5   THR L O   1 
ATOM   37   C CB  . THR A 1 5   ? 12.591  -18.293 -4.935  1.00 40.59  ? 5   THR L CB  1 
ATOM   38   O OG1 . THR A 1 5   ? 11.200  -18.050 -5.189  1.00 41.16  ? 5   THR L OG1 1 
ATOM   39   C CG2 . THR A 1 5   ? 12.843  -18.279 -3.435  1.00 41.72  ? 5   THR L CG2 1 
ATOM   40   N N   . GLN A 1 6   ? 15.657  -16.531 -4.923  1.00 40.42  ? 6   GLN L N   1 
ATOM   41   C CA  . GLN A 1 6   ? 17.084  -16.691 -4.657  1.00 41.06  ? 6   GLN L CA  1 
ATOM   42   C C   . GLN A 1 6   ? 17.239  -17.256 -3.256  1.00 44.07  ? 6   GLN L C   1 
ATOM   43   O O   . GLN A 1 6   ? 16.924  -16.597 -2.262  1.00 42.25  ? 6   GLN L O   1 
ATOM   44   C CB  . GLN A 1 6   ? 17.795  -15.348 -4.788  1.00 38.09  ? 6   GLN L CB  1 
ATOM   45   C CG  . GLN A 1 6   ? 17.802  -14.842 -6.213  1.00 40.87  ? 6   GLN L CG  1 
ATOM   46   C CD  . GLN A 1 6   ? 18.589  -13.568 -6.384  1.00 42.19  ? 6   GLN L CD  1 
ATOM   47   O OE1 . GLN A 1 6   ? 18.090  -12.588 -6.938  1.00 45.01  ? 6   GLN L OE1 1 
ATOM   48   N NE2 . GLN A 1 6   ? 19.831  -13.573 -5.916  1.00 40.94  ? 6   GLN L NE2 1 
ATOM   49   N N   . THR A 1 7   ? 17.737  -18.485 -3.194  1.00 50.68  ? 7   THR L N   1 
ATOM   50   C CA  . THR A 1 7   ? 17.894  -19.205 -1.941  1.00 58.10  ? 7   THR L CA  1 
ATOM   51   C C   . THR A 1 7   ? 18.733  -18.547 -0.861  1.00 60.91  ? 7   THR L C   1 
ATOM   52   O O   . THR A 1 7   ? 18.211  -18.175 0.194   1.00 69.10  ? 7   THR L O   1 
ATOM   53   C CB  . THR A 1 7   ? 18.433  -20.624 -2.191  1.00 59.38  ? 7   THR L CB  1 
ATOM   54   O OG1 . THR A 1 7   ? 17.570  -21.298 -3.116  1.00 64.67  ? 7   THR L OG1 1 
ATOM   55   C CG2 . THR A 1 7   ? 18.492  -21.412 -0.887  1.00 61.33  ? 7   THR L CG2 1 
ATOM   56   N N   . PRO A 1 8   ? 20.041  -18.374 -1.099  1.00 57.24  ? 8   PRO L N   1 
ATOM   57   C CA  . PRO A 1 8   ? 20.767  -17.741 0.006   1.00 49.96  ? 8   PRO L CA  1 
ATOM   58   C C   . PRO A 1 8   ? 20.453  -16.258 0.109   1.00 46.60  ? 8   PRO L C   1 
ATOM   59   O O   . PRO A 1 8   ? 20.931  -15.465 -0.682  1.00 48.16  ? 8   PRO L O   1 
ATOM   60   C CB  . PRO A 1 8   ? 22.240  -18.012 -0.315  1.00 51.75  ? 8   PRO L CB  1 
ATOM   61   C CG  . PRO A 1 8   ? 22.248  -18.837 -1.622  1.00 55.64  ? 8   PRO L CG  1 
ATOM   62   C CD  . PRO A 1 8   ? 20.903  -18.659 -2.258  1.00 51.94  ? 8   PRO L CD  1 
ATOM   63   N N   . LEU A 1 9   ? 19.631  -15.883 1.077   1.00 42.59  ? 9   LEU L N   1 
ATOM   64   C CA  . LEU A 1 9   ? 19.288  -14.480 1.237   1.00 41.22  ? 9   LEU L CA  1 
ATOM   65   C C   . LEU A 1 9   ? 20.564  -13.700 1.539   1.00 38.59  ? 9   LEU L C   1 
ATOM   66   O O   . LEU A 1 9   ? 20.786  -12.615 1.011   1.00 27.48  ? 9   LEU L O   1 
ATOM   67   C CB  . LEU A 1 9   ? 18.278  -14.306 2.372   1.00 43.41  ? 9   LEU L CB  1 
ATOM   68   C CG  . LEU A 1 9   ? 17.303  -13.125 2.286   1.00 51.44  ? 9   LEU L CG  1 
ATOM   69   C CD1 . LEU A 1 9   ? 17.729  -12.084 3.309   1.00 56.44  ? 9   LEU L CD1 1 
ATOM   70   C CD2 . LEU A 1 9   ? 17.275  -12.514 0.879   1.00 55.80  ? 9   LEU L CD2 1 
ATOM   71   N N   . SER A 1 10  ? 21.393  -14.281 2.397   1.00 37.54  ? 10  SER L N   1 
ATOM   72   C CA  . SER A 1 10  ? 22.669  -13.701 2.784   1.00 40.62  ? 10  SER L CA  1 
ATOM   73   C C   . SER A 1 10  ? 23.685  -14.833 2.754   1.00 39.63  ? 10  SER L C   1 
ATOM   74   O O   . SER A 1 10  ? 23.405  -15.945 3.213   1.00 38.75  ? 10  SER L O   1 
ATOM   75   C CB  . SER A 1 10  ? 22.592  -13.114 4.191   1.00 39.83  ? 10  SER L CB  1 
ATOM   76   O OG  . SER A 1 10  ? 23.563  -12.091 4.356   1.00 49.80  ? 10  SER L OG  1 
ATOM   77   N N   . LEU A 1 11  ? 24.862  -14.560 2.209   1.00 38.76  ? 11  LEU L N   1 
ATOM   78   C CA  . LEU A 1 11  ? 25.881  -15.592 2.126   1.00 36.41  ? 11  LEU L CA  1 
ATOM   79   C C   . LEU A 1 11  ? 27.187  -15.140 2.739   1.00 35.31  ? 11  LEU L C   1 
ATOM   80   O O   . LEU A 1 11  ? 27.910  -14.337 2.153   1.00 32.48  ? 11  LEU L O   1 
ATOM   81   C CB  . LEU A 1 11  ? 26.116  -15.984 0.660   1.00 39.13  ? 11  LEU L CB  1 
ATOM   82   C CG  . LEU A 1 11  ? 26.404  -17.458 0.354   1.00 41.28  ? 11  LEU L CG  1 
ATOM   83   C CD1 . LEU A 1 11  ? 27.087  -17.579 -0.991  1.00 42.03  ? 11  LEU L CD1 1 
ATOM   84   C CD2 . LEU A 1 11  ? 27.265  -18.059 1.450   1.00 41.89  ? 11  LEU L CD2 1 
ATOM   85   N N   . PRO A 1 12  ? 27.502  -15.634 3.941   1.00 37.92  ? 12  PRO L N   1 
ATOM   86   C CA  . PRO A 1 12  ? 28.757  -15.249 4.595   1.00 33.79  ? 12  PRO L CA  1 
ATOM   87   C C   . PRO A 1 12  ? 29.894  -16.027 3.942   1.00 34.51  ? 12  PRO L C   1 
ATOM   88   O O   . PRO A 1 12  ? 29.781  -17.224 3.690   1.00 28.40  ? 12  PRO L O   1 
ATOM   89   C CB  . PRO A 1 12  ? 28.547  -15.642 6.063   1.00 35.61  ? 12  PRO L CB  1 
ATOM   90   C CG  . PRO A 1 12  ? 27.128  -16.159 6.161   1.00 37.56  ? 12  PRO L CG  1 
ATOM   91   C CD  . PRO A 1 12  ? 26.721  -16.560 4.774   1.00 38.65  ? 12  PRO L CD  1 
ATOM   92   N N   . VAL A 1 13  ? 30.991  -15.347 3.654   1.00 33.95  ? 13  VAL L N   1 
ATOM   93   C CA  . VAL A 1 13  ? 32.104  -16.015 3.014   1.00 32.87  ? 13  VAL L CA  1 
ATOM   94   C C   . VAL A 1 13  ? 33.445  -15.444 3.467   1.00 35.09  ? 13  VAL L C   1 
ATOM   95   O O   . VAL A 1 13  ? 33.539  -14.305 3.934   1.00 26.56  ? 13  VAL L O   1 
ATOM   96   C CB  . VAL A 1 13  ? 31.987  -15.896 1.472   1.00 32.24  ? 13  VAL L CB  1 
ATOM   97   C CG1 . VAL A 1 13  ? 32.231  -14.441 1.023   1.00 26.85  ? 13  VAL L CG1 1 
ATOM   98   C CG2 . VAL A 1 13  ? 32.972  -16.844 0.803   1.00 38.54  ? 13  VAL L CG2 1 
ATOM   99   N N   . SER A 1 14  ? 34.481  -16.260 3.352   1.00 35.63  ? 14  SER L N   1 
ATOM   100  C CA  . SER A 1 14  ? 35.811  -15.812 3.698   1.00 32.92  ? 14  SER L CA  1 
ATOM   101  C C   . SER A 1 14  ? 36.441  -15.469 2.375   1.00 30.30  ? 14  SER L C   1 
ATOM   102  O O   . SER A 1 14  ? 36.185  -16.145 1.376   1.00 30.75  ? 14  SER L O   1 
ATOM   103  C CB  . SER A 1 14  ? 36.586  -16.921 4.399   1.00 30.75  ? 14  SER L CB  1 
ATOM   104  O OG  . SER A 1 14  ? 35.958  -17.233 5.628   1.00 36.64  ? 14  SER L OG  1 
ATOM   105  N N   . LEU A 1 15  ? 37.222  -14.393 2.359   1.00 32.73  ? 15  LEU L N   1 
ATOM   106  C CA  . LEU A 1 15  ? 37.900  -13.949 1.148   1.00 35.43  ? 15  LEU L CA  1 
ATOM   107  C C   . LEU A 1 15  ? 38.784  -15.090 0.638   1.00 36.55  ? 15  LEU L C   1 
ATOM   108  O O   . LEU A 1 15  ? 39.382  -15.825 1.430   1.00 38.01  ? 15  LEU L O   1 
ATOM   109  C CB  . LEU A 1 15  ? 38.753  -12.708 1.449   1.00 32.82  ? 15  LEU L CB  1 
ATOM   110  C CG  . LEU A 1 15  ? 38.019  -11.396 1.746   1.00 34.73  ? 15  LEU L CG  1 
ATOM   111  C CD1 . LEU A 1 15  ? 39.039  -10.249 1.822   1.00 28.77  ? 15  LEU L CD1 1 
ATOM   112  C CD2 . LEU A 1 15  ? 36.979  -11.112 0.664   1.00 28.52  ? 15  LEU L CD2 1 
ATOM   113  N N   . GLY A 1 16  ? 38.849  -15.252 -0.679  1.00 35.56  ? 16  GLY L N   1 
ATOM   114  C CA  . GLY A 1 16  ? 39.649  -16.321 -1.237  1.00 34.94  ? 16  GLY L CA  1 
ATOM   115  C C   . GLY A 1 16  ? 38.874  -17.616 -1.412  1.00 38.05  ? 16  GLY L C   1 
ATOM   116  O O   . GLY A 1 16  ? 39.294  -18.497 -2.157  1.00 37.54  ? 16  GLY L O   1 
ATOM   117  N N   . ASP A 1 17  ? 37.744  -17.734 -0.724  1.00 38.40  ? 17  ASP L N   1 
ATOM   118  C CA  . ASP A 1 17  ? 36.900  -18.925 -0.806  1.00 43.44  ? 17  ASP L CA  1 
ATOM   119  C C   . ASP A 1 17  ? 35.905  -18.856 -1.972  1.00 42.08  ? 17  ASP L C   1 
ATOM   120  O O   . ASP A 1 17  ? 35.746  -17.819 -2.616  1.00 39.59  ? 17  ASP L O   1 
ATOM   121  C CB  . ASP A 1 17  ? 36.116  -19.102 0.502   1.00 50.87  ? 17  ASP L CB  1 
ATOM   122  C CG  . ASP A 1 17  ? 36.986  -19.584 1.655   1.00 57.53  ? 17  ASP L CG  1 
ATOM   123  O OD1 . ASP A 1 17  ? 38.208  -19.322 1.644   1.00 58.95  ? 17  ASP L OD1 1 
ATOM   124  O OD2 . ASP A 1 17  ? 36.438  -20.227 2.579   1.00 63.66  ? 17  ASP L OD2 1 
ATOM   125  N N   . GLN A 1 18  ? 35.225  -19.965 -2.231  1.00 40.62  ? 18  GLN L N   1 
ATOM   126  C CA  . GLN A 1 18  ? 34.246  -20.007 -3.312  1.00 42.68  ? 18  GLN L CA  1 
ATOM   127  C C   . GLN A 1 18  ? 32.849  -19.687 -2.794  1.00 39.87  ? 18  GLN L C   1 
ATOM   128  O O   . GLN A 1 18  ? 32.491  -20.049 -1.672  1.00 36.52  ? 18  GLN L O   1 
ATOM   129  C CB  . GLN A 1 18  ? 34.248  -21.384 -3.981  1.00 48.05  ? 18  GLN L CB  1 
ATOM   130  C CG  . GLN A 1 18  ? 32.878  -22.040 -4.095  1.00 58.07  ? 18  GLN L CG  1 
ATOM   131  C CD  . GLN A 1 18  ? 32.399  -22.147 -5.527  1.00 65.05  ? 18  GLN L CD  1 
ATOM   132  O OE1 . GLN A 1 18  ? 32.480  -23.209 -6.143  1.00 68.43  ? 18  GLN L OE1 1 
ATOM   133  N NE2 . GLN A 1 18  ? 31.892  -21.044 -6.066  1.00 70.32  ? 18  GLN L NE2 1 
ATOM   134  N N   . ALA A 1 19  ? 32.067  -18.999 -3.619  1.00 37.60  ? 19  ALA L N   1 
ATOM   135  C CA  . ALA A 1 19  ? 30.700  -18.640 -3.262  1.00 36.00  ? 19  ALA L CA  1 
ATOM   136  C C   . ALA A 1 19  ? 29.750  -19.237 -4.294  1.00 37.85  ? 19  ALA L C   1 
ATOM   137  O O   . ALA A 1 19  ? 30.059  -19.293 -5.493  1.00 38.53  ? 19  ALA L O   1 
ATOM   138  C CB  . ALA A 1 19  ? 30.543  -17.133 -3.230  1.00 26.03  ? 19  ALA L CB  1 
ATOM   139  N N   . SER A 1 20  ? 28.598  -19.694 -3.823  1.00 38.73  ? 20  SER L N   1 
ATOM   140  C CA  . SER A 1 20  ? 27.594  -20.272 -4.703  1.00 42.67  ? 20  SER L CA  1 
ATOM   141  C C   . SER A 1 20  ? 26.201  -19.737 -4.341  1.00 40.65  ? 20  SER L C   1 
ATOM   142  O O   . SER A 1 20  ? 25.689  -20.000 -3.258  1.00 42.47  ? 20  SER L O   1 
ATOM   143  C CB  . SER A 1 20  ? 27.629  -21.795 -4.600  1.00 42.83  ? 20  SER L CB  1 
ATOM   144  O OG  . SER A 1 20  ? 27.636  -22.379 -5.889  1.00 47.06  ? 20  SER L OG  1 
ATOM   145  N N   . ILE A 1 21  ? 25.618  -18.969 -5.255  1.00 38.95  ? 21  ILE L N   1 
ATOM   146  C CA  . ILE A 1 21  ? 24.301  -18.362 -5.080  1.00 38.85  ? 21  ILE L CA  1 
ATOM   147  C C   . ILE A 1 21  ? 23.306  -19.072 -5.986  1.00 38.12  ? 21  ILE L C   1 
ATOM   148  O O   . ILE A 1 21  ? 23.597  -19.327 -7.152  1.00 33.57  ? 21  ILE L O   1 
ATOM   149  C CB  . ILE A 1 21  ? 24.344  -16.859 -5.429  1.00 39.09  ? 21  ILE L CB  1 
ATOM   150  C CG1 . ILE A 1 21  ? 24.901  -16.083 -4.241  1.00 41.19  ? 21  ILE L CG1 1 
ATOM   151  C CG2 . ILE A 1 21  ? 22.959  -16.345 -5.794  1.00 42.84  ? 21  ILE L CG2 1 
ATOM   152  C CD1 . ILE A 1 21  ? 25.571  -14.784 -4.628  1.00 40.68  ? 21  ILE L CD1 1 
ATOM   153  N N   . SER A 1 22  ? 22.129  -19.370 -5.445  1.00 36.57  ? 22  SER L N   1 
ATOM   154  C CA  . SER A 1 22  ? 21.103  -20.095 -6.183  1.00 40.55  ? 22  SER L CA  1 
ATOM   155  C C   . SER A 1 22  ? 19.889  -19.265 -6.601  1.00 39.13  ? 22  SER L C   1 
ATOM   156  O O   . SER A 1 22  ? 19.483  -18.346 -5.902  1.00 34.62  ? 22  SER L O   1 
ATOM   157  C CB  . SER A 1 22  ? 20.632  -21.288 -5.344  1.00 43.68  ? 22  SER L CB  1 
ATOM   158  O OG  . SER A 1 22  ? 20.526  -22.462 -6.126  1.00 54.99  ? 22  SER L OG  1 
ATOM   159  N N   . CYS A 1 23  ? 19.317  -19.620 -7.747  1.00 40.66  ? 23  CYS L N   1 
ATOM   160  C CA  . CYS A 1 23  ? 18.138  -18.952 -8.290  1.00 45.10  ? 23  CYS L CA  1 
ATOM   161  C C   . CYS A 1 23  ? 17.174  -20.026 -8.816  1.00 45.77  ? 23  CYS L C   1 
ATOM   162  O O   . CYS A 1 23  ? 17.567  -20.913 -9.582  1.00 42.27  ? 23  CYS L O   1 
ATOM   163  C CB  . CYS A 1 23  ? 18.549  -17.999 -9.424  1.00 45.89  ? 23  CYS L CB  1 
ATOM   164  S SG  . CYS A 1 23  ? 17.199  -17.054 -10.217 1.00 49.88  ? 23  CYS L SG  1 
ATOM   165  N N   . ARG A 1 24  ? 15.922  -19.961 -8.377  1.00 45.96  ? 24  ARG L N   1 
ATOM   166  C CA  . ARG A 1 24  ? 14.912  -20.910 -8.823  1.00 48.82  ? 24  ARG L CA  1 
ATOM   167  C C   . ARG A 1 24  ? 13.742  -20.119 -9.388  1.00 47.45  ? 24  ARG L C   1 
ATOM   168  O O   . ARG A 1 24  ? 13.258  -19.181 -8.755  1.00 46.59  ? 24  ARG L O   1 
ATOM   169  C CB  . ARG A 1 24  ? 14.442  -21.782 -7.654  1.00 56.35  ? 24  ARG L CB  1 
ATOM   170  C CG  . ARG A 1 24  ? 13.180  -22.587 -7.938  1.00 66.33  ? 24  ARG L CG  1 
ATOM   171  C CD  . ARG A 1 24  ? 12.545  -23.100 -6.655  1.00 75.79  ? 24  ARG L CD  1 
ATOM   172  N NE  . ARG A 1 24  ? 12.220  -22.011 -5.737  1.00 86.93  ? 24  ARG L NE  1 
ATOM   173  C CZ  . ARG A 1 24  ? 11.251  -22.056 -4.827  1.00 92.52  ? 24  ARG L CZ  1 
ATOM   174  N NH1 . ARG A 1 24  ? 10.497  -23.141 -4.701  1.00 93.72  ? 24  ARG L NH1 1 
ATOM   175  N NH2 . ARG A 1 24  ? 11.034  -21.012 -4.040  1.00 95.51  ? 24  ARG L NH2 1 
ATOM   176  N N   . SER A 1 25  ? 13.297  -20.480 -10.586 1.00 45.12  ? 25  SER L N   1 
ATOM   177  C CA  . SER A 1 25  ? 12.179  -19.777 -11.200 1.00 44.14  ? 25  SER L CA  1 
ATOM   178  C C   . SER A 1 25  ? 10.871  -20.559 -11.096 1.00 45.90  ? 25  SER L C   1 
ATOM   179  O O   . SER A 1 25  ? 10.870  -21.795 -11.031 1.00 43.17  ? 25  SER L O   1 
ATOM   180  C CB  . SER A 1 25  ? 12.484  -19.466 -12.671 1.00 44.75  ? 25  SER L CB  1 
ATOM   181  O OG  . SER A 1 25  ? 12.556  -20.641 -13.453 1.00 45.56  ? 25  SER L OG  1 
ATOM   182  N N   . SER A 1 26  ? 9.763   -19.819 -11.083 1.00 47.33  ? 26  SER L N   1 
ATOM   183  C CA  . SER A 1 26  ? 8.418   -20.390 -10.994 1.00 45.31  ? 26  SER L CA  1 
ATOM   184  C C   . SER A 1 26  ? 8.125   -21.308 -12.175 1.00 44.06  ? 26  SER L C   1 
ATOM   185  O O   . SER A 1 26  ? 7.570   -22.388 -12.003 1.00 42.08  ? 26  SER L O   1 
ATOM   186  C CB  . SER A 1 26  ? 7.381   -19.268 -10.949 1.00 45.64  ? 26  SER L CB  1 
ATOM   187  O OG  . SER A 1 26  ? 7.439   -18.490 -12.133 1.00 50.14  ? 26  SER L OG  1 
ATOM   188  N N   . GLN A 1 27  ? 8.489   -20.869 -13.376 1.00 45.88  ? 27  GLN L N   1 
ATOM   189  C CA  . GLN A 1 27  ? 8.284   -21.670 -14.582 1.00 46.81  ? 27  GLN L CA  1 
ATOM   190  C C   . GLN A 1 27  ? 9.615   -21.838 -15.301 1.00 47.69  ? 27  GLN L C   1 
ATOM   191  O O   . GLN A 1 27  ? 10.597  -21.159 -14.987 1.00 45.38  ? 27  GLN L O   1 
ATOM   192  C CB  . GLN A 1 27  ? 7.294   -20.994 -15.529 1.00 47.08  ? 27  GLN L CB  1 
ATOM   193  C CG  . GLN A 1 27  ? 6.123   -20.316 -14.834 1.00 58.05  ? 27  GLN L CG  1 
ATOM   194  C CD  . GLN A 1 27  ? 5.440   -19.292 -15.720 1.00 63.79  ? 27  GLN L CD  1 
ATOM   195  O OE1 . GLN A 1 27  ? 5.485   -19.390 -16.949 1.00 70.87  ? 27  GLN L OE1 1 
ATOM   196  N NE2 . GLN A 1 27  ? 4.805   -18.303 -15.103 1.00 63.14  ? 27  GLN L NE2 1 
ATOM   197  N N   . SER A 1 28  ? 9.646   -22.741 -16.270 1.00 45.76  ? 28  SER L N   1 
ATOM   198  C CA  . SER A 1 28  ? 10.862  -22.959 -17.029 1.00 45.18  ? 28  SER L CA  1 
ATOM   199  C C   . SER A 1 28  ? 11.180  -21.660 -17.751 1.00 45.23  ? 28  SER L C   1 
ATOM   200  O O   . SER A 1 28  ? 10.278  -21.013 -18.282 1.00 45.49  ? 28  SER L O   1 
ATOM   201  C CB  . SER A 1 28  ? 10.664  -24.073 -18.051 1.00 43.42  ? 28  SER L CB  1 
ATOM   202  O OG  . SER A 1 28  ? 11.490  -23.849 -19.181 1.00 50.51  ? 28  SER L OG  1 
ATOM   203  N N   . LEU A 1 29  ? 12.453  -21.272 -17.758 1.00 44.96  ? 29  LEU L N   1 
ATOM   204  C CA  . LEU A 1 29  ? 12.871  -20.046 -18.430 1.00 45.49  ? 29  LEU L CA  1 
ATOM   205  C C   . LEU A 1 29  ? 13.395  -20.397 -19.816 1.00 44.63  ? 29  LEU L C   1 
ATOM   206  O O   . LEU A 1 29  ? 14.111  -19.620 -20.443 1.00 37.88  ? 29  LEU L O   1 
ATOM   207  C CB  . LEU A 1 29  ? 13.959  -19.317 -17.621 1.00 47.44  ? 29  LEU L CB  1 
ATOM   208  C CG  . LEU A 1 29  ? 13.769  -19.222 -16.101 1.00 47.96  ? 29  LEU L CG  1 
ATOM   209  C CD1 . LEU A 1 29  ? 14.810  -18.294 -15.507 1.00 44.61  ? 29  LEU L CD1 1 
ATOM   210  C CD2 . LEU A 1 29  ? 12.361  -18.714 -15.791 1.00 50.87  ? 29  LEU L CD2 1 
ATOM   211  N N   . VAL A 1 30  ? 13.041  -21.590 -20.281 1.00 45.58  ? 30  VAL L N   1 
ATOM   212  C CA  . VAL A 1 30  ? 13.449  -22.034 -21.606 1.00 44.35  ? 30  VAL L CA  1 
ATOM   213  C C   . VAL A 1 30  ? 12.461  -21.472 -22.621 1.00 49.30  ? 30  VAL L C   1 
ATOM   214  O O   . VAL A 1 30  ? 11.343  -21.971 -22.745 1.00 47.62  ? 30  VAL L O   1 
ATOM   215  C CB  . VAL A 1 30  ? 13.428  -23.565 -21.728 1.00 44.39  ? 30  VAL L CB  1 
ATOM   216  C CG1 . VAL A 1 30  ? 13.931  -23.972 -23.107 1.00 43.31  ? 30  VAL L CG1 1 
ATOM   217  C CG2 . VAL A 1 30  ? 14.279  -24.188 -20.642 1.00 39.64  ? 30  VAL L CG2 1 
ATOM   218  N N   . HIS A 1 31  ? 12.874  -20.433 -23.340 1.00 51.97  ? 31  HIS L N   1 
ATOM   219  C CA  . HIS A 1 31  ? 12.017  -19.816 -24.339 1.00 55.01  ? 31  HIS L CA  1 
ATOM   220  C C   . HIS A 1 31  ? 11.727  -20.848 -25.416 1.00 58.48  ? 31  HIS L C   1 
ATOM   221  O O   . HIS A 1 31  ? 12.493  -21.796 -25.587 1.00 62.03  ? 31  HIS L O   1 
ATOM   222  C CB  . HIS A 1 31  ? 12.711  -18.601 -24.951 1.00 53.24  ? 31  HIS L CB  1 
ATOM   223  C CG  . HIS A 1 31  ? 11.795  -17.716 -25.735 1.00 53.84  ? 31  HIS L CG  1 
ATOM   224  N ND1 . HIS A 1 31  ? 11.457  -16.443 -25.326 1.00 55.11  ? 31  HIS L ND1 1 
ATOM   225  C CD2 . HIS A 1 31  ? 11.137  -17.922 -26.900 1.00 50.66  ? 31  HIS L CD2 1 
ATOM   226  C CE1 . HIS A 1 31  ? 10.630  -15.905 -26.204 1.00 54.24  ? 31  HIS L CE1 1 
ATOM   227  N NE2 . HIS A 1 31  ? 10.420  -16.783 -27.169 1.00 55.70  ? 31  HIS L NE2 1 
ATOM   228  N N   . SER A 1 32  ? 10.620  -20.677 -26.136 1.00 58.56  ? 32  SER L N   1 
ATOM   229  C CA  . SER A 1 32  ? 10.260  -21.624 -27.185 1.00 56.89  ? 32  SER L CA  1 
ATOM   230  C C   . SER A 1 32  ? 11.247  -21.548 -28.356 1.00 55.97  ? 32  SER L C   1 
ATOM   231  O O   . SER A 1 32  ? 11.296  -22.443 -29.202 1.00 54.11  ? 32  SER L O   1 
ATOM   232  C CB  . SER A 1 32  ? 8.822   -21.373 -27.661 1.00 54.18  ? 32  SER L CB  1 
ATOM   233  O OG  . SER A 1 32  ? 8.728   -20.239 -28.507 1.00 52.34  ? 32  SER L OG  1 
ATOM   234  N N   . ASN A 1 33  ? 12.042  -20.482 -28.393 1.00 55.11  ? 33  ASN L N   1 
ATOM   235  C CA  . ASN A 1 33  ? 13.028  -20.316 -29.452 1.00 53.00  ? 33  ASN L CA  1 
ATOM   236  C C   . ASN A 1 33  ? 14.311  -21.079 -29.106 1.00 50.34  ? 33  ASN L C   1 
ATOM   237  O O   . ASN A 1 33  ? 15.253  -21.145 -29.907 1.00 46.67  ? 33  ASN L O   1 
ATOM   238  C CB  . ASN A 1 33  ? 13.332  -18.831 -29.666 1.00 56.51  ? 33  ASN L CB  1 
ATOM   239  C CG  . ASN A 1 33  ? 14.228  -18.258 -28.588 1.00 57.75  ? 33  ASN L CG  1 
ATOM   240  O OD1 . ASN A 1 33  ? 14.298  -18.785 -27.480 1.00 51.80  ? 33  ASN L OD1 1 
ATOM   241  N ND2 . ASN A 1 33  ? 14.920  -17.170 -28.909 1.00 56.67  ? 33  ASN L ND2 1 
ATOM   242  N N   . GLY A 1 34  ? 14.331  -21.664 -27.912 1.00 46.12  ? 34  GLY L N   1 
ATOM   243  C CA  . GLY A 1 34  ? 15.488  -22.424 -27.482 1.00 47.42  ? 34  GLY L CA  1 
ATOM   244  C C   . GLY A 1 34  ? 16.262  -21.830 -26.320 1.00 46.73  ? 34  GLY L C   1 
ATOM   245  O O   . GLY A 1 34  ? 16.420  -22.479 -25.288 1.00 48.12  ? 34  GLY L O   1 
ATOM   246  N N   . ASN A 1 35  ? 16.751  -20.604 -26.490 1.00 46.32  ? 35  ASN L N   1 
ATOM   247  C CA  . ASN A 1 35  ? 17.519  -19.918 -25.452 1.00 45.88  ? 35  ASN L CA  1 
ATOM   248  C C   . ASN A 1 35  ? 16.843  -19.901 -24.088 1.00 43.80  ? 35  ASN L C   1 
ATOM   249  O O   . ASN A 1 35  ? 15.633  -20.092 -23.974 1.00 43.57  ? 35  ASN L O   1 
ATOM   250  C CB  . ASN A 1 35  ? 17.797  -18.475 -25.864 1.00 46.77  ? 35  ASN L CB  1 
ATOM   251  C CG  . ASN A 1 35  ? 18.163  -18.350 -27.322 1.00 51.36  ? 35  ASN L CG  1 
ATOM   252  O OD1 . ASN A 1 35  ? 17.528  -18.952 -28.179 1.00 53.35  ? 35  ASN L OD1 1 
ATOM   253  N ND2 . ASN A 1 35  ? 19.195  -17.559 -27.613 1.00 57.25  ? 35  ASN L ND2 1 
ATOM   254  N N   . THR A 1 36  ? 17.646  -19.663 -23.057 1.00 39.07  ? 36  THR L N   1 
ATOM   255  C CA  . THR A 1 36  ? 17.160  -19.586 -21.683 1.00 41.34  ? 36  THR L CA  1 
ATOM   256  C C   . THR A 1 36  ? 17.685  -18.253 -21.165 1.00 41.91  ? 36  THR L C   1 
ATOM   257  O O   . THR A 1 36  ? 18.844  -18.156 -20.756 1.00 40.75  ? 36  THR L O   1 
ATOM   258  C CB  . THR A 1 36  ? 17.730  -20.729 -20.811 1.00 40.47  ? 36  THR L CB  1 
ATOM   259  O OG1 . THR A 1 36  ? 17.221  -21.981 -21.279 1.00 40.85  ? 36  THR L OG1 1 
ATOM   260  C CG2 . THR A 1 36  ? 17.332  -20.546 -19.351 1.00 40.93  ? 36  THR L CG2 1 
ATOM   261  N N   . TYR A 1 37  ? 16.828  -17.234 -21.189 1.00 35.66  ? 37  TYR L N   1 
ATOM   262  C CA  . TYR A 1 37  ? 17.207  -15.895 -20.769 1.00 34.18  ? 37  TYR L CA  1 
ATOM   263  C C   . TYR A 1 37  ? 17.226  -15.650 -19.273 1.00 33.87  ? 37  TYR L C   1 
ATOM   264  O O   . TYR A 1 37  ? 16.360  -14.959 -18.724 1.00 26.33  ? 37  TYR L O   1 
ATOM   265  C CB  . TYR A 1 37  ? 16.307  -14.879 -21.452 1.00 33.96  ? 37  TYR L CB  1 
ATOM   266  C CG  . TYR A 1 37  ? 16.253  -15.057 -22.944 1.00 39.38  ? 37  TYR L CG  1 
ATOM   267  C CD1 . TYR A 1 37  ? 15.302  -15.892 -23.532 1.00 38.07  ? 37  TYR L CD1 1 
ATOM   268  C CD2 . TYR A 1 37  ? 17.136  -14.371 -23.777 1.00 41.60  ? 37  TYR L CD2 1 
ATOM   269  C CE1 . TYR A 1 37  ? 15.226  -16.036 -24.919 1.00 42.97  ? 37  TYR L CE1 1 
ATOM   270  C CE2 . TYR A 1 37  ? 17.072  -14.505 -25.165 1.00 43.52  ? 37  TYR L CE2 1 
ATOM   271  C CZ  . TYR A 1 37  ? 16.114  -15.336 -25.731 1.00 46.03  ? 37  TYR L CZ  1 
ATOM   272  O OH  . TYR A 1 37  ? 16.031  -15.437 -27.106 1.00 46.41  ? 37  TYR L OH  1 
ATOM   273  N N   . LEU A 1 38  ? 18.244  -16.216 -18.629 1.00 32.39  ? 38  LEU L N   1 
ATOM   274  C CA  . LEU A 1 38  ? 18.451  -16.096 -17.194 1.00 32.17  ? 38  LEU L CA  1 
ATOM   275  C C   . LEU A 1 38  ? 19.817  -15.420 -17.033 1.00 34.73  ? 38  LEU L C   1 
ATOM   276  O O   . LEU A 1 38  ? 20.839  -15.973 -17.439 1.00 35.33  ? 38  LEU L O   1 
ATOM   277  C CB  . LEU A 1 38  ? 18.427  -17.494 -16.573 1.00 25.74  ? 38  LEU L CB  1 
ATOM   278  C CG  . LEU A 1 38  ? 18.595  -17.681 -15.066 1.00 32.71  ? 38  LEU L CG  1 
ATOM   279  C CD1 . LEU A 1 38  ? 20.063  -17.437 -14.691 1.00 28.30  ? 38  LEU L CD1 1 
ATOM   280  C CD2 . LEU A 1 38  ? 17.648  -16.756 -14.307 1.00 18.10  ? 38  LEU L CD2 1 
ATOM   281  N N   . HIS A 1 39  ? 19.811  -14.214 -16.465 1.00 31.14  ? 39  HIS L N   1 
ATOM   282  C CA  . HIS A 1 39  ? 21.013  -13.402 -16.269 1.00 27.59  ? 39  HIS L CA  1 
ATOM   283  C C   . HIS A 1 39  ? 21.322  -13.106 -14.788 1.00 29.41  ? 39  HIS L C   1 
ATOM   284  O O   . HIS A 1 39  ? 20.451  -13.232 -13.930 1.00 28.75  ? 39  HIS L O   1 
ATOM   285  C CB  . HIS A 1 39  ? 20.846  -12.089 -17.036 1.00 31.19  ? 39  HIS L CB  1 
ATOM   286  C CG  . HIS A 1 39  ? 20.180  -12.252 -18.368 1.00 39.41  ? 39  HIS L CG  1 
ATOM   287  N ND1 . HIS A 1 39  ? 18.856  -11.938 -18.587 1.00 40.81  ? 39  HIS L ND1 1 
ATOM   288  C CD2 . HIS A 1 39  ? 20.654  -12.710 -19.554 1.00 38.98  ? 39  HIS L CD2 1 
ATOM   289  C CE1 . HIS A 1 39  ? 18.543  -12.194 -19.846 1.00 37.88  ? 39  HIS L CE1 1 
ATOM   290  N NE2 . HIS A 1 39  ? 19.618  -12.662 -20.453 1.00 44.01  ? 39  HIS L NE2 1 
ATOM   291  N N   . TRP A 1 40  ? 22.567  -12.722 -14.497 1.00 25.15  ? 40  TRP L N   1 
ATOM   292  C CA  . TRP A 1 40  ? 22.991  -12.415 -13.131 1.00 25.61  ? 40  TRP L CA  1 
ATOM   293  C C   . TRP A 1 40  ? 23.624  -11.043 -13.044 1.00 28.20  ? 40  TRP L C   1 
ATOM   294  O O   . TRP A 1 40  ? 24.492  -10.680 -13.861 1.00 33.73  ? 40  TRP L O   1 
ATOM   295  C CB  . TRP A 1 40  ? 24.010  -13.438 -12.626 1.00 22.98  ? 40  TRP L CB  1 
ATOM   296  C CG  . TRP A 1 40  ? 23.467  -14.804 -12.397 1.00 14.91  ? 40  TRP L CG  1 
ATOM   297  C CD1 . TRP A 1 40  ? 23.537  -15.855 -13.248 1.00 14.93  ? 40  TRP L CD1 1 
ATOM   298  C CD2 . TRP A 1 40  ? 22.852  -15.290 -11.203 1.00 20.03  ? 40  TRP L CD2 1 
ATOM   299  N NE1 . TRP A 1 40  ? 23.014  -16.976 -12.663 1.00 17.10  ? 40  TRP L NE1 1 
ATOM   300  C CE2 . TRP A 1 40  ? 22.586  -16.655 -11.402 1.00 20.43  ? 40  TRP L CE2 1 
ATOM   301  C CE3 . TRP A 1 40  ? 22.505  -14.700 -9.977  1.00 22.42  ? 40  TRP L CE3 1 
ATOM   302  C CZ2 . TRP A 1 40  ? 21.983  -17.455 -10.423 1.00 21.48  ? 40  TRP L CZ2 1 
ATOM   303  C CZ3 . TRP A 1 40  ? 21.909  -15.491 -9.000  1.00 22.08  ? 40  TRP L CZ3 1 
ATOM   304  C CH2 . TRP A 1 40  ? 21.655  -16.858 -9.232  1.00 22.69  ? 40  TRP L CH2 1 
ATOM   305  N N   . TYR A 1 41  ? 23.209  -10.294 -12.029 1.00 27.55  ? 41  TYR L N   1 
ATOM   306  C CA  . TYR A 1 41  ? 23.712  -8.945  -11.797 1.00 25.48  ? 41  TYR L CA  1 
ATOM   307  C C   . TYR A 1 41  ? 24.253  -8.790  -10.375 1.00 22.10  ? 41  TYR L C   1 
ATOM   308  O O   . TYR A 1 41  ? 23.849  -9.508  -9.475  1.00 25.41  ? 41  TYR L O   1 
ATOM   309  C CB  . TYR A 1 41  ? 22.574  -7.932  -12.015 1.00 22.26  ? 41  TYR L CB  1 
ATOM   310  C CG  . TYR A 1 41  ? 21.865  -8.045  -13.357 1.00 25.64  ? 41  TYR L CG  1 
ATOM   311  C CD1 . TYR A 1 41  ? 20.984  -9.100  -13.633 1.00 22.86  ? 41  TYR L CD1 1 
ATOM   312  C CD2 . TYR A 1 41  ? 22.066  -7.092  -14.340 1.00 24.48  ? 41  TYR L CD2 1 
ATOM   313  C CE1 . TYR A 1 41  ? 20.328  -9.186  -14.872 1.00 26.07  ? 41  TYR L CE1 1 
ATOM   314  C CE2 . TYR A 1 41  ? 21.417  -7.168  -15.569 1.00 25.03  ? 41  TYR L CE2 1 
ATOM   315  C CZ  . TYR A 1 41  ? 20.557  -8.206  -15.835 1.00 23.20  ? 41  TYR L CZ  1 
ATOM   316  O OH  . TYR A 1 41  ? 19.930  -8.273  -17.061 1.00 25.48  ? 41  TYR L OH  1 
ATOM   317  N N   . LEU A 1 42  ? 25.185  -7.863  -10.186 1.00 24.35  ? 42  LEU L N   1 
ATOM   318  C CA  . LEU A 1 42  ? 25.726  -7.576  -8.866  1.00 24.63  ? 42  LEU L CA  1 
ATOM   319  C C   . LEU A 1 42  ? 25.495  -6.087  -8.673  1.00 23.88  ? 42  LEU L C   1 
ATOM   320  O O   . LEU A 1 42  ? 25.766  -5.308  -9.567  1.00 20.80  ? 42  LEU L O   1 
ATOM   321  C CB  . LEU A 1 42  ? 27.240  -7.854  -8.781  1.00 27.83  ? 42  LEU L CB  1 
ATOM   322  C CG  . LEU A 1 42  ? 27.983  -7.010  -7.720  1.00 28.63  ? 42  LEU L CG  1 
ATOM   323  C CD1 . LEU A 1 42  ? 27.505  -7.414  -6.310  1.00 21.58  ? 42  LEU L CD1 1 
ATOM   324  C CD2 . LEU A 1 42  ? 29.529  -7.182  -7.856  1.00 23.02  ? 42  LEU L CD2 1 
ATOM   325  N N   . GLN A 1 43  ? 24.977  -5.696  -7.514  1.00 22.41  ? 43  GLN L N   1 
ATOM   326  C CA  . GLN A 1 43  ? 24.748  -4.288  -7.228  1.00 22.29  ? 43  GLN L CA  1 
ATOM   327  C C   . GLN A 1 43  ? 25.486  -3.973  -5.921  1.00 29.89  ? 43  GLN L C   1 
ATOM   328  O O   . GLN A 1 43  ? 25.265  -4.626  -4.909  1.00 28.48  ? 43  GLN L O   1 
ATOM   329  C CB  . GLN A 1 43  ? 23.244  -3.997  -7.056  1.00 19.07  ? 43  GLN L CB  1 
ATOM   330  C CG  . GLN A 1 43  ? 22.916  -2.513  -6.862  1.00 22.26  ? 43  GLN L CG  1 
ATOM   331  C CD  . GLN A 1 43  ? 21.439  -2.261  -6.483  1.00 19.10  ? 43  GLN L CD  1 
ATOM   332  O OE1 . GLN A 1 43  ? 20.851  -1.247  -6.859  1.00 21.44  ? 43  GLN L OE1 1 
ATOM   333  N NE2 . GLN A 1 43  ? 20.862  -3.175  -5.735  1.00 16.08  ? 43  GLN L NE2 1 
ATOM   334  N N   . LYS A 1 44  ? 26.373  -2.986  -5.949  1.00 35.42  ? 44  LYS L N   1 
ATOM   335  C CA  . LYS A 1 44  ? 27.111  -2.614  -4.747  1.00 44.96  ? 44  LYS L CA  1 
ATOM   336  C C   . LYS A 1 44  ? 26.480  -1.354  -4.172  1.00 45.74  ? 44  LYS L C   1 
ATOM   337  O O   . LYS A 1 44  ? 25.931  -0.534  -4.911  1.00 44.85  ? 44  LYS L O   1 
ATOM   338  C CB  . LYS A 1 44  ? 28.588  -2.355  -5.074  1.00 44.43  ? 44  LYS L CB  1 
ATOM   339  C CG  . LYS A 1 44  ? 29.268  -3.497  -5.805  1.00 49.67  ? 44  LYS L CG  1 
ATOM   340  C CD  . LYS A 1 44  ? 30.770  -3.458  -5.605  1.00 52.71  ? 44  LYS L CD  1 
ATOM   341  C CE  . LYS A 1 44  ? 31.491  -3.244  -6.923  1.00 61.81  ? 44  LYS L CE  1 
ATOM   342  N NZ  . LYS A 1 44  ? 32.953  -3.008  -6.718  1.00 63.72  ? 44  LYS L NZ  1 
ATOM   343  N N   . PRO A 1 45  ? 26.534  -1.196  -2.840  1.00 48.46  ? 45  PRO L N   1 
ATOM   344  C CA  . PRO A 1 45  ? 25.962  -0.027  -2.169  1.00 48.27  ? 45  PRO L CA  1 
ATOM   345  C C   . PRO A 1 45  ? 26.224  1.293   -2.887  1.00 47.81  ? 45  PRO L C   1 
ATOM   346  O O   . PRO A 1 45  ? 27.368  1.622   -3.213  1.00 52.35  ? 45  PRO L O   1 
ATOM   347  C CB  . PRO A 1 45  ? 26.592  -0.061  -0.772  1.00 50.49  ? 45  PRO L CB  1 
ATOM   348  C CG  . PRO A 1 45  ? 27.513  -1.254  -0.755  1.00 51.18  ? 45  PRO L CG  1 
ATOM   349  C CD  . PRO A 1 45  ? 27.122  -2.140  -1.880  1.00 49.14  ? 45  PRO L CD  1 
ATOM   350  N N   . GLY A 1 46  ? 25.145  2.031   -3.138  1.00 47.59  ? 46  GLY L N   1 
ATOM   351  C CA  . GLY A 1 46  ? 25.236  3.315   -3.808  1.00 45.14  ? 46  GLY L CA  1 
ATOM   352  C C   . GLY A 1 46  ? 25.406  3.241   -5.309  1.00 45.88  ? 46  GLY L C   1 
ATOM   353  O O   . GLY A 1 46  ? 25.332  4.262   -5.992  1.00 46.92  ? 46  GLY L O   1 
ATOM   354  N N   . GLN A 1 47  ? 25.633  2.037   -5.826  1.00 47.12  ? 47  GLN L N   1 
ATOM   355  C CA  . GLN A 1 47  ? 25.834  1.837   -7.258  1.00 45.46  ? 47  GLN L CA  1 
ATOM   356  C C   . GLN A 1 47  ? 24.620  1.221   -7.958  1.00 44.16  ? 47  GLN L C   1 
ATOM   357  O O   . GLN A 1 47  ? 23.699  0.681   -7.320  1.00 41.94  ? 47  GLN L O   1 
ATOM   358  C CB  . GLN A 1 47  ? 27.060  0.940   -7.493  1.00 50.01  ? 47  GLN L CB  1 
ATOM   359  C CG  . GLN A 1 47  ? 28.365  1.680   -7.810  1.00 44.58  ? 47  GLN L CG  1 
ATOM   360  C CD  . GLN A 1 47  ? 29.611  0.860   -7.466  1.00 46.26  ? 47  GLN L CD  1 
ATOM   361  O OE1 . GLN A 1 47  ? 30.285  1.125   -6.471  1.00 46.93  ? 47  GLN L OE1 1 
ATOM   362  N NE2 . GLN A 1 47  ? 29.916  -0.142  -8.290  1.00 39.61  ? 47  GLN L NE2 1 
ATOM   363  N N   . SER A 1 48  ? 24.627  1.316   -9.281  1.00 41.32  ? 48  SER L N   1 
ATOM   364  C CA  . SER A 1 48  ? 23.563  0.757   -10.082 1.00 39.54  ? 48  SER L CA  1 
ATOM   365  C C   . SER A 1 48  ? 23.970  -0.682  -10.320 1.00 38.65  ? 48  SER L C   1 
ATOM   366  O O   . SER A 1 48  ? 25.155  -1.018  -10.246 1.00 37.12  ? 48  SER L O   1 
ATOM   367  C CB  . SER A 1 48  ? 23.448  1.499   -11.408 1.00 44.37  ? 48  SER L CB  1 
ATOM   368  O OG  . SER A 1 48  ? 24.403  1.013   -12.336 1.00 47.28  ? 48  SER L OG  1 
ATOM   369  N N   . PRO A 1 49  ? 22.992  -1.564  -10.581 1.00 36.40  ? 49  PRO L N   1 
ATOM   370  C CA  . PRO A 1 49  ? 23.342  -2.966  -10.817 1.00 30.98  ? 49  PRO L CA  1 
ATOM   371  C C   . PRO A 1 49  ? 24.292  -3.093  -12.007 1.00 27.85  ? 49  PRO L C   1 
ATOM   372  O O   . PRO A 1 49  ? 24.446  -2.159  -12.778 1.00 26.51  ? 49  PRO L O   1 
ATOM   373  C CB  . PRO A 1 49  ? 21.992  -3.634  -11.053 1.00 28.17  ? 49  PRO L CB  1 
ATOM   374  C CG  . PRO A 1 49  ? 20.999  -2.701  -10.405 1.00 27.02  ? 49  PRO L CG  1 
ATOM   375  C CD  . PRO A 1 49  ? 21.540  -1.340  -10.658 1.00 30.89  ? 49  PRO L CD  1 
ATOM   376  N N   . LYS A 1 50  ? 24.950  -4.239  -12.117 1.00 26.49  ? 50  LYS L N   1 
ATOM   377  C CA  . LYS A 1 50  ? 25.892  -4.477  -13.201 1.00 30.72  ? 50  LYS L CA  1 
ATOM   378  C C   . LYS A 1 50  ? 25.757  -5.895  -13.725 1.00 25.90  ? 50  LYS L C   1 
ATOM   379  O O   . LYS A 1 50  ? 25.814  -6.863  -12.967 1.00 25.34  ? 50  LYS L O   1 
ATOM   380  C CB  . LYS A 1 50  ? 27.322  -4.236  -12.707 1.00 34.58  ? 50  LYS L CB  1 
ATOM   381  C CG  . LYS A 1 50  ? 27.847  -2.854  -13.020 1.00 42.80  ? 50  LYS L CG  1 
ATOM   382  C CD  . LYS A 1 50  ? 27.791  -1.927  -11.819 1.00 50.10  ? 50  LYS L CD  1 
ATOM   383  C CE  . LYS A 1 50  ? 28.488  -0.602  -12.123 1.00 50.31  ? 50  LYS L CE  1 
ATOM   384  N NZ  . LYS A 1 50  ? 27.577  0.563   -11.986 1.00 57.47  ? 50  LYS L NZ  1 
ATOM   385  N N   . LEU A 1 51  ? 25.554  -6.005  -15.030 1.00 25.59  ? 51  LEU L N   1 
ATOM   386  C CA  . LEU A 1 51  ? 25.411  -7.303  -15.673 1.00 26.10  ? 51  LEU L CA  1 
ATOM   387  C C   . LEU A 1 51  ? 26.696  -8.137  -15.607 1.00 27.56  ? 51  LEU L C   1 
ATOM   388  O O   . LEU A 1 51  ? 27.765  -7.709  -16.052 1.00 27.86  ? 51  LEU L O   1 
ATOM   389  C CB  . LEU A 1 51  ? 24.979  -7.095  -17.120 1.00 21.90  ? 51  LEU L CB  1 
ATOM   390  C CG  . LEU A 1 51  ? 24.885  -8.270  -18.091 1.00 25.31  ? 51  LEU L CG  1 
ATOM   391  C CD1 . LEU A 1 51  ? 24.206  -9.463  -17.446 1.00 26.68  ? 51  LEU L CD1 1 
ATOM   392  C CD2 . LEU A 1 51  ? 24.092  -7.803  -19.311 1.00 23.25  ? 51  LEU L CD2 1 
ATOM   393  N N   . LEU A 1 52  ? 26.580  -9.341  -15.062 1.00 28.80  ? 52  LEU L N   1 
ATOM   394  C CA  . LEU A 1 52  ? 27.727  -10.224 -14.933 1.00 28.54  ? 52  LEU L CA  1 
ATOM   395  C C   . LEU A 1 52  ? 27.649  -11.383 -15.919 1.00 29.03  ? 52  LEU L C   1 
ATOM   396  O O   . LEU A 1 52  ? 28.537  -11.584 -16.744 1.00 32.98  ? 52  LEU L O   1 
ATOM   397  C CB  . LEU A 1 52  ? 27.798  -10.789 -13.506 1.00 21.04  ? 52  LEU L CB  1 
ATOM   398  C CG  . LEU A 1 52  ? 28.052  -9.813  -12.358 1.00 29.10  ? 52  LEU L CG  1 
ATOM   399  C CD1 . LEU A 1 52  ? 28.260  -10.616 -11.087 1.00 24.80  ? 52  LEU L CD1 1 
ATOM   400  C CD2 . LEU A 1 52  ? 29.268  -8.927  -12.640 1.00 26.01  ? 52  LEU L CD2 1 
ATOM   401  N N   . ILE A 1 53  ? 26.564  -12.135 -15.814 1.00 29.92  ? 53  ILE L N   1 
ATOM   402  C CA  . ILE A 1 53  ? 26.318  -13.312 -16.627 1.00 26.09  ? 53  ILE L CA  1 
ATOM   403  C C   . ILE A 1 53  ? 24.979  -13.220 -17.362 1.00 30.69  ? 53  ILE L C   1 
ATOM   404  O O   . ILE A 1 53  ? 23.980  -12.795 -16.779 1.00 23.39  ? 53  ILE L O   1 
ATOM   405  C CB  . ILE A 1 53  ? 26.281  -14.567 -15.720 1.00 24.08  ? 53  ILE L CB  1 
ATOM   406  C CG1 . ILE A 1 53  ? 27.596  -14.717 -14.943 1.00 27.81  ? 53  ILE L CG1 1 
ATOM   407  C CG2 . ILE A 1 53  ? 25.974  -15.773 -16.536 1.00 19.61  ? 53  ILE L CG2 1 
ATOM   408  C CD1 . ILE A 1 53  ? 28.637  -15.613 -15.652 1.00 25.00  ? 53  ILE L CD1 1 
ATOM   409  N N   . TYR A 1 54  ? 24.966  -13.608 -18.637 1.00 33.32  ? 54  TYR L N   1 
ATOM   410  C CA  . TYR A 1 54  ? 23.734  -13.620 -19.428 1.00 30.24  ? 54  TYR L CA  1 
ATOM   411  C C   . TYR A 1 54  ? 23.511  -14.998 -20.053 1.00 32.84  ? 54  TYR L C   1 
ATOM   412  O O   . TYR A 1 54  ? 24.454  -15.768 -20.259 1.00 34.76  ? 54  TYR L O   1 
ATOM   413  C CB  . TYR A 1 54  ? 23.734  -12.519 -20.496 1.00 34.98  ? 54  TYR L CB  1 
ATOM   414  C CG  . TYR A 1 54  ? 24.767  -12.658 -21.592 1.00 40.81  ? 54  TYR L CG  1 
ATOM   415  C CD1 . TYR A 1 54  ? 24.543  -13.509 -22.674 1.00 40.58  ? 54  TYR L CD1 1 
ATOM   416  C CD2 . TYR A 1 54  ? 25.954  -11.921 -21.564 1.00 37.15  ? 54  TYR L CD2 1 
ATOM   417  C CE1 . TYR A 1 54  ? 25.462  -13.630 -23.701 1.00 40.57  ? 54  TYR L CE1 1 
ATOM   418  C CE2 . TYR A 1 54  ? 26.887  -12.037 -22.596 1.00 43.76  ? 54  TYR L CE2 1 
ATOM   419  C CZ  . TYR A 1 54  ? 26.630  -12.899 -23.664 1.00 43.08  ? 54  TYR L CZ  1 
ATOM   420  O OH  . TYR A 1 54  ? 27.526  -13.034 -24.702 1.00 44.86  ? 54  TYR L OH  1 
ATOM   421  N N   . LYS A 1 55  ? 22.250  -15.304 -20.335 1.00 32.44  ? 55  LYS L N   1 
ATOM   422  C CA  . LYS A 1 55  ? 21.837  -16.587 -20.872 1.00 31.75  ? 55  LYS L CA  1 
ATOM   423  C C   . LYS A 1 55  ? 22.482  -17.762 -20.139 1.00 32.68  ? 55  LYS L C   1 
ATOM   424  O O   . LYS A 1 55  ? 23.094  -18.647 -20.748 1.00 31.20  ? 55  LYS L O   1 
ATOM   425  C CB  . LYS A 1 55  ? 22.105  -16.671 -22.376 1.00 34.17  ? 55  LYS L CB  1 
ATOM   426  C CG  . LYS A 1 55  ? 21.744  -15.398 -23.116 1.00 38.25  ? 55  LYS L CG  1 
ATOM   427  C CD  . LYS A 1 55  ? 20.838  -15.672 -24.304 1.00 42.02  ? 55  LYS L CD  1 
ATOM   428  C CE  . LYS A 1 55  ? 21.627  -16.150 -25.506 1.00 43.31  ? 55  LYS L CE  1 
ATOM   429  N NZ  . LYS A 1 55  ? 21.342  -15.332 -26.709 1.00 50.91  ? 55  LYS L NZ  1 
ATOM   430  N N   . VAL A 1 56  ? 22.341  -17.754 -18.814 1.00 30.04  ? 56  VAL L N   1 
ATOM   431  C CA  . VAL A 1 56  ? 22.840  -18.827 -17.962 1.00 28.76  ? 56  VAL L CA  1 
ATOM   432  C C   . VAL A 1 56  ? 24.350  -18.911 -17.662 1.00 32.67  ? 56  VAL L C   1 
ATOM   433  O O   . VAL A 1 56  ? 24.746  -18.996 -16.491 1.00 29.84  ? 56  VAL L O   1 
ATOM   434  C CB  . VAL A 1 56  ? 22.389  -20.197 -18.535 1.00 28.72  ? 56  VAL L CB  1 
ATOM   435  C CG1 . VAL A 1 56  ? 22.663  -21.307 -17.547 1.00 19.75  ? 56  VAL L CG1 1 
ATOM   436  C CG2 . VAL A 1 56  ? 20.899  -20.144 -18.918 1.00 25.32  ? 56  VAL L CG2 1 
ATOM   437  N N   . SER A 1 57  ? 25.183  -18.867 -18.701 1.00 33.94  ? 57  SER L N   1 
ATOM   438  C CA  . SER A 1 57  ? 26.630  -19.032 -18.522 1.00 33.85  ? 57  SER L CA  1 
ATOM   439  C C   . SER A 1 57  ? 27.565  -18.092 -19.263 1.00 32.80  ? 57  SER L C   1 
ATOM   440  O O   . SER A 1 57  ? 28.787  -18.220 -19.144 1.00 33.05  ? 57  SER L O   1 
ATOM   441  C CB  . SER A 1 57  ? 27.014  -20.453 -18.907 1.00 34.93  ? 57  SER L CB  1 
ATOM   442  O OG  . SER A 1 57  ? 26.496  -20.766 -20.185 1.00 32.29  ? 57  SER L OG  1 
ATOM   443  N N   . ASN A 1 58  ? 27.010  -17.167 -20.030 1.00 31.43  ? 58  ASN L N   1 
ATOM   444  C CA  . ASN A 1 58  ? 27.824  -16.232 -20.786 1.00 32.34  ? 58  ASN L CA  1 
ATOM   445  C C   . ASN A 1 58  ? 28.268  -15.034 -19.963 1.00 34.76  ? 58  ASN L C   1 
ATOM   446  O O   . ASN A 1 58  ? 27.447  -14.277 -19.447 1.00 31.23  ? 58  ASN L O   1 
ATOM   447  C CB  . ASN A 1 58  ? 27.053  -15.751 -22.006 1.00 31.04  ? 58  ASN L CB  1 
ATOM   448  C CG  . ASN A 1 58  ? 26.669  -16.882 -22.931 1.00 33.08  ? 58  ASN L CG  1 
ATOM   449  O OD1 . ASN A 1 58  ? 27.442  -17.271 -23.801 1.00 45.04  ? 58  ASN L OD1 1 
ATOM   450  N ND2 . ASN A 1 58  ? 25.474  -17.420 -22.747 1.00 35.49  ? 58  ASN L ND2 1 
ATOM   451  N N   . ARG A 1 59  ? 29.579  -14.857 -19.849 1.00 35.31  ? 59  ARG L N   1 
ATOM   452  C CA  . ARG A 1 59  ? 30.104  -13.739 -19.100 1.00 32.08  ? 59  ARG L CA  1 
ATOM   453  C C   . ARG A 1 59  ? 30.138  -12.502 -19.973 1.00 33.58  ? 59  ARG L C   1 
ATOM   454  O O   . ARG A 1 59  ? 30.692  -12.507 -21.076 1.00 32.99  ? 59  ARG L O   1 
ATOM   455  C CB  . ARG A 1 59  ? 31.499  -14.052 -18.578 1.00 32.08  ? 59  ARG L CB  1 
ATOM   456  C CG  . ARG A 1 59  ? 31.484  -14.654 -17.187 1.00 36.61  ? 59  ARG L CG  1 
ATOM   457  C CD  . ARG A 1 59  ? 32.848  -14.564 -16.541 1.00 40.57  ? 59  ARG L CD  1 
ATOM   458  N NE  . ARG A 1 59  ? 33.892  -14.488 -17.549 1.00 44.16  ? 59  ARG L NE  1 
ATOM   459  C CZ  . ARG A 1 59  ? 34.525  -15.546 -18.040 1.00 45.91  ? 59  ARG L CZ  1 
ATOM   460  N NH1 . ARG A 1 59  ? 34.211  -16.762 -17.610 1.00 42.23  ? 59  ARG L NH1 1 
ATOM   461  N NH2 . ARG A 1 59  ? 35.473  -15.385 -18.958 1.00 44.80  ? 59  ARG L NH2 1 
ATOM   462  N N   . PHE A 1 60  ? 29.521  -11.446 -19.459 1.00 29.40  ? 60  PHE L N   1 
ATOM   463  C CA  . PHE A 1 60  ? 29.444  -10.170 -20.133 1.00 28.29  ? 60  PHE L CA  1 
ATOM   464  C C   . PHE A 1 60  ? 30.862  -9.623  -20.270 1.00 34.00  ? 60  PHE L C   1 
ATOM   465  O O   . PHE A 1 60  ? 31.756  -10.027 -19.534 1.00 37.86  ? 60  PHE L O   1 
ATOM   466  C CB  . PHE A 1 60  ? 28.585  -9.217  -19.296 1.00 24.36  ? 60  PHE L CB  1 
ATOM   467  C CG  . PHE A 1 60  ? 28.136  -7.989  -20.031 1.00 21.31  ? 60  PHE L CG  1 
ATOM   468  C CD1 . PHE A 1 60  ? 27.520  -8.082  -21.260 1.00 26.59  ? 60  PHE L CD1 1 
ATOM   469  C CD2 . PHE A 1 60  ? 28.314  -6.734  -19.475 1.00 29.01  ? 60  PHE L CD2 1 
ATOM   470  C CE1 . PHE A 1 60  ? 27.088  -6.942  -21.921 1.00 29.67  ? 60  PHE L CE1 1 
ATOM   471  C CE2 . PHE A 1 60  ? 27.883  -5.594  -20.138 1.00 24.84  ? 60  PHE L CE2 1 
ATOM   472  C CZ  . PHE A 1 60  ? 27.273  -5.706  -21.355 1.00 20.86  ? 60  PHE L CZ  1 
ATOM   473  N N   . SER A 1 61  ? 31.052  -8.691  -21.195 1.00 33.63  ? 61  SER L N   1 
ATOM   474  C CA  . SER A 1 61  ? 32.356  -8.103  -21.446 1.00 40.00  ? 61  SER L CA  1 
ATOM   475  C C   . SER A 1 61  ? 32.986  -7.424  -20.238 1.00 38.79  ? 61  SER L C   1 
ATOM   476  O O   . SER A 1 61  ? 32.386  -6.543  -19.632 1.00 42.96  ? 61  SER L O   1 
ATOM   477  C CB  . SER A 1 61  ? 32.256  -7.097  -22.593 1.00 47.26  ? 61  SER L CB  1 
ATOM   478  O OG  . SER A 1 61  ? 30.914  -6.672  -22.782 1.00 54.22  ? 61  SER L OG  1 
ATOM   479  N N   . GLY A 1 62  ? 34.208  -7.840  -19.901 1.00 38.51  ? 62  GLY L N   1 
ATOM   480  C CA  . GLY A 1 62  ? 34.927  -7.240  -18.789 1.00 32.39  ? 62  GLY L CA  1 
ATOM   481  C C   . GLY A 1 62  ? 34.802  -7.951  -17.462 1.00 32.08  ? 62  GLY L C   1 
ATOM   482  O O   . GLY A 1 62  ? 35.510  -7.631  -16.507 1.00 30.66  ? 62  GLY L O   1 
ATOM   483  N N   . VAL A 1 63  ? 33.918  -8.938  -17.405 1.00 30.51  ? 63  VAL L N   1 
ATOM   484  C CA  . VAL A 1 63  ? 33.695  -9.681  -16.178 1.00 29.06  ? 63  VAL L CA  1 
ATOM   485  C C   . VAL A 1 63  ? 34.751  -10.758 -15.892 1.00 27.09  ? 63  VAL L C   1 
ATOM   486  O O   . VAL A 1 63  ? 34.954  -11.660 -16.698 1.00 27.67  ? 63  VAL L O   1 
ATOM   487  C CB  . VAL A 1 63  ? 32.291  -10.361 -16.196 1.00 26.77  ? 63  VAL L CB  1 
ATOM   488  C CG1 . VAL A 1 63  ? 32.077  -11.089 -14.899 1.00 21.05  ? 63  VAL L CG1 1 
ATOM   489  C CG2 . VAL A 1 63  ? 31.175  -9.306  -16.423 1.00 24.47  ? 63  VAL L CG2 1 
ATOM   490  N N   . PRO A 1 64  ? 35.420  -10.679 -14.720 1.00 30.12  ? 64  PRO L N   1 
ATOM   491  C CA  . PRO A 1 64  ? 36.458  -11.616 -14.260 1.00 27.69  ? 64  PRO L CA  1 
ATOM   492  C C   . PRO A 1 64  ? 36.020  -13.081 -14.401 1.00 29.90  ? 64  PRO L C   1 
ATOM   493  O O   . PRO A 1 64  ? 34.914  -13.446 -13.988 1.00 26.82  ? 64  PRO L O   1 
ATOM   494  C CB  . PRO A 1 64  ? 36.646  -11.238 -12.798 1.00 31.27  ? 64  PRO L CB  1 
ATOM   495  C CG  . PRO A 1 64  ? 36.261  -9.826  -12.724 1.00 24.60  ? 64  PRO L CG  1 
ATOM   496  C CD  . PRO A 1 64  ? 35.194  -9.601  -13.740 1.00 25.07  ? 64  PRO L CD  1 
ATOM   497  N N   . ASP A 1 65  ? 36.894  -13.928 -14.942 1.00 24.93  ? 65  ASP L N   1 
ATOM   498  C CA  . ASP A 1 65  ? 36.540  -15.328 -15.149 1.00 20.33  ? 65  ASP L CA  1 
ATOM   499  C C   . ASP A 1 65  ? 36.324  -16.176 -13.910 1.00 20.59  ? 65  ASP L C   1 
ATOM   500  O O   . ASP A 1 65  ? 36.077  -17.377 -14.017 1.00 23.06  ? 65  ASP L O   1 
ATOM   501  C CB  . ASP A 1 65  ? 37.554  -16.006 -16.090 1.00 27.47  ? 65  ASP L CB  1 
ATOM   502  C CG  . ASP A 1 65  ? 38.949  -16.126 -15.477 1.00 26.40  ? 65  ASP L CG  1 
ATOM   503  O OD1 . ASP A 1 65  ? 39.240  -15.458 -14.465 1.00 28.22  ? 65  ASP L OD1 1 
ATOM   504  O OD2 . ASP A 1 65  ? 39.746  -16.897 -16.040 1.00 30.54  ? 65  ASP L OD2 1 
ATOM   505  N N   . ARG A 1 66  ? 36.416  -15.574 -12.727 1.00 25.24  ? 66  ARG L N   1 
ATOM   506  C CA  . ARG A 1 66  ? 36.182  -16.331 -11.507 1.00 24.68  ? 66  ARG L CA  1 
ATOM   507  C C   . ARG A 1 66  ? 34.654  -16.453 -11.311 1.00 29.26  ? 66  ARG L C   1 
ATOM   508  O O   . ARG A 1 66  ? 34.168  -17.214 -10.457 1.00 28.65  ? 66  ARG L O   1 
ATOM   509  C CB  . ARG A 1 66  ? 36.837  -15.622 -10.311 1.00 31.44  ? 66  ARG L CB  1 
ATOM   510  C CG  . ARG A 1 66  ? 36.059  -14.424 -9.766  1.00 35.57  ? 66  ARG L CG  1 
ATOM   511  C CD  . ARG A 1 66  ? 36.859  -13.622 -8.752  1.00 33.65  ? 66  ARG L CD  1 
ATOM   512  N NE  . ARG A 1 66  ? 37.575  -12.536 -9.409  1.00 43.36  ? 66  ARG L NE  1 
ATOM   513  C CZ  . ARG A 1 66  ? 37.272  -11.253 -9.273  1.00 45.73  ? 66  ARG L CZ  1 
ATOM   514  N NH1 . ARG A 1 66  ? 36.268  -10.897 -8.499  1.00 47.51  ? 66  ARG L NH1 1 
ATOM   515  N NH2 . ARG A 1 66  ? 37.960  -10.328 -9.933  1.00 53.22  ? 66  ARG L NH2 1 
ATOM   516  N N   . PHE A 1 67  ? 33.914  -15.695 -12.125 1.00 29.52  ? 67  PHE L N   1 
ATOM   517  C CA  . PHE A 1 67  ? 32.441  -15.676 -12.102 1.00 25.59  ? 67  PHE L CA  1 
ATOM   518  C C   . PHE A 1 67  ? 31.939  -16.630 -13.161 1.00 24.31  ? 67  PHE L C   1 
ATOM   519  O O   . PHE A 1 67  ? 32.271  -16.475 -14.333 1.00 30.31  ? 67  PHE L O   1 
ATOM   520  C CB  . PHE A 1 67  ? 31.906  -14.279 -12.454 1.00 20.41  ? 67  PHE L CB  1 
ATOM   521  C CG  . PHE A 1 67  ? 32.019  -13.286 -11.349 1.00 26.11  ? 67  PHE L CG  1 
ATOM   522  C CD1 . PHE A 1 67  ? 31.231  -13.399 -10.214 1.00 29.88  ? 67  PHE L CD1 1 
ATOM   523  C CD2 . PHE A 1 67  ? 32.928  -12.233 -11.434 1.00 31.16  ? 67  PHE L CD2 1 
ATOM   524  C CE1 . PHE A 1 67  ? 31.347  -12.479 -9.167  1.00 31.45  ? 67  PHE L CE1 1 
ATOM   525  C CE2 . PHE A 1 67  ? 33.053  -11.307 -10.393 1.00 26.01  ? 67  PHE L CE2 1 
ATOM   526  C CZ  . PHE A 1 67  ? 32.263  -11.435 -9.261  1.00 31.89  ? 67  PHE L CZ  1 
ATOM   527  N N   . SER A 1 68  ? 31.138  -17.608 -12.770 1.00 20.24  ? 68  SER L N   1 
ATOM   528  C CA  . SER A 1 68  ? 30.610  -18.553 -13.742 1.00 29.37  ? 68  SER L CA  1 
ATOM   529  C C   . SER A 1 68  ? 29.166  -18.926 -13.403 1.00 31.66  ? 68  SER L C   1 
ATOM   530  O O   . SER A 1 68  ? 28.768  -18.892 -12.244 1.00 35.56  ? 68  SER L O   1 
ATOM   531  C CB  . SER A 1 68  ? 31.483  -19.814 -13.797 1.00 25.73  ? 68  SER L CB  1 
ATOM   532  O OG  . SER A 1 68  ? 31.654  -20.403 -12.518 1.00 29.22  ? 68  SER L OG  1 
ATOM   533  N N   . GLY A 1 69  ? 28.381  -19.269 -14.423 1.00 38.34  ? 69  GLY L N   1 
ATOM   534  C CA  . GLY A 1 69  ? 26.995  -19.636 -14.188 1.00 38.08  ? 69  GLY L CA  1 
ATOM   535  C C   . GLY A 1 69  ? 26.561  -20.947 -14.813 1.00 41.42  ? 69  GLY L C   1 
ATOM   536  O O   . GLY A 1 69  ? 27.055  -21.332 -15.874 1.00 43.16  ? 69  GLY L O   1 
ATOM   537  N N   . SER A 1 70  ? 25.628  -21.628 -14.147 1.00 41.15  ? 70  SER L N   1 
ATOM   538  C CA  . SER A 1 70  ? 25.087  -22.903 -14.619 1.00 39.41  ? 70  SER L CA  1 
ATOM   539  C C   . SER A 1 70  ? 23.566  -23.019 -14.370 1.00 38.58  ? 70  SER L C   1 
ATOM   540  O O   . SER A 1 70  ? 22.947  -22.123 -13.780 1.00 31.69  ? 70  SER L O   1 
ATOM   541  C CB  . SER A 1 70  ? 25.825  -24.068 -13.940 1.00 39.60  ? 70  SER L CB  1 
ATOM   542  O OG  . SER A 1 70  ? 26.043  -23.819 -12.563 1.00 38.12  ? 70  SER L OG  1 
ATOM   543  N N   . GLY A 1 71  ? 22.980  -24.127 -14.823 1.00 38.42  ? 71  GLY L N   1 
ATOM   544  C CA  . GLY A 1 71  ? 21.546  -24.350 -14.673 1.00 43.26  ? 71  GLY L CA  1 
ATOM   545  C C   . GLY A 1 71  ? 20.896  -24.620 -16.026 1.00 43.16  ? 71  GLY L C   1 
ATOM   546  O O   . GLY A 1 71  ? 21.502  -24.355 -17.057 1.00 42.45  ? 71  GLY L O   1 
ATOM   547  N N   . SER A 1 72  ? 19.665  -25.121 -16.051 1.00 47.09  ? 72  SER L N   1 
ATOM   548  C CA  . SER A 1 72  ? 19.044  -25.418 -17.344 1.00 46.38  ? 72  SER L CA  1 
ATOM   549  C C   . SER A 1 72  ? 17.594  -24.996 -17.574 1.00 49.51  ? 72  SER L C   1 
ATOM   550  O O   . SER A 1 72  ? 17.288  -24.370 -18.594 1.00 54.11  ? 72  SER L O   1 
ATOM   551  C CB  . SER A 1 72  ? 19.163  -26.911 -17.635 1.00 37.79  ? 72  SER L CB  1 
ATOM   552  O OG  . SER A 1 72  ? 18.905  -27.656 -16.465 1.00 36.24  ? 72  SER L OG  1 
ATOM   553  N N   . GLY A 1 73  ? 16.699  -25.344 -16.653 1.00 47.69  ? 73  GLY L N   1 
ATOM   554  C CA  . GLY A 1 73  ? 15.296  -25.000 -16.852 1.00 44.80  ? 73  GLY L CA  1 
ATOM   555  C C   . GLY A 1 73  ? 14.710  -24.060 -15.824 1.00 40.27  ? 73  GLY L C   1 
ATOM   556  O O   . GLY A 1 73  ? 14.387  -22.913 -16.131 1.00 39.02  ? 73  GLY L O   1 
ATOM   557  N N   . THR A 1 74  ? 14.564  -24.543 -14.597 1.00 39.60  ? 74  THR L N   1 
ATOM   558  C CA  . THR A 1 74  ? 14.028  -23.713 -13.533 1.00 39.96  ? 74  THR L CA  1 
ATOM   559  C C   . THR A 1 74  ? 15.017  -23.533 -12.392 1.00 39.98  ? 74  THR L C   1 
ATOM   560  O O   . THR A 1 74  ? 14.734  -22.824 -11.436 1.00 36.18  ? 74  THR L O   1 
ATOM   561  C CB  . THR A 1 74  ? 12.730  -24.294 -12.967 1.00 43.61  ? 74  THR L CB  1 
ATOM   562  O OG1 . THR A 1 74  ? 13.035  -25.373 -12.069 1.00 47.08  ? 74  THR L OG1 1 
ATOM   563  C CG2 . THR A 1 74  ? 11.846  -24.789 -14.101 1.00 41.42  ? 74  THR L CG2 1 
ATOM   564  N N   . ASP A 1 75  ? 16.179  -24.170 -12.488 1.00 43.49  ? 75  ASP L N   1 
ATOM   565  C CA  . ASP A 1 75  ? 17.176  -24.027 -11.436 1.00 48.36  ? 75  ASP L CA  1 
ATOM   566  C C   . ASP A 1 75  ? 18.529  -23.586 -11.994 1.00 45.86  ? 75  ASP L C   1 
ATOM   567  O O   . ASP A 1 75  ? 19.078  -24.218 -12.890 1.00 45.03  ? 75  ASP L O   1 
ATOM   568  C CB  . ASP A 1 75  ? 17.301  -25.331 -10.646 1.00 55.06  ? 75  ASP L CB  1 
ATOM   569  C CG  . ASP A 1 75  ? 16.410  -25.345 -9.406  1.00 62.59  ? 75  ASP L CG  1 
ATOM   570  O OD1 . ASP A 1 75  ? 16.836  -24.813 -8.357  1.00 66.86  ? 75  ASP L OD1 1 
ATOM   571  O OD2 . ASP A 1 75  ? 15.281  -25.878 -9.481  1.00 53.68  ? 75  ASP L OD2 1 
ATOM   572  N N   . PHE A 1 76  ? 19.048  -22.488 -11.451 1.00 44.35  ? 76  PHE L N   1 
ATOM   573  C CA  . PHE A 1 76  ? 20.317  -21.913 -11.895 1.00 42.16  ? 76  PHE L CA  1 
ATOM   574  C C   . PHE A 1 76  ? 21.253  -21.555 -10.740 1.00 42.62  ? 76  PHE L C   1 
ATOM   575  O O   . PHE A 1 76  ? 20.805  -21.256 -9.627  1.00 40.88  ? 76  PHE L O   1 
ATOM   576  C CB  . PHE A 1 76  ? 20.037  -20.669 -12.739 1.00 36.97  ? 76  PHE L CB  1 
ATOM   577  C CG  . PHE A 1 76  ? 19.038  -20.906 -13.836 1.00 34.70  ? 76  PHE L CG  1 
ATOM   578  C CD1 . PHE A 1 76  ? 17.680  -20.761 -13.595 1.00 26.69  ? 76  PHE L CD1 1 
ATOM   579  C CD2 . PHE A 1 76  ? 19.457  -21.322 -15.095 1.00 30.13  ? 76  PHE L CD2 1 
ATOM   580  C CE1 . PHE A 1 76  ? 16.750  -21.035 -14.594 1.00 30.79  ? 76  PHE L CE1 1 
ATOM   581  C CE2 . PHE A 1 76  ? 18.544  -21.594 -16.096 1.00 28.19  ? 76  PHE L CE2 1 
ATOM   582  C CZ  . PHE A 1 76  ? 17.182  -21.454 -15.847 1.00 30.29  ? 76  PHE L CZ  1 
ATOM   583  N N   . THR A 1 77  ? 22.554  -21.574 -11.018 1.00 39.89  ? 77  THR L N   1 
ATOM   584  C CA  . THR A 1 77  ? 23.548  -21.270 -10.002 1.00 39.84  ? 77  THR L CA  1 
ATOM   585  C C   . THR A 1 77  ? 24.700  -20.394 -10.496 1.00 39.51  ? 77  THR L C   1 
ATOM   586  O O   . THR A 1 77  ? 25.239  -20.580 -11.596 1.00 38.96  ? 77  THR L O   1 
ATOM   587  C CB  . THR A 1 77  ? 24.124  -22.580 -9.397  1.00 41.90  ? 77  THR L CB  1 
ATOM   588  O OG1 . THR A 1 77  ? 23.185  -23.121 -8.461  1.00 40.42  ? 77  THR L OG1 1 
ATOM   589  C CG2 . THR A 1 77  ? 25.443  -22.323 -8.679  1.00 35.54  ? 77  THR L CG2 1 
ATOM   590  N N   . LEU A 1 78  ? 25.054  -19.415 -9.674  1.00 37.99  ? 78  LEU L N   1 
ATOM   591  C CA  . LEU A 1 78  ? 26.156  -18.528 -9.978  1.00 35.44  ? 78  LEU L CA  1 
ATOM   592  C C   . LEU A 1 78  ? 27.238  -18.938 -8.998  1.00 36.48  ? 78  LEU L C   1 
ATOM   593  O O   . LEU A 1 78  ? 26.966  -19.152 -7.812  1.00 34.37  ? 78  LEU L O   1 
ATOM   594  C CB  . LEU A 1 78  ? 25.764  -17.065 -9.755  1.00 30.54  ? 78  LEU L CB  1 
ATOM   595  C CG  . LEU A 1 78  ? 26.839  -15.971 -9.836  1.00 31.42  ? 78  LEU L CG  1 
ATOM   596  C CD1 . LEU A 1 78  ? 27.130  -15.572 -11.284 1.00 28.91  ? 78  LEU L CD1 1 
ATOM   597  C CD2 . LEU A 1 78  ? 26.330  -14.768 -9.056  1.00 30.52  ? 78  LEU L CD2 1 
ATOM   598  N N   . LYS A 1 79  ? 28.453  -19.096 -9.499  1.00 37.75  ? 79  LYS L N   1 
ATOM   599  C CA  . LYS A 1 79  ? 29.567  -19.474 -8.635  1.00 41.23  ? 79  LYS L CA  1 
ATOM   600  C C   . LYS A 1 79  ? 30.676  -18.458 -8.784  1.00 36.37  ? 79  LYS L C   1 
ATOM   601  O O   . LYS A 1 79  ? 30.869  -17.896 -9.858  1.00 37.29  ? 79  LYS L O   1 
ATOM   602  C CB  . LYS A 1 79  ? 30.095  -20.860 -8.998  1.00 44.28  ? 79  LYS L CB  1 
ATOM   603  C CG  . LYS A 1 79  ? 29.017  -21.886 -9.295  1.00 50.57  ? 79  LYS L CG  1 
ATOM   604  C CD  . LYS A 1 79  ? 29.554  -23.281 -9.036  1.00 54.30  ? 79  LYS L CD  1 
ATOM   605  C CE  . LYS A 1 79  ? 28.527  -24.358 -9.316  1.00 56.49  ? 79  LYS L CE  1 
ATOM   606  N NZ  . LYS A 1 79  ? 29.022  -25.691 -8.866  1.00 58.82  ? 79  LYS L NZ  1 
ATOM   607  N N   . ILE A 1 80  ? 31.376  -18.201 -7.689  1.00 39.37  ? 80  ILE L N   1 
ATOM   608  C CA  . ILE A 1 80  ? 32.493  -17.266 -7.685  1.00 37.90  ? 80  ILE L CA  1 
ATOM   609  C C   . ILE A 1 80  ? 33.669  -17.984 -7.034  1.00 41.78  ? 80  ILE L C   1 
ATOM   610  O O   . ILE A 1 80  ? 33.674  -18.186 -5.817  1.00 40.28  ? 80  ILE L O   1 
ATOM   611  C CB  . ILE A 1 80  ? 32.214  -16.009 -6.827  1.00 38.99  ? 80  ILE L CB  1 
ATOM   612  C CG1 . ILE A 1 80  ? 30.814  -15.465 -7.100  1.00 35.39  ? 80  ILE L CG1 1 
ATOM   613  C CG2 . ILE A 1 80  ? 33.288  -14.950 -7.098  1.00 37.43  ? 80  ILE L CG2 1 
ATOM   614  C CD1 . ILE A 1 80  ? 30.455  -14.241 -6.232  1.00 31.32  ? 80  ILE L CD1 1 
ATOM   615  N N   . SER A 1 81  ? 34.652  -18.387 -7.834  1.00 40.89  ? 81  SER L N   1 
ATOM   616  C CA  . SER A 1 81  ? 35.829  -19.047 -7.285  1.00 43.32  ? 81  SER L CA  1 
ATOM   617  C C   . SER A 1 81  ? 36.680  -17.928 -6.704  1.00 43.10  ? 81  SER L C   1 
ATOM   618  O O   . SER A 1 81  ? 36.794  -16.860 -7.300  1.00 49.32  ? 81  SER L O   1 
ATOM   619  C CB  . SER A 1 81  ? 36.593  -19.768 -8.386  1.00 45.06  ? 81  SER L CB  1 
ATOM   620  O OG  . SER A 1 81  ? 37.223  -20.926 -7.865  1.00 60.10  ? 81  SER L OG  1 
ATOM   621  N N   . ARG A 1 82  ? 37.252  -18.152 -5.532  1.00 43.84  ? 82  ARG L N   1 
ATOM   622  C CA  . ARG A 1 82  ? 38.078  -17.134 -4.896  1.00 42.92  ? 82  ARG L CA  1 
ATOM   623  C C   . ARG A 1 82  ? 37.357  -15.795 -4.854  1.00 39.85  ? 82  ARG L C   1 
ATOM   624  O O   . ARG A 1 82  ? 37.403  -15.011 -5.809  1.00 36.95  ? 82  ARG L O   1 
ATOM   625  C CB  . ARG A 1 82  ? 39.412  -16.989 -5.636  1.00 46.34  ? 82  ARG L CB  1 
ATOM   626  C CG  . ARG A 1 82  ? 40.267  -18.256 -5.604  1.00 54.63  ? 82  ARG L CG  1 
ATOM   627  C CD  . ARG A 1 82  ? 41.022  -18.458 -6.909  1.00 64.84  ? 82  ARG L CD  1 
ATOM   628  N NE  . ARG A 1 82  ? 40.831  -19.797 -7.468  1.00 69.51  ? 82  ARG L NE  1 
ATOM   629  C CZ  . ARG A 1 82  ? 40.843  -20.075 -8.770  1.00 70.87  ? 82  ARG L CZ  1 
ATOM   630  N NH1 . ARG A 1 82  ? 41.039  -19.107 -9.658  1.00 66.40  ? 82  ARG L NH1 1 
ATOM   631  N NH2 . ARG A 1 82  ? 40.658  -21.323 -9.186  1.00 72.34  ? 82  ARG L NH2 1 
ATOM   632  N N   . VAL A 1 83  ? 36.687  -15.542 -3.735  1.00 37.03  ? 83  VAL L N   1 
ATOM   633  C CA  . VAL A 1 83  ? 35.943  -14.304 -3.549  1.00 31.42  ? 83  VAL L CA  1 
ATOM   634  C C   . VAL A 1 83  ? 36.915  -13.182 -3.238  1.00 29.21  ? 83  VAL L C   1 
ATOM   635  O O   . VAL A 1 83  ? 37.842  -13.368 -2.461  1.00 32.82  ? 83  VAL L O   1 
ATOM   636  C CB  . VAL A 1 83  ? 34.937  -14.420 -2.356  1.00 29.76  ? 83  VAL L CB  1 
ATOM   637  C CG1 . VAL A 1 83  ? 34.435  -13.041 -1.951  1.00 29.17  ? 83  VAL L CG1 1 
ATOM   638  C CG2 . VAL A 1 83  ? 33.771  -15.308 -2.726  1.00 26.15  ? 83  VAL L CG2 1 
ATOM   639  N N   . GLU A 1 84  ? 36.699  -12.016 -3.838  1.00 32.54  ? 84  GLU L N   1 
ATOM   640  C CA  . GLU A 1 84  ? 37.543  -10.847 -3.584  1.00 28.99  ? 84  GLU L CA  1 
ATOM   641  C C   . GLU A 1 84  ? 36.689  -9.789  -2.906  1.00 31.45  ? 84  GLU L C   1 
ATOM   642  O O   . GLU A 1 84  ? 35.455  -9.833  -2.985  1.00 27.47  ? 84  GLU L O   1 
ATOM   643  C CB  . GLU A 1 84  ? 38.079  -10.283 -4.893  1.00 38.53  ? 84  GLU L CB  1 
ATOM   644  C CG  . GLU A 1 84  ? 38.214  -11.319 -5.982  1.00 52.38  ? 84  GLU L CG  1 
ATOM   645  C CD  . GLU A 1 84  ? 39.651  -11.576 -6.355  1.00 55.60  ? 84  GLU L CD  1 
ATOM   646  O OE1 . GLU A 1 84  ? 40.330  -10.614 -6.769  1.00 61.26  ? 84  GLU L OE1 1 
ATOM   647  O OE2 . GLU A 1 84  ? 40.096  -12.738 -6.235  1.00 59.48  ? 84  GLU L OE2 1 
ATOM   648  N N   . ALA A 1 85  ? 37.345  -8.829  -2.262  1.00 25.36  ? 85  ALA L N   1 
ATOM   649  C CA  . ALA A 1 85  ? 36.652  -7.764  -1.573  1.00 28.50  ? 85  ALA L CA  1 
ATOM   650  C C   . ALA A 1 85  ? 35.727  -6.981  -2.489  1.00 30.78  ? 85  ALA L C   1 
ATOM   651  O O   . ALA A 1 85  ? 34.642  -6.558  -2.080  1.00 32.15  ? 85  ALA L O   1 
ATOM   652  C CB  . ALA A 1 85  ? 37.652  -6.828  -0.944  1.00 27.49  ? 85  ALA L CB  1 
ATOM   653  N N   . GLU A 1 86  ? 36.153  -6.794  -3.731  1.00 28.48  ? 86  GLU L N   1 
ATOM   654  C CA  . GLU A 1 86  ? 35.377  -6.030  -4.689  1.00 24.95  ? 86  GLU L CA  1 
ATOM   655  C C   . GLU A 1 86  ? 34.134  -6.792  -5.176  1.00 21.84  ? 86  GLU L C   1 
ATOM   656  O O   . GLU A 1 86  ? 33.307  -6.236  -5.877  1.00 19.55  ? 86  GLU L O   1 
ATOM   657  C CB  . GLU A 1 86  ? 36.270  -5.654  -5.866  1.00 28.83  ? 86  GLU L CB  1 
ATOM   658  C CG  . GLU A 1 86  ? 36.637  -6.813  -6.773  1.00 43.02  ? 86  GLU L CG  1 
ATOM   659  C CD  . GLU A 1 86  ? 37.844  -6.500  -7.638  1.00 58.55  ? 86  GLU L CD  1 
ATOM   660  O OE1 . GLU A 1 86  ? 38.926  -6.213  -7.077  1.00 65.58  ? 86  GLU L OE1 1 
ATOM   661  O OE2 . GLU A 1 86  ? 37.706  -6.538  -8.879  1.00 66.34  ? 86  GLU L OE2 1 
ATOM   662  N N   . ASP A 1 87  ? 34.037  -8.062  -4.801  1.00 24.03  ? 87  ASP L N   1 
ATOM   663  C CA  . ASP A 1 87  ? 32.913  -8.924  -5.153  1.00 27.38  ? 87  ASP L CA  1 
ATOM   664  C C   . ASP A 1 87  ? 31.755  -8.848  -4.137  1.00 29.80  ? 87  ASP L C   1 
ATOM   665  O O   . ASP A 1 87  ? 30.675  -9.407  -4.363  1.00 25.41  ? 87  ASP L O   1 
ATOM   666  C CB  . ASP A 1 87  ? 33.360  -10.379 -5.224  1.00 21.92  ? 87  ASP L CB  1 
ATOM   667  C CG  . ASP A 1 87  ? 34.372  -10.636 -6.329  1.00 31.11  ? 87  ASP L CG  1 
ATOM   668  O OD1 . ASP A 1 87  ? 34.494  -9.801  -7.254  1.00 30.79  ? 87  ASP L OD1 1 
ATOM   669  O OD2 . ASP A 1 87  ? 35.046  -11.690 -6.272  1.00 33.31  ? 87  ASP L OD2 1 
ATOM   670  N N   . LEU A 1 88  ? 31.986  -8.183  -3.014  1.00 31.34  ? 88  LEU L N   1 
ATOM   671  C CA  . LEU A 1 88  ? 30.957  -8.063  -1.976  1.00 32.32  ? 88  LEU L CA  1 
ATOM   672  C C   . LEU A 1 88  ? 29.838  -7.089  -2.342  1.00 32.25  ? 88  LEU L C   1 
ATOM   673  O O   . LEU A 1 88  ? 30.089  -5.917  -2.647  1.00 27.09  ? 88  LEU L O   1 
ATOM   674  C CB  . LEU A 1 88  ? 31.592  -7.628  -0.653  1.00 31.48  ? 88  LEU L CB  1 
ATOM   675  C CG  . LEU A 1 88  ? 32.329  -8.727  0.114   1.00 35.13  ? 88  LEU L CG  1 
ATOM   676  C CD1 . LEU A 1 88  ? 32.668  -8.222  1.499   1.00 37.66  ? 88  LEU L CD1 1 
ATOM   677  C CD2 . LEU A 1 88  ? 31.469  -9.981  0.206   1.00 33.90  ? 88  LEU L CD2 1 
ATOM   678  N N   . GLY A 1 89  ? 28.604  -7.590  -2.291  1.00 29.61  ? 89  GLY L N   1 
ATOM   679  C CA  . GLY A 1 89  ? 27.446  -6.779  -2.608  1.00 25.51  ? 89  GLY L CA  1 
ATOM   680  C C   . GLY A 1 89  ? 26.229  -7.675  -2.734  1.00 28.08  ? 89  GLY L C   1 
ATOM   681  O O   . GLY A 1 89  ? 26.235  -8.789  -2.218  1.00 29.83  ? 89  GLY L O   1 
ATOM   682  N N   . VAL A 1 90  ? 25.198  -7.208  -3.438  1.00 27.95  ? 90  VAL L N   1 
ATOM   683  C CA  . VAL A 1 90  ? 23.971  -7.987  -3.625  1.00 25.67  ? 90  VAL L CA  1 
ATOM   684  C C   . VAL A 1 90  ? 23.852  -8.561  -5.028  1.00 19.22  ? 90  VAL L C   1 
ATOM   685  O O   . VAL A 1 90  ? 23.880  -7.826  -6.000  1.00 21.36  ? 90  VAL L O   1 
ATOM   686  C CB  . VAL A 1 90  ? 22.738  -7.116  -3.356  1.00 27.15  ? 90  VAL L CB  1 
ATOM   687  C CG1 . VAL A 1 90  ? 21.463  -7.913  -3.610  1.00 25.96  ? 90  VAL L CG1 1 
ATOM   688  C CG2 . VAL A 1 90  ? 22.805  -6.586  -1.926  1.00 26.05  ? 90  VAL L CG2 1 
ATOM   689  N N   . TYR A 1 91  ? 23.680  -9.876  -5.127  1.00 23.56  ? 91  TYR L N   1 
ATOM   690  C CA  . TYR A 1 91  ? 23.558  -10.509 -6.435  1.00 29.00  ? 91  TYR L CA  1 
ATOM   691  C C   . TYR A 1 91  ? 22.101  -10.779 -6.798  1.00 26.79  ? 91  TYR L C   1 
ATOM   692  O O   . TYR A 1 91  ? 21.351  -11.375 -6.019  1.00 33.28  ? 91  TYR L O   1 
ATOM   693  C CB  . TYR A 1 91  ? 24.356  -11.819 -6.457  1.00 28.42  ? 91  TYR L CB  1 
ATOM   694  C CG  . TYR A 1 91  ? 25.858  -11.584 -6.459  1.00 36.64  ? 91  TYR L CG  1 
ATOM   695  C CD1 . TYR A 1 91  ? 26.527  -11.236 -5.283  1.00 35.75  ? 91  TYR L CD1 1 
ATOM   696  C CD2 . TYR A 1 91  ? 26.599  -11.650 -7.645  1.00 34.16  ? 91  TYR L CD2 1 
ATOM   697  C CE1 . TYR A 1 91  ? 27.898  -10.952 -5.289  1.00 37.60  ? 91  TYR L CE1 1 
ATOM   698  C CE2 . TYR A 1 91  ? 27.975  -11.368 -7.660  1.00 32.88  ? 91  TYR L CE2 1 
ATOM   699  C CZ  . TYR A 1 91  ? 28.612  -11.018 -6.480  1.00 33.93  ? 91  TYR L CZ  1 
ATOM   700  O OH  . TYR A 1 91  ? 29.954  -10.707 -6.480  1.00 30.04  ? 91  TYR L OH  1 
ATOM   701  N N   . PHE A 1 92  ? 21.701  -10.333 -7.980  1.00 23.13  ? 92  PHE L N   1 
ATOM   702  C CA  . PHE A 1 92  ? 20.342  -10.548 -8.444  1.00 26.75  ? 92  PHE L CA  1 
ATOM   703  C C   . PHE A 1 92  ? 20.334  -11.412 -9.695  1.00 27.15  ? 92  PHE L C   1 
ATOM   704  O O   . PHE A 1 92  ? 21.174  -11.233 -10.584 1.00 23.66  ? 92  PHE L O   1 
ATOM   705  C CB  . PHE A 1 92  ? 19.667  -9.219  -8.817  1.00 31.77  ? 92  PHE L CB  1 
ATOM   706  C CG  . PHE A 1 92  ? 19.409  -8.306  -7.659  1.00 43.03  ? 92  PHE L CG  1 
ATOM   707  C CD1 . PHE A 1 92  ? 18.260  -8.446  -6.884  1.00 50.98  ? 92  PHE L CD1 1 
ATOM   708  C CD2 . PHE A 1 92  ? 20.278  -7.257  -7.380  1.00 46.41  ? 92  PHE L CD2 1 
ATOM   709  C CE1 . PHE A 1 92  ? 17.979  -7.545  -5.848  1.00 50.00  ? 92  PHE L CE1 1 
ATOM   710  C CE2 . PHE A 1 92  ? 20.006  -6.354  -6.350  1.00 49.28  ? 92  PHE L CE2 1 
ATOM   711  C CZ  . PHE A 1 92  ? 18.853  -6.498  -5.585  1.00 48.16  ? 92  PHE L CZ  1 
ATOM   712  N N   . CYS A 1 93  ? 19.409  -12.366 -9.747  1.00 23.62  ? 93  CYS L N   1 
ATOM   713  C CA  . CYS A 1 93  ? 19.239  -13.166 -10.940 1.00 25.75  ? 93  CYS L CA  1 
ATOM   714  C C   . CYS A 1 93  ? 18.052  -12.482 -11.634 1.00 29.83  ? 93  CYS L C   1 
ATOM   715  O O   . CYS A 1 93  ? 17.300  -11.720 -11.000 1.00 28.58  ? 93  CYS L O   1 
ATOM   716  C CB  . CYS A 1 93  ? 18.967  -14.640 -10.604 1.00 33.67  ? 93  CYS L CB  1 
ATOM   717  S SG  . CYS A 1 93  ? 17.489  -15.118 -9.634  1.00 43.90  ? 93  CYS L SG  1 
ATOM   718  N N   . SER A 1 94  ? 17.891  -12.710 -12.928 1.00 24.35  ? 94  SER L N   1 
ATOM   719  C CA  . SER A 1 94  ? 16.819  -12.070 -13.653 1.00 27.64  ? 94  SER L CA  1 
ATOM   720  C C   . SER A 1 94  ? 16.443  -12.868 -14.898 1.00 31.20  ? 94  SER L C   1 
ATOM   721  O O   . SER A 1 94  ? 17.304  -13.452 -15.547 1.00 28.40  ? 94  SER L O   1 
ATOM   722  C CB  . SER A 1 94  ? 17.249  -10.654 -14.018 1.00 21.89  ? 94  SER L CB  1 
ATOM   723  O OG  . SER A 1 94  ? 16.645  -10.207 -15.210 1.00 30.49  ? 94  SER L OG  1 
ATOM   724  N N   . GLN A 1 95  ? 15.147  -12.902 -15.207 1.00 28.04  ? 95  GLN L N   1 
ATOM   725  C CA  . GLN A 1 95  ? 14.651  -13.648 -16.358 1.00 31.41  ? 95  GLN L CA  1 
ATOM   726  C C   . GLN A 1 95  ? 14.050  -12.694 -17.378 1.00 31.01  ? 95  GLN L C   1 
ATOM   727  O O   . GLN A 1 95  ? 13.438  -11.688 -17.031 1.00 33.25  ? 95  GLN L O   1 
ATOM   728  C CB  . GLN A 1 95  ? 13.623  -14.694 -15.889 1.00 36.38  ? 95  GLN L CB  1 
ATOM   729  C CG  . GLN A 1 95  ? 12.440  -14.938 -16.832 1.00 44.46  ? 95  GLN L CG  1 
ATOM   730  C CD  . GLN A 1 95  ? 11.305  -13.983 -16.577 1.00 36.33  ? 95  GLN L CD  1 
ATOM   731  O OE1 . GLN A 1 95  ? 10.719  -13.444 -17.498 1.00 37.31  ? 95  GLN L OE1 1 
ATOM   732  N NE2 . GLN A 1 95  ? 11.003  -13.756 -15.311 1.00 47.85  ? 95  GLN L NE2 1 
ATOM   733  N N   . SER A 1 96  ? 14.244  -13.005 -18.650 1.00 32.84  ? 96  SER L N   1 
ATOM   734  C CA  . SER A 1 96  ? 13.735  -12.164 -19.719 1.00 33.18  ? 96  SER L CA  1 
ATOM   735  C C   . SER A 1 96  ? 12.983  -13.061 -20.704 1.00 33.77  ? 96  SER L C   1 
ATOM   736  O O   . SER A 1 96  ? 12.612  -12.637 -21.801 1.00 33.94  ? 96  SER L O   1 
ATOM   737  C CB  . SER A 1 96  ? 14.906  -11.467 -20.417 1.00 39.69  ? 96  SER L CB  1 
ATOM   738  O OG  . SER A 1 96  ? 14.468  -10.678 -21.507 1.00 50.17  ? 96  SER L OG  1 
ATOM   739  N N   . THR A 1 97  ? 12.769  -14.312 -20.311 1.00 35.35  ? 97  THR L N   1 
ATOM   740  C CA  . THR A 1 97  ? 12.071  -15.243 -21.182 1.00 38.38  ? 97  THR L CA  1 
ATOM   741  C C   . THR A 1 97  ? 10.557  -14.994 -21.207 1.00 44.39  ? 97  THR L C   1 
ATOM   742  O O   . THR A 1 97  ? 9.965   -14.945 -22.278 1.00 44.96  ? 97  THR L O   1 
ATOM   743  C CB  . THR A 1 97  ? 12.315  -16.700 -20.768 1.00 35.01  ? 97  THR L CB  1 
ATOM   744  O OG1 . THR A 1 97  ? 13.697  -17.040 -20.991 1.00 36.34  ? 97  THR L OG1 1 
ATOM   745  C CG2 . THR A 1 97  ? 11.437  -17.636 -21.598 1.00 29.13  ? 97  THR L CG2 1 
ATOM   746  N N   . HIS A 1 98  ? 9.952   -14.807 -20.032 1.00 52.61  ? 98  HIS L N   1 
ATOM   747  C CA  . HIS A 1 98  ? 8.505   -14.598 -19.915 1.00 60.72  ? 98  HIS L CA  1 
ATOM   748  C C   . HIS A 1 98  ? 7.974   -13.160 -19.879 1.00 63.49  ? 98  HIS L C   1 
ATOM   749  O O   . HIS A 1 98  ? 8.638   -12.241 -19.391 1.00 63.43  ? 98  HIS L O   1 
ATOM   750  C CB  . HIS A 1 98  ? 7.987   -15.356 -18.694 1.00 64.40  ? 98  HIS L CB  1 
ATOM   751  C CG  . HIS A 1 98  ? 7.896   -16.835 -18.904 1.00 73.48  ? 98  HIS L CG  1 
ATOM   752  N ND1 . HIS A 1 98  ? 6.830   -17.432 -19.542 1.00 78.32  ? 98  HIS L ND1 1 
ATOM   753  C CD2 . HIS A 1 98  ? 8.741   -17.839 -18.571 1.00 74.12  ? 98  HIS L CD2 1 
ATOM   754  C CE1 . HIS A 1 98  ? 7.020   -18.737 -19.591 1.00 80.89  ? 98  HIS L CE1 1 
ATOM   755  N NE2 . HIS A 1 98  ? 8.174   -19.011 -19.008 1.00 76.84  ? 98  HIS L NE2 1 
ATOM   756  N N   . VAL A 1 99  ? 6.749   -13.010 -20.393 1.00 67.51  ? 99  VAL L N   1 
ATOM   757  C CA  . VAL A 1 99  ? 6.010   -11.742 -20.493 1.00 66.10  ? 99  VAL L CA  1 
ATOM   758  C C   . VAL A 1 99  ? 6.713   -10.531 -19.881 1.00 58.75  ? 99  VAL L C   1 
ATOM   759  O O   . VAL A 1 99  ? 7.340   -9.764  -20.605 1.00 58.02  ? 99  VAL L O   1 
ATOM   760  C CB  . VAL A 1 99  ? 4.575   -11.893 -19.901 1.00 72.66  ? 99  VAL L CB  1 
ATOM   761  C CG1 . VAL A 1 99  ? 3.699   -10.712 -20.327 1.00 76.48  ? 99  VAL L CG1 1 
ATOM   762  C CG2 . VAL A 1 99  ? 3.960   -13.216 -20.355 1.00 75.43  ? 99  VAL L CG2 1 
ATOM   763  N N   . PRO A 1 100 ? 6.597   -10.317 -18.556 1.00 53.11  ? 100 PRO L N   1 
ATOM   764  C CA  . PRO A 1 100 ? 7.282   -9.162  -17.972 1.00 49.84  ? 100 PRO L CA  1 
ATOM   765  C C   . PRO A 1 100 ? 8.608   -9.620  -17.337 1.00 45.47  ? 100 PRO L C   1 
ATOM   766  O O   . PRO A 1 100 ? 8.631   -10.555 -16.534 1.00 46.83  ? 100 PRO L O   1 
ATOM   767  C CB  . PRO A 1 100 ? 6.293   -8.665  -16.923 1.00 48.17  ? 100 PRO L CB  1 
ATOM   768  C CG  . PRO A 1 100 ? 5.476   -9.919  -16.546 1.00 49.44  ? 100 PRO L CG  1 
ATOM   769  C CD  . PRO A 1 100 ? 5.837   -11.032 -17.520 1.00 52.93  ? 100 PRO L CD  1 
ATOM   770  N N   . PRO A 1 101 ? 9.727   -8.972  -17.700 1.00 41.07  ? 101 PRO L N   1 
ATOM   771  C CA  . PRO A 1 101 ? 11.032  -9.347  -17.141 1.00 35.81  ? 101 PRO L CA  1 
ATOM   772  C C   . PRO A 1 101 ? 11.062  -9.172  -15.627 1.00 33.21  ? 101 PRO L C   1 
ATOM   773  O O   . PRO A 1 101 ? 10.789  -8.086  -15.114 1.00 33.75  ? 101 PRO L O   1 
ATOM   774  C CB  . PRO A 1 101 ? 12.014  -8.405  -17.843 1.00 35.06  ? 101 PRO L CB  1 
ATOM   775  C CG  . PRO A 1 101 ? 11.184  -7.260  -18.284 1.00 35.25  ? 101 PRO L CG  1 
ATOM   776  C CD  . PRO A 1 101 ? 9.841   -7.846  -18.639 1.00 35.40  ? 101 PRO L CD  1 
ATOM   777  N N   . THR A 1 102 ? 11.400  -10.235 -14.906 1.00 31.04  ? 102 THR L N   1 
ATOM   778  C CA  . THR A 1 102 ? 11.437  -10.137 -13.455 1.00 30.68  ? 102 THR L CA  1 
ATOM   779  C C   . THR A 1 102 ? 12.795  -10.465 -12.849 1.00 28.21  ? 102 THR L C   1 
ATOM   780  O O   . THR A 1 102 ? 13.593  -11.180 -13.445 1.00 31.48  ? 102 THR L O   1 
ATOM   781  C CB  . THR A 1 102 ? 10.355  -11.030 -12.825 1.00 27.25  ? 102 THR L CB  1 
ATOM   782  O OG1 . THR A 1 102 ? 10.601  -12.400 -13.170 1.00 27.96  ? 102 THR L OG1 1 
ATOM   783  C CG2 . THR A 1 102 ? 8.964   -10.622 -13.352 1.00 32.66  ? 102 THR L CG2 1 
ATOM   784  N N   . PHE A 1 103 ? 13.033  -9.927  -11.657 1.00 26.89  ? 103 PHE L N   1 
ATOM   785  C CA  . PHE A 1 103 ? 14.273  -10.116 -10.910 1.00 27.50  ? 103 PHE L CA  1 
ATOM   786  C C   . PHE A 1 103 ? 14.068  -10.988 -9.662  1.00 31.97  ? 103 PHE L C   1 
ATOM   787  O O   . PHE A 1 103 ? 12.972  -11.030 -9.093  1.00 29.78  ? 103 PHE L O   1 
ATOM   788  C CB  . PHE A 1 103 ? 14.789  -8.762  -10.433 1.00 23.33  ? 103 PHE L CB  1 
ATOM   789  C CG  . PHE A 1 103 ? 15.180  -7.827  -11.536 1.00 27.01  ? 103 PHE L CG  1 
ATOM   790  C CD1 . PHE A 1 103 ? 14.250  -6.961  -12.094 1.00 29.80  ? 103 PHE L CD1 1 
ATOM   791  C CD2 . PHE A 1 103 ? 16.494  -7.797  -12.004 1.00 30.44  ? 103 PHE L CD2 1 
ATOM   792  C CE1 . PHE A 1 103 ? 14.615  -6.068  -13.103 1.00 23.45  ? 103 PHE L CE1 1 
ATOM   793  C CE2 . PHE A 1 103 ? 16.867  -6.912  -13.010 1.00 28.30  ? 103 PHE L CE2 1 
ATOM   794  C CZ  . PHE A 1 103 ? 15.921  -6.044  -13.559 1.00 27.71  ? 103 PHE L CZ  1 
ATOM   795  N N   . GLY A 1 104 ? 15.134  -11.656 -9.229  1.00 26.43  ? 104 GLY L N   1 
ATOM   796  C CA  . GLY A 1 104 ? 15.068  -12.460 -8.027  1.00 22.73  ? 104 GLY L CA  1 
ATOM   797  C C   . GLY A 1 104 ? 15.128  -11.454 -6.896  1.00 24.44  ? 104 GLY L C   1 
ATOM   798  O O   . GLY A 1 104 ? 15.266  -10.257 -7.149  1.00 27.68  ? 104 GLY L O   1 
ATOM   799  N N   . GLY A 1 105 ? 15.052  -11.916 -5.653  1.00 29.82  ? 105 GLY L N   1 
ATOM   800  C CA  . GLY A 1 105 ? 15.070  -10.995 -4.524  1.00 27.27  ? 105 GLY L CA  1 
ATOM   801  C C   . GLY A 1 105 ? 16.416  -10.495 -4.022  1.00 30.72  ? 105 GLY L C   1 
ATOM   802  O O   . GLY A 1 105 ? 16.472  -9.630  -3.140  1.00 23.77  ? 105 GLY L O   1 
ATOM   803  N N   . GLY A 1 106 ? 17.501  -11.043 -4.557  1.00 31.09  ? 106 GLY L N   1 
ATOM   804  C CA  . GLY A 1 106 ? 18.818  -10.604 -4.140  1.00 29.43  ? 106 GLY L CA  1 
ATOM   805  C C   . GLY A 1 106 ? 19.473  -11.472 -3.085  1.00 31.74  ? 106 GLY L C   1 
ATOM   806  O O   . GLY A 1 106 ? 18.818  -11.981 -2.168  1.00 32.47  ? 106 GLY L O   1 
ATOM   807  N N   . THR A 1 107 ? 20.786  -11.646 -3.222  1.00 33.29  ? 107 THR L N   1 
ATOM   808  C CA  . THR A 1 107 ? 21.568  -12.429 -2.273  1.00 29.33  ? 107 THR L CA  1 
ATOM   809  C C   . THR A 1 107 ? 22.765  -11.556 -1.875  1.00 34.12  ? 107 THR L C   1 
ATOM   810  O O   . THR A 1 107 ? 23.564  -11.141 -2.724  1.00 33.53  ? 107 THR L O   1 
ATOM   811  C CB  . THR A 1 107 ? 22.037  -13.758 -2.918  1.00 33.93  ? 107 THR L CB  1 
ATOM   812  O OG1 . THR A 1 107 ? 20.892  -14.572 -3.203  1.00 29.76  ? 107 THR L OG1 1 
ATOM   813  C CG2 . THR A 1 107 ? 22.979  -14.528 -2.000  1.00 29.74  ? 107 THR L CG2 1 
ATOM   814  N N   . LYS A 1 108 ? 22.874  -11.273 -0.580  1.00 34.95  ? 108 LYS L N   1 
ATOM   815  C CA  . LYS A 1 108 ? 23.942  -10.437 -0.059  1.00 30.81  ? 108 LYS L CA  1 
ATOM   816  C C   . LYS A 1 108 ? 25.165  -11.246 0.326   1.00 33.10  ? 108 LYS L C   1 
ATOM   817  O O   . LYS A 1 108 ? 25.113  -12.058 1.248   1.00 32.92  ? 108 LYS L O   1 
ATOM   818  C CB  . LYS A 1 108 ? 23.444  -9.668  1.165   1.00 35.19  ? 108 LYS L CB  1 
ATOM   819  C CG  . LYS A 1 108 ? 23.979  -8.255  1.294   1.00 34.66  ? 108 LYS L CG  1 
ATOM   820  C CD  . LYS A 1 108 ? 24.949  -8.160  2.442   1.00 38.45  ? 108 LYS L CD  1 
ATOM   821  C CE  . LYS A 1 108 ? 24.466  -7.208  3.509   1.00 39.21  ? 108 LYS L CE  1 
ATOM   822  N NZ  . LYS A 1 108 ? 24.254  -5.843  2.960   1.00 44.35  ? 108 LYS L NZ  1 
ATOM   823  N N   . LEU A 1 109 ? 26.263  -11.040 -0.401  1.00 34.63  ? 109 LEU L N   1 
ATOM   824  C CA  . LEU A 1 109 ? 27.527  -11.729 -0.099  1.00 33.62  ? 109 LEU L CA  1 
ATOM   825  C C   . LEU A 1 109 ? 28.199  -10.907 1.007   1.00 30.56  ? 109 LEU L C   1 
ATOM   826  O O   . LEU A 1 109 ? 28.364  -9.696  0.871   1.00 29.86  ? 109 LEU L O   1 
ATOM   827  C CB  . LEU A 1 109 ? 28.426  -11.786 -1.347  1.00 33.65  ? 109 LEU L CB  1 
ATOM   828  C CG  . LEU A 1 109 ? 29.567  -12.822 -1.368  1.00 35.26  ? 109 LEU L CG  1 
ATOM   829  C CD1 . LEU A 1 109 ? 29.021  -14.235 -1.257  1.00 35.35  ? 109 LEU L CD1 1 
ATOM   830  C CD2 . LEU A 1 109 ? 30.361  -12.671 -2.653  1.00 28.18  ? 109 LEU L CD2 1 
ATOM   831  N N   . GLU A 1 110 ? 28.558  -11.553 2.112   1.00 31.75  ? 110 GLU L N   1 
ATOM   832  C CA  . GLU A 1 110 ? 29.187  -10.845 3.226   1.00 31.48  ? 110 GLU L CA  1 
ATOM   833  C C   . GLU A 1 110 ? 30.399  -11.582 3.767   1.00 27.79  ? 110 GLU L C   1 
ATOM   834  O O   . GLU A 1 110 ? 30.620  -12.747 3.447   1.00 25.45  ? 110 GLU L O   1 
ATOM   835  C CB  . GLU A 1 110 ? 28.186  -10.659 4.366   1.00 33.21  ? 110 GLU L CB  1 
ATOM   836  C CG  . GLU A 1 110 ? 27.593  -11.955 4.862   1.00 48.05  ? 110 GLU L CG  1 
ATOM   837  C CD  . GLU A 1 110 ? 27.329  -11.938 6.358   1.00 53.88  ? 110 GLU L CD  1 
ATOM   838  O OE1 . GLU A 1 110 ? 26.340  -11.303 6.771   1.00 58.94  ? 110 GLU L OE1 1 
ATOM   839  O OE2 . GLU A 1 110 ? 28.108  -12.559 7.114   1.00 58.15  ? 110 GLU L OE2 1 
ATOM   840  N N   . ILE A 1 111 ? 31.180  -10.889 4.591   1.00 32.01  ? 111 ILE L N   1 
ATOM   841  C CA  . ILE A 1 111 ? 32.370  -11.476 5.195   1.00 33.60  ? 111 ILE L CA  1 
ATOM   842  C C   . ILE A 1 111 ? 32.034  -12.311 6.423   1.00 33.42  ? 111 ILE L C   1 
ATOM   843  O O   . ILE A 1 111 ? 31.456  -11.815 7.388   1.00 32.42  ? 111 ILE L O   1 
ATOM   844  C CB  . ILE A 1 111 ? 33.373  -10.398 5.619   1.00 35.33  ? 111 ILE L CB  1 
ATOM   845  C CG1 . ILE A 1 111 ? 34.008  -9.775  4.385   1.00 32.63  ? 111 ILE L CG1 1 
ATOM   846  C CG2 . ILE A 1 111 ? 34.454  -11.016 6.509   1.00 37.72  ? 111 ILE L CG2 1 
ATOM   847  C CD1 . ILE A 1 111 ? 35.076  -10.646 3.759   1.00 31.77  ? 111 ILE L CD1 1 
ATOM   848  N N   . LYS A 1 112 ? 32.412  -13.581 6.379   1.00 34.14  ? 112 LYS L N   1 
ATOM   849  C CA  . LYS A 1 112 ? 32.165  -14.490 7.477   1.00 35.57  ? 112 LYS L CA  1 
ATOM   850  C C   . LYS A 1 112 ? 33.336  -14.475 8.461   1.00 37.37  ? 112 LYS L C   1 
ATOM   851  O O   . LYS A 1 112 ? 34.487  -14.603 8.057   1.00 44.06  ? 112 LYS L O   1 
ATOM   852  C CB  . LYS A 1 112 ? 31.959  -15.897 6.926   1.00 34.93  ? 112 LYS L CB  1 
ATOM   853  C CG  . LYS A 1 112 ? 32.093  -16.986 7.952   1.00 42.58  ? 112 LYS L CG  1 
ATOM   854  C CD  . LYS A 1 112 ? 33.108  -18.019 7.507   1.00 49.65  ? 112 LYS L CD  1 
ATOM   855  C CE  . LYS A 1 112 ? 32.500  -19.009 6.525   1.00 50.98  ? 112 LYS L CE  1 
ATOM   856  N NZ  . LYS A 1 112 ? 33.558  -19.818 5.860   1.00 57.35  ? 112 LYS L NZ  1 
ATOM   857  N N   . ARG A 1 113 ? 33.029  -14.291 9.744   1.00 36.74  ? 113 ARG L N   1 
ATOM   858  C CA  . ARG A 1 113 ? 34.030  -14.266 10.809  1.00 29.47  ? 113 ARG L CA  1 
ATOM   859  C C   . ARG A 1 113 ? 33.528  -15.033 12.019  1.00 28.79  ? 113 ARG L C   1 
ATOM   860  O O   . ARG A 1 113 ? 32.532  -15.752 11.934  1.00 27.98  ? 113 ARG L O   1 
ATOM   861  C CB  . ARG A 1 113 ? 34.345  -12.835 11.226  1.00 28.87  ? 113 ARG L CB  1 
ATOM   862  C CG  . ARG A 1 113 ? 33.152  -11.895 11.359  1.00 30.26  ? 113 ARG L CG  1 
ATOM   863  C CD  . ARG A 1 113 ? 32.904  -11.551 12.803  1.00 33.84  ? 113 ARG L CD  1 
ATOM   864  N NE  . ARG A 1 113 ? 33.763  -10.487 13.307  1.00 37.84  ? 113 ARG L NE  1 
ATOM   865  C CZ  . ARG A 1 113 ? 34.406  -10.535 14.471  1.00 33.13  ? 113 ARG L CZ  1 
ATOM   866  N NH1 . ARG A 1 113 ? 34.288  -11.599 15.248  1.00 30.78  ? 113 ARG L NH1 1 
ATOM   867  N NH2 . ARG A 1 113 ? 35.138  -9.503  14.875  1.00 27.77  ? 113 ARG L NH2 1 
ATOM   868  N N   . THR A 1 114 ? 34.211  -14.868 13.148  1.00 29.01  ? 114 THR L N   1 
ATOM   869  C CA  . THR A 1 114 ? 33.834  -15.556 14.378  1.00 33.39  ? 114 THR L CA  1 
ATOM   870  C C   . THR A 1 114 ? 32.673  -14.873 15.083  1.00 34.28  ? 114 THR L C   1 
ATOM   871  O O   . THR A 1 114 ? 32.445  -13.676 14.912  1.00 35.33  ? 114 THR L O   1 
ATOM   872  C CB  . THR A 1 114 ? 35.008  -15.625 15.371  1.00 28.81  ? 114 THR L CB  1 
ATOM   873  O OG1 . THR A 1 114 ? 35.985  -14.639 15.026  1.00 43.14  ? 114 THR L OG1 1 
ATOM   874  C CG2 . THR A 1 114 ? 35.644  -16.993 15.336  1.00 29.62  ? 114 THR L CG2 1 
ATOM   875  N N   . VAL A 1 115 ? 31.962  -15.648 15.894  1.00 36.18  ? 115 VAL L N   1 
ATOM   876  C CA  . VAL A 1 115 ? 30.818  -15.157 16.639  1.00 37.59  ? 115 VAL L CA  1 
ATOM   877  C C   . VAL A 1 115 ? 31.230  -14.119 17.677  1.00 39.03  ? 115 VAL L C   1 
ATOM   878  O O   . VAL A 1 115 ? 32.161  -14.336 18.453  1.00 42.35  ? 115 VAL L O   1 
ATOM   879  C CB  . VAL A 1 115 ? 30.097  -16.331 17.350  1.00 40.14  ? 115 VAL L CB  1 
ATOM   880  C CG1 . VAL A 1 115 ? 29.025  -15.807 18.305  1.00 37.16  ? 115 VAL L CG1 1 
ATOM   881  C CG2 . VAL A 1 115 ? 29.488  -17.255 16.313  1.00 34.11  ? 115 VAL L CG2 1 
ATOM   882  N N   . ALA A 1 116 ? 30.538  -12.986 17.680  1.00 36.01  ? 116 ALA L N   1 
ATOM   883  C CA  . ALA A 1 116 ? 30.814  -11.926 18.639  1.00 36.20  ? 116 ALA L CA  1 
ATOM   884  C C   . ALA A 1 116 ? 29.500  -11.481 19.290  1.00 38.27  ? 116 ALA L C   1 
ATOM   885  O O   . ALA A 1 116 ? 28.589  -11.011 18.610  1.00 36.98  ? 116 ALA L O   1 
ATOM   886  C CB  . ALA A 1 116 ? 31.487  -10.733 17.939  1.00 31.45  ? 116 ALA L CB  1 
ATOM   887  N N   . ALA A 1 117 ? 29.398  -11.640 20.605  1.00 38.81  ? 117 ALA L N   1 
ATOM   888  C CA  . ALA A 1 117 ? 28.195  -11.222 21.306  1.00 38.41  ? 117 ALA L CA  1 
ATOM   889  C C   . ALA A 1 117 ? 28.237  -9.707  21.370  1.00 39.65  ? 117 ALA L C   1 
ATOM   890  O O   . ALA A 1 117 ? 29.312  -9.111  21.458  1.00 42.52  ? 117 ALA L O   1 
ATOM   891  C CB  . ALA A 1 117 ? 28.164  -11.804 22.712  1.00 39.74  ? 117 ALA L CB  1 
ATOM   892  N N   . PRO A 1 118 ? 27.064  -9.058  21.337  1.00 35.89  ? 118 PRO L N   1 
ATOM   893  C CA  . PRO A 1 118 ? 27.050  -7.594  21.391  1.00 32.99  ? 118 PRO L CA  1 
ATOM   894  C C   . PRO A 1 118 ? 27.335  -7.005  22.766  1.00 29.87  ? 118 PRO L C   1 
ATOM   895  O O   . PRO A 1 118 ? 27.194  -7.668  23.784  1.00 32.07  ? 118 PRO L O   1 
ATOM   896  C CB  . PRO A 1 118 ? 25.641  -7.234  20.892  1.00 33.58  ? 118 PRO L CB  1 
ATOM   897  C CG  . PRO A 1 118 ? 24.807  -8.415  21.233  1.00 34.12  ? 118 PRO L CG  1 
ATOM   898  C CD  . PRO A 1 118 ? 25.708  -9.631  21.237  1.00 35.33  ? 118 PRO L CD  1 
ATOM   899  N N   . SER A 1 119 ? 27.768  -5.754  22.790  1.00 32.68  ? 119 SER L N   1 
ATOM   900  C CA  . SER A 1 119 ? 27.999  -5.079  24.059  1.00 38.60  ? 119 SER L CA  1 
ATOM   901  C C   . SER A 1 119 ? 26.722  -4.271  24.119  1.00 36.08  ? 119 SER L C   1 
ATOM   902  O O   . SER A 1 119 ? 26.429  -3.510  23.198  1.00 37.10  ? 119 SER L O   1 
ATOM   903  C CB  . SER A 1 119 ? 29.219  -4.160  23.994  1.00 40.37  ? 119 SER L CB  1 
ATOM   904  O OG  . SER A 1 119 ? 30.217  -4.693  23.140  1.00 54.30  ? 119 SER L OG  1 
ATOM   905  N N   . VAL A 1 120 ? 25.953  -4.449  25.188  1.00 36.86  ? 120 VAL L N   1 
ATOM   906  C CA  . VAL A 1 120 ? 24.665  -3.774  25.333  1.00 32.30  ? 120 VAL L CA  1 
ATOM   907  C C   . VAL A 1 120 ? 24.647  -2.554  26.235  1.00 32.43  ? 120 VAL L C   1 
ATOM   908  O O   . VAL A 1 120 ? 25.021  -2.627  27.405  1.00 38.19  ? 120 VAL L O   1 
ATOM   909  C CB  . VAL A 1 120 ? 23.604  -4.769  25.841  1.00 29.90  ? 120 VAL L CB  1 
ATOM   910  C CG1 . VAL A 1 120 ? 22.208  -4.171  25.691  1.00 23.75  ? 120 VAL L CG1 1 
ATOM   911  C CG2 . VAL A 1 120 ? 23.734  -6.075  25.074  1.00 28.38  ? 120 VAL L CG2 1 
ATOM   912  N N   . PHE A 1 121 ? 24.193  -1.437  25.682  1.00 26.89  ? 121 PHE L N   1 
ATOM   913  C CA  . PHE A 1 121 ? 24.099  -0.186  26.423  1.00 28.96  ? 121 PHE L CA  1 
ATOM   914  C C   . PHE A 1 121 ? 22.674  0.362   26.338  1.00 29.26  ? 121 PHE L C   1 
ATOM   915  O O   . PHE A 1 121 ? 22.008  0.230   25.306  1.00 31.91  ? 121 PHE L O   1 
ATOM   916  C CB  . PHE A 1 121 ? 25.064  0.847   25.847  1.00 26.91  ? 121 PHE L CB  1 
ATOM   917  C CG  . PHE A 1 121 ? 26.513  0.418   25.894  1.00 35.74  ? 121 PHE L CG  1 
ATOM   918  C CD1 . PHE A 1 121 ? 27.066  -0.328  24.855  1.00 30.20  ? 121 PHE L CD1 1 
ATOM   919  C CD2 . PHE A 1 121 ? 27.319  0.752   26.984  1.00 33.99  ? 121 PHE L CD2 1 
ATOM   920  C CE1 . PHE A 1 121 ? 28.406  -0.742  24.903  1.00 33.39  ? 121 PHE L CE1 1 
ATOM   921  C CE2 . PHE A 1 121 ? 28.650  0.346   27.041  1.00 32.93  ? 121 PHE L CE2 1 
ATOM   922  C CZ  . PHE A 1 121 ? 29.196  -0.405  25.996  1.00 31.26  ? 121 PHE L CZ  1 
ATOM   923  N N   . ILE A 1 122 ? 22.201  0.957   27.427  1.00 26.76  ? 122 ILE L N   1 
ATOM   924  C CA  . ILE A 1 122 ? 20.870  1.532   27.436  1.00 24.02  ? 122 ILE L CA  1 
ATOM   925  C C   . ILE A 1 122 ? 20.932  2.985   27.856  1.00 25.34  ? 122 ILE L C   1 
ATOM   926  O O   . ILE A 1 122 ? 21.606  3.340   28.830  1.00 29.67  ? 122 ILE L O   1 
ATOM   927  C CB  . ILE A 1 122 ? 19.907  0.758   28.384  1.00 25.75  ? 122 ILE L CB  1 
ATOM   928  C CG1 . ILE A 1 122 ? 18.515  1.391   28.334  1.00 28.74  ? 122 ILE L CG1 1 
ATOM   929  C CG2 . ILE A 1 122 ? 20.442  0.780   29.814  1.00 29.93  ? 122 ILE L CG2 1 
ATOM   930  C CD1 . ILE A 1 122 ? 17.357  0.403   28.539  1.00 28.76  ? 122 ILE L CD1 1 
ATOM   931  N N   . PHE A 1 123 ? 20.221  3.831   27.116  1.00 26.34  ? 123 PHE L N   1 
ATOM   932  C CA  . PHE A 1 123 ? 20.174  5.249   27.434  1.00 30.93  ? 123 PHE L CA  1 
ATOM   933  C C   . PHE A 1 123 ? 18.744  5.734   27.684  1.00 36.27  ? 123 PHE L C   1 
ATOM   934  O O   . PHE A 1 123 ? 17.822  5.459   26.905  1.00 33.86  ? 123 PHE L O   1 
ATOM   935  C CB  . PHE A 1 123 ? 20.769  6.090   26.296  1.00 31.81  ? 123 PHE L CB  1 
ATOM   936  C CG  . PHE A 1 123 ? 22.117  5.631   25.841  1.00 32.48  ? 123 PHE L CG  1 
ATOM   937  C CD1 . PHE A 1 123 ? 22.240  4.608   24.900  1.00 30.10  ? 123 PHE L CD1 1 
ATOM   938  C CD2 . PHE A 1 123 ? 23.269  6.231   26.341  1.00 36.22  ? 123 PHE L CD2 1 
ATOM   939  C CE1 . PHE A 1 123 ? 23.495  4.189   24.464  1.00 34.87  ? 123 PHE L CE1 1 
ATOM   940  C CE2 . PHE A 1 123 ? 24.532  5.823   25.911  1.00 32.23  ? 123 PHE L CE2 1 
ATOM   941  C CZ  . PHE A 1 123 ? 24.645  4.798   24.970  1.00 33.75  ? 123 PHE L CZ  1 
ATOM   942  N N   . PRO A 1 124 ? 18.541  6.448   28.796  1.00 38.46  ? 124 PRO L N   1 
ATOM   943  C CA  . PRO A 1 124 ? 17.219  6.976   29.128  1.00 39.53  ? 124 PRO L CA  1 
ATOM   944  C C   . PRO A 1 124 ? 17.085  8.293   28.373  1.00 40.33  ? 124 PRO L C   1 
ATOM   945  O O   . PRO A 1 124 ? 18.070  8.811   27.844  1.00 34.54  ? 124 PRO L O   1 
ATOM   946  C CB  . PRO A 1 124 ? 17.282  7.187   30.641  1.00 40.31  ? 124 PRO L CB  1 
ATOM   947  C CG  . PRO A 1 124 ? 18.673  6.723   31.069  1.00 43.19  ? 124 PRO L CG  1 
ATOM   948  C CD  . PRO A 1 124 ? 19.519  6.762   29.841  1.00 39.52  ? 124 PRO L CD  1 
ATOM   949  N N   . PRO A 1 125 ? 15.872  8.856   28.315  1.00 41.27  ? 125 PRO L N   1 
ATOM   950  C CA  . PRO A 1 125 ? 15.757  10.124  27.587  1.00 40.31  ? 125 PRO L CA  1 
ATOM   951  C C   . PRO A 1 125 ? 16.464  11.227  28.361  1.00 40.33  ? 125 PRO L C   1 
ATOM   952  O O   . PRO A 1 125 ? 16.607  11.141  29.575  1.00 40.91  ? 125 PRO L O   1 
ATOM   953  C CB  . PRO A 1 125 ? 14.248  10.356  27.506  1.00 36.82  ? 125 PRO L CB  1 
ATOM   954  C CG  . PRO A 1 125 ? 13.692  9.597   28.671  1.00 36.56  ? 125 PRO L CG  1 
ATOM   955  C CD  . PRO A 1 125 ? 14.587  8.418   28.894  1.00 39.24  ? 125 PRO L CD  1 
ATOM   956  N N   . SER A 1 126 ? 16.906  12.263  27.662  1.00 39.56  ? 126 SER L N   1 
ATOM   957  C CA  . SER A 1 126 ? 17.573  13.387  28.313  1.00 39.00  ? 126 SER L CA  1 
ATOM   958  C C   . SER A 1 126 ? 16.519  14.357  28.856  1.00 39.93  ? 126 SER L C   1 
ATOM   959  O O   . SER A 1 126 ? 15.393  14.389  28.376  1.00 41.21  ? 126 SER L O   1 
ATOM   960  C CB  . SER A 1 126 ? 18.457  14.124  27.311  1.00 33.06  ? 126 SER L CB  1 
ATOM   961  O OG  . SER A 1 126 ? 17.667  14.694  26.279  1.00 22.73  ? 126 SER L OG  1 
ATOM   962  N N   . ASP A 1 127 ? 16.895  15.150  29.850  1.00 44.44  ? 127 ASP L N   1 
ATOM   963  C CA  . ASP A 1 127 ? 15.981  16.117  30.438  1.00 49.57  ? 127 ASP L CA  1 
ATOM   964  C C   . ASP A 1 127 ? 15.497  17.100  29.379  1.00 46.47  ? 127 ASP L C   1 
ATOM   965  O O   . ASP A 1 127 ? 14.330  17.486  29.360  1.00 48.57  ? 127 ASP L O   1 
ATOM   966  C CB  . ASP A 1 127 ? 16.681  16.885  31.563  1.00 55.88  ? 127 ASP L CB  1 
ATOM   967  C CG  . ASP A 1 127 ? 16.823  16.063  32.831  1.00 62.96  ? 127 ASP L CG  1 
ATOM   968  O OD1 . ASP A 1 127 ? 16.155  15.011  32.941  1.00 65.03  ? 127 ASP L OD1 1 
ATOM   969  O OD2 . ASP A 1 127 ? 17.603  16.468  33.718  1.00 65.86  ? 127 ASP L OD2 1 
ATOM   970  N N   . GLU A 1 128 ? 16.407  17.500  28.499  1.00 43.97  ? 128 GLU L N   1 
ATOM   971  C CA  . GLU A 1 128 ? 16.093  18.449  27.436  1.00 41.85  ? 128 GLU L CA  1 
ATOM   972  C C   . GLU A 1 128 ? 14.990  17.919  26.518  1.00 34.95  ? 128 GLU L C   1 
ATOM   973  O O   . GLU A 1 128 ? 14.116  18.673  26.093  1.00 32.23  ? 128 GLU L O   1 
ATOM   974  C CB  . GLU A 1 128 ? 17.355  18.752  26.625  1.00 47.70  ? 128 GLU L CB  1 
ATOM   975  C CG  . GLU A 1 128 ? 18.260  17.550  26.449  1.00 62.60  ? 128 GLU L CG  1 
ATOM   976  C CD  . GLU A 1 128 ? 19.543  17.648  27.256  1.00 68.63  ? 128 GLU L CD  1 
ATOM   977  O OE1 . GLU A 1 128 ? 20.504  18.282  26.767  1.00 68.25  ? 128 GLU L OE1 1 
ATOM   978  O OE2 . GLU A 1 128 ? 19.588  17.087  28.374  1.00 69.18  ? 128 GLU L OE2 1 
ATOM   979  N N   . GLN A 1 129 ? 15.036  16.624  26.217  1.00 29.87  ? 129 GLN L N   1 
ATOM   980  C CA  . GLN A 1 129 ? 14.018  16.023  25.368  1.00 31.18  ? 129 GLN L CA  1 
ATOM   981  C C   . GLN A 1 129 ? 12.689  15.940  26.108  1.00 33.48  ? 129 GLN L C   1 
ATOM   982  O O   . GLN A 1 129 ? 11.665  16.388  25.603  1.00 33.17  ? 129 GLN L O   1 
ATOM   983  C CB  . GLN A 1 129 ? 14.403  14.612  24.919  1.00 29.55  ? 129 GLN L CB  1 
ATOM   984  C CG  . GLN A 1 129 ? 13.411  14.075  23.887  1.00 25.80  ? 129 GLN L CG  1 
ATOM   985  C CD  . GLN A 1 129 ? 13.658  12.649  23.469  1.00 29.46  ? 129 GLN L CD  1 
ATOM   986  O OE1 . GLN A 1 129 ? 14.266  11.853  24.199  1.00 33.95  ? 129 GLN L OE1 1 
ATOM   987  N NE2 . GLN A 1 129 ? 13.180  12.306  22.283  1.00 25.27  ? 129 GLN L NE2 1 
ATOM   988  N N   . LEU A 1 130 ? 12.706  15.342  27.292  1.00 36.81  ? 130 LEU L N   1 
ATOM   989  C CA  . LEU A 1 130 ? 11.498  15.223  28.096  1.00 39.35  ? 130 LEU L CA  1 
ATOM   990  C C   . LEU A 1 130 ? 10.817  16.582  28.138  1.00 40.66  ? 130 LEU L C   1 
ATOM   991  O O   . LEU A 1 130 ? 9.601   16.695  27.956  1.00 43.67  ? 130 LEU L O   1 
ATOM   992  C CB  . LEU A 1 130 ? 11.851  14.769  29.514  1.00 36.42  ? 130 LEU L CB  1 
ATOM   993  C CG  . LEU A 1 130 ? 12.028  13.256  29.602  1.00 31.38  ? 130 LEU L CG  1 
ATOM   994  C CD1 . LEU A 1 130 ? 12.910  12.881  30.779  1.00 28.75  ? 130 LEU L CD1 1 
ATOM   995  C CD2 . LEU A 1 130 ? 10.664  12.627  29.703  1.00 39.66  ? 130 LEU L CD2 1 
ATOM   996  N N   . LYS A 1 131 ? 11.623  17.614  28.357  1.00 44.47  ? 131 LYS L N   1 
ATOM   997  C CA  . LYS A 1 131 ? 11.143  18.990  28.423  1.00 47.04  ? 131 LYS L CA  1 
ATOM   998  C C   . LYS A 1 131 ? 10.334  19.397  27.185  1.00 45.92  ? 131 LYS L C   1 
ATOM   999  O O   . LYS A 1 131 ? 9.678   20.443  27.180  1.00 44.02  ? 131 LYS L O   1 
ATOM   1000 C CB  . LYS A 1 131 ? 12.340  19.931  28.595  1.00 50.65  ? 131 LYS L CB  1 
ATOM   1001 C CG  . LYS A 1 131 ? 11.993  21.344  29.023  1.00 55.54  ? 131 LYS L CG  1 
ATOM   1002 C CD  . LYS A 1 131 ? 12.899  21.830  30.149  1.00 59.97  ? 131 LYS L CD  1 
ATOM   1003 C CE  . LYS A 1 131 ? 14.339  21.364  29.961  1.00 59.69  ? 131 LYS L CE  1 
ATOM   1004 N NZ  . LYS A 1 131 ? 15.159  22.378  29.243  1.00 61.78  ? 131 LYS L NZ  1 
ATOM   1005 N N   . SER A 1 132 ? 10.381  18.575  26.140  1.00 48.05  ? 132 SER L N   1 
ATOM   1006 C CA  . SER A 1 132 ? 9.650   18.866  24.907  1.00 47.45  ? 132 SER L CA  1 
ATOM   1007 C C   . SER A 1 132 ? 8.479   17.916  24.650  1.00 47.21  ? 132 SER L C   1 
ATOM   1008 O O   . SER A 1 132 ? 7.969   17.837  23.532  1.00 51.58  ? 132 SER L O   1 
ATOM   1009 C CB  . SER A 1 132 ? 10.609  18.850  23.708  1.00 48.40  ? 132 SER L CB  1 
ATOM   1010 O OG  . SER A 1 132 ? 11.061  17.535  23.419  1.00 53.73  ? 132 SER L OG  1 
ATOM   1011 N N   . GLY A 1 133 ? 8.063   17.182  25.675  1.00 45.71  ? 133 GLY L N   1 
ATOM   1012 C CA  . GLY A 1 133 ? 6.927   16.289  25.517  1.00 44.12  ? 133 GLY L CA  1 
ATOM   1013 C C   . GLY A 1 133 ? 7.181   14.880  25.022  1.00 44.17  ? 133 GLY L C   1 
ATOM   1014 O O   . GLY A 1 133 ? 6.258   14.060  24.997  1.00 41.47  ? 133 GLY L O   1 
ATOM   1015 N N   . THR A 1 134 ? 8.420   14.587  24.633  1.00 43.20  ? 134 THR L N   1 
ATOM   1016 C CA  . THR A 1 134 ? 8.759   13.256  24.141  1.00 41.48  ? 134 THR L CA  1 
ATOM   1017 C C   . THR A 1 134 ? 9.773   12.567  25.030  1.00 38.37  ? 134 THR L C   1 
ATOM   1018 O O   . THR A 1 134 ? 10.411  13.198  25.870  1.00 41.58  ? 134 THR L O   1 
ATOM   1019 C CB  . THR A 1 134 ? 9.356   13.312  22.729  1.00 46.88  ? 134 THR L CB  1 
ATOM   1020 O OG1 . THR A 1 134 ? 9.632   14.673  22.375  1.00 48.88  ? 134 THR L OG1 1 
ATOM   1021 C CG2 . THR A 1 134 ? 8.394   12.700  21.735  1.00 48.71  ? 134 THR L CG2 1 
ATOM   1022 N N   . ALA A 1 135 ? 9.916   11.262  24.841  1.00 30.30  ? 135 ALA L N   1 
ATOM   1023 C CA  . ALA A 1 135 ? 10.877  10.490  25.610  1.00 33.03  ? 135 ALA L CA  1 
ATOM   1024 C C   . ALA A 1 135 ? 11.381  9.340   24.758  1.00 33.81  ? 135 ALA L C   1 
ATOM   1025 O O   . ALA A 1 135 ? 10.630  8.403   24.463  1.00 27.21  ? 135 ALA L O   1 
ATOM   1026 C CB  . ALA A 1 135 ? 10.243  9.950   26.889  1.00 33.78  ? 135 ALA L CB  1 
ATOM   1027 N N   . SER A 1 136 ? 12.643  9.425   24.331  1.00 28.22  ? 136 SER L N   1 
ATOM   1028 C CA  . SER A 1 136 ? 13.206  8.347   23.546  1.00 20.94  ? 136 SER L CA  1 
ATOM   1029 C C   . SER A 1 136 ? 14.188  7.585   24.416  1.00 23.10  ? 136 SER L C   1 
ATOM   1030 O O   . SER A 1 136 ? 15.048  8.164   25.088  1.00 23.34  ? 136 SER L O   1 
ATOM   1031 C CB  . SER A 1 136 ? 13.926  8.873   22.298  1.00 24.64  ? 136 SER L CB  1 
ATOM   1032 O OG  . SER A 1 136 ? 13.037  9.539   21.420  1.00 27.03  ? 136 SER L OG  1 
ATOM   1033 N N   . VAL A 1 137 ? 14.039  6.274   24.405  1.00 20.12  ? 137 VAL L N   1 
ATOM   1034 C CA  . VAL A 1 137 ? 14.911  5.392   25.143  1.00 27.36  ? 137 VAL L CA  1 
ATOM   1035 C C   . VAL A 1 137 ? 15.658  4.624   24.051  1.00 26.51  ? 137 VAL L C   1 
ATOM   1036 O O   . VAL A 1 137 ? 15.034  4.045   23.155  1.00 25.86  ? 137 VAL L O   1 
ATOM   1037 C CB  . VAL A 1 137 ? 14.091  4.425   26.024  1.00 28.06  ? 137 VAL L CB  1 
ATOM   1038 C CG1 . VAL A 1 137 ? 14.987  3.720   27.003  1.00 23.75  ? 137 VAL L CG1 1 
ATOM   1039 C CG2 . VAL A 1 137 ? 13.031  5.217   26.794  1.00 23.78  ? 137 VAL L CG2 1 
ATOM   1040 N N   . VAL A 1 138 ? 16.988  4.636   24.128  1.00 28.36  ? 138 VAL L N   1 
ATOM   1041 C CA  . VAL A 1 138 ? 17.841  3.970   23.133  1.00 26.25  ? 138 VAL L CA  1 
ATOM   1042 C C   . VAL A 1 138 ? 18.606  2.776   23.687  1.00 24.17  ? 138 VAL L C   1 
ATOM   1043 O O   . VAL A 1 138 ? 19.238  2.861   24.746  1.00 27.35  ? 138 VAL L O   1 
ATOM   1044 C CB  . VAL A 1 138 ? 18.875  4.954   22.551  1.00 23.73  ? 138 VAL L CB  1 
ATOM   1045 C CG1 . VAL A 1 138 ? 19.762  4.244   21.533  1.00 22.02  ? 138 VAL L CG1 1 
ATOM   1046 C CG2 . VAL A 1 138 ? 18.171  6.155   21.923  1.00 20.86  ? 138 VAL L CG2 1 
ATOM   1047 N N   . CYS A 1 139 ? 18.557  1.669   22.958  1.00 23.04  ? 139 CYS L N   1 
ATOM   1048 C CA  . CYS A 1 139 ? 19.268  0.465   23.347  1.00 24.97  ? 139 CYS L CA  1 
ATOM   1049 C C   . CYS A 1 139 ? 20.310  0.206   22.249  1.00 27.08  ? 139 CYS L C   1 
ATOM   1050 O O   . CYS A 1 139 ? 19.969  0.095   21.070  1.00 24.56  ? 139 CYS L O   1 
ATOM   1051 C CB  . CYS A 1 139 ? 18.307  -0.720  23.455  1.00 27.55  ? 139 CYS L CB  1 
ATOM   1052 S SG  . CYS A 1 139 ? 19.043  -2.271  24.069  1.00 39.50  ? 139 CYS L SG  1 
ATOM   1053 N N   . LEU A 1 140 ? 21.577  0.132   22.638  1.00 25.26  ? 140 LEU L N   1 
ATOM   1054 C CA  . LEU A 1 140 ? 22.666  -0.088  21.672  1.00 24.34  ? 140 LEU L CA  1 
ATOM   1055 C C   . LEU A 1 140 ? 23.290  -1.481  21.762  1.00 22.72  ? 140 LEU L C   1 
ATOM   1056 O O   . LEU A 1 140 ? 23.645  -1.935  22.847  1.00 26.08  ? 140 LEU L O   1 
ATOM   1057 C CB  . LEU A 1 140 ? 23.763  0.967   21.883  1.00 25.44  ? 140 LEU L CB  1 
ATOM   1058 C CG  . LEU A 1 140 ? 25.140  0.651   21.292  1.00 19.35  ? 140 LEU L CG  1 
ATOM   1059 C CD1 . LEU A 1 140 ? 25.080  0.825   19.758  1.00 19.08  ? 140 LEU L CD1 1 
ATOM   1060 C CD2 . LEU A 1 140 ? 26.165  1.595   21.888  1.00 24.50  ? 140 LEU L CD2 1 
ATOM   1061 N N   . LEU A 1 141 ? 23.391  -2.164  20.625  1.00 24.73  ? 141 LEU L N   1 
ATOM   1062 C CA  . LEU A 1 141 ? 24.016  -3.485  20.563  1.00 25.35  ? 141 LEU L CA  1 
ATOM   1063 C C   . LEU A 1 141 ? 25.311  -3.279  19.744  1.00 26.38  ? 141 LEU L C   1 
ATOM   1064 O O   . LEU A 1 141 ? 25.286  -3.128  18.513  1.00 22.59  ? 141 LEU L O   1 
ATOM   1065 C CB  . LEU A 1 141 ? 23.088  -4.477  19.871  1.00 22.73  ? 141 LEU L CB  1 
ATOM   1066 C CG  . LEU A 1 141 ? 22.022  -5.165  20.736  1.00 30.81  ? 141 LEU L CG  1 
ATOM   1067 C CD1 . LEU A 1 141 ? 21.047  -4.134  21.348  1.00 18.55  ? 141 LEU L CD1 1 
ATOM   1068 C CD2 . LEU A 1 141 ? 21.276  -6.158  19.874  1.00 28.26  ? 141 LEU L CD2 1 
ATOM   1069 N N   . ASN A 1 142 ? 26.445  -3.277  20.431  1.00 28.99  ? 142 ASN L N   1 
ATOM   1070 C CA  . ASN A 1 142 ? 27.725  -3.003  19.771  1.00 25.13  ? 142 ASN L CA  1 
ATOM   1071 C C   . ASN A 1 142 ? 28.588  -4.141  19.249  1.00 25.72  ? 142 ASN L C   1 
ATOM   1072 O O   . ASN A 1 142 ? 28.855  -5.125  19.943  1.00 22.97  ? 142 ASN L O   1 
ATOM   1073 C CB  . ASN A 1 142 ? 28.576  -2.146  20.691  1.00 29.60  ? 142 ASN L CB  1 
ATOM   1074 C CG  . ASN A 1 142 ? 29.293  -1.048  19.954  1.00 31.02  ? 142 ASN L CG  1 
ATOM   1075 O OD1 . ASN A 1 142 ? 28.683  -0.309  19.187  1.00 38.34  ? 142 ASN L OD1 1 
ATOM   1076 N ND2 . ASN A 1 142 ? 30.595  -0.934  20.178  1.00 35.42  ? 142 ASN L ND2 1 
ATOM   1077 N N   . ASN A 1 143 ? 29.030  -3.973  18.006  1.00 29.61  ? 143 ASN L N   1 
ATOM   1078 C CA  . ASN A 1 143 ? 29.923  -4.907  17.328  1.00 32.08  ? 143 ASN L CA  1 
ATOM   1079 C C   . ASN A 1 143 ? 29.667  -6.390  17.570  1.00 33.82  ? 143 ASN L C   1 
ATOM   1080 O O   . ASN A 1 143 ? 30.451  -7.060  18.255  1.00 35.83  ? 143 ASN L O   1 
ATOM   1081 C CB  . ASN A 1 143 ? 31.369  -4.572  17.710  1.00 36.32  ? 143 ASN L CB  1 
ATOM   1082 C CG  . ASN A 1 143 ? 31.661  -3.085  17.627  1.00 33.50  ? 143 ASN L CG  1 
ATOM   1083 O OD1 . ASN A 1 143 ? 32.521  -2.568  18.336  1.00 47.18  ? 143 ASN L OD1 1 
ATOM   1084 N ND2 . ASN A 1 143 ? 30.947  -2.394  16.764  1.00 38.44  ? 143 ASN L ND2 1 
ATOM   1085 N N   . PHE A 1 144 ? 28.595  -6.912  16.985  1.00 32.01  ? 144 PHE L N   1 
ATOM   1086 C CA  . PHE A 1 144 ? 28.255  -8.321  17.161  1.00 30.60  ? 144 PHE L CA  1 
ATOM   1087 C C   . PHE A 1 144 ? 28.222  -9.071  15.840  1.00 27.59  ? 144 PHE L C   1 
ATOM   1088 O O   . PHE A 1 144 ? 28.236  -8.469  14.768  1.00 27.65  ? 144 PHE L O   1 
ATOM   1089 C CB  . PHE A 1 144 ? 26.898  -8.458  17.867  1.00 32.80  ? 144 PHE L CB  1 
ATOM   1090 C CG  . PHE A 1 144 ? 25.773  -7.813  17.126  1.00 26.23  ? 144 PHE L CG  1 
ATOM   1091 C CD1 . PHE A 1 144 ? 25.104  -8.504  16.123  1.00 29.49  ? 144 PHE L CD1 1 
ATOM   1092 C CD2 . PHE A 1 144 ? 25.407  -6.503  17.395  1.00 27.70  ? 144 PHE L CD2 1 
ATOM   1093 C CE1 . PHE A 1 144 ? 24.089  -7.899  15.392  1.00 24.33  ? 144 PHE L CE1 1 
ATOM   1094 C CE2 . PHE A 1 144 ? 24.389  -5.892  16.665  1.00 23.04  ? 144 PHE L CE2 1 
ATOM   1095 C CZ  . PHE A 1 144 ? 23.734  -6.599  15.661  1.00 23.39  ? 144 PHE L CZ  1 
ATOM   1096 N N   . TYR A 1 145 ? 28.190  -10.398 15.925  1.00 25.87  ? 145 TYR L N   1 
ATOM   1097 C CA  . TYR A 1 145 ? 28.165  -11.227 14.734  1.00 29.22  ? 145 TYR L CA  1 
ATOM   1098 C C   . TYR A 1 145 ? 27.708  -12.629 15.136  1.00 29.38  ? 145 TYR L C   1 
ATOM   1099 O O   . TYR A 1 145 ? 28.128  -13.156 16.166  1.00 29.22  ? 145 TYR L O   1 
ATOM   1100 C CB  . TYR A 1 145 ? 29.569  -11.277 14.100  1.00 27.70  ? 145 TYR L CB  1 
ATOM   1101 C CG  . TYR A 1 145 ? 29.595  -12.026 12.793  1.00 26.79  ? 145 TYR L CG  1 
ATOM   1102 C CD1 . TYR A 1 145 ? 29.654  -13.417 12.771  1.00 25.67  ? 145 TYR L CD1 1 
ATOM   1103 C CD2 . TYR A 1 145 ? 29.442  -11.354 11.579  1.00 23.69  ? 145 TYR L CD2 1 
ATOM   1104 C CE1 . TYR A 1 145 ? 29.545  -14.119 11.573  1.00 24.68  ? 145 TYR L CE1 1 
ATOM   1105 C CE2 . TYR A 1 145 ? 29.333  -12.059 10.368  1.00 20.24  ? 145 TYR L CE2 1 
ATOM   1106 C CZ  . TYR A 1 145 ? 29.380  -13.428 10.378  1.00 22.82  ? 145 TYR L CZ  1 
ATOM   1107 O OH  . TYR A 1 145 ? 29.235  -14.124 9.195   1.00 32.95  ? 145 TYR L OH  1 
ATOM   1108 N N   . PRO A 1 146 ? 26.828  -13.257 14.335  1.00 30.31  ? 146 PRO L N   1 
ATOM   1109 C CA  . PRO A 1 146 ? 26.214  -12.786 13.091  1.00 31.29  ? 146 PRO L CA  1 
ATOM   1110 C C   . PRO A 1 146 ? 25.253  -11.626 13.283  1.00 31.14  ? 146 PRO L C   1 
ATOM   1111 O O   . PRO A 1 146 ? 25.073  -11.141 14.393  1.00 33.28  ? 146 PRO L O   1 
ATOM   1112 C CB  . PRO A 1 146 ? 25.527  -14.025 12.530  1.00 33.15  ? 146 PRO L CB  1 
ATOM   1113 C CG  . PRO A 1 146 ? 25.331  -14.929 13.682  1.00 27.86  ? 146 PRO L CG  1 
ATOM   1114 C CD  . PRO A 1 146 ? 26.392  -14.618 14.692  1.00 32.13  ? 146 PRO L CD  1 
ATOM   1115 N N   . ARG A 1 147 ? 24.634  -11.179 12.199  1.00 34.49  ? 147 ARG L N   1 
ATOM   1116 C CA  . ARG A 1 147 ? 23.719  -10.044 12.279  1.00 36.57  ? 147 ARG L CA  1 
ATOM   1117 C C   . ARG A 1 147 ? 22.469  -10.283 13.119  1.00 36.98  ? 147 ARG L C   1 
ATOM   1118 O O   . ARG A 1 147 ? 21.928  -9.350  13.712  1.00 35.55  ? 147 ARG L O   1 
ATOM   1119 C CB  . ARG A 1 147 ? 23.297  -9.599  10.882  1.00 38.20  ? 147 ARG L CB  1 
ATOM   1120 C CG  . ARG A 1 147 ? 22.212  -8.525  10.904  1.00 49.00  ? 147 ARG L CG  1 
ATOM   1121 C CD  . ARG A 1 147 ? 22.541  -7.374  9.982   1.00 55.35  ? 147 ARG L CD  1 
ATOM   1122 N NE  . ARG A 1 147 ? 22.211  -7.688  8.598   1.00 65.76  ? 147 ARG L NE  1 
ATOM   1123 C CZ  . ARG A 1 147 ? 21.661  -6.827  7.749   1.00 73.33  ? 147 ARG L CZ  1 
ATOM   1124 N NH1 . ARG A 1 147 ? 21.377  -5.594  8.145   1.00 75.27  ? 147 ARG L NH1 1 
ATOM   1125 N NH2 . ARG A 1 147 ? 21.390  -7.204  6.505   1.00 81.20  ? 147 ARG L NH2 1 
ATOM   1126 N N   . GLU A 1 148 ? 22.022  -11.532 13.174  1.00 39.04  ? 148 GLU L N   1 
ATOM   1127 C CA  . GLU A 1 148 ? 20.822  -11.875 13.915  1.00 41.19  ? 148 GLU L CA  1 
ATOM   1128 C C   . GLU A 1 148 ? 20.941  -11.555 15.390  1.00 39.96  ? 148 GLU L C   1 
ATOM   1129 O O   . GLU A 1 148 ? 21.874  -11.983 16.069  1.00 34.81  ? 148 GLU L O   1 
ATOM   1130 C CB  . GLU A 1 148 ? 20.493  -13.351 13.724  1.00 47.34  ? 148 GLU L CB  1 
ATOM   1131 C CG  . GLU A 1 148 ? 20.411  -13.772 12.263  1.00 66.42  ? 148 GLU L CG  1 
ATOM   1132 C CD  . GLU A 1 148 ? 21.701  -14.402 11.760  1.00 75.29  ? 148 GLU L CD  1 
ATOM   1133 O OE1 . GLU A 1 148 ? 22.224  -15.316 12.440  1.00 78.69  ? 148 GLU L OE1 1 
ATOM   1134 O OE2 . GLU A 1 148 ? 22.191  -13.983 10.686  1.00 78.42  ? 148 GLU L OE2 1 
ATOM   1135 N N   . ALA A 1 149 ? 19.981  -10.778 15.871  1.00 35.92  ? 149 ALA L N   1 
ATOM   1136 C CA  . ALA A 1 149 ? 19.920  -10.379 17.262  1.00 40.76  ? 149 ALA L CA  1 
ATOM   1137 C C   . ALA A 1 149 ? 18.449  -10.185 17.574  1.00 42.49  ? 149 ALA L C   1 
ATOM   1138 O O   . ALA A 1 149 ? 17.616  -10.085 16.668  1.00 42.21  ? 149 ALA L O   1 
ATOM   1139 C CB  . ALA A 1 149 ? 20.683  -9.073  17.484  1.00 38.60  ? 149 ALA L CB  1 
ATOM   1140 N N   . LYS A 1 150 ? 18.129  -10.140 18.858  1.00 43.09  ? 150 LYS L N   1 
ATOM   1141 C CA  . LYS A 1 150 ? 16.753  -9.951  19.276  1.00 42.27  ? 150 LYS L CA  1 
ATOM   1142 C C   . LYS A 1 150 ? 16.728  -8.996  20.449  1.00 42.90  ? 150 LYS L C   1 
ATOM   1143 O O   . LYS A 1 150 ? 17.305  -9.277  21.501  1.00 45.17  ? 150 LYS L O   1 
ATOM   1144 C CB  . LYS A 1 150 ? 16.135  -11.291 19.673  1.00 42.91  ? 150 LYS L CB  1 
ATOM   1145 C CG  . LYS A 1 150 ? 14.679  -11.426 19.263  1.00 50.50  ? 150 LYS L CG  1 
ATOM   1146 C CD  . LYS A 1 150 ? 13.761  -10.989 20.384  1.00 56.64  ? 150 LYS L CD  1 
ATOM   1147 C CE  . LYS A 1 150 ? 13.687  -12.049 21.476  1.00 64.41  ? 150 LYS L CE  1 
ATOM   1148 N NZ  . LYS A 1 150 ? 13.252  -13.363 20.931  1.00 68.49  ? 150 LYS L NZ  1 
ATOM   1149 N N   . VAL A 1 151 ? 16.076  -7.857  20.260  1.00 43.96  ? 151 VAL L N   1 
ATOM   1150 C CA  . VAL A 1 151 ? 15.985  -6.863  21.318  1.00 44.62  ? 151 VAL L CA  1 
ATOM   1151 C C   . VAL A 1 151 ? 14.534  -6.657  21.725  1.00 46.35  ? 151 VAL L C   1 
ATOM   1152 O O   . VAL A 1 151 ? 13.743  -6.075  20.983  1.00 47.50  ? 151 VAL L O   1 
ATOM   1153 C CB  . VAL A 1 151 ? 16.572  -5.518  20.866  1.00 47.29  ? 151 VAL L CB  1 
ATOM   1154 C CG1 . VAL A 1 151 ? 16.739  -4.590  22.065  1.00 50.24  ? 151 VAL L CG1 1 
ATOM   1155 C CG2 . VAL A 1 151 ? 17.911  -5.750  20.180  1.00 53.13  ? 151 VAL L CG2 1 
ATOM   1156 N N   . GLN A 1 152 ? 14.192  -7.143  22.910  1.00 44.72  ? 152 GLN L N   1 
ATOM   1157 C CA  . GLN A 1 152 ? 12.837  -7.024  23.431  1.00 43.74  ? 152 GLN L CA  1 
ATOM   1158 C C   . GLN A 1 152 ? 12.793  -5.960  24.515  1.00 40.88  ? 152 GLN L C   1 
ATOM   1159 O O   . GLN A 1 152 ? 13.569  -6.005  25.472  1.00 35.78  ? 152 GLN L O   1 
ATOM   1160 C CB  . GLN A 1 152 ? 12.379  -8.360  24.017  1.00 42.94  ? 152 GLN L CB  1 
ATOM   1161 C CG  . GLN A 1 152 ? 12.322  -9.494  23.018  1.00 51.35  ? 152 GLN L CG  1 
ATOM   1162 C CD  . GLN A 1 152 ? 10.915  -10.035 22.823  1.00 57.39  ? 152 GLN L CD  1 
ATOM   1163 O OE1 . GLN A 1 152 ? 10.154  -9.531  21.997  1.00 59.82  ? 152 GLN L OE1 1 
ATOM   1164 N NE2 . GLN A 1 152 ? 10.566  -11.071 23.581  1.00 56.48  ? 152 GLN L NE2 1 
ATOM   1165 N N   . TRP A 1 153 ? 11.892  -4.996  24.363  1.00 38.81  ? 153 TRP L N   1 
ATOM   1166 C CA  . TRP A 1 153 ? 11.759  -3.942  25.355  1.00 38.69  ? 153 TRP L CA  1 
ATOM   1167 C C   . TRP A 1 153 ? 10.738  -4.356  26.412  1.00 37.66  ? 153 TRP L C   1 
ATOM   1168 O O   . TRP A 1 153 ? 9.827   -5.141  26.144  1.00 38.75  ? 153 TRP L O   1 
ATOM   1169 C CB  . TRP A 1 153 ? 11.312  -2.639  24.699  1.00 37.48  ? 153 TRP L CB  1 
ATOM   1170 C CG  . TRP A 1 153 ? 12.400  -1.904  23.967  1.00 35.61  ? 153 TRP L CG  1 
ATOM   1171 C CD1 . TRP A 1 153 ? 12.623  -1.908  22.628  1.00 29.97  ? 153 TRP L CD1 1 
ATOM   1172 C CD2 . TRP A 1 153 ? 13.355  -0.989  24.529  1.00 32.18  ? 153 TRP L CD2 1 
ATOM   1173 N NE1 . TRP A 1 153 ? 13.643  -1.057  22.308  1.00 30.57  ? 153 TRP L NE1 1 
ATOM   1174 C CE2 . TRP A 1 153 ? 14.115  -0.475  23.455  1.00 33.80  ? 153 TRP L CE2 1 
ATOM   1175 C CE3 . TRP A 1 153 ? 13.638  -0.556  25.831  1.00 32.10  ? 153 TRP L CE3 1 
ATOM   1176 C CZ2 . TRP A 1 153 ? 15.146  0.459   23.639  1.00 29.48  ? 153 TRP L CZ2 1 
ATOM   1177 C CZ3 . TRP A 1 153 ? 14.671  0.384   26.022  1.00 32.05  ? 153 TRP L CZ3 1 
ATOM   1178 C CH2 . TRP A 1 153 ? 15.407  0.875   24.928  1.00 32.98  ? 153 TRP L CH2 1 
ATOM   1179 N N   . LYS A 1 154 ? 10.908  -3.826  27.617  1.00 39.78  ? 154 LYS L N   1 
ATOM   1180 C CA  . LYS A 1 154 ? 10.018  -4.119  28.731  1.00 42.06  ? 154 LYS L CA  1 
ATOM   1181 C C   . LYS A 1 154 ? 9.882   -2.872  29.591  1.00 43.13  ? 154 LYS L C   1 
ATOM   1182 O O   . LYS A 1 154 ? 10.889  -2.286  29.996  1.00 43.02  ? 154 LYS L O   1 
ATOM   1183 C CB  . LYS A 1 154 ? 10.579  -5.258  29.586  1.00 41.08  ? 154 LYS L CB  1 
ATOM   1184 C CG  . LYS A 1 154 ? 10.330  -6.647  29.024  1.00 44.18  ? 154 LYS L CG  1 
ATOM   1185 C CD  . LYS A 1 154 ? 10.400  -7.703  30.114  1.00 46.17  ? 154 LYS L CD  1 
ATOM   1186 C CE  . LYS A 1 154 ? 11.723  -8.434  30.079  1.00 51.19  ? 154 LYS L CE  1 
ATOM   1187 N NZ  . LYS A 1 154 ? 11.894  -9.346  31.243  1.00 58.51  ? 154 LYS L NZ  1 
ATOM   1188 N N   . VAL A 1 155 ? 8.642   -2.457  29.846  1.00 43.15  ? 155 VAL L N   1 
ATOM   1189 C CA  . VAL A 1 155 ? 8.370   -1.291  30.685  1.00 41.78  ? 155 VAL L CA  1 
ATOM   1190 C C   . VAL A 1 155 ? 7.658   -1.842  31.920  1.00 43.72  ? 155 VAL L C   1 
ATOM   1191 O O   . VAL A 1 155 ? 6.512   -2.272  31.838  1.00 45.99  ? 155 VAL L O   1 
ATOM   1192 C CB  . VAL A 1 155 ? 7.467   -0.265  29.952  1.00 38.66  ? 155 VAL L CB  1 
ATOM   1193 C CG1 . VAL A 1 155 ? 7.235   0.951   30.831  1.00 36.61  ? 155 VAL L CG1 1 
ATOM   1194 C CG2 . VAL A 1 155 ? 8.137   0.183   28.653  1.00 38.04  ? 155 VAL L CG2 1 
ATOM   1195 N N   . ASP A 1 156 ? 8.351   -1.843  33.056  1.00 43.06  ? 156 ASP L N   1 
ATOM   1196 C CA  . ASP A 1 156 ? 7.807   -2.378  34.301  1.00 40.46  ? 156 ASP L CA  1 
ATOM   1197 C C   . ASP A 1 156 ? 7.404   -3.823  34.044  1.00 40.19  ? 156 ASP L C   1 
ATOM   1198 O O   . ASP A 1 156 ? 6.300   -4.245  34.373  1.00 41.55  ? 156 ASP L O   1 
ATOM   1199 C CB  . ASP A 1 156 ? 6.595   -1.565  34.768  1.00 40.84  ? 156 ASP L CB  1 
ATOM   1200 C CG  . ASP A 1 156 ? 6.991   -0.253  35.427  1.00 42.63  ? 156 ASP L CG  1 
ATOM   1201 O OD1 . ASP A 1 156 ? 8.114   -0.168  35.972  1.00 42.75  ? 156 ASP L OD1 1 
ATOM   1202 O OD2 . ASP A 1 156 ? 6.180   0.697   35.399  1.00 44.10  ? 156 ASP L OD2 1 
ATOM   1203 N N   . ASN A 1 157 ? 8.325   -4.557  33.434  1.00 37.14  ? 157 ASN L N   1 
ATOM   1204 C CA  . ASN A 1 157 ? 8.169   -5.964  33.088  1.00 37.82  ? 157 ASN L CA  1 
ATOM   1205 C C   . ASN A 1 157 ? 7.166   -6.300  31.991  1.00 39.91  ? 157 ASN L C   1 
ATOM   1206 O O   . ASN A 1 157 ? 7.087   -7.449  31.552  1.00 40.94  ? 157 ASN L O   1 
ATOM   1207 C CB  . ASN A 1 157 ? 7.875   -6.785  34.334  1.00 44.76  ? 157 ASN L CB  1 
ATOM   1208 C CG  . ASN A 1 157 ? 8.907   -7.858  34.560  1.00 47.58  ? 157 ASN L CG  1 
ATOM   1209 O OD1 . ASN A 1 157 ? 8.958   -8.849  33.834  1.00 52.92  ? 157 ASN L OD1 1 
ATOM   1210 N ND2 . ASN A 1 157 ? 9.750   -7.662  35.561  1.00 57.91  ? 157 ASN L ND2 1 
ATOM   1211 N N   . ALA A 1 158 ? 6.416   -5.302  31.533  1.00 39.10  ? 158 ALA L N   1 
ATOM   1212 C CA  . ALA A 1 158 ? 5.446   -5.524  30.473  1.00 36.36  ? 158 ALA L CA  1 
ATOM   1213 C C   . ALA A 1 158 ? 6.153   -5.410  29.133  1.00 35.97  ? 158 ALA L C   1 
ATOM   1214 O O   . ALA A 1 158 ? 6.730   -4.363  28.817  1.00 32.74  ? 158 ALA L O   1 
ATOM   1215 C CB  . ALA A 1 158 ? 4.325   -4.497  30.554  1.00 36.75  ? 158 ALA L CB  1 
ATOM   1216 N N   . LEU A 1 159 ? 6.094   -6.489  28.357  1.00 36.42  ? 159 LEU L N   1 
ATOM   1217 C CA  . LEU A 1 159 ? 6.716   -6.550  27.044  1.00 40.87  ? 159 LEU L CA  1 
ATOM   1218 C C   . LEU A 1 159 ? 6.094   -5.549  26.087  1.00 38.49  ? 159 LEU L C   1 
ATOM   1219 O O   . LEU A 1 159 ? 4.875   -5.501  25.933  1.00 40.38  ? 159 LEU L O   1 
ATOM   1220 C CB  . LEU A 1 159 ? 6.594   -7.961  26.468  1.00 45.20  ? 159 LEU L CB  1 
ATOM   1221 C CG  . LEU A 1 159 ? 7.039   -8.122  25.008  1.00 55.77  ? 159 LEU L CG  1 
ATOM   1222 C CD1 . LEU A 1 159 ? 8.484   -7.623  24.834  1.00 60.26  ? 159 LEU L CD1 1 
ATOM   1223 C CD2 . LEU A 1 159 ? 6.924   -9.586  24.602  1.00 60.08  ? 159 LEU L CD2 1 
ATOM   1224 N N   . GLN A 1 160 ? 6.944   -4.754  25.443  1.00 34.91  ? 160 GLN L N   1 
ATOM   1225 C CA  . GLN A 1 160 ? 6.497   -3.744  24.499  1.00 32.63  ? 160 GLN L CA  1 
ATOM   1226 C C   . GLN A 1 160 ? 6.424   -4.293  23.088  1.00 34.11  ? 160 GLN L C   1 
ATOM   1227 O O   . GLN A 1 160 ? 7.064   -5.299  22.749  1.00 36.02  ? 160 GLN L O   1 
ATOM   1228 C CB  . GLN A 1 160 ? 7.439   -2.548  24.516  1.00 34.34  ? 160 GLN L CB  1 
ATOM   1229 C CG  . GLN A 1 160 ? 7.537   -1.855  25.845  1.00 35.49  ? 160 GLN L CG  1 
ATOM   1230 C CD  . GLN A 1 160 ? 6.200   -1.364  26.343  1.00 38.02  ? 160 GLN L CD  1 
ATOM   1231 O OE1 . GLN A 1 160 ? 5.749   -0.278  25.981  1.00 32.67  ? 160 GLN L OE1 1 
ATOM   1232 N NE2 . GLN A 1 160 ? 5.560   -2.163  27.190  1.00 40.06  ? 160 GLN L NE2 1 
ATOM   1233 N N   . SER A 1 161 ? 5.623   -3.638  22.262  1.00 31.93  ? 161 SER L N   1 
ATOM   1234 C CA  . SER A 1 161 ? 5.485   -4.053  20.881  1.00 34.88  ? 161 SER L CA  1 
ATOM   1235 C C   . SER A 1 161 ? 4.922   -2.908  20.062  1.00 36.56  ? 161 SER L C   1 
ATOM   1236 O O   . SER A 1 161 ? 4.069   -2.152  20.535  1.00 37.99  ? 161 SER L O   1 
ATOM   1237 C CB  . SER A 1 161 ? 4.582   -5.293  20.785  1.00 37.33  ? 161 SER L CB  1 
ATOM   1238 O OG  . SER A 1 161 ? 3.364   -5.011  20.120  1.00 33.82  ? 161 SER L OG  1 
ATOM   1239 N N   . GLY A 1 162 ? 5.436   -2.763  18.846  1.00 36.11  ? 162 GLY L N   1 
ATOM   1240 C CA  . GLY A 1 162 ? 4.968   -1.715  17.964  1.00 30.49  ? 162 GLY L CA  1 
ATOM   1241 C C   . GLY A 1 162 ? 5.386   -0.298  18.273  1.00 29.07  ? 162 GLY L C   1 
ATOM   1242 O O   . GLY A 1 162 ? 5.118   0.593   17.470  1.00 32.84  ? 162 GLY L O   1 
ATOM   1243 N N   . ASN A 1 163 ? 6.015   -0.050  19.421  1.00 27.18  ? 163 ASN L N   1 
ATOM   1244 C CA  . ASN A 1 163 ? 6.428   1.319   19.720  1.00 27.49  ? 163 ASN L CA  1 
ATOM   1245 C C   . ASN A 1 163 ? 7.951   1.533   19.661  1.00 27.04  ? 163 ASN L C   1 
ATOM   1246 O O   . ASN A 1 163 ? 8.488   2.448   20.284  1.00 22.96  ? 163 ASN L O   1 
ATOM   1247 C CB  . ASN A 1 163 ? 5.888   1.768   21.083  1.00 25.91  ? 163 ASN L CB  1 
ATOM   1248 C CG  . ASN A 1 163 ? 6.299   0.851   22.205  1.00 31.72  ? 163 ASN L CG  1 
ATOM   1249 O OD1 . ASN A 1 163 ? 6.780   -0.256  21.974  1.00 39.11  ? 163 ASN L OD1 1 
ATOM   1250 N ND2 . ASN A 1 163 ? 6.107   1.308   23.441  1.00 34.78  ? 163 ASN L ND2 1 
ATOM   1251 N N   . SER A 1 164 ? 8.643   0.705   18.896  1.00 29.56  ? 164 SER L N   1 
ATOM   1252 C CA  . SER A 1 164 ? 10.087  0.869   18.765  1.00 29.98  ? 164 SER L CA  1 
ATOM   1253 C C   . SER A 1 164 ? 10.587  0.681   17.322  1.00 31.29  ? 164 SER L C   1 
ATOM   1254 O O   . SER A 1 164 ? 9.991   -0.048  16.534  1.00 28.24  ? 164 SER L O   1 
ATOM   1255 C CB  . SER A 1 164 ? 10.812  -0.083  19.724  1.00 27.74  ? 164 SER L CB  1 
ATOM   1256 O OG  . SER A 1 164 ? 10.748  -1.415  19.274  1.00 32.06  ? 164 SER L OG  1 
ATOM   1257 N N   . GLN A 1 165 ? 11.664  1.383   16.972  1.00 27.36  ? 165 GLN L N   1 
ATOM   1258 C CA  . GLN A 1 165 ? 12.250  1.277   15.643  1.00 30.87  ? 165 GLN L CA  1 
ATOM   1259 C C   . GLN A 1 165 ? 13.744  0.986   15.832  1.00 33.73  ? 165 GLN L C   1 
ATOM   1260 O O   . GLN A 1 165 ? 14.381  1.553   16.730  1.00 30.82  ? 165 GLN L O   1 
ATOM   1261 C CB  . GLN A 1 165 ? 12.059  2.588   14.870  1.00 27.54  ? 165 GLN L CB  1 
ATOM   1262 C CG  . GLN A 1 165 ? 10.840  2.616   13.964  1.00 32.00  ? 165 GLN L CG  1 
ATOM   1263 C CD  . GLN A 1 165 ? 10.657  3.945   13.234  1.00 27.58  ? 165 GLN L CD  1 
ATOM   1264 O OE1 . GLN A 1 165 ? 10.759  5.026   13.824  1.00 28.16  ? 165 GLN L OE1 1 
ATOM   1265 N NE2 . GLN A 1 165 ? 10.390  3.866   11.939  1.00 23.74  ? 165 GLN L NE2 1 
ATOM   1266 N N   . GLU A 1 166 ? 14.292  0.100   15.003  1.00 31.11  ? 166 GLU L N   1 
ATOM   1267 C CA  . GLU A 1 166 ? 15.700  -0.244  15.096  1.00 29.37  ? 166 GLU L CA  1 
ATOM   1268 C C   . GLU A 1 166 ? 16.446  -0.079  13.783  1.00 31.80  ? 166 GLU L C   1 
ATOM   1269 O O   . GLU A 1 166 ? 15.901  -0.328  12.702  1.00 32.36  ? 166 GLU L O   1 
ATOM   1270 C CB  . GLU A 1 166 ? 15.862  -1.668  15.630  1.00 33.72  ? 166 GLU L CB  1 
ATOM   1271 C CG  . GLU A 1 166 ? 15.813  -2.770  14.607  1.00 30.68  ? 166 GLU L CG  1 
ATOM   1272 C CD  . GLU A 1 166 ? 15.773  -4.127  15.274  1.00 37.11  ? 166 GLU L CD  1 
ATOM   1273 O OE1 . GLU A 1 166 ? 15.590  -4.166  16.516  1.00 42.71  ? 166 GLU L OE1 1 
ATOM   1274 O OE2 . GLU A 1 166 ? 15.920  -5.153  14.573  1.00 42.46  ? 166 GLU L OE2 1 
ATOM   1275 N N   . SER A 1 167 ? 17.698  0.362   13.897  1.00 27.57  ? 167 SER L N   1 
ATOM   1276 C CA  . SER A 1 167 ? 18.588  0.602   12.757  1.00 28.48  ? 167 SER L CA  1 
ATOM   1277 C C   . SER A 1 167 ? 19.821  -0.290  12.919  1.00 27.74  ? 167 SER L C   1 
ATOM   1278 O O   . SER A 1 167 ? 20.228  -0.564  14.041  1.00 26.80  ? 167 SER L O   1 
ATOM   1279 C CB  . SER A 1 167 ? 19.041  2.062   12.763  1.00 19.81  ? 167 SER L CB  1 
ATOM   1280 O OG  . SER A 1 167 ? 19.283  2.548   11.453  1.00 35.65  ? 167 SER L OG  1 
ATOM   1281 N N   . VAL A 1 168 ? 20.412  -0.726  11.805  1.00 28.47  ? 168 VAL L N   1 
ATOM   1282 C CA  . VAL A 1 168 ? 21.605  -1.571  11.852  1.00 30.64  ? 168 VAL L CA  1 
ATOM   1283 C C   . VAL A 1 168 ? 22.689  -1.091  10.868  1.00 31.18  ? 168 VAL L C   1 
ATOM   1284 O O   . VAL A 1 168 ? 22.389  -0.732  9.726   1.00 28.83  ? 168 VAL L O   1 
ATOM   1285 C CB  . VAL A 1 168 ? 21.248  -3.052  11.553  1.00 30.19  ? 168 VAL L CB  1 
ATOM   1286 C CG1 . VAL A 1 168 ? 20.884  -3.226  10.095  1.00 36.47  ? 168 VAL L CG1 1 
ATOM   1287 C CG2 . VAL A 1 168 ? 22.428  -3.949  11.897  1.00 34.10  ? 168 VAL L CG2 1 
ATOM   1288 N N   . THR A 1 169 ? 23.948  -1.070  11.313  1.00 32.03  ? 169 THR L N   1 
ATOM   1289 C CA  . THR A 1 169 ? 25.040  -0.628  10.435  1.00 27.82  ? 169 THR L CA  1 
ATOM   1290 C C   . THR A 1 169 ? 25.473  -1.723  9.466   1.00 24.38  ? 169 THR L C   1 
ATOM   1291 O O   . THR A 1 169 ? 25.121  -2.896  9.623   1.00 23.18  ? 169 THR L O   1 
ATOM   1292 C CB  . THR A 1 169 ? 26.316  -0.146  11.228  1.00 24.21  ? 169 THR L CB  1 
ATOM   1293 O OG1 . THR A 1 169 ? 26.670  -1.086  12.255  1.00 25.28  ? 169 THR L OG1 1 
ATOM   1294 C CG2 . THR A 1 169 ? 26.075  1.198   11.839  1.00 28.11  ? 169 THR L CG2 1 
ATOM   1295 N N   . GLU A 1 170 ? 26.216  -1.326  8.438   1.00 27.55  ? 170 GLU L N   1 
ATOM   1296 C CA  . GLU A 1 170 ? 26.717  -2.283  7.462   1.00 28.41  ? 170 GLU L CA  1 
ATOM   1297 C C   . GLU A 1 170 ? 27.907  -2.963  8.129   1.00 27.91  ? 170 GLU L C   1 
ATOM   1298 O O   . GLU A 1 170 ? 28.536  -2.382  9.019   1.00 27.94  ? 170 GLU L O   1 
ATOM   1299 C CB  . GLU A 1 170 ? 27.169  -1.558  6.191   1.00 32.17  ? 170 GLU L CB  1 
ATOM   1300 C CG  . GLU A 1 170 ? 26.027  -1.013  5.335   1.00 39.81  ? 170 GLU L CG  1 
ATOM   1301 C CD  . GLU A 1 170 ? 24.920  -2.031  5.098   1.00 46.60  ? 170 GLU L CD  1 
ATOM   1302 O OE1 . GLU A 1 170 ? 25.204  -3.247  5.031   1.00 55.49  ? 170 GLU L OE1 1 
ATOM   1303 O OE2 . GLU A 1 170 ? 23.754  -1.610  4.977   1.00 59.46  ? 170 GLU L OE2 1 
ATOM   1304 N N   . GLN A 1 171 ? 28.217  -4.188  7.713   1.00 29.94  ? 171 GLN L N   1 
ATOM   1305 C CA  . GLN A 1 171 ? 29.342  -4.907  8.298   1.00 27.76  ? 171 GLN L CA  1 
ATOM   1306 C C   . GLN A 1 171 ? 30.539  -3.960  8.347   1.00 31.32  ? 171 GLN L C   1 
ATOM   1307 O O   . GLN A 1 171 ? 30.807  -3.227  7.382   1.00 25.96  ? 171 GLN L O   1 
ATOM   1308 C CB  . GLN A 1 171 ? 29.670  -6.155  7.463   1.00 29.56  ? 171 GLN L CB  1 
ATOM   1309 C CG  . GLN A 1 171 ? 30.412  -7.243  8.223   1.00 30.14  ? 171 GLN L CG  1 
ATOM   1310 C CD  . GLN A 1 171 ? 30.548  -8.550  7.458   1.00 28.61  ? 171 GLN L CD  1 
ATOM   1311 O OE1 . GLN A 1 171 ? 30.788  -9.605  8.050   1.00 25.85  ? 171 GLN L OE1 1 
ATOM   1312 N NE2 . GLN A 1 171 ? 30.402  -8.487  6.140   1.00 23.81  ? 171 GLN L NE2 1 
ATOM   1313 N N   . ASP A 1 172 ? 31.232  -3.942  9.485   1.00 32.35  ? 172 ASP L N   1 
ATOM   1314 C CA  . ASP A 1 172 ? 32.397  -3.077  9.648   1.00 32.66  ? 172 ASP L CA  1 
ATOM   1315 C C   . ASP A 1 172 ? 33.557  -3.561  8.774   1.00 33.39  ? 172 ASP L C   1 
ATOM   1316 O O   . ASP A 1 172 ? 33.798  -4.763  8.661   1.00 25.30  ? 172 ASP L O   1 
ATOM   1317 C CB  . ASP A 1 172 ? 32.833  -3.042  11.116  1.00 35.05  ? 172 ASP L CB  1 
ATOM   1318 C CG  . ASP A 1 172 ? 33.926  -2.023  11.363  1.00 32.61  ? 172 ASP L CG  1 
ATOM   1319 O OD1 . ASP A 1 172 ? 33.605  -0.819  11.461  1.00 29.84  ? 172 ASP L OD1 1 
ATOM   1320 O OD2 . ASP A 1 172 ? 35.106  -2.427  11.447  1.00 36.73  ? 172 ASP L OD2 1 
ATOM   1321 N N   . SER A 1 173 ? 34.264  -2.618  8.158   1.00 35.18  ? 173 SER L N   1 
ATOM   1322 C CA  . SER A 1 173 ? 35.383  -2.936  7.283   1.00 43.27  ? 173 SER L CA  1 
ATOM   1323 C C   . SER A 1 173 ? 36.540  -3.619  8.012   1.00 44.27  ? 173 SER L C   1 
ATOM   1324 O O   . SER A 1 173 ? 37.089  -4.603  7.517   1.00 51.69  ? 173 SER L O   1 
ATOM   1325 C CB  . SER A 1 173 ? 35.881  -1.666  6.581   1.00 44.64  ? 173 SER L CB  1 
ATOM   1326 O OG  . SER A 1 173 ? 35.813  -0.538  7.439   1.00 49.21  ? 173 SER L OG  1 
ATOM   1327 N N   . LYS A 1 174 ? 36.904  -3.107  9.184   1.00 41.73  ? 174 LYS L N   1 
ATOM   1328 C CA  . LYS A 1 174 ? 37.998  -3.682  9.959   1.00 37.61  ? 174 LYS L CA  1 
ATOM   1329 C C   . LYS A 1 174 ? 37.648  -4.982  10.665  1.00 37.65  ? 174 LYS L C   1 
ATOM   1330 O O   . LYS A 1 174 ? 38.306  -5.993  10.450  1.00 37.82  ? 174 LYS L O   1 
ATOM   1331 C CB  . LYS A 1 174 ? 38.499  -2.681  10.999  1.00 40.51  ? 174 LYS L CB  1 
ATOM   1332 C CG  . LYS A 1 174 ? 38.665  -1.277  10.459  1.00 48.44  ? 174 LYS L CG  1 
ATOM   1333 C CD  . LYS A 1 174 ? 40.106  -0.811  10.422  1.00 54.60  ? 174 LYS L CD  1 
ATOM   1334 C CE  . LYS A 1 174 ? 40.222  0.663   10.812  1.00 58.30  ? 174 LYS L CE  1 
ATOM   1335 N NZ  . LYS A 1 174 ? 41.630  1.171   10.764  1.00 52.45  ? 174 LYS L NZ  1 
ATOM   1336 N N   . ASP A 1 175 ? 36.617  -4.978  11.506  1.00 33.17  ? 175 ASP L N   1 
ATOM   1337 C CA  . ASP A 1 175 ? 36.282  -6.202  12.221  1.00 31.10  ? 175 ASP L CA  1 
ATOM   1338 C C   . ASP A 1 175 ? 35.104  -7.035  11.720  1.00 32.77  ? 175 ASP L C   1 
ATOM   1339 O O   . ASP A 1 175 ? 34.752  -8.046  12.334  1.00 37.01  ? 175 ASP L O   1 
ATOM   1340 C CB  . ASP A 1 175 ? 36.124  -5.920  13.723  1.00 28.82  ? 175 ASP L CB  1 
ATOM   1341 C CG  . ASP A 1 175 ? 34.922  -5.059  14.036  1.00 28.59  ? 175 ASP L CG  1 
ATOM   1342 O OD1 . ASP A 1 175 ? 33.946  -5.082  13.265  1.00 27.13  ? 175 ASP L OD1 1 
ATOM   1343 O OD2 . ASP A 1 175 ? 34.961  -4.363  15.068  1.00 28.43  ? 175 ASP L OD2 1 
ATOM   1344 N N   . SER A 1 176 ? 34.485  -6.625  10.622  1.00 28.28  ? 176 SER L N   1 
ATOM   1345 C CA  . SER A 1 176 ? 33.397  -7.426  10.066  1.00 28.95  ? 176 SER L CA  1 
ATOM   1346 C C   . SER A 1 176 ? 32.161  -7.658  10.965  1.00 27.57  ? 176 SER L C   1 
ATOM   1347 O O   . SER A 1 176 ? 31.376  -8.576  10.708  1.00 21.35  ? 176 SER L O   1 
ATOM   1348 C CB  . SER A 1 176 ? 33.958  -8.789  9.636   1.00 29.43  ? 176 SER L CB  1 
ATOM   1349 O OG  . SER A 1 176 ? 34.736  -8.685  8.446   1.00 35.26  ? 176 SER L OG  1 
ATOM   1350 N N   . THR A 1 177 ? 31.982  -6.838  11.999  1.00 27.47  ? 177 THR L N   1 
ATOM   1351 C CA  . THR A 1 177 ? 30.828  -6.989  12.893  1.00 25.71  ? 177 THR L CA  1 
ATOM   1352 C C   . THR A 1 177 ? 29.714  -6.050  12.448  1.00 26.06  ? 177 THR L C   1 
ATOM   1353 O O   . THR A 1 177 ? 29.836  -5.349  11.443  1.00 25.46  ? 177 THR L O   1 
ATOM   1354 C CB  . THR A 1 177 ? 31.152  -6.611  14.346  1.00 18.71  ? 177 THR L CB  1 
ATOM   1355 O OG1 . THR A 1 177 ? 31.551  -5.233  14.390  1.00 25.07  ? 177 THR L OG1 1 
ATOM   1356 C CG2 . THR A 1 177 ? 32.250  -7.500  14.920  1.00 23.55  ? 177 THR L CG2 1 
ATOM   1357 N N   . TYR A 1 178 ? 28.625  -6.055  13.210  1.00 30.04  ? 178 TYR L N   1 
ATOM   1358 C CA  . TYR A 1 178 ? 27.474  -5.196  12.942  1.00 25.52  ? 178 TYR L CA  1 
ATOM   1359 C C   . TYR A 1 178 ? 27.138  -4.528  14.246  1.00 27.30  ? 178 TYR L C   1 
ATOM   1360 O O   . TYR A 1 178 ? 27.474  -5.036  15.317  1.00 32.55  ? 178 TYR L O   1 
ATOM   1361 C CB  . TYR A 1 178 ? 26.249  -6.013  12.527  1.00 27.54  ? 178 TYR L CB  1 
ATOM   1362 C CG  . TYR A 1 178 ? 26.377  -6.783  11.237  1.00 21.43  ? 178 TYR L CG  1 
ATOM   1363 C CD1 . TYR A 1 178 ? 26.068  -6.182  10.012  1.00 24.70  ? 178 TYR L CD1 1 
ATOM   1364 C CD2 . TYR A 1 178 ? 26.792  -8.113  11.235  1.00 19.77  ? 178 TYR L CD2 1 
ATOM   1365 C CE1 . TYR A 1 178 ? 26.171  -6.884  8.816   1.00 21.10  ? 178 TYR L CE1 1 
ATOM   1366 C CE2 . TYR A 1 178 ? 26.898  -8.832  10.032  1.00 22.97  ? 178 TYR L CE2 1 
ATOM   1367 C CZ  . TYR A 1 178 ? 26.585  -8.206  8.837   1.00 20.52  ? 178 TYR L CZ  1 
ATOM   1368 O OH  . TYR A 1 178 ? 26.670  -8.897  7.651   1.00 31.29  ? 178 TYR L OH  1 
ATOM   1369 N N   . SER A 1 179 ? 26.474  -3.388  14.164  1.00 31.82  ? 179 SER L N   1 
ATOM   1370 C CA  . SER A 1 179 ? 26.035  -2.693  15.365  1.00 28.51  ? 179 SER L CA  1 
ATOM   1371 C C   . SER A 1 179 ? 24.572  -2.363  15.096  1.00 28.57  ? 179 SER L C   1 
ATOM   1372 O O   . SER A 1 179 ? 24.151  -2.302  13.934  1.00 22.80  ? 179 SER L O   1 
ATOM   1373 C CB  . SER A 1 179 ? 26.859  -1.430  15.611  1.00 24.93  ? 179 SER L CB  1 
ATOM   1374 O OG  . SER A 1 179 ? 28.131  -1.786  16.128  1.00 23.82  ? 179 SER L OG  1 
ATOM   1375 N N   . LEU A 1 180 ? 23.797  -2.181  16.161  1.00 26.04  ? 180 LEU L N   1 
ATOM   1376 C CA  . LEU A 1 180 ? 22.377  -1.908  16.010  1.00 28.07  ? 180 LEU L CA  1 
ATOM   1377 C C   . LEU A 1 180 ? 21.858  -1.030  17.142  1.00 28.58  ? 180 LEU L C   1 
ATOM   1378 O O   . LEU A 1 180 ? 22.324  -1.133  18.279  1.00 28.49  ? 180 LEU L O   1 
ATOM   1379 C CB  . LEU A 1 180 ? 21.623  -3.232  15.998  1.00 29.12  ? 180 LEU L CB  1 
ATOM   1380 C CG  . LEU A 1 180 ? 20.088  -3.237  16.088  1.00 27.88  ? 180 LEU L CG  1 
ATOM   1381 C CD1 . LEU A 1 180 ? 19.596  -4.483  15.409  1.00 18.91  ? 180 LEU L CD1 1 
ATOM   1382 C CD2 . LEU A 1 180 ? 19.618  -3.218  17.533  1.00 26.49  ? 180 LEU L CD2 1 
ATOM   1383 N N   . SER A 1 181 ? 20.932  -0.134  16.813  1.00 30.06  ? 181 SER L N   1 
ATOM   1384 C CA  . SER A 1 181 ? 20.313  0.737   17.807  1.00 31.44  ? 181 SER L CA  1 
ATOM   1385 C C   . SER A 1 181 ? 18.815  0.501   17.742  1.00 33.47  ? 181 SER L C   1 
ATOM   1386 O O   . SER A 1 181 ? 18.240  0.436   16.648  1.00 34.56  ? 181 SER L O   1 
ATOM   1387 C CB  . SER A 1 181 ? 20.558  2.205   17.499  1.00 32.29  ? 181 SER L CB  1 
ATOM   1388 O OG  . SER A 1 181 ? 19.644  2.624   16.507  1.00 34.98  ? 181 SER L OG  1 
ATOM   1389 N N   . SER A 1 182 ? 18.185  0.365   18.905  1.00 29.36  ? 182 SER L N   1 
ATOM   1390 C CA  . SER A 1 182 ? 16.737  0.171   18.968  1.00 28.58  ? 182 SER L CA  1 
ATOM   1391 C C   . SER A 1 182 ? 16.224  1.322   19.803  1.00 31.99  ? 182 SER L C   1 
ATOM   1392 O O   . SER A 1 182 ? 16.681  1.539   20.930  1.00 35.39  ? 182 SER L O   1 
ATOM   1393 C CB  . SER A 1 182 ? 16.383  -1.161  19.636  1.00 29.13  ? 182 SER L CB  1 
ATOM   1394 O OG  . SER A 1 182 ? 14.991  -1.439  19.514  1.00 35.42  ? 182 SER L OG  1 
ATOM   1395 N N   . THR A 1 183 ? 15.303  2.090   19.246  1.00 28.47  ? 183 THR L N   1 
ATOM   1396 C CA  . THR A 1 183 ? 14.756  3.219   19.967  1.00 30.31  ? 183 THR L CA  1 
ATOM   1397 C C   . THR A 1 183 ? 13.298  2.989   20.352  1.00 33.72  ? 183 THR L C   1 
ATOM   1398 O O   . THR A 1 183 ? 12.468  2.639   19.513  1.00 28.02  ? 183 THR L O   1 
ATOM   1399 C CB  . THR A 1 183 ? 14.860  4.494   19.132  1.00 23.86  ? 183 THR L CB  1 
ATOM   1400 O OG1 . THR A 1 183 ? 16.224  4.700   18.758  1.00 35.52  ? 183 THR L OG1 1 
ATOM   1401 C CG2 . THR A 1 183 ? 14.383  5.689   19.920  1.00 21.56  ? 183 THR L CG2 1 
ATOM   1402 N N   . LEU A 1 184 ? 13.012  3.165   21.638  1.00 34.40  ? 184 LEU L N   1 
ATOM   1403 C CA  . LEU A 1 184 ? 11.660  3.008   22.163  1.00 33.82  ? 184 LEU L CA  1 
ATOM   1404 C C   . LEU A 1 184 ? 11.121  4.420   22.311  1.00 31.44  ? 184 LEU L C   1 
ATOM   1405 O O   . LEU A 1 184 ? 11.694  5.242   23.024  1.00 25.10  ? 184 LEU L O   1 
ATOM   1406 C CB  . LEU A 1 184 ? 11.684  2.336   23.536  1.00 28.91  ? 184 LEU L CB  1 
ATOM   1407 C CG  . LEU A 1 184 ? 10.319  2.165   24.216  1.00 28.45  ? 184 LEU L CG  1 
ATOM   1408 C CD1 . LEU A 1 184 ? 9.573   1.031   23.545  1.00 19.66  ? 184 LEU L CD1 1 
ATOM   1409 C CD2 . LEU A 1 184 ? 10.493  1.882   25.715  1.00 25.92  ? 184 LEU L CD2 1 
ATOM   1410 N N   . THR A 1 185 ? 10.023  4.724   21.644  1.00 26.71  ? 185 THR L N   1 
ATOM   1411 C CA  . THR A 1 185 ? 9.505   6.074   21.766  1.00 33.84  ? 185 THR L CA  1 
ATOM   1412 C C   . THR A 1 185 ? 8.176   6.142   22.528  1.00 32.51  ? 185 THR L C   1 
ATOM   1413 O O   . THR A 1 185 ? 7.268   5.356   22.269  1.00 32.58  ? 185 THR L O   1 
ATOM   1414 C CB  . THR A 1 185 ? 9.355   6.718   20.371  1.00 39.03  ? 185 THR L CB  1 
ATOM   1415 O OG1 . THR A 1 185 ? 9.900   5.837   19.379  1.00 43.09  ? 185 THR L OG1 1 
ATOM   1416 C CG2 . THR A 1 185 ? 10.096  8.048   20.318  1.00 45.07  ? 185 THR L CG2 1 
ATOM   1417 N N   . LEU A 1 186 ? 8.088   7.062   23.492  1.00 34.08  ? 186 LEU L N   1 
ATOM   1418 C CA  . LEU A 1 186 ? 6.858   7.245   24.278  1.00 34.83  ? 186 LEU L CA  1 
ATOM   1419 C C   . LEU A 1 186 ? 6.623   8.707   24.573  1.00 32.97  ? 186 LEU L C   1 
ATOM   1420 O O   . LEU A 1 186 ? 7.551   9.526   24.528  1.00 28.55  ? 186 LEU L O   1 
ATOM   1421 C CB  . LEU A 1 186 ? 6.911   6.501   25.617  1.00 34.74  ? 186 LEU L CB  1 
ATOM   1422 C CG  . LEU A 1 186 ? 7.618   5.152   25.723  1.00 41.55  ? 186 LEU L CG  1 
ATOM   1423 C CD1 . LEU A 1 186 ? 8.158   4.987   27.137  1.00 36.57  ? 186 LEU L CD1 1 
ATOM   1424 C CD2 . LEU A 1 186 ? 6.662   4.034   25.372  1.00 40.04  ? 186 LEU L CD2 1 
ATOM   1425 N N   . SER A 1 187 ? 5.371   9.042   24.869  1.00 28.38  ? 187 SER L N   1 
ATOM   1426 C CA  . SER A 1 187 ? 5.040   10.415  25.192  1.00 28.73  ? 187 SER L CA  1 
ATOM   1427 C C   . SER A 1 187 ? 5.628   10.589  26.581  1.00 26.21  ? 187 SER L C   1 
ATOM   1428 O O   . SER A 1 187 ? 5.832   9.606   27.287  1.00 26.85  ? 187 SER L O   1 
ATOM   1429 C CB  . SER A 1 187 ? 3.520   10.609  25.230  1.00 33.54  ? 187 SER L CB  1 
ATOM   1430 O OG  . SER A 1 187 ? 2.945   9.947   26.347  1.00 32.59  ? 187 SER L OG  1 
ATOM   1431 N N   . LYS A 1 188 ? 5.904   11.826  26.960  1.00 25.95  ? 188 LYS L N   1 
ATOM   1432 C CA  . LYS A 1 188 ? 6.482   12.120  28.266  1.00 33.23  ? 188 LYS L CA  1 
ATOM   1433 C C   . LYS A 1 188 ? 5.563   11.607  29.370  1.00 35.45  ? 188 LYS L C   1 
ATOM   1434 O O   . LYS A 1 188 ? 6.016   10.969  30.314  1.00 40.19  ? 188 LYS L O   1 
ATOM   1435 C CB  . LYS A 1 188 ? 6.700   13.640  28.394  1.00 33.68  ? 188 LYS L CB  1 
ATOM   1436 C CG  . LYS A 1 188 ? 7.267   14.111  29.719  1.00 38.51  ? 188 LYS L CG  1 
ATOM   1437 C CD  . LYS A 1 188 ? 6.916   15.580  29.953  1.00 42.06  ? 188 LYS L CD  1 
ATOM   1438 C CE  . LYS A 1 188 ? 7.745   16.200  31.069  1.00 48.16  ? 188 LYS L CE  1 
ATOM   1439 N NZ  . LYS A 1 188 ? 7.097   16.076  32.400  1.00 54.97  ? 188 LYS L NZ  1 
ATOM   1440 N N   . ALA A 1 189 ? 4.265   11.860  29.237  1.00 38.48  ? 189 ALA L N   1 
ATOM   1441 C CA  . ALA A 1 189 ? 3.310   11.419  30.251  1.00 40.87  ? 189 ALA L CA  1 
ATOM   1442 C C   . ALA A 1 189 ? 3.342   9.904   30.433  1.00 43.56  ? 189 ALA L C   1 
ATOM   1443 O O   . ALA A 1 189 ? 3.437   9.404   31.558  1.00 43.98  ? 189 ALA L O   1 
ATOM   1444 C CB  . ALA A 1 189 ? 1.902   11.884  29.887  1.00 38.74  ? 189 ALA L CB  1 
ATOM   1445 N N   . ASP A 1 190 ? 3.259   9.170   29.327  1.00 45.27  ? 190 ASP L N   1 
ATOM   1446 C CA  . ASP A 1 190 ? 3.299   7.716   29.400  1.00 46.61  ? 190 ASP L CA  1 
ATOM   1447 C C   . ASP A 1 190 ? 4.621   7.270   30.003  1.00 47.10  ? 190 ASP L C   1 
ATOM   1448 O O   . ASP A 1 190 ? 4.674   6.298   30.764  1.00 43.83  ? 190 ASP L O   1 
ATOM   1449 C CB  . ASP A 1 190 ? 3.140   7.111   28.012  1.00 51.97  ? 190 ASP L CB  1 
ATOM   1450 C CG  . ASP A 1 190 ? 1.699   7.087   27.560  1.00 63.18  ? 190 ASP L CG  1 
ATOM   1451 O OD1 . ASP A 1 190 ? 0.810   7.073   28.442  1.00 64.52  ? 190 ASP L OD1 1 
ATOM   1452 O OD2 . ASP A 1 190 ? 1.455   7.086   26.335  1.00 66.88  ? 190 ASP L OD2 1 
ATOM   1453 N N   . TYR A 1 191 ? 5.686   7.994   29.659  1.00 46.50  ? 191 TYR L N   1 
ATOM   1454 C CA  . TYR A 1 191 ? 7.028   7.689   30.151  1.00 42.85  ? 191 TYR L CA  1 
ATOM   1455 C C   . TYR A 1 191 ? 7.099   7.852   31.662  1.00 43.41  ? 191 TYR L C   1 
ATOM   1456 O O   . TYR A 1 191 ? 7.701   7.038   32.362  1.00 41.35  ? 191 TYR L O   1 
ATOM   1457 C CB  . TYR A 1 191 ? 8.063   8.614   29.499  1.00 39.15  ? 191 TYR L CB  1 
ATOM   1458 C CG  . TYR A 1 191 ? 9.442   8.465   30.094  1.00 28.90  ? 191 TYR L CG  1 
ATOM   1459 C CD1 . TYR A 1 191 ? 10.150  7.270   29.965  1.00 30.57  ? 191 TYR L CD1 1 
ATOM   1460 C CD2 . TYR A 1 191 ? 10.033  9.508   30.801  1.00 25.84  ? 191 TYR L CD2 1 
ATOM   1461 C CE1 . TYR A 1 191 ? 11.430  7.114   30.533  1.00 28.90  ? 191 TYR L CE1 1 
ATOM   1462 C CE2 . TYR A 1 191 ? 11.310  9.364   31.373  1.00 31.10  ? 191 TYR L CE2 1 
ATOM   1463 C CZ  . TYR A 1 191 ? 11.997  8.163   31.232  1.00 30.14  ? 191 TYR L CZ  1 
ATOM   1464 O OH  . TYR A 1 191 ? 13.239  8.005   31.801  1.00 35.83  ? 191 TYR L OH  1 
ATOM   1465 N N   . GLU A 1 192 ? 6.483   8.921   32.154  1.00 46.24  ? 192 GLU L N   1 
ATOM   1466 C CA  . GLU A 1 192 ? 6.469   9.206   33.577  1.00 48.33  ? 192 GLU L CA  1 
ATOM   1467 C C   . GLU A 1 192 ? 5.422   8.354   34.272  1.00 47.38  ? 192 GLU L C   1 
ATOM   1468 O O   . GLU A 1 192 ? 5.239   8.437   35.480  1.00 51.41  ? 192 GLU L O   1 
ATOM   1469 C CB  . GLU A 1 192 ? 6.189   10.687  33.807  1.00 48.40  ? 192 GLU L CB  1 
ATOM   1470 C CG  . GLU A 1 192 ? 7.454   11.490  34.057  1.00 54.34  ? 192 GLU L CG  1 
ATOM   1471 C CD  . GLU A 1 192 ? 7.391   12.881  33.474  1.00 55.95  ? 192 GLU L CD  1 
ATOM   1472 O OE1 . GLU A 1 192 ? 6.283   13.320  33.111  1.00 53.56  ? 192 GLU L OE1 1 
ATOM   1473 O OE2 . GLU A 1 192 ? 8.454   13.532  33.383  1.00 61.14  ? 192 GLU L OE2 1 
ATOM   1474 N N   . LYS A 1 193 ? 4.749   7.518   33.494  1.00 49.75  ? 193 LYS L N   1 
ATOM   1475 C CA  . LYS A 1 193 ? 3.720   6.631   34.017  1.00 49.68  ? 193 LYS L CA  1 
ATOM   1476 C C   . LYS A 1 193 ? 4.308   5.282   34.435  1.00 51.82  ? 193 LYS L C   1 
ATOM   1477 O O   . LYS A 1 193 ? 3.595   4.437   34.978  1.00 53.00  ? 193 LYS L O   1 
ATOM   1478 C CB  . LYS A 1 193 ? 2.641   6.405   32.957  1.00 48.52  ? 193 LYS L CB  1 
ATOM   1479 C CG  . LYS A 1 193 ? 1.226   6.679   33.423  1.00 51.32  ? 193 LYS L CG  1 
ATOM   1480 C CD  . LYS A 1 193 ? 0.277   6.872   32.247  1.00 53.57  ? 193 LYS L CD  1 
ATOM   1481 C CE  . LYS A 1 193 ? -0.148  5.539   31.642  1.00 57.88  ? 193 LYS L CE  1 
ATOM   1482 N NZ  . LYS A 1 193 ? 0.697   5.133   30.468  1.00 64.39  ? 193 LYS L NZ  1 
ATOM   1483 N N   . HIS A 1 194 ? 5.601   5.072   34.183  1.00 48.30  ? 194 HIS L N   1 
ATOM   1484 C CA  . HIS A 1 194 ? 6.230   3.802   34.541  1.00 41.98  ? 194 HIS L CA  1 
ATOM   1485 C C   . HIS A 1 194 ? 7.588   3.905   35.213  1.00 38.41  ? 194 HIS L C   1 
ATOM   1486 O O   . HIS A 1 194 ? 8.236   4.952   35.191  1.00 38.84  ? 194 HIS L O   1 
ATOM   1487 C CB  . HIS A 1 194 ? 6.345   2.917   33.315  1.00 42.87  ? 194 HIS L CB  1 
ATOM   1488 C CG  . HIS A 1 194 ? 5.029   2.469   32.776  1.00 42.80  ? 194 HIS L CG  1 
ATOM   1489 N ND1 . HIS A 1 194 ? 4.296   3.221   31.884  1.00 47.70  ? 194 HIS L ND1 1 
ATOM   1490 C CD2 . HIS A 1 194 ? 4.328   1.327   32.973  1.00 45.17  ? 194 HIS L CD2 1 
ATOM   1491 C CE1 . HIS A 1 194 ? 3.202   2.558   31.550  1.00 46.33  ? 194 HIS L CE1 1 
ATOM   1492 N NE2 . HIS A 1 194 ? 3.198   1.407   32.197  1.00 44.97  ? 194 HIS L NE2 1 
ATOM   1493 N N   . LYS A 1 195 ? 8.012   2.787   35.791  1.00 39.64  ? 195 LYS L N   1 
ATOM   1494 C CA  . LYS A 1 195 ? 9.259   2.684   36.533  1.00 44.14  ? 195 LYS L CA  1 
ATOM   1495 C C   . LYS A 1 195 ? 10.450  2.116   35.763  1.00 43.45  ? 195 LYS L C   1 
ATOM   1496 O O   . LYS A 1 195 ? 11.299  2.858   35.303  1.00 45.95  ? 195 LYS L O   1 
ATOM   1497 C CB  . LYS A 1 195 ? 9.028   1.826   37.782  1.00 48.27  ? 195 LYS L CB  1 
ATOM   1498 C CG  . LYS A 1 195 ? 9.646   2.361   39.061  1.00 56.70  ? 195 LYS L CG  1 
ATOM   1499 C CD  . LYS A 1 195 ? 9.215   1.518   40.276  1.00 64.16  ? 195 LYS L CD  1 
ATOM   1500 C CE  . LYS A 1 195 ? 7.760   1.799   40.676  1.00 67.40  ? 195 LYS L CE  1 
ATOM   1501 N NZ  . LYS A 1 195 ? 6.808   0.772   40.151  1.00 61.47  ? 195 LYS L NZ  1 
ATOM   1502 N N   . VAL A 1 196 ? 10.511  0.796   35.644  1.00 43.56  ? 196 VAL L N   1 
ATOM   1503 C CA  . VAL A 1 196 ? 11.623  0.140   34.967  1.00 44.90  ? 196 VAL L CA  1 
ATOM   1504 C C   . VAL A 1 196 ? 11.509  0.046   33.462  1.00 44.47  ? 196 VAL L C   1 
ATOM   1505 O O   . VAL A 1 196 ? 10.490  -0.381  32.917  1.00 44.12  ? 196 VAL L O   1 
ATOM   1506 C CB  . VAL A 1 196 ? 11.855  -1.287  35.486  1.00 44.96  ? 196 VAL L CB  1 
ATOM   1507 C CG1 . VAL A 1 196 ? 13.219  -1.375  36.148  1.00 41.88  ? 196 VAL L CG1 1 
ATOM   1508 C CG2 . VAL A 1 196 ? 10.754  -1.677  36.460  1.00 50.06  ? 196 VAL L CG2 1 
ATOM   1509 N N   . TYR A 1 197 ? 12.590  0.456   32.808  1.00 42.72  ? 197 TYR L N   1 
ATOM   1510 C CA  . TYR A 1 197 ? 12.712  0.435   31.364  1.00 37.61  ? 197 TYR L CA  1 
ATOM   1511 C C   . TYR A 1 197 ? 13.902  -0.471  31.088  1.00 38.84  ? 197 TYR L C   1 
ATOM   1512 O O   . TYR A 1 197 ? 15.009  -0.223  31.589  1.00 34.87  ? 197 TYR L O   1 
ATOM   1513 C CB  . TYR A 1 197 ? 12.973  1.846   30.865  1.00 32.36  ? 197 TYR L CB  1 
ATOM   1514 C CG  . TYR A 1 197 ? 11.744  2.713   30.951  1.00 36.04  ? 197 TYR L CG  1 
ATOM   1515 C CD1 . TYR A 1 197 ? 10.789  2.694   29.934  1.00 33.17  ? 197 TYR L CD1 1 
ATOM   1516 C CD2 . TYR A 1 197 ? 11.505  3.520   32.069  1.00 33.99  ? 197 TYR L CD2 1 
ATOM   1517 C CE1 . TYR A 1 197 ? 9.629   3.445   30.023  1.00 34.81  ? 197 TYR L CE1 1 
ATOM   1518 C CE2 . TYR A 1 197 ? 10.335  4.282   32.167  1.00 37.35  ? 197 TYR L CE2 1 
ATOM   1519 C CZ  . TYR A 1 197 ? 9.402   4.235   31.136  1.00 36.76  ? 197 TYR L CZ  1 
ATOM   1520 O OH  . TYR A 1 197 ? 8.239   4.963   31.216  1.00 37.04  ? 197 TYR L OH  1 
ATOM   1521 N N   . ALA A 1 198 ? 13.675  -1.533  30.322  1.00 39.34  ? 198 ALA L N   1 
ATOM   1522 C CA  . ALA A 1 198 ? 14.749  -2.467  30.024  1.00 40.36  ? 198 ALA L CA  1 
ATOM   1523 C C   . ALA A 1 198 ? 14.667  -3.094  28.649  1.00 42.30  ? 198 ALA L C   1 
ATOM   1524 O O   . ALA A 1 198 ? 13.586  -3.416  28.162  1.00 41.59  ? 198 ALA L O   1 
ATOM   1525 C CB  . ALA A 1 198 ? 14.779  -3.572  31.074  1.00 43.95  ? 198 ALA L CB  1 
ATOM   1526 N N   . CYS A 1 199 ? 15.824  -3.249  28.014  1.00 42.84  ? 199 CYS L N   1 
ATOM   1527 C CA  . CYS A 1 199 ? 15.870  -3.893  26.720  1.00 41.40  ? 199 CYS L CA  1 
ATOM   1528 C C   . CYS A 1 199 ? 16.634  -5.180  26.954  1.00 41.56  ? 199 CYS L C   1 
ATOM   1529 O O   . CYS A 1 199 ? 17.679  -5.195  27.626  1.00 36.05  ? 199 CYS L O   1 
ATOM   1530 C CB  . CYS A 1 199 ? 16.554  -3.013  25.663  1.00 47.38  ? 199 CYS L CB  1 
ATOM   1531 S SG  . CYS A 1 199 ? 18.282  -2.514  25.950  1.00 51.26  ? 199 CYS L SG  1 
ATOM   1532 N N   . GLU A 1 200 ? 16.070  -6.269  26.449  1.00 41.81  ? 200 GLU L N   1 
ATOM   1533 C CA  . GLU A 1 200 ? 16.671  -7.576  26.595  1.00 46.08  ? 200 GLU L CA  1 
ATOM   1534 C C   . GLU A 1 200 ? 17.184  -8.007  25.247  1.00 44.18  ? 200 GLU L C   1 
ATOM   1535 O O   . GLU A 1 200 ? 16.421  -8.184  24.298  1.00 39.85  ? 200 GLU L O   1 
ATOM   1536 C CB  . GLU A 1 200 ? 15.644  -8.593  27.105  1.00 51.98  ? 200 GLU L CB  1 
ATOM   1537 C CG  . GLU A 1 200 ? 16.177  -10.025 27.185  1.00 62.68  ? 200 GLU L CG  1 
ATOM   1538 C CD  . GLU A 1 200 ? 15.287  -10.932 28.016  1.00 72.51  ? 200 GLU L CD  1 
ATOM   1539 O OE1 . GLU A 1 200 ? 14.047  -10.764 27.956  1.00 75.16  ? 200 GLU L OE1 1 
ATOM   1540 O OE2 . GLU A 1 200 ? 15.824  -11.811 28.728  1.00 73.36  ? 200 GLU L OE2 1 
ATOM   1541 N N   . VAL A 1 201 ? 18.494  -8.171  25.166  1.00 46.04  ? 201 VAL L N   1 
ATOM   1542 C CA  . VAL A 1 201 ? 19.110  -8.583  23.928  1.00 44.95  ? 201 VAL L CA  1 
ATOM   1543 C C   . VAL A 1 201 ? 19.361  -10.072 24.003  1.00 43.92  ? 201 VAL L C   1 
ATOM   1544 O O   . VAL A 1 201 ? 19.812  -10.582 25.031  1.00 42.20  ? 201 VAL L O   1 
ATOM   1545 C CB  . VAL A 1 201 ? 20.427  -7.833  23.709  1.00 44.88  ? 201 VAL L CB  1 
ATOM   1546 C CG1 . VAL A 1 201 ? 21.140  -8.368  22.478  1.00 35.27  ? 201 VAL L CG1 1 
ATOM   1547 C CG2 . VAL A 1 201 ? 20.137  -6.349  23.573  1.00 44.23  ? 201 VAL L CG2 1 
ATOM   1548 N N   . THR A 1 202 ? 19.037  -10.771 22.923  1.00 40.89  ? 202 THR L N   1 
ATOM   1549 C CA  . THR A 1 202 ? 19.256  -12.203 22.872  1.00 46.38  ? 202 THR L CA  1 
ATOM   1550 C C   . THR A 1 202 ? 19.963  -12.494 21.545  1.00 51.99  ? 202 THR L C   1 
ATOM   1551 O O   . THR A 1 202 ? 19.344  -12.542 20.485  1.00 56.33  ? 202 THR L O   1 
ATOM   1552 C CB  . THR A 1 202 ? 17.913  -12.979 23.003  1.00 46.95  ? 202 THR L CB  1 
ATOM   1553 O OG1 . THR A 1 202 ? 17.513  -13.477 21.727  1.00 47.33  ? 202 THR L OG1 1 
ATOM   1554 C CG2 . THR A 1 202 ? 16.801  -12.062 23.557  1.00 47.10  ? 202 THR L CG2 1 
ATOM   1555 N N   . HIS A 1 203 ? 21.281  -12.658 21.616  1.00 53.54  ? 203 HIS L N   1 
ATOM   1556 C CA  . HIS A 1 203 ? 22.097  -12.915 20.433  1.00 52.97  ? 203 HIS L CA  1 
ATOM   1557 C C   . HIS A 1 203 ? 22.833  -14.250 20.542  1.00 54.12  ? 203 HIS L C   1 
ATOM   1558 O O   . HIS A 1 203 ? 23.196  -14.679 21.637  1.00 57.49  ? 203 HIS L O   1 
ATOM   1559 C CB  . HIS A 1 203 ? 23.103  -11.769 20.254  1.00 48.63  ? 203 HIS L CB  1 
ATOM   1560 C CG  . HIS A 1 203 ? 24.133  -12.021 19.199  1.00 44.45  ? 203 HIS L CG  1 
ATOM   1561 N ND1 . HIS A 1 203 ? 23.871  -11.895 17.854  1.00 39.41  ? 203 HIS L ND1 1 
ATOM   1562 C CD2 . HIS A 1 203 ? 25.434  -12.396 19.293  1.00 39.59  ? 203 HIS L CD2 1 
ATOM   1563 C CE1 . HIS A 1 203 ? 24.958  -12.183 17.164  1.00 36.03  ? 203 HIS L CE1 1 
ATOM   1564 N NE2 . HIS A 1 203 ? 25.922  -12.490 18.014  1.00 35.10  ? 203 HIS L NE2 1 
ATOM   1565 N N   . GLN A 1 204 ? 23.054  -14.894 19.399  1.00 52.66  ? 204 GLN L N   1 
ATOM   1566 C CA  . GLN A 1 204 ? 23.732  -16.184 19.353  1.00 50.59  ? 204 GLN L CA  1 
ATOM   1567 C C   . GLN A 1 204 ? 25.064  -16.204 20.113  1.00 49.64  ? 204 GLN L C   1 
ATOM   1568 O O   . GLN A 1 204 ? 25.579  -17.266 20.444  1.00 47.53  ? 204 GLN L O   1 
ATOM   1569 C CB  . GLN A 1 204 ? 23.947  -16.599 17.891  1.00 50.61  ? 204 GLN L CB  1 
ATOM   1570 C CG  . GLN A 1 204 ? 25.395  -16.599 17.426  1.00 54.04  ? 204 GLN L CG  1 
ATOM   1571 C CD  . GLN A 1 204 ? 25.747  -17.841 16.632  1.00 54.94  ? 204 GLN L CD  1 
ATOM   1572 O OE1 . GLN A 1 204 ? 25.413  -17.954 15.456  1.00 57.44  ? 204 GLN L OE1 1 
ATOM   1573 N NE2 . GLN A 1 204 ? 26.427  -18.784 17.276  1.00 58.68  ? 204 GLN L NE2 1 
ATOM   1574 N N   . GLY A 1 205 ? 25.611  -15.029 20.399  1.00 48.55  ? 205 GLY L N   1 
ATOM   1575 C CA  . GLY A 1 205 ? 26.873  -14.960 21.111  1.00 49.59  ? 205 GLY L CA  1 
ATOM   1576 C C   . GLY A 1 205 ? 26.727  -14.864 22.617  1.00 48.87  ? 205 GLY L C   1 
ATOM   1577 O O   . GLY A 1 205 ? 27.712  -14.971 23.347  1.00 45.61  ? 205 GLY L O   1 
ATOM   1578 N N   . LEU A 1 206 ? 25.504  -14.650 23.090  1.00 48.04  ? 206 LEU L N   1 
ATOM   1579 C CA  . LEU A 1 206 ? 25.264  -14.550 24.521  1.00 47.36  ? 206 LEU L CA  1 
ATOM   1580 C C   . LEU A 1 206 ? 24.854  -15.928 25.025  1.00 50.46  ? 206 LEU L C   1 
ATOM   1581 O O   . LEU A 1 206 ? 24.194  -16.681 24.310  1.00 50.24  ? 206 LEU L O   1 
ATOM   1582 C CB  . LEU A 1 206 ? 24.153  -13.529 24.809  1.00 46.65  ? 206 LEU L CB  1 
ATOM   1583 C CG  . LEU A 1 206 ? 24.331  -12.074 24.343  1.00 42.43  ? 206 LEU L CG  1 
ATOM   1584 C CD1 . LEU A 1 206 ? 23.046  -11.284 24.634  1.00 37.68  ? 206 LEU L CD1 1 
ATOM   1585 C CD2 . LEU A 1 206 ? 25.533  -11.439 25.046  1.00 28.28  ? 206 LEU L CD2 1 
ATOM   1586 N N   . SER A 1 207 ? 25.263  -16.262 26.248  1.00 55.39  ? 207 SER L N   1 
ATOM   1587 C CA  . SER A 1 207 ? 24.934  -17.555 26.850  1.00 60.52  ? 207 SER L CA  1 
ATOM   1588 C C   . SER A 1 207 ? 23.431  -17.596 27.103  1.00 61.51  ? 207 SER L C   1 
ATOM   1589 O O   . SER A 1 207 ? 22.755  -18.584 26.805  1.00 61.91  ? 207 SER L O   1 
ATOM   1590 C CB  . SER A 1 207 ? 25.695  -17.735 28.169  1.00 60.24  ? 207 SER L CB  1 
ATOM   1591 O OG  . SER A 1 207 ? 26.412  -16.559 28.505  1.00 64.57  ? 207 SER L OG  1 
ATOM   1592 N N   . SER A 1 208 ? 22.924  -16.500 27.655  1.00 60.80  ? 208 SER L N   1 
ATOM   1593 C CA  . SER A 1 208 ? 21.508  -16.341 27.945  1.00 56.92  ? 208 SER L CA  1 
ATOM   1594 C C   . SER A 1 208 ? 21.193  -14.878 27.668  1.00 56.94  ? 208 SER L C   1 
ATOM   1595 O O   . SER A 1 208 ? 22.045  -14.013 27.870  1.00 57.14  ? 208 SER L O   1 
ATOM   1596 C CB  . SER A 1 208 ? 21.225  -16.669 29.407  1.00 51.86  ? 208 SER L CB  1 
ATOM   1597 O OG  . SER A 1 208 ? 21.887  -15.758 30.263  1.00 49.85  ? 208 SER L OG  1 
ATOM   1598 N N   . PRO A 1 209 ? 19.973  -14.582 27.186  1.00 55.90  ? 209 PRO L N   1 
ATOM   1599 C CA  . PRO A 1 209 ? 19.617  -13.191 26.900  1.00 53.16  ? 209 PRO L CA  1 
ATOM   1600 C C   . PRO A 1 209 ? 20.118  -12.233 27.974  1.00 50.93  ? 209 PRO L C   1 
ATOM   1601 O O   . PRO A 1 209 ? 19.977  -12.495 29.162  1.00 50.71  ? 209 PRO L O   1 
ATOM   1602 C CB  . PRO A 1 209 ? 18.095  -13.227 26.803  1.00 51.51  ? 209 PRO L CB  1 
ATOM   1603 C CG  . PRO A 1 209 ? 17.809  -14.592 26.272  1.00 53.89  ? 209 PRO L CG  1 
ATOM   1604 C CD  . PRO A 1 209 ? 18.868  -15.505 26.867  1.00 57.68  ? 209 PRO L CD  1 
ATOM   1605 N N   . VAL A 1 210 ? 20.732  -11.136 27.545  1.00 47.34  ? 210 VAL L N   1 
ATOM   1606 C CA  . VAL A 1 210 ? 21.245  -10.138 28.476  1.00 43.97  ? 210 VAL L CA  1 
ATOM   1607 C C   . VAL A 1 210 ? 20.288  -8.951  28.481  1.00 41.83  ? 210 VAL L C   1 
ATOM   1608 O O   . VAL A 1 210 ? 19.749  -8.577  27.441  1.00 43.15  ? 210 VAL L O   1 
ATOM   1609 C CB  . VAL A 1 210 ? 22.644  -9.631  28.049  1.00 42.45  ? 210 VAL L CB  1 
ATOM   1610 C CG1 . VAL A 1 210 ? 23.120  -8.551  29.005  1.00 39.58  ? 210 VAL L CG1 1 
ATOM   1611 C CG2 . VAL A 1 210 ? 23.633  -10.781 28.011  1.00 41.16  ? 210 VAL L CG2 1 
ATOM   1612 N N   . THR A 1 211 ? 20.074  -8.359  29.648  1.00 41.07  ? 211 THR L N   1 
ATOM   1613 C CA  . THR A 1 211 ? 19.188  -7.206  29.745  1.00 40.41  ? 211 THR L CA  1 
ATOM   1614 C C   . THR A 1 211 ? 19.825  -6.065  30.523  1.00 42.27  ? 211 THR L C   1 
ATOM   1615 O O   . THR A 1 211 ? 20.371  -6.264  31.609  1.00 41.82  ? 211 THR L O   1 
ATOM   1616 C CB  . THR A 1 211 ? 17.854  -7.536  30.454  1.00 40.71  ? 211 THR L CB  1 
ATOM   1617 O OG1 . THR A 1 211 ? 17.987  -7.254  31.851  1.00 40.66  ? 211 THR L OG1 1 
ATOM   1618 C CG2 . THR A 1 211 ? 17.457  -8.984  30.252  1.00 33.91  ? 211 THR L CG2 1 
ATOM   1619 N N   . LYS A 1 212 ? 19.747  -4.867  29.960  1.00 42.62  ? 212 LYS L N   1 
ATOM   1620 C CA  . LYS A 1 212 ? 20.284  -3.677  30.608  1.00 42.03  ? 212 LYS L CA  1 
ATOM   1621 C C   . LYS A 1 212 ? 19.079  -2.803  30.947  1.00 43.06  ? 212 LYS L C   1 
ATOM   1622 O O   . LYS A 1 212 ? 18.109  -2.775  30.187  1.00 43.41  ? 212 LYS L O   1 
ATOM   1623 C CB  . LYS A 1 212 ? 21.227  -2.940  29.654  1.00 38.37  ? 212 LYS L CB  1 
ATOM   1624 C CG  . LYS A 1 212 ? 22.517  -3.699  29.372  1.00 38.21  ? 212 LYS L CG  1 
ATOM   1625 C CD  . LYS A 1 212 ? 23.451  -3.652  30.566  1.00 36.76  ? 212 LYS L CD  1 
ATOM   1626 C CE  . LYS A 1 212 ? 24.402  -4.827  30.574  1.00 43.09  ? 212 LYS L CE  1 
ATOM   1627 N NZ  . LYS A 1 212 ? 23.690  -6.108  30.791  1.00 48.57  ? 212 LYS L NZ  1 
ATOM   1628 N N   . SER A 1 213 ? 19.121  -2.096  32.075  1.00 40.21  ? 213 SER L N   1 
ATOM   1629 C CA  . SER A 1 213 ? 17.983  -1.266  32.430  1.00 41.76  ? 213 SER L CA  1 
ATOM   1630 C C   . SER A 1 213 ? 18.272  -0.121  33.378  1.00 43.66  ? 213 SER L C   1 
ATOM   1631 O O   . SER A 1 213 ? 19.382  0.025   33.891  1.00 47.34  ? 213 SER L O   1 
ATOM   1632 C CB  . SER A 1 213 ? 16.873  -2.137  33.028  1.00 41.72  ? 213 SER L CB  1 
ATOM   1633 O OG  . SER A 1 213 ? 17.246  -2.708  34.277  1.00 40.59  ? 213 SER L OG  1 
ATOM   1634 N N   . PHE A 1 214 ? 17.252  0.708   33.568  1.00 45.69  ? 214 PHE L N   1 
ATOM   1635 C CA  . PHE A 1 214 ? 17.282  1.843   34.481  1.00 45.58  ? 214 PHE L CA  1 
ATOM   1636 C C   . PHE A 1 214 ? 15.849  1.887   34.996  1.00 48.67  ? 214 PHE L C   1 
ATOM   1637 O O   . PHE A 1 214 ? 15.086  0.968   34.709  1.00 47.33  ? 214 PHE L O   1 
ATOM   1638 C CB  . PHE A 1 214 ? 17.683  3.145   33.763  1.00 44.25  ? 214 PHE L CB  1 
ATOM   1639 C CG  . PHE A 1 214 ? 16.710  3.614   32.716  1.00 45.97  ? 214 PHE L CG  1 
ATOM   1640 C CD1 . PHE A 1 214 ? 16.849  3.215   31.389  1.00 47.25  ? 214 PHE L CD1 1 
ATOM   1641 C CD2 . PHE A 1 214 ? 15.681  4.497   33.046  1.00 46.61  ? 214 PHE L CD2 1 
ATOM   1642 C CE1 . PHE A 1 214 ? 15.979  3.689   30.404  1.00 49.05  ? 214 PHE L CE1 1 
ATOM   1643 C CE2 . PHE A 1 214 ? 14.805  4.976   32.068  1.00 47.52  ? 214 PHE L CE2 1 
ATOM   1644 C CZ  . PHE A 1 214 ? 14.955  4.573   30.746  1.00 50.95  ? 214 PHE L CZ  1 
ATOM   1645 N N   . ASN A 1 215 ? 15.464  2.905   35.756  1.00 51.51  ? 215 ASN L N   1 
ATOM   1646 C CA  . ASN A 1 215 ? 14.089  2.916   36.233  1.00 55.66  ? 215 ASN L CA  1 
ATOM   1647 C C   . ASN A 1 215 ? 13.451  4.271   36.550  1.00 56.62  ? 215 ASN L C   1 
ATOM   1648 O O   . ASN A 1 215 ? 12.256  4.332   36.850  1.00 62.76  ? 215 ASN L O   1 
ATOM   1649 C CB  . ASN A 1 215 ? 13.961  1.984   37.442  1.00 59.91  ? 215 ASN L CB  1 
ATOM   1650 C CG  . ASN A 1 215 ? 14.919  2.340   38.548  1.00 61.50  ? 215 ASN L CG  1 
ATOM   1651 O OD1 . ASN A 1 215 ? 15.729  3.257   38.408  1.00 69.84  ? 215 ASN L OD1 1 
ATOM   1652 N ND2 . ASN A 1 215 ? 14.836  1.619   39.657  1.00 64.92  ? 215 ASN L ND2 1 
ATOM   1653 N N   . ARG A 1 216 ? 14.217  5.356   36.497  1.00 53.92  ? 216 ARG L N   1 
ATOM   1654 C CA  . ARG A 1 216 ? 13.634  6.669   36.770  1.00 53.37  ? 216 ARG L CA  1 
ATOM   1655 C C   . ARG A 1 216 ? 12.536  6.975   35.738  1.00 52.96  ? 216 ARG L C   1 
ATOM   1656 O O   . ARG A 1 216 ? 12.104  6.091   34.998  1.00 53.70  ? 216 ARG L O   1 
ATOM   1657 C CB  . ARG A 1 216 ? 14.714  7.756   36.722  1.00 56.85  ? 216 ARG L CB  1 
ATOM   1658 C CG  . ARG A 1 216 ? 14.649  8.737   37.881  1.00 57.75  ? 216 ARG L CG  1 
ATOM   1659 C CD  . ARG A 1 216 ? 15.159  8.092   39.159  1.00 62.68  ? 216 ARG L CD  1 
ATOM   1660 N NE  . ARG A 1 216 ? 16.427  8.671   39.596  1.00 70.86  ? 216 ARG L NE  1 
ATOM   1661 C CZ  . ARG A 1 216 ? 17.613  8.084   39.452  1.00 75.74  ? 216 ARG L CZ  1 
ATOM   1662 N NH1 . ARG A 1 216 ? 17.707  6.890   38.882  1.00 76.05  ? 216 ARG L NH1 1 
ATOM   1663 N NH2 . ARG A 1 216 ? 18.710  8.694   39.882  1.00 78.05  ? 216 ARG L NH2 1 
ATOM   1664 N N   . GLY A 1 217 ? 12.081  8.224   35.691  1.00 51.41  ? 217 GLY L N   1 
ATOM   1665 C CA  . GLY A 1 217 ? 11.041  8.591   34.743  1.00 47.01  ? 217 GLY L CA  1 
ATOM   1666 C C   . GLY A 1 217 ? 9.636   8.348   35.262  1.00 46.85  ? 217 GLY L C   1 
ATOM   1667 O O   . GLY A 1 217 ? 8.950   9.337   35.589  1.00 46.84  ? 217 GLY L O   1 
ATOM   1668 O OXT . GLY A 1 217 ? 9.213   7.173   35.347  1.00 45.09  ? 217 GLY L OXT 1 
ATOM   1669 N N   . GLN B 2 1   ? 31.208  2.801   -23.879 1.00 100.00 ? 1   GLN H N   1 
ATOM   1670 C CA  . GLN B 2 1   ? 30.758  3.680   -22.761 1.00 99.32  ? 1   GLN H CA  1 
ATOM   1671 C C   . GLN B 2 1   ? 29.313  3.386   -22.378 1.00 98.66  ? 1   GLN H C   1 
ATOM   1672 O O   . GLN B 2 1   ? 29.006  3.177   -21.204 1.00 99.32  ? 1   GLN H O   1 
ATOM   1673 C CB  . GLN B 2 1   ? 30.888  5.155   -23.158 1.00 99.30  ? 1   GLN H CB  1 
ATOM   1674 C CG  . GLN B 2 1   ? 31.496  5.385   -24.538 1.00 99.46  ? 1   GLN H CG  1 
ATOM   1675 C CD  . GLN B 2 1   ? 30.639  6.279   -25.417 1.00 98.88  ? 1   GLN H CD  1 
ATOM   1676 O OE1 . GLN B 2 1   ? 29.423  6.097   -25.514 1.00 97.73  ? 1   GLN H OE1 1 
ATOM   1677 N NE2 . GLN B 2 1   ? 31.272  7.252   -26.066 1.00 98.81  ? 1   GLN H NE2 1 
ATOM   1678 N N   . VAL B 2 2   ? 28.432  3.365   -23.377 1.00 97.10  ? 2   VAL H N   1 
ATOM   1679 C CA  . VAL B 2 2   ? 27.007  3.121   -23.157 1.00 95.08  ? 2   VAL H CA  1 
ATOM   1680 C C   . VAL B 2 2   ? 26.525  4.051   -22.055 1.00 91.07  ? 2   VAL H C   1 
ATOM   1681 O O   . VAL B 2 2   ? 25.419  3.902   -21.540 1.00 92.88  ? 2   VAL H O   1 
ATOM   1682 C CB  . VAL B 2 2   ? 26.721  1.665   -22.719 1.00 97.08  ? 2   VAL H CB  1 
ATOM   1683 C CG1 . VAL B 2 2   ? 25.355  1.246   -23.225 1.00 97.70  ? 2   VAL H CG1 1 
ATOM   1684 C CG2 . VAL B 2 2   ? 27.797  0.725   -23.246 1.00 97.91  ? 2   VAL H CG2 1 
ATOM   1685 N N   . GLN B 2 3   ? 27.377  5.013   -21.711 1.00 84.27  ? 3   GLN H N   1 
ATOM   1686 C CA  . GLN B 2 3   ? 27.108  5.991   -20.667 1.00 73.90  ? 3   GLN H CA  1 
ATOM   1687 C C   . GLN B 2 3   ? 25.645  6.366   -20.546 1.00 63.90  ? 3   GLN H C   1 
ATOM   1688 O O   . GLN B 2 3   ? 24.964  6.582   -21.551 1.00 61.68  ? 3   GLN H O   1 
ATOM   1689 C CB  . GLN B 2 3   ? 27.928  7.256   -20.914 1.00 77.00  ? 3   GLN H CB  1 
ATOM   1690 C CG  . GLN B 2 3   ? 29.427  7.049   -20.825 1.00 78.19  ? 3   GLN H CG  1 
ATOM   1691 C CD  . GLN B 2 3   ? 30.190  8.354   -20.900 1.00 78.86  ? 3   GLN H CD  1 
ATOM   1692 O OE1 . GLN B 2 3   ? 30.343  9.057   -19.898 1.00 79.08  ? 3   GLN H OE1 1 
ATOM   1693 N NE2 . GLN B 2 3   ? 30.670  8.691   -22.091 1.00 75.14  ? 3   GLN H NE2 1 
ATOM   1694 N N   . LEU B 2 4   ? 25.179  6.426   -19.300 1.00 53.25  ? 4   LEU H N   1 
ATOM   1695 C CA  . LEU B 2 4   ? 23.808  6.797   -18.981 1.00 38.60  ? 4   LEU H CA  1 
ATOM   1696 C C   . LEU B 2 4   ? 23.866  7.737   -17.795 1.00 31.68  ? 4   LEU H C   1 
ATOM   1697 O O   . LEU B 2 4   ? 24.162  7.334   -16.672 1.00 30.93  ? 4   LEU H O   1 
ATOM   1698 C CB  . LEU B 2 4   ? 22.977  5.561   -18.650 1.00 38.49  ? 4   LEU H CB  1 
ATOM   1699 C CG  . LEU B 2 4   ? 22.558  4.780   -19.896 1.00 33.69  ? 4   LEU H CG  1 
ATOM   1700 C CD1 . LEU B 2 4   ? 21.606  3.663   -19.507 1.00 28.28  ? 4   LEU H CD1 1 
ATOM   1701 C CD2 . LEU B 2 4   ? 21.871  5.716   -20.874 1.00 31.18  ? 4   LEU H CD2 1 
ATOM   1702 N N   . LEU B 2 5   ? 23.595  9.004   -18.062 1.00 23.87  ? 5   LEU H N   1 
ATOM   1703 C CA  . LEU B 2 5   ? 23.637  10.028  -17.034 1.00 29.34  ? 5   LEU H CA  1 
ATOM   1704 C C   . LEU B 2 5   ? 22.236  10.535  -16.670 1.00 25.49  ? 5   LEU H C   1 
ATOM   1705 O O   . LEU B 2 5   ? 21.570  11.176  -17.486 1.00 29.49  ? 5   LEU H O   1 
ATOM   1706 C CB  . LEU B 2 5   ? 24.524  11.187  -17.519 1.00 20.83  ? 5   LEU H CB  1 
ATOM   1707 C CG  . LEU B 2 5   ? 24.192  12.587  -17.009 1.00 34.58  ? 5   LEU H CG  1 
ATOM   1708 C CD1 . LEU B 2 5   ? 24.953  12.863  -15.730 1.00 31.09  ? 5   LEU H CD1 1 
ATOM   1709 C CD2 . LEU B 2 5   ? 24.519  13.612  -18.085 1.00 33.14  ? 5   LEU H CD2 1 
ATOM   1710 N N   . GLU B 2 6   ? 21.813  10.253  -15.434 1.00 30.66  ? 6   GLU H N   1 
ATOM   1711 C CA  . GLU B 2 6   ? 20.494  10.643  -14.922 1.00 26.56  ? 6   GLU H CA  1 
ATOM   1712 C C   . GLU B 2 6   ? 20.497  11.993  -14.238 1.00 29.33  ? 6   GLU H C   1 
ATOM   1713 O O   . GLU B 2 6   ? 21.558  12.509  -13.863 1.00 30.14  ? 6   GLU H O   1 
ATOM   1714 C CB  . GLU B 2 6   ? 19.979  9.571   -13.955 1.00 26.88  ? 6   GLU H CB  1 
ATOM   1715 C CG  . GLU B 2 6   ? 20.140  8.152   -14.501 1.00 27.32  ? 6   GLU H CG  1 
ATOM   1716 C CD  . GLU B 2 6   ? 19.059  7.189   -14.078 1.00 32.21  ? 6   GLU H CD  1 
ATOM   1717 O OE1 . GLU B 2 6   ? 17.879  7.600   -13.972 1.00 34.88  ? 6   GLU H OE1 1 
ATOM   1718 O OE2 . GLU B 2 6   ? 19.395  6.006   -13.855 1.00 33.12  ? 6   GLU H OE2 1 
ATOM   1719 N N   . SER B 2 7   ? 19.305  12.569  -14.085 1.00 22.75  ? 7   SER H N   1 
ATOM   1720 C CA  . SER B 2 7   ? 19.139  13.875  -13.462 1.00 21.22  ? 7   SER H CA  1 
ATOM   1721 C C   . SER B 2 7   ? 19.283  13.773  -11.931 1.00 19.14  ? 7   SER H C   1 
ATOM   1722 O O   . SER B 2 7   ? 19.279  12.678  -11.388 1.00 21.96  ? 7   SER H O   1 
ATOM   1723 C CB  . SER B 2 7   ? 17.777  14.457  -13.833 1.00 19.78  ? 7   SER H CB  1 
ATOM   1724 O OG  . SER B 2 7   ? 16.796  13.438  -13.794 1.00 20.62  ? 7   SER H OG  1 
ATOM   1725 N N   . GLY B 2 8   ? 19.434  14.916  -11.265 1.00 21.71  ? 8   GLY H N   1 
ATOM   1726 C CA  . GLY B 2 8   ? 19.619  14.938  -9.814  1.00 27.08  ? 8   GLY H CA  1 
ATOM   1727 C C   . GLY B 2 8   ? 18.467  14.390  -8.973  1.00 29.55  ? 8   GLY H C   1 
ATOM   1728 O O   . GLY B 2 8   ? 17.432  14.028  -9.511  1.00 30.80  ? 8   GLY H O   1 
ATOM   1729 N N   . PRO B 2 9   ? 18.633  14.302  -7.640  1.00 32.06  ? 9   PRO H N   1 
ATOM   1730 C CA  . PRO B 2 9   ? 17.597  13.792  -6.739  1.00 26.32  ? 9   PRO H CA  1 
ATOM   1731 C C   . PRO B 2 9   ? 16.400  14.736  -6.691  1.00 25.39  ? 9   PRO H C   1 
ATOM   1732 O O   . PRO B 2 9   ? 16.547  15.943  -6.856  1.00 21.52  ? 9   PRO H O   1 
ATOM   1733 C CB  . PRO B 2 9   ? 18.304  13.681  -5.384  1.00 20.03  ? 9   PRO H CB  1 
ATOM   1734 C CG  . PRO B 2 9   ? 19.441  14.617  -5.456  1.00 26.76  ? 9   PRO H CG  1 
ATOM   1735 C CD  . PRO B 2 9   ? 19.855  14.696  -6.915  1.00 27.96  ? 9   PRO H CD  1 
ATOM   1736 N N   . GLU B 2 10  ? 15.222  14.172  -6.470  1.00 25.87  ? 10  GLU H N   1 
ATOM   1737 C CA  . GLU B 2 10  ? 13.992  14.962  -6.447  1.00 26.63  ? 10  GLU H CA  1 
ATOM   1738 C C   . GLU B 2 10  ? 13.206  14.840  -5.143  1.00 21.66  ? 10  GLU H C   1 
ATOM   1739 O O   . GLU B 2 10  ? 12.994  13.753  -4.648  1.00 18.80  ? 10  GLU H O   1 
ATOM   1740 C CB  . GLU B 2 10  ? 13.094  14.528  -7.617  1.00 30.67  ? 10  GLU H CB  1 
ATOM   1741 C CG  . GLU B 2 10  ? 13.714  14.739  -9.001  1.00 33.48  ? 10  GLU H CG  1 
ATOM   1742 C CD  . GLU B 2 10  ? 13.355  16.091  -9.608  1.00 41.80  ? 10  GLU H CD  1 
ATOM   1743 O OE1 . GLU B 2 10  ? 12.487  16.791  -9.045  1.00 44.54  ? 10  GLU H OE1 1 
ATOM   1744 O OE2 . GLU B 2 10  ? 13.937  16.458  -10.651 1.00 41.42  ? 10  GLU H OE2 1 
ATOM   1745 N N   . LEU B 2 11  ? 12.771  15.973  -4.614  1.00 21.44  ? 11  LEU H N   1 
ATOM   1746 C CA  . LEU B 2 11  ? 11.978  16.020  -3.384  1.00 27.74  ? 11  LEU H CA  1 
ATOM   1747 C C   . LEU B 2 11  ? 10.616  16.563  -3.805  1.00 25.05  ? 11  LEU H C   1 
ATOM   1748 O O   . LEU B 2 11  ? 10.527  17.709  -4.244  1.00 25.63  ? 11  LEU H O   1 
ATOM   1749 C CB  . LEU B 2 11  ? 12.632  16.971  -2.365  1.00 28.77  ? 11  LEU H CB  1 
ATOM   1750 C CG  . LEU B 2 11  ? 12.370  16.843  -0.850  1.00 34.04  ? 11  LEU H CG  1 
ATOM   1751 C CD1 . LEU B 2 11  ? 11.985  18.206  -0.306  1.00 31.77  ? 11  LEU H CD1 1 
ATOM   1752 C CD2 . LEU B 2 11  ? 11.298  15.831  -0.551  1.00 31.36  ? 11  LEU H CD2 1 
ATOM   1753 N N   . LYS B 2 12  ? 9.573   15.739  -3.680  1.00 28.09  ? 12  LYS H N   1 
ATOM   1754 C CA  . LYS B 2 12  ? 8.215   16.121  -4.075  1.00 28.01  ? 12  LYS H CA  1 
ATOM   1755 C C   . LYS B 2 12  ? 7.169   15.923  -2.976  1.00 27.06  ? 12  LYS H C   1 
ATOM   1756 O O   . LYS B 2 12  ? 7.418   15.242  -1.990  1.00 31.09  ? 12  LYS H O   1 
ATOM   1757 C CB  . LYS B 2 12  ? 7.793   15.306  -5.305  1.00 26.47  ? 12  LYS H CB  1 
ATOM   1758 C CG  . LYS B 2 12  ? 8.711   15.458  -6.508  1.00 21.75  ? 12  LYS H CG  1 
ATOM   1759 C CD  . LYS B 2 12  ? 8.136   16.433  -7.484  1.00 24.29  ? 12  LYS H CD  1 
ATOM   1760 C CE  . LYS B 2 12  ? 8.844   17.757  -7.448  1.00 26.97  ? 12  LYS H CE  1 
ATOM   1761 N NZ  . LYS B 2 12  ? 9.458   18.056  -8.766  1.00 31.04  ? 12  LYS H NZ  1 
ATOM   1762 N N   . LYS B 2 13  ? 6.000   16.535  -3.179  1.00 29.65  ? 13  LYS H N   1 
ATOM   1763 C CA  . LYS B 2 13  ? 4.853   16.436  -2.270  1.00 27.12  ? 13  LYS H CA  1 
ATOM   1764 C C   . LYS B 2 13  ? 3.769   15.632  -2.998  1.00 25.11  ? 13  LYS H C   1 
ATOM   1765 O O   . LYS B 2 13  ? 3.698   15.671  -4.227  1.00 28.89  ? 13  LYS H O   1 
ATOM   1766 C CB  . LYS B 2 13  ? 4.315   17.829  -1.951  1.00 26.22  ? 13  LYS H CB  1 
ATOM   1767 C CG  . LYS B 2 13  ? 5.295   18.708  -1.205  1.00 29.78  ? 13  LYS H CG  1 
ATOM   1768 C CD  . LYS B 2 13  ? 4.727   20.081  -0.942  1.00 32.25  ? 13  LYS H CD  1 
ATOM   1769 C CE  . LYS B 2 13  ? 5.839   21.077  -0.628  1.00 32.36  ? 13  LYS H CE  1 
ATOM   1770 N NZ  . LYS B 2 13  ? 6.163   21.928  -1.824  1.00 44.56  ? 13  LYS H NZ  1 
ATOM   1771 N N   . PRO B 2 14  ? 2.932   14.874  -2.261  1.00 23.98  ? 14  PRO H N   1 
ATOM   1772 C CA  . PRO B 2 14  ? 1.873   14.074  -2.899  1.00 23.64  ? 14  PRO H CA  1 
ATOM   1773 C C   . PRO B 2 14  ? 1.039   14.841  -3.927  1.00 22.94  ? 14  PRO H C   1 
ATOM   1774 O O   . PRO B 2 14  ? 0.732   16.012  -3.733  1.00 21.45  ? 14  PRO H O   1 
ATOM   1775 C CB  . PRO B 2 14  ? 1.024   13.601  -1.715  1.00 27.87  ? 14  PRO H CB  1 
ATOM   1776 C CG  . PRO B 2 14  ? 2.039   13.519  -0.564  1.00 19.88  ? 14  PRO H CG  1 
ATOM   1777 C CD  . PRO B 2 14  ? 2.942   14.710  -0.792  1.00 24.76  ? 14  PRO H CD  1 
ATOM   1778 N N   . GLY B 2 15  ? 0.708   14.180  -5.036  1.00 21.91  ? 15  GLY H N   1 
ATOM   1779 C CA  . GLY B 2 15  ? -0.098  14.818  -6.073  1.00 21.34  ? 15  GLY H CA  1 
ATOM   1780 C C   . GLY B 2 15  ? 0.633   15.647  -7.127  1.00 25.75  ? 15  GLY H C   1 
ATOM   1781 O O   . GLY B 2 15  ? 0.045   16.054  -8.127  1.00 17.16  ? 15  GLY H O   1 
ATOM   1782 N N   . GLU B 2 16  ? 1.915   15.909  -6.904  1.00 22.94  ? 16  GLU H N   1 
ATOM   1783 C CA  . GLU B 2 16  ? 2.700   16.683  -7.852  1.00 26.00  ? 16  GLU H CA  1 
ATOM   1784 C C   . GLU B 2 16  ? 3.171   15.761  -8.979  1.00 24.68  ? 16  GLU H C   1 
ATOM   1785 O O   . GLU B 2 16  ? 2.858   14.572  -8.981  1.00 26.28  ? 16  GLU H O   1 
ATOM   1786 C CB  . GLU B 2 16  ? 3.901   17.313  -7.131  1.00 16.73  ? 16  GLU H CB  1 
ATOM   1787 C CG  . GLU B 2 16  ? 3.503   18.358  -6.108  1.00 18.98  ? 16  GLU H CG  1 
ATOM   1788 C CD  . GLU B 2 16  ? 4.672   19.132  -5.550  1.00 24.82  ? 16  GLU H CD  1 
ATOM   1789 O OE1 . GLU B 2 16  ? 5.804   18.622  -5.586  1.00 25.43  ? 16  GLU H OE1 1 
ATOM   1790 O OE2 . GLU B 2 16  ? 4.455   20.263  -5.071  1.00 32.38  ? 16  GLU H OE2 1 
ATOM   1791 N N   . THR B 2 17  ? 3.904   16.320  -9.938  1.00 26.38  ? 17  THR H N   1 
ATOM   1792 C CA  . THR B 2 17  ? 4.448   15.565  -11.075 1.00 28.00  ? 17  THR H CA  1 
ATOM   1793 C C   . THR B 2 17  ? 5.972   15.687  -11.092 1.00 22.01  ? 17  THR H C   1 
ATOM   1794 O O   . THR B 2 17  ? 6.519   16.720  -10.692 1.00 22.78  ? 17  THR H O   1 
ATOM   1795 C CB  . THR B 2 17  ? 3.918   16.115  -12.442 1.00 24.00  ? 17  THR H CB  1 
ATOM   1796 O OG1 . THR B 2 17  ? 2.527   15.816  -12.568 1.00 26.52  ? 17  THR H OG1 1 
ATOM   1797 C CG2 . THR B 2 17  ? 4.670   15.454  -13.647 1.00 19.36  ? 17  THR H CG2 1 
ATOM   1798 N N   . VAL B 2 18  ? 6.656   14.620  -11.498 1.00 29.92  ? 18  VAL H N   1 
ATOM   1799 C CA  . VAL B 2 18  ? 8.122   14.652  -11.621 1.00 26.44  ? 18  VAL H CA  1 
ATOM   1800 C C   . VAL B 2 18  ? 8.509   14.179  -13.015 1.00 27.27  ? 18  VAL H C   1 
ATOM   1801 O O   . VAL B 2 18  ? 7.846   13.319  -13.586 1.00 23.13  ? 18  VAL H O   1 
ATOM   1802 C CB  . VAL B 2 18  ? 8.914   13.666  -10.697 1.00 29.15  ? 18  VAL H CB  1 
ATOM   1803 C CG1 . VAL B 2 18  ? 9.867   14.436  -9.806  1.00 29.47  ? 18  VAL H CG1 1 
ATOM   1804 C CG2 . VAL B 2 18  ? 8.005   12.752  -9.954  1.00 36.30  ? 18  VAL H CG2 1 
ATOM   1805 N N   . LYS B 2 19  ? 9.617   14.718  -13.517 1.00 19.63  ? 19  LYS H N   1 
ATOM   1806 C CA  . LYS B 2 19  ? 10.163  14.333  -14.809 1.00 23.88  ? 19  LYS H CA  1 
ATOM   1807 C C   . LYS B 2 19  ? 11.666  14.086  -14.625 1.00 19.67  ? 19  LYS H C   1 
ATOM   1808 O O   . LYS B 2 19  ? 12.420  14.996  -14.304 1.00 17.06  ? 19  LYS H O   1 
ATOM   1809 C CB  . LYS B 2 19  ? 9.929   15.423  -15.849 1.00 28.09  ? 19  LYS H CB  1 
ATOM   1810 C CG  . LYS B 2 19  ? 10.222  14.931  -17.262 1.00 30.72  ? 19  LYS H CG  1 
ATOM   1811 C CD  . LYS B 2 19  ? 9.211   15.461  -18.229 1.00 30.74  ? 19  LYS H CD  1 
ATOM   1812 C CE  . LYS B 2 19  ? 9.543   15.027  -19.642 1.00 31.37  ? 19  LYS H CE  1 
ATOM   1813 N NZ  . LYS B 2 19  ? 8.973   16.006  -20.602 1.00 33.70  ? 19  LYS H NZ  1 
ATOM   1814 N N   . ILE B 2 20  ? 12.065  12.831  -14.751 1.00 19.23  ? 20  ILE H N   1 
ATOM   1815 C CA  . ILE B 2 20  ? 13.460  12.432  -14.605 1.00 27.66  ? 20  ILE H CA  1 
ATOM   1816 C C   . ILE B 2 20  ? 14.027  12.226  -16.014 1.00 28.17  ? 20  ILE H C   1 
ATOM   1817 O O   . ILE B 2 20  ? 13.320  11.752  -16.907 1.00 27.07  ? 20  ILE H O   1 
ATOM   1818 C CB  . ILE B 2 20  ? 13.552  11.106  -13.834 1.00 22.08  ? 20  ILE H CB  1 
ATOM   1819 C CG1 . ILE B 2 20  ? 13.160  11.327  -12.380 1.00 28.90  ? 20  ILE H CG1 1 
ATOM   1820 C CG2 . ILE B 2 20  ? 14.931  10.529  -13.944 1.00 30.53  ? 20  ILE H CG2 1 
ATOM   1821 C CD1 . ILE B 2 20  ? 13.038  10.021  -11.605 1.00 23.55  ? 20  ILE H CD1 1 
ATOM   1822 N N   . SER B 2 21  ? 15.288  12.594  -16.220 1.00 28.36  ? 21  SER H N   1 
ATOM   1823 C CA  . SER B 2 21  ? 15.904  12.414  -17.531 1.00 29.63  ? 21  SER H CA  1 
ATOM   1824 C C   . SER B 2 21  ? 17.069  11.440  -17.470 1.00 30.03  ? 21  SER H C   1 
ATOM   1825 O O   . SER B 2 21  ? 17.628  11.180  -16.403 1.00 23.68  ? 21  SER H O   1 
ATOM   1826 C CB  . SER B 2 21  ? 16.396  13.750  -18.095 1.00 27.89  ? 21  SER H CB  1 
ATOM   1827 O OG  . SER B 2 21  ? 17.404  14.311  -17.267 1.00 31.76  ? 21  SER H OG  1 
ATOM   1828 N N   . CYS B 2 22  ? 17.412  10.897  -18.635 1.00 33.12  ? 22  CYS H N   1 
ATOM   1829 C CA  . CYS B 2 22  ? 18.515  9.975   -18.777 1.00 32.42  ? 22  CYS H CA  1 
ATOM   1830 C C   . CYS B 2 22  ? 19.172  10.228  -20.137 1.00 37.37  ? 22  CYS H C   1 
ATOM   1831 O O   . CYS B 2 22  ? 18.638  9.857   -21.173 1.00 34.94  ? 22  CYS H O   1 
ATOM   1832 C CB  . CYS B 2 22  ? 18.026  8.541   -18.714 1.00 38.36  ? 22  CYS H CB  1 
ATOM   1833 S SG  . CYS B 2 22  ? 19.419  7.387   -18.679 1.00 39.85  ? 22  CYS H SG  1 
ATOM   1834 N N   . LYS B 2 23  ? 20.332  10.874  -20.118 1.00 37.98  ? 23  LYS H N   1 
ATOM   1835 C CA  . LYS B 2 23  ? 21.064  11.182  -21.338 1.00 40.43  ? 23  LYS H CA  1 
ATOM   1836 C C   . LYS B 2 23  ? 22.006  10.032  -21.646 1.00 36.53  ? 23  LYS H C   1 
ATOM   1837 O O   . LYS B 2 23  ? 22.805  9.622   -20.800 1.00 34.83  ? 23  LYS H O   1 
ATOM   1838 C CB  . LYS B 2 23  ? 21.863  12.474  -21.163 1.00 43.65  ? 23  LYS H CB  1 
ATOM   1839 C CG  . LYS B 2 23  ? 21.640  13.495  -22.273 1.00 48.73  ? 23  LYS H CG  1 
ATOM   1840 C CD  . LYS B 2 23  ? 21.082  14.804  -21.715 1.00 46.14  ? 23  LYS H CD  1 
ATOM   1841 C CE  . LYS B 2 23  ? 20.970  15.878  -22.797 1.00 47.48  ? 23  LYS H CE  1 
ATOM   1842 N NZ  . LYS B 2 23  ? 22.289  16.334  -23.327 1.00 35.18  ? 23  LYS H NZ  1 
ATOM   1843 N N   . ALA B 2 24  ? 21.872  9.492   -22.848 1.00 29.57  ? 24  ALA H N   1 
ATOM   1844 C CA  . ALA B 2 24  ? 22.706  8.396   -23.288 1.00 32.78  ? 24  ALA H CA  1 
ATOM   1845 C C   . ALA B 2 24  ? 23.595  8.890   -24.428 1.00 33.41  ? 24  ALA H C   1 
ATOM   1846 O O   . ALA B 2 24  ? 23.312  9.912   -25.052 1.00 39.33  ? 24  ALA H O   1 
ATOM   1847 C CB  . ALA B 2 24  ? 21.843  7.245   -23.761 1.00 27.19  ? 24  ALA H CB  1 
ATOM   1848 N N   . SER B 2 25  ? 24.675  8.171   -24.699 1.00 39.00  ? 25  SER H N   1 
ATOM   1849 C CA  . SER B 2 25  ? 25.568  8.568   -25.781 1.00 40.96  ? 25  SER H CA  1 
ATOM   1850 C C   . SER B 2 25  ? 24.923  8.139   -27.087 1.00 43.19  ? 25  SER H C   1 
ATOM   1851 O O   . SER B 2 25  ? 24.393  7.029   -27.178 1.00 38.35  ? 25  SER H O   1 
ATOM   1852 C CB  . SER B 2 25  ? 26.935  7.887   -25.627 1.00 44.59  ? 25  SER H CB  1 
ATOM   1853 O OG  . SER B 2 25  ? 26.798  6.482   -25.465 1.00 43.09  ? 25  SER H OG  1 
ATOM   1854 N N   . GLY B 2 26  ? 24.956  9.015   -28.089 1.00 46.66  ? 26  GLY H N   1 
ATOM   1855 C CA  . GLY B 2 26  ? 24.381  8.675   -29.380 1.00 58.14  ? 26  GLY H CA  1 
ATOM   1856 C C   . GLY B 2 26  ? 25.035  7.439   -29.975 1.00 64.90  ? 26  GLY H C   1 
ATOM   1857 O O   . GLY B 2 26  ? 25.385  6.503   -29.253 1.00 70.51  ? 26  GLY H O   1 
ATOM   1858 N N   . TYR B 2 27  ? 25.209  7.432   -31.293 1.00 69.40  ? 27  TYR H N   1 
ATOM   1859 C CA  . TYR B 2 27  ? 25.829  6.307   -32.000 1.00 71.93  ? 27  TYR H CA  1 
ATOM   1860 C C   . TYR B 2 27  ? 25.634  4.958   -31.312 1.00 70.35  ? 27  TYR H C   1 
ATOM   1861 O O   . TYR B 2 27  ? 26.572  4.166   -31.214 1.00 77.26  ? 27  TYR H O   1 
ATOM   1862 C CB  . TYR B 2 27  ? 27.335  6.552   -32.199 1.00 73.65  ? 27  TYR H CB  1 
ATOM   1863 C CG  . TYR B 2 27  ? 27.891  7.734   -31.436 1.00 75.12  ? 27  TYR H CG  1 
ATOM   1864 C CD1 . TYR B 2 27  ? 28.326  7.598   -30.121 1.00 75.44  ? 27  TYR H CD1 1 
ATOM   1865 C CD2 . TYR B 2 27  ? 27.979  8.992   -32.031 1.00 74.56  ? 27  TYR H CD2 1 
ATOM   1866 C CE1 . TYR B 2 27  ? 28.835  8.686   -29.420 1.00 77.22  ? 27  TYR H CE1 1 
ATOM   1867 C CE2 . TYR B 2 27  ? 28.483  10.081  -31.346 1.00 75.04  ? 27  TYR H CE2 1 
ATOM   1868 C CZ  . TYR B 2 27  ? 28.909  9.925   -30.041 1.00 76.87  ? 27  TYR H CZ  1 
ATOM   1869 O OH  . TYR B 2 27  ? 29.409  11.010  -29.360 1.00 80.21  ? 27  TYR H OH  1 
ATOM   1870 N N   . THR B 2 28  ? 24.418  4.706   -30.835 1.00 63.62  ? 28  THR H N   1 
ATOM   1871 C CA  . THR B 2 28  ? 24.076  3.454   -30.163 1.00 55.35  ? 28  THR H CA  1 
ATOM   1872 C C   . THR B 2 28  ? 22.747  3.601   -29.420 1.00 50.38  ? 28  THR H C   1 
ATOM   1873 O O   . THR B 2 28  ? 22.221  2.638   -28.864 1.00 48.01  ? 28  THR H O   1 
ATOM   1874 C CB  . THR B 2 28  ? 25.192  3.004   -29.175 1.00 53.47  ? 28  THR H CB  1 
ATOM   1875 O OG1 . THR B 2 28  ? 25.346  1.579   -29.250 1.00 50.81  ? 28  THR H OG1 1 
ATOM   1876 C CG2 . THR B 2 28  ? 24.865  3.409   -27.742 1.00 45.76  ? 28  THR H CG2 1 
ATOM   1877 N N   . PHE B 2 29  ? 22.216  4.820   -29.432 1.00 47.27  ? 29  PHE H N   1 
ATOM   1878 C CA  . PHE B 2 29  ? 20.937  5.144   -28.795 1.00 42.88  ? 29  PHE H CA  1 
ATOM   1879 C C   . PHE B 2 29  ? 19.832  4.247   -29.342 1.00 43.13  ? 29  PHE H C   1 
ATOM   1880 O O   . PHE B 2 29  ? 19.122  3.607   -28.575 1.00 42.20  ? 29  PHE H O   1 
ATOM   1881 C CB  . PHE B 2 29  ? 20.585  6.603   -29.068 1.00 41.84  ? 29  PHE H CB  1 
ATOM   1882 C CG  . PHE B 2 29  ? 19.446  7.131   -28.237 1.00 44.55  ? 29  PHE H CG  1 
ATOM   1883 C CD1 . PHE B 2 29  ? 19.551  7.217   -26.852 1.00 42.08  ? 29  PHE H CD1 1 
ATOM   1884 C CD2 . PHE B 2 29  ? 18.280  7.594   -28.849 1.00 41.82  ? 29  PHE H CD2 1 
ATOM   1885 C CE1 . PHE B 2 29  ? 18.513  7.761   -26.089 1.00 39.50  ? 29  PHE H CE1 1 
ATOM   1886 C CE2 . PHE B 2 29  ? 17.243  8.137   -28.099 1.00 36.01  ? 29  PHE H CE2 1 
ATOM   1887 C CZ  . PHE B 2 29  ? 17.360  8.220   -26.713 1.00 34.80  ? 29  PHE H CZ  1 
ATOM   1888 N N   . THR B 2 30  ? 19.695  4.193   -30.670 1.00 38.81  ? 30  THR H N   1 
ATOM   1889 C CA  . THR B 2 30  ? 18.661  3.365   -31.282 1.00 37.63  ? 30  THR H CA  1 
ATOM   1890 C C   . THR B 2 30  ? 19.040  1.889   -31.336 1.00 37.58  ? 30  THR H C   1 
ATOM   1891 O O   . THR B 2 30  ? 18.324  1.084   -31.921 1.00 34.49  ? 30  THR H O   1 
ATOM   1892 C CB  . THR B 2 30  ? 18.311  3.824   -32.735 1.00 40.60  ? 30  THR H CB  1 
ATOM   1893 O OG1 . THR B 2 30  ? 19.484  3.746   -33.560 1.00 43.66  ? 30  THR H OG1 1 
ATOM   1894 C CG2 . THR B 2 30  ? 17.768  5.260   -32.743 1.00 35.82  ? 30  THR H CG2 1 
ATOM   1895 N N   . ASN B 2 31  ? 20.153  1.517   -30.721 1.00 36.53  ? 31  ASN H N   1 
ATOM   1896 C CA  . ASN B 2 31  ? 20.550  0.115   -30.750 1.00 39.49  ? 31  ASN H CA  1 
ATOM   1897 C C   . ASN B 2 31  ? 20.112  -0.671  -29.510 1.00 37.97  ? 31  ASN H C   1 
ATOM   1898 O O   . ASN B 2 31  ? 20.382  -1.869  -29.403 1.00 36.38  ? 31  ASN H O   1 
ATOM   1899 C CB  . ASN B 2 31  ? 22.068  0.003   -30.939 1.00 44.93  ? 31  ASN H CB  1 
ATOM   1900 C CG  . ASN B 2 31  ? 22.511  0.429   -32.326 1.00 45.53  ? 31  ASN H CG  1 
ATOM   1901 O OD1 . ASN B 2 31  ? 22.878  1.581   -32.545 1.00 49.36  ? 31  ASN H OD1 1 
ATOM   1902 N ND2 . ASN B 2 31  ? 22.472  -0.501  -33.272 1.00 50.68  ? 31  ASN H ND2 1 
ATOM   1903 N N   . TYR B 2 32  ? 19.434  0.002   -28.582 1.00 34.62  ? 32  TYR H N   1 
ATOM   1904 C CA  . TYR B 2 32  ? 18.954  -0.642  -27.366 1.00 30.19  ? 32  TYR H CA  1 
ATOM   1905 C C   . TYR B 2 32  ? 17.523  -0.216  -27.055 1.00 29.80  ? 32  TYR H C   1 
ATOM   1906 O O   . TYR B 2 32  ? 17.062  0.819   -27.510 1.00 24.01  ? 32  TYR H O   1 
ATOM   1907 C CB  . TYR B 2 32  ? 19.798  -0.253  -26.136 1.00 29.28  ? 32  TYR H CB  1 
ATOM   1908 C CG  . TYR B 2 32  ? 21.256  -0.640  -26.180 1.00 26.86  ? 32  TYR H CG  1 
ATOM   1909 C CD1 . TYR B 2 32  ? 21.664  -1.927  -25.839 1.00 22.79  ? 32  TYR H CD1 1 
ATOM   1910 C CD2 . TYR B 2 32  ? 22.223  0.280   -26.593 1.00 30.34  ? 32  TYR H CD2 1 
ATOM   1911 C CE1 . TYR B 2 32  ? 23.000  -2.299  -25.915 1.00 36.18  ? 32  TYR H CE1 1 
ATOM   1912 C CE2 . TYR B 2 32  ? 23.573  -0.077  -26.675 1.00 39.48  ? 32  TYR H CE2 1 
ATOM   1913 C CZ  . TYR B 2 32  ? 23.954  -1.367  -26.338 1.00 38.76  ? 32  TYR H CZ  1 
ATOM   1914 O OH  . TYR B 2 32  ? 25.275  -1.732  -26.444 1.00 45.02  ? 32  TYR H OH  1 
ATOM   1915 N N   . GLY B 2 33  ? 16.829  -1.033  -26.274 1.00 30.31  ? 33  GLY H N   1 
ATOM   1916 C CA  . GLY B 2 33  ? 15.494  -0.667  -25.845 1.00 30.91  ? 33  GLY H CA  1 
ATOM   1917 C C   . GLY B 2 33  ? 15.776  0.097   -24.560 1.00 27.01  ? 33  GLY H C   1 
ATOM   1918 O O   . GLY B 2 33  ? 16.678  -0.301  -23.807 1.00 17.90  ? 33  GLY H O   1 
ATOM   1919 N N   . MET B 2 34  ? 15.064  1.196   -24.322 1.00 17.87  ? 34  MET H N   1 
ATOM   1920 C CA  . MET B 2 34  ? 15.276  1.972   -23.113 1.00 22.08  ? 34  MET H CA  1 
ATOM   1921 C C   . MET B 2 34  ? 14.241  1.588   -22.054 1.00 27.37  ? 34  MET H C   1 
ATOM   1922 O O   . MET B 2 34  ? 13.081  2.029   -22.116 1.00 21.43  ? 34  MET H O   1 
ATOM   1923 C CB  . MET B 2 34  ? 15.170  3.466   -23.405 1.00 16.73  ? 34  MET H CB  1 
ATOM   1924 C CG  . MET B 2 34  ? 15.535  4.334   -22.204 1.00 29.98  ? 34  MET H CG  1 
ATOM   1925 S SD  . MET B 2 34  ? 17.264  4.100   -21.574 1.00 42.12  ? 34  MET H SD  1 
ATOM   1926 C CE  . MET B 2 34  ? 18.101  5.375   -22.527 1.00 26.43  ? 34  MET H CE  1 
ATOM   1927 N N   . ASN B 2 35  ? 14.670  0.758   -21.101 1.00 21.88  ? 35  ASN H N   1 
ATOM   1928 C CA  . ASN B 2 35  ? 13.809  0.307   -20.025 1.00 21.81  ? 35  ASN H CA  1 
ATOM   1929 C C   . ASN B 2 35  ? 13.934  1.183   -18.789 1.00 20.78  ? 35  ASN H C   1 
ATOM   1930 O O   . ASN B 2 35  ? 14.807  2.057   -18.686 1.00 18.90  ? 35  ASN H O   1 
ATOM   1931 C CB  . ASN B 2 35  ? 14.136  -1.145  -19.651 1.00 15.20  ? 35  ASN H CB  1 
ATOM   1932 C CG  . ASN B 2 35  ? 13.964  -2.106  -20.799 1.00 18.62  ? 35  ASN H CG  1 
ATOM   1933 O OD1 . ASN B 2 35  ? 13.212  -3.073  -20.699 1.00 19.84  ? 35  ASN H OD1 1 
ATOM   1934 N ND2 . ASN B 2 35  ? 14.679  -1.856  -21.903 1.00 16.69  ? 35  ASN H ND2 1 
ATOM   1935 N N   . TRP B 2 36  ? 13.041  0.952   -17.840 1.00 25.62  ? 36  TRP H N   1 
ATOM   1936 C CA  . TRP B 2 36  ? 13.049  1.706   -16.593 1.00 23.42  ? 36  TRP H CA  1 
ATOM   1937 C C   . TRP B 2 36  ? 12.695  0.755   -15.455 1.00 26.28  ? 36  TRP H C   1 
ATOM   1938 O O   . TRP B 2 36  ? 11.762  -0.029  -15.577 1.00 15.10  ? 36  TRP H O   1 
ATOM   1939 C CB  . TRP B 2 36  ? 12.026  2.846   -16.643 1.00 29.19  ? 36  TRP H CB  1 
ATOM   1940 C CG  . TRP B 2 36  ? 12.397  4.036   -17.526 1.00 22.87  ? 36  TRP H CG  1 
ATOM   1941 C CD1 . TRP B 2 36  ? 11.971  4.262   -18.798 1.00 14.15  ? 36  TRP H CD1 1 
ATOM   1942 C CD2 . TRP B 2 36  ? 13.183  5.189   -17.156 1.00 18.91  ? 36  TRP H CD2 1 
ATOM   1943 N NE1 . TRP B 2 36  ? 12.421  5.480   -19.248 1.00 18.06  ? 36  TRP H NE1 1 
ATOM   1944 C CE2 . TRP B 2 36  ? 13.171  6.072   -18.262 1.00 16.62  ? 36  TRP H CE2 1 
ATOM   1945 C CE3 . TRP B 2 36  ? 13.889  5.561   -15.999 1.00 22.07  ? 36  TRP H CE3 1 
ATOM   1946 C CZ2 . TRP B 2 36  ? 13.835  7.305   -18.251 1.00 15.21  ? 36  TRP H CZ2 1 
ATOM   1947 C CZ3 . TRP B 2 36  ? 14.549  6.806   -15.980 1.00 16.80  ? 36  TRP H CZ3 1 
ATOM   1948 C CH2 . TRP B 2 36  ? 14.515  7.662   -17.105 1.00 11.15  ? 36  TRP H CH2 1 
ATOM   1949 N N   . VAL B 2 37  ? 13.476  0.778   -14.376 1.00 25.49  ? 37  VAL H N   1 
ATOM   1950 C CA  . VAL B 2 37  ? 13.174  -0.083  -13.243 1.00 24.66  ? 37  VAL H CA  1 
ATOM   1951 C C   . VAL B 2 37  ? 13.256  0.719   -11.949 1.00 23.46  ? 37  VAL H C   1 
ATOM   1952 O O   . VAL B 2 37  ? 14.100  1.623   -11.787 1.00 13.42  ? 37  VAL H O   1 
ATOM   1953 C CB  . VAL B 2 37  ? 14.050  -1.401  -13.223 1.00 26.81  ? 37  VAL H CB  1 
ATOM   1954 C CG1 . VAL B 2 37  ? 14.779  -1.566  -14.543 1.00 14.59  ? 37  VAL H CG1 1 
ATOM   1955 C CG2 . VAL B 2 37  ? 14.981  -1.431  -12.030 1.00 23.61  ? 37  VAL H CG2 1 
ATOM   1956 N N   . LYS B 2 38  ? 12.329  0.403   -11.047 1.00 18.77  ? 38  LYS H N   1 
ATOM   1957 C CA  . LYS B 2 38  ? 12.205  1.121   -9.788  1.00 14.33  ? 38  LYS H CA  1 
ATOM   1958 C C   . LYS B 2 38  ? 12.771  0.259   -8.701  1.00 13.20  ? 38  LYS H C   1 
ATOM   1959 O O   . LYS B 2 38  ? 12.690  -0.958  -8.782  1.00 19.46  ? 38  LYS H O   1 
ATOM   1960 C CB  . LYS B 2 38  ? 10.708  1.418   -9.492  1.00 20.71  ? 38  LYS H CB  1 
ATOM   1961 C CG  . LYS B 2 38  ? 10.379  1.769   -8.012  1.00 19.62  ? 38  LYS H CG  1 
ATOM   1962 C CD  . LYS B 2 38  ? 8.854   1.740   -7.730  1.00 13.58  ? 38  LYS H CD  1 
ATOM   1963 C CE  . LYS B 2 38  ? 8.446   2.669   -6.586  1.00 25.14  ? 38  LYS H CE  1 
ATOM   1964 N NZ  . LYS B 2 38  ? 6.923   2.699   -6.447  1.00 23.56  ? 38  LYS H NZ  1 
ATOM   1965 N N   . GLN B 2 39  ? 13.338  0.896   -7.682  1.00 16.03  ? 39  GLN H N   1 
ATOM   1966 C CA  . GLN B 2 39  ? 13.881  0.170   -6.543  1.00 21.93  ? 39  GLN H CA  1 
ATOM   1967 C C   . GLN B 2 39  ? 13.490  0.980   -5.345  1.00 25.26  ? 39  GLN H C   1 
ATOM   1968 O O   . GLN B 2 39  ? 14.027  2.065   -5.124  1.00 26.07  ? 39  GLN H O   1 
ATOM   1969 C CB  . GLN B 2 39  ? 15.429  0.042   -6.598  1.00 23.39  ? 39  GLN H CB  1 
ATOM   1970 C CG  . GLN B 2 39  ? 15.977  -0.915  -5.516  1.00 19.03  ? 39  GLN H CG  1 
ATOM   1971 C CD  . GLN B 2 39  ? 17.417  -1.322  -5.735  1.00 21.62  ? 39  GLN H CD  1 
ATOM   1972 O OE1 . GLN B 2 39  ? 18.271  -0.494  -6.018  1.00 18.72  ? 39  GLN H OE1 1 
ATOM   1973 N NE2 . GLN B 2 39  ? 17.685  -2.599  -5.606  1.00 20.57  ? 39  GLN H NE2 1 
ATOM   1974 N N   . ALA B 2 40  ? 12.502  0.481   -4.607  1.00 30.99  ? 40  ALA H N   1 
ATOM   1975 C CA  . ALA B 2 40  ? 12.048  1.155   -3.403  1.00 29.64  ? 40  ALA H CA  1 
ATOM   1976 C C   . ALA B 2 40  ? 13.059  0.850   -2.311  1.00 35.68  ? 40  ALA H C   1 
ATOM   1977 O O   . ALA B 2 40  ? 13.640  -0.243  -2.273  1.00 37.69  ? 40  ALA H O   1 
ATOM   1978 C CB  . ALA B 2 40  ? 10.665  0.642   -2.997  1.00 32.10  ? 40  ALA H CB  1 
ATOM   1979 N N   . PRO B 2 41  ? 13.300  1.816   -1.411  1.00 38.55  ? 41  PRO H N   1 
ATOM   1980 C CA  . PRO B 2 41  ? 14.251  1.633   -0.314  1.00 41.75  ? 41  PRO H CA  1 
ATOM   1981 C C   . PRO B 2 41  ? 14.240  0.213   0.258   1.00 45.12  ? 41  PRO H C   1 
ATOM   1982 O O   . PRO B 2 41  ? 13.246  -0.236  0.841   1.00 40.40  ? 41  PRO H O   1 
ATOM   1983 C CB  . PRO B 2 41  ? 13.806  2.673   0.704   1.00 41.82  ? 41  PRO H CB  1 
ATOM   1984 C CG  . PRO B 2 41  ? 13.275  3.803   -0.159  1.00 42.76  ? 41  PRO H CG  1 
ATOM   1985 C CD  . PRO B 2 41  ? 12.676  3.155   -1.382  1.00 39.13  ? 41  PRO H CD  1 
ATOM   1986 N N   . GLY B 2 42  ? 15.347  -0.496  0.061   1.00 48.41  ? 42  GLY H N   1 
ATOM   1987 C CA  . GLY B 2 42  ? 15.466  -1.858  0.560   1.00 50.48  ? 42  GLY H CA  1 
ATOM   1988 C C   . GLY B 2 42  ? 14.500  -2.868  -0.039  1.00 53.22  ? 42  GLY H C   1 
ATOM   1989 O O   . GLY B 2 42  ? 14.280  -3.935  0.536   1.00 54.62  ? 42  GLY H O   1 
ATOM   1990 N N   . LYS B 2 43  ? 13.914  -2.548  -1.187  1.00 52.12  ? 43  LYS H N   1 
ATOM   1991 C CA  . LYS B 2 43  ? 12.986  -3.477  -1.813  1.00 52.35  ? 43  LYS H CA  1 
ATOM   1992 C C   . LYS B 2 43  ? 13.649  -4.091  -3.034  1.00 50.50  ? 43  LYS H C   1 
ATOM   1993 O O   . LYS B 2 43  ? 14.792  -3.759  -3.349  1.00 54.96  ? 43  LYS H O   1 
ATOM   1994 C CB  . LYS B 2 43  ? 11.687  -2.760  -2.199  1.00 55.83  ? 43  LYS H CB  1 
ATOM   1995 C CG  . LYS B 2 43  ? 10.899  -2.211  -1.006  1.00 55.52  ? 43  LYS H CG  1 
ATOM   1996 C CD  . LYS B 2 43  ? 10.911  -3.177  0.173   1.00 60.16  ? 43  LYS H CD  1 
ATOM   1997 C CE  . LYS B 2 43  ? 9.613   -3.106  0.966   1.00 66.14  ? 43  LYS H CE  1 
ATOM   1998 N NZ  . LYS B 2 43  ? 8.958   -4.445  1.094   1.00 73.40  ? 43  LYS H NZ  1 
ATOM   1999 N N   . GLY B 2 44  ? 12.951  -4.991  -3.718  1.00 47.98  ? 44  GLY H N   1 
ATOM   2000 C CA  . GLY B 2 44  ? 13.546  -5.614  -4.890  1.00 45.80  ? 44  GLY H CA  1 
ATOM   2001 C C   . GLY B 2 44  ? 13.696  -4.655  -6.056  1.00 38.17  ? 44  GLY H C   1 
ATOM   2002 O O   . GLY B 2 44  ? 13.733  -3.437  -5.871  1.00 38.59  ? 44  GLY H O   1 
ATOM   2003 N N   . LEU B 2 45  ? 13.808  -5.207  -7.256  1.00 33.07  ? 45  LEU H N   1 
ATOM   2004 C CA  . LEU B 2 45  ? 13.910  -4.396  -8.472  1.00 32.92  ? 45  LEU H CA  1 
ATOM   2005 C C   . LEU B 2 45  ? 12.628  -4.679  -9.252  1.00 29.43  ? 45  LEU H C   1 
ATOM   2006 O O   . LEU B 2 45  ? 12.282  -5.840  -9.495  1.00 32.21  ? 45  LEU H O   1 
ATOM   2007 C CB  . LEU B 2 45  ? 15.157  -4.783  -9.298  1.00 29.77  ? 45  LEU H CB  1 
ATOM   2008 C CG  . LEU B 2 45  ? 16.511  -4.353  -8.698  1.00 30.82  ? 45  LEU H CG  1 
ATOM   2009 C CD1 . LEU B 2 45  ? 17.667  -5.133  -9.355  1.00 30.23  ? 45  LEU H CD1 1 
ATOM   2010 C CD2 . LEU B 2 45  ? 16.714  -2.857  -8.924  1.00 25.46  ? 45  LEU H CD2 1 
ATOM   2011 N N   . LYS B 2 46  ? 11.918  -3.621  -9.626  1.00 27.19  ? 46  LYS H N   1 
ATOM   2012 C CA  . LYS B 2 46  ? 10.660  -3.764  -10.355 1.00 25.67  ? 46  LYS H CA  1 
ATOM   2013 C C   . LYS B 2 46  ? 10.707  -3.135  -11.743 1.00 13.69  ? 46  LYS H C   1 
ATOM   2014 O O   . LYS B 2 46  ? 10.874  -1.933  -11.882 1.00 15.42  ? 46  LYS H O   1 
ATOM   2015 C CB  . LYS B 2 46  ? 9.518   -3.128  -9.543  1.00 30.76  ? 46  LYS H CB  1 
ATOM   2016 C CG  . LYS B 2 46  ? 8.595   -4.145  -8.895  1.00 46.44  ? 46  LYS H CG  1 
ATOM   2017 C CD  . LYS B 2 46  ? 9.374   -5.132  -8.029  1.00 55.96  ? 46  LYS H CD  1 
ATOM   2018 C CE  . LYS B 2 46  ? 8.750   -6.523  -8.064  1.00 59.54  ? 46  LYS H CE  1 
ATOM   2019 N NZ  . LYS B 2 46  ? 9.776   -7.605  -7.989  1.00 61.07  ? 46  LYS H NZ  1 
ATOM   2020 N N   . TRP B 2 47  ? 10.549  -3.957  -12.773 1.00 21.41  ? 47  TRP H N   1 
ATOM   2021 C CA  . TRP B 2 47  ? 10.579  -3.450  -14.146 1.00 23.12  ? 47  TRP H CA  1 
ATOM   2022 C C   . TRP B 2 47  ? 9.309   -2.654  -14.361 1.00 25.64  ? 47  TRP H C   1 
ATOM   2023 O O   . TRP B 2 47  ? 8.203   -3.138  -14.081 1.00 24.68  ? 47  TRP H O   1 
ATOM   2024 C CB  . TRP B 2 47  ? 10.652  -4.612  -15.148 1.00 21.86  ? 47  TRP H CB  1 
ATOM   2025 C CG  . TRP B 2 47  ? 10.653  -4.216  -16.587 1.00 27.59  ? 47  TRP H CG  1 
ATOM   2026 C CD1 . TRP B 2 47  ? 11.676  -3.640  -17.269 1.00 28.10  ? 47  TRP H CD1 1 
ATOM   2027 C CD2 . TRP B 2 47  ? 9.604   -4.437  -17.546 1.00 29.82  ? 47  TRP H CD2 1 
ATOM   2028 N NE1 . TRP B 2 47  ? 11.346  -3.492  -18.588 1.00 31.30  ? 47  TRP H NE1 1 
ATOM   2029 C CE2 . TRP B 2 47  ? 10.079  -3.974  -18.790 1.00 28.16  ? 47  TRP H CE2 1 
ATOM   2030 C CE3 . TRP B 2 47  ? 8.314   -4.986  -17.473 1.00 27.21  ? 47  TRP H CE3 1 
ATOM   2031 C CZ2 . TRP B 2 47  ? 9.311   -4.038  -19.959 1.00 28.73  ? 47  TRP H CZ2 1 
ATOM   2032 C CZ3 . TRP B 2 47  ? 7.542   -5.054  -18.646 1.00 30.42  ? 47  TRP H CZ3 1 
ATOM   2033 C CH2 . TRP B 2 47  ? 8.048   -4.581  -19.867 1.00 32.02  ? 47  TRP H CH2 1 
ATOM   2034 N N   . MET B 2 48  ? 9.471   -1.430  -14.842 1.00 18.09  ? 48  MET H N   1 
ATOM   2035 C CA  . MET B 2 48  ? 8.340   -0.560  -15.096 1.00 20.30  ? 48  MET H CA  1 
ATOM   2036 C C   . MET B 2 48  ? 7.882   -0.597  -16.533 1.00 22.17  ? 48  MET H C   1 
ATOM   2037 O O   . MET B 2 48  ? 6.700   -0.355  -16.839 1.00 18.75  ? 48  MET H O   1 
ATOM   2038 C CB  . MET B 2 48  ? 8.696   0.866   -14.746 1.00 18.93  ? 48  MET H CB  1 
ATOM   2039 C CG  . MET B 2 48  ? 8.964   1.058   -13.276 1.00 22.26  ? 48  MET H CG  1 
ATOM   2040 S SD  . MET B 2 48  ? 9.774   2.575   -13.017 1.00 19.93  ? 48  MET H SD  1 
ATOM   2041 C CE  . MET B 2 48  ? 8.348   3.776   -13.249 1.00 25.39  ? 48  MET H CE  1 
ATOM   2042 N N   . GLY B 2 49  ? 8.830   -0.875  -17.419 1.00 17.60  ? 49  GLY H N   1 
ATOM   2043 C CA  . GLY B 2 49  ? 8.522   -0.929  -18.826 1.00 17.38  ? 49  GLY H CA  1 
ATOM   2044 C C   . GLY B 2 49  ? 9.658   -0.344  -19.653 1.00 19.98  ? 49  GLY H C   1 
ATOM   2045 O O   . GLY B 2 49  ? 10.740  -0.060  -19.139 1.00 18.95  ? 49  GLY H O   1 
ATOM   2046 N N   . TRP B 2 50  ? 9.403   -0.146  -20.935 1.00 20.52  ? 50  TRP H N   1 
ATOM   2047 C CA  . TRP B 2 50  ? 10.407  0.406   -21.839 1.00 21.19  ? 50  TRP H CA  1 
ATOM   2048 C C   . TRP B 2 50  ? 9.779   1.144   -23.004 1.00 25.86  ? 50  TRP H C   1 
ATOM   2049 O O   . TRP B 2 50  ? 8.557   1.041   -23.267 1.00 20.17  ? 50  TRP H O   1 
ATOM   2050 C CB  . TRP B 2 50  ? 11.276  -0.711  -22.394 1.00 19.77  ? 50  TRP H CB  1 
ATOM   2051 C CG  . TRP B 2 50  ? 10.565  -1.535  -23.412 1.00 24.25  ? 50  TRP H CG  1 
ATOM   2052 C CD1 . TRP B 2 50  ? 9.499   -2.353  -23.204 1.00 23.57  ? 50  TRP H CD1 1 
ATOM   2053 C CD2 . TRP B 2 50  ? 10.865  -1.611  -24.808 1.00 29.53  ? 50  TRP H CD2 1 
ATOM   2054 N NE1 . TRP B 2 50  ? 9.108   -2.936  -24.383 1.00 27.84  ? 50  TRP H NE1 1 
ATOM   2055 C CE2 . TRP B 2 50  ? 9.932   -2.497  -25.386 1.00 31.94  ? 50  TRP H CE2 1 
ATOM   2056 C CE3 . TRP B 2 50  ? 11.834  -1.014  -25.627 1.00 27.58  ? 50  TRP H CE3 1 
ATOM   2057 C CZ2 . TRP B 2 50  ? 9.938   -2.805  -26.749 1.00 31.95  ? 50  TRP H CZ2 1 
ATOM   2058 C CZ3 . TRP B 2 50  ? 11.842  -1.311  -26.971 1.00 32.36  ? 50  TRP H CZ3 1 
ATOM   2059 C CH2 . TRP B 2 50  ? 10.897  -2.203  -27.525 1.00 34.96  ? 50  TRP H CH2 1 
ATOM   2060 N N   . ILE B 2 51  ? 10.626  1.889   -23.705 1.00 18.86  ? 51  ILE H N   1 
ATOM   2061 C CA  . ILE B 2 51  ? 10.194  2.629   -24.860 1.00 18.70  ? 51  ILE H CA  1 
ATOM   2062 C C   . ILE B 2 51  ? 11.130  2.388   -26.052 1.00 26.36  ? 51  ILE H C   1 
ATOM   2063 O O   . ILE B 2 51  ? 12.358  2.391   -25.914 1.00 19.20  ? 51  ILE H O   1 
ATOM   2064 C CB  . ILE B 2 51  ? 10.131  4.105   -24.561 1.00 16.92  ? 51  ILE H CB  1 
ATOM   2065 C CG1 . ILE B 2 51  ? 9.557   4.835   -25.781 1.00 15.58  ? 51  ILE H CG1 1 
ATOM   2066 C CG2 . ILE B 2 51  ? 11.503  4.604   -24.123 1.00 26.04  ? 51  ILE H CG2 1 
ATOM   2067 C CD1 . ILE B 2 51  ? 9.200   6.295   -25.527 1.00 7.72   ? 51  ILE H CD1 1 
ATOM   2068 N N   . ASN B 2 52  ? 10.529  2.158   -27.213 1.00 24.83  ? 52  ASN H N   1 
ATOM   2069 C CA  . ASN B 2 52  ? 11.265  1.904   -28.448 1.00 25.19  ? 52  ASN H CA  1 
ATOM   2070 C C   . ASN B 2 52  ? 11.954  3.172   -28.918 1.00 23.23  ? 52  ASN H C   1 
ATOM   2071 O O   . ASN B 2 52  ? 11.302  4.188   -29.164 1.00 25.32  ? 52  ASN H O   1 
ATOM   2072 C CB  . ASN B 2 52  ? 10.297  1.400   -29.518 1.00 28.12  ? 52  ASN H CB  1 
ATOM   2073 C CG  . ASN B 2 52  ? 11.006  0.711   -30.649 1.00 23.79  ? 52  ASN H CG  1 
ATOM   2074 O OD1 . ASN B 2 52  ? 10.845  -0.487  -30.861 1.00 24.60  ? 52  ASN H OD1 1 
ATOM   2075 N ND2 . ASN B 2 52  ? 11.802  1.469   -31.387 1.00 25.23  ? 52  ASN H ND2 1 
ATOM   2076 N N   . THR B 2 53  ? 13.276  3.123   -29.026 1.00 24.17  ? 53  THR H N   1 
ATOM   2077 C CA  . THR B 2 53  ? 14.045  4.291   -29.455 1.00 26.74  ? 53  THR H CA  1 
ATOM   2078 C C   . THR B 2 53  ? 14.056  4.454   -30.978 1.00 27.18  ? 53  THR H C   1 
ATOM   2079 O O   . THR B 2 53  ? 14.519  5.460   -31.509 1.00 27.28  ? 53  THR H O   1 
ATOM   2080 C CB  . THR B 2 53  ? 15.502  4.213   -28.924 1.00 26.50  ? 53  THR H CB  1 
ATOM   2081 O OG1 . THR B 2 53  ? 16.020  2.881   -29.113 1.00 27.61  ? 53  THR H OG1 1 
ATOM   2082 C CG2 . THR B 2 53  ? 15.533  4.562   -27.421 1.00 22.89  ? 53  THR H CG2 1 
ATOM   2083 N N   . TYR B 2 54  ? 13.520  3.458   -31.667 1.00 27.64  ? 54  TYR H N   1 
ATOM   2084 C CA  . TYR B 2 54  ? 13.466  3.457   -33.120 1.00 30.43  ? 54  TYR H CA  1 
ATOM   2085 C C   . TYR B 2 54  ? 12.084  3.898   -33.624 1.00 33.12  ? 54  TYR H C   1 
ATOM   2086 O O   . TYR B 2 54  ? 11.946  4.382   -34.752 1.00 31.24  ? 54  TYR H O   1 
ATOM   2087 C CB  . TYR B 2 54  ? 13.809  2.046   -33.598 1.00 40.65  ? 54  TYR H CB  1 
ATOM   2088 C CG  . TYR B 2 54  ? 14.073  1.895   -35.071 1.00 53.01  ? 54  TYR H CG  1 
ATOM   2089 C CD1 . TYR B 2 54  ? 13.033  1.592   -35.954 1.00 57.89  ? 54  TYR H CD1 1 
ATOM   2090 C CD2 . TYR B 2 54  ? 15.365  2.011   -35.585 1.00 60.79  ? 54  TYR H CD2 1 
ATOM   2091 C CE1 . TYR B 2 54  ? 13.273  1.402   -37.314 1.00 61.70  ? 54  TYR H CE1 1 
ATOM   2092 C CE2 . TYR B 2 54  ? 15.615  1.823   -36.948 1.00 65.50  ? 54  TYR H CE2 1 
ATOM   2093 C CZ  . TYR B 2 54  ? 14.562  1.519   -37.801 1.00 62.87  ? 54  TYR H CZ  1 
ATOM   2094 O OH  . TYR B 2 54  ? 14.802  1.331   -39.136 1.00 65.22  ? 54  TYR H OH  1 
ATOM   2095 N N   . THR B 2 55  ? 11.063  3.737   -32.780 1.00 33.08  ? 55  THR H N   1 
ATOM   2096 C CA  . THR B 2 55  ? 9.688   4.119   -33.134 1.00 34.98  ? 55  THR H CA  1 
ATOM   2097 C C   . THR B 2 55  ? 9.048   5.074   -32.126 1.00 31.58  ? 55  THR H C   1 
ATOM   2098 O O   . THR B 2 55  ? 8.118   5.814   -32.451 1.00 30.52  ? 55  THR H O   1 
ATOM   2099 C CB  . THR B 2 55  ? 8.772   2.898   -33.232 1.00 34.70  ? 55  THR H CB  1 
ATOM   2100 O OG1 . THR B 2 55  ? 8.609   2.335   -31.927 1.00 33.76  ? 55  THR H OG1 1 
ATOM   2101 C CG2 . THR B 2 55  ? 9.360   1.849   -34.172 1.00 31.74  ? 55  THR H CG2 1 
ATOM   2102 N N   . GLY B 2 56  ? 9.552   5.062   -30.900 1.00 30.37  ? 56  GLY H N   1 
ATOM   2103 C CA  . GLY B 2 56  ? 9.005   5.936   -29.882 1.00 25.92  ? 56  GLY H CA  1 
ATOM   2104 C C   . GLY B 2 56  ? 7.785   5.371   -29.176 1.00 25.04  ? 56  GLY H C   1 
ATOM   2105 O O   . GLY B 2 56  ? 7.108   6.106   -28.484 1.00 23.79  ? 56  GLY H O   1 
ATOM   2106 N N   . GLU B 2 57  ? 7.512   4.076   -29.332 1.00 24.68  ? 57  GLU H N   1 
ATOM   2107 C CA  . GLU B 2 57  ? 6.361   3.456   -28.691 1.00 27.68  ? 57  GLU H CA  1 
ATOM   2108 C C   . GLU B 2 57  ? 6.651   2.854   -27.312 1.00 27.25  ? 57  GLU H C   1 
ATOM   2109 O O   . GLU B 2 57  ? 7.544   2.011   -27.157 1.00 22.28  ? 57  GLU H O   1 
ATOM   2110 C CB  . GLU B 2 57  ? 5.776   2.367   -29.592 1.00 34.08  ? 57  GLU H CB  1 
ATOM   2111 C CG  . GLU B 2 57  ? 4.971   2.886   -30.792 1.00 48.58  ? 57  GLU H CG  1 
ATOM   2112 C CD  . GLU B 2 57  ? 3.981   4.001   -30.432 1.00 57.38  ? 57  GLU H CD  1 
ATOM   2113 O OE1 . GLU B 2 57  ? 3.254   3.855   -29.425 1.00 63.71  ? 57  GLU H OE1 1 
ATOM   2114 O OE2 . GLU B 2 57  ? 3.927   5.023   -31.160 1.00 57.36  ? 57  GLU H OE2 1 
ATOM   2115 N N   . PRO B 2 58  ? 5.883   3.281   -26.287 1.00 27.43  ? 58  PRO H N   1 
ATOM   2116 C CA  . PRO B 2 58  ? 6.058   2.772   -24.930 1.00 22.77  ? 58  PRO H CA  1 
ATOM   2117 C C   . PRO B 2 58  ? 5.264   1.520   -24.644 1.00 24.23  ? 58  PRO H C   1 
ATOM   2118 O O   . PRO B 2 58  ? 4.223   1.269   -25.239 1.00 26.97  ? 58  PRO H O   1 
ATOM   2119 C CB  . PRO B 2 58  ? 5.623   3.939   -24.038 1.00 22.45  ? 58  PRO H CB  1 
ATOM   2120 C CG  . PRO B 2 58  ? 4.754   4.833   -24.929 1.00 29.41  ? 58  PRO H CG  1 
ATOM   2121 C CD  . PRO B 2 58  ? 4.842   4.324   -26.357 1.00 26.10  ? 58  PRO H CD  1 
ATOM   2122 N N   . THR B 2 59  ? 5.790   0.710   -23.747 1.00 20.14  ? 59  THR H N   1 
ATOM   2123 C CA  . THR B 2 59  ? 5.121   -0.497  -23.318 1.00 24.85  ? 59  THR H CA  1 
ATOM   2124 C C   . THR B 2 59  ? 5.216   -0.395  -21.793 1.00 27.90  ? 59  THR H C   1 
ATOM   2125 O O   . THR B 2 59  ? 6.315   -0.300  -21.239 1.00 26.11  ? 59  THR H O   1 
ATOM   2126 C CB  . THR B 2 59  ? 5.842   -1.747  -23.832 1.00 22.36  ? 59  THR H CB  1 
ATOM   2127 O OG1 . THR B 2 59  ? 5.606   -1.886  -25.241 1.00 24.93  ? 59  THR H OG1 1 
ATOM   2128 C CG2 . THR B 2 59  ? 5.336   -2.983  -23.123 1.00 22.76  ? 59  THR H CG2 1 
ATOM   2129 N N   . TYR B 2 60  ? 4.068   -0.350  -21.120 1.00 26.16  ? 60  TYR H N   1 
ATOM   2130 C CA  . TYR B 2 60  ? 4.072   -0.233  -19.666 1.00 21.55  ? 60  TYR H CA  1 
ATOM   2131 C C   . TYR B 2 60  ? 3.752   -1.537  -18.987 1.00 24.36  ? 60  TYR H C   1 
ATOM   2132 O O   . TYR B 2 60  ? 2.914   -2.305  -19.474 1.00 26.47  ? 60  TYR H O   1 
ATOM   2133 C CB  . TYR B 2 60  ? 3.080   0.831   -19.211 1.00 21.32  ? 60  TYR H CB  1 
ATOM   2134 C CG  . TYR B 2 60  ? 3.406   2.204   -19.729 1.00 17.72  ? 60  TYR H CG  1 
ATOM   2135 C CD1 . TYR B 2 60  ? 4.271   3.048   -19.029 1.00 14.03  ? 60  TYR H CD1 1 
ATOM   2136 C CD2 . TYR B 2 60  ? 2.911   2.633   -20.945 1.00 14.27  ? 60  TYR H CD2 1 
ATOM   2137 C CE1 . TYR B 2 60  ? 4.632   4.284   -19.539 1.00 17.52  ? 60  TYR H CE1 1 
ATOM   2138 C CE2 . TYR B 2 60  ? 3.277   3.879   -21.473 1.00 15.93  ? 60  TYR H CE2 1 
ATOM   2139 C CZ  . TYR B 2 60  ? 4.132   4.691   -20.765 1.00 18.99  ? 60  TYR H CZ  1 
ATOM   2140 O OH  . TYR B 2 60  ? 4.476   5.929   -21.264 1.00 21.89  ? 60  TYR H OH  1 
ATOM   2141 N N   . ALA B 2 61  ? 4.442   -1.803  -17.878 1.00 18.95  ? 61  ALA H N   1 
ATOM   2142 C CA  . ALA B 2 61  ? 4.191   -3.010  -17.116 1.00 24.99  ? 61  ALA H CA  1 
ATOM   2143 C C   . ALA B 2 61  ? 2.839   -2.787  -16.418 1.00 24.39  ? 61  ALA H C   1 
ATOM   2144 O O   . ALA B 2 61  ? 2.472   -1.658  -16.090 1.00 23.22  ? 61  ALA H O   1 
ATOM   2145 C CB  . ALA B 2 61  ? 5.291   -3.234  -16.080 1.00 23.14  ? 61  ALA H CB  1 
ATOM   2146 N N   . ASP B 2 62  ? 2.115   -3.866  -16.183 1.00 29.91  ? 62  ASP H N   1 
ATOM   2147 C CA  . ASP B 2 62  ? 0.806   -3.786  -15.553 1.00 34.08  ? 62  ASP H CA  1 
ATOM   2148 C C   . ASP B 2 62  ? 0.761   -2.870  -14.341 1.00 35.96  ? 62  ASP H C   1 
ATOM   2149 O O   . ASP B 2 62  ? -0.167  -2.065  -14.196 1.00 36.34  ? 62  ASP H O   1 
ATOM   2150 C CB  . ASP B 2 62  ? 0.341   -5.195  -15.168 1.00 40.59  ? 62  ASP H CB  1 
ATOM   2151 C CG  . ASP B 2 62  ? -0.105  -5.997  -16.371 1.00 40.34  ? 62  ASP H CG  1 
ATOM   2152 O OD1 . ASP B 2 62  ? -0.278  -5.400  -17.452 1.00 47.98  ? 62  ASP H OD1 1 
ATOM   2153 O OD2 . ASP B 2 62  ? -0.282  -7.224  -16.240 1.00 45.40  ? 62  ASP H OD2 1 
ATOM   2154 N N   . ASP B 2 63  ? 1.773   -2.967  -13.483 1.00 31.27  ? 63  ASP H N   1 
ATOM   2155 C CA  . ASP B 2 63  ? 1.816   -2.153  -12.272 1.00 31.49  ? 63  ASP H CA  1 
ATOM   2156 C C   . ASP B 2 63  ? 2.105   -0.677  -12.475 1.00 27.14  ? 63  ASP H C   1 
ATOM   2157 O O   . ASP B 2 63  ? 2.061   0.101   -11.520 1.00 29.28  ? 63  ASP H O   1 
ATOM   2158 C CB  . ASP B 2 63  ? 2.836   -2.727  -11.293 1.00 40.53  ? 63  ASP H CB  1 
ATOM   2159 C CG  . ASP B 2 63  ? 2.199   -3.617  -10.241 1.00 46.48  ? 63  ASP H CG  1 
ATOM   2160 O OD1 . ASP B 2 63  ? 2.059   -4.830  -10.490 1.00 55.30  ? 63  ASP H OD1 1 
ATOM   2161 O OD2 . ASP B 2 63  ? 1.834   -3.102  -9.166  1.00 58.71  ? 63  ASP H OD2 1 
ATOM   2162 N N   . PHE B 2 64  ? 2.376   -0.271  -13.712 1.00 23.21  ? 64  PHE H N   1 
ATOM   2163 C CA  . PHE B 2 64  ? 2.684   1.126   -13.964 1.00 19.38  ? 64  PHE H CA  1 
ATOM   2164 C C   . PHE B 2 64  ? 1.917   1.745   -15.109 1.00 25.59  ? 64  PHE H C   1 
ATOM   2165 O O   . PHE B 2 64  ? 2.423   2.608   -15.847 1.00 22.26  ? 64  PHE H O   1 
ATOM   2166 C CB  . PHE B 2 64  ? 4.183   1.274   -14.177 1.00 23.23  ? 64  PHE H CB  1 
ATOM   2167 C CG  . PHE B 2 64  ? 4.994   0.829   -12.999 1.00 17.75  ? 64  PHE H CG  1 
ATOM   2168 C CD1 . PHE B 2 64  ? 5.321   -0.510  -12.826 1.00 17.34  ? 64  PHE H CD1 1 
ATOM   2169 C CD2 . PHE B 2 64  ? 5.442   1.748   -12.076 1.00 16.29  ? 64  PHE H CD2 1 
ATOM   2170 C CE1 . PHE B 2 64  ? 6.094   -0.921  -11.743 1.00 13.24  ? 64  PHE H CE1 1 
ATOM   2171 C CE2 . PHE B 2 64  ? 6.211   1.346   -11.000 1.00 24.12  ? 64  PHE H CE2 1 
ATOM   2172 C CZ  . PHE B 2 64  ? 6.535   0.009   -10.839 1.00 17.42  ? 64  PHE H CZ  1 
ATOM   2173 N N   . LYS B 2 65  ? 0.671   1.310   -15.239 1.00 28.86  ? 65  LYS H N   1 
ATOM   2174 C CA  . LYS B 2 65  ? -0.219  1.803   -16.274 1.00 28.34  ? 65  LYS H CA  1 
ATOM   2175 C C   . LYS B 2 65  ? -1.161  2.809   -15.642 1.00 33.37  ? 65  LYS H C   1 
ATOM   2176 O O   . LYS B 2 65  ? -2.058  2.417   -14.887 1.00 30.80  ? 65  LYS H O   1 
ATOM   2177 C CB  . LYS B 2 65  ? -1.025  0.647   -16.855 1.00 30.19  ? 65  LYS H CB  1 
ATOM   2178 C CG  . LYS B 2 65  ? -0.379  -0.028  -18.048 1.00 24.84  ? 65  LYS H CG  1 
ATOM   2179 C CD  . LYS B 2 65  ? -1.076  -1.327  -18.368 1.00 24.45  ? 65  LYS H CD  1 
ATOM   2180 C CE  . LYS B 2 65  ? -0.400  -2.027  -19.520 1.00 16.85  ? 65  LYS H CE  1 
ATOM   2181 N NZ  . LYS B 2 65  ? -0.237  -3.482  -19.261 1.00 29.34  ? 65  LYS H NZ  1 
ATOM   2182 N N   . GLY B 2 66  ? -0.949  4.091   -15.932 1.00 28.38  ? 66  GLY H N   1 
ATOM   2183 C CA  . GLY B 2 66  ? -1.815  5.113   -15.372 1.00 24.53  ? 66  GLY H CA  1 
ATOM   2184 C C   . GLY B 2 66  ? -1.171  6.453   -15.054 1.00 21.84  ? 66  GLY H C   1 
ATOM   2185 O O   . GLY B 2 66  ? -1.539  7.476   -15.607 1.00 23.93  ? 66  GLY H O   1 
ATOM   2186 N N   . ARG B 2 67  ? -0.212  6.475   -14.146 1.00 13.58  ? 67  ARG H N   1 
ATOM   2187 C CA  . ARG B 2 67  ? 0.400   7.748   -13.807 1.00 14.78  ? 67  ARG H CA  1 
ATOM   2188 C C   . ARG B 2 67  ? 1.838   7.849   -14.328 1.00 19.73  ? 67  ARG H C   1 
ATOM   2189 O O   . ARG B 2 67  ? 2.560   8.756   -13.936 1.00 21.07  ? 67  ARG H O   1 
ATOM   2190 C CB  . ARG B 2 67  ? 0.379   7.939   -12.298 1.00 17.35  ? 67  ARG H CB  1 
ATOM   2191 C CG  . ARG B 2 67  ? -0.960  7.545   -11.658 1.00 25.35  ? 67  ARG H CG  1 
ATOM   2192 C CD  . ARG B 2 67  ? -0.995  7.901   -10.170 1.00 23.22  ? 67  ARG H CD  1 
ATOM   2193 N NE  . ARG B 2 67  ? 0.264   7.641   -9.482  1.00 32.91  ? 67  ARG H NE  1 
ATOM   2194 C CZ  . ARG B 2 67  ? 0.708   6.436   -9.155  1.00 30.81  ? 67  ARG H CZ  1 
ATOM   2195 N NH1 . ARG B 2 67  ? -0.002  5.357   -9.453  1.00 44.10  ? 67  ARG H NH1 1 
ATOM   2196 N NH2 . ARG B 2 67  ? 1.847   6.307   -8.504  1.00 26.61  ? 67  ARG H NH2 1 
ATOM   2197 N N   . PHE B 2 68  ? 2.228   6.935   -15.227 1.00 19.35  ? 68  PHE H N   1 
ATOM   2198 C CA  . PHE B 2 68  ? 3.610   6.912   -15.767 1.00 19.28  ? 68  PHE H CA  1 
ATOM   2199 C C   . PHE B 2 68  ? 3.653   7.124   -17.277 1.00 19.05  ? 68  PHE H C   1 
ATOM   2200 O O   . PHE B 2 68  ? 2.854   6.569   -18.034 1.00 17.07  ? 68  PHE H O   1 
ATOM   2201 C CB  . PHE B 2 68  ? 4.299   5.595   -15.359 1.00 13.60  ? 68  PHE H CB  1 
ATOM   2202 C CG  . PHE B 2 68  ? 4.228   5.330   -13.853 1.00 17.98  ? 68  PHE H CG  1 
ATOM   2203 C CD1 . PHE B 2 68  ? 3.115   4.721   -13.291 1.00 11.71  ? 68  PHE H CD1 1 
ATOM   2204 C CD2 . PHE B 2 68  ? 5.242   5.760   -13.004 1.00 17.12  ? 68  PHE H CD2 1 
ATOM   2205 C CE1 . PHE B 2 68  ? 2.997   4.541   -11.889 1.00 7.48   ? 68  PHE H CE1 1 
ATOM   2206 C CE2 . PHE B 2 68  ? 5.143   5.594   -11.634 1.00 21.64  ? 68  PHE H CE2 1 
ATOM   2207 C CZ  . PHE B 2 68  ? 4.000   4.977   -11.070 1.00 19.73  ? 68  PHE H CZ  1 
ATOM   2208 N N   . ALA B 2 69  ? 4.594   7.961   -17.695 1.00 21.39  ? 69  ALA H N   1 
ATOM   2209 C CA  . ALA B 2 69  ? 4.756   8.313   -19.081 1.00 20.99  ? 69  ALA H CA  1 
ATOM   2210 C C   . ALA B 2 69  ? 6.227   8.250   -19.543 1.00 22.82  ? 69  ALA H C   1 
ATOM   2211 O O   . ALA B 2 69  ? 7.063   9.002   -19.040 1.00 27.13  ? 69  ALA H O   1 
ATOM   2212 C CB  . ALA B 2 69  ? 4.204   9.713   -19.286 1.00 15.74  ? 69  ALA H CB  1 
ATOM   2213 N N   . PHE B 2 70  ? 6.515   7.358   -20.496 1.00 24.99  ? 70  PHE H N   1 
ATOM   2214 C CA  . PHE B 2 70  ? 7.858   7.170   -21.075 1.00 22.06  ? 70  PHE H CA  1 
ATOM   2215 C C   . PHE B 2 70  ? 7.960   8.036   -22.317 1.00 22.56  ? 70  PHE H C   1 
ATOM   2216 O O   . PHE B 2 70  ? 7.104   7.955   -23.186 1.00 24.22  ? 70  PHE H O   1 
ATOM   2217 C CB  . PHE B 2 70  ? 8.089   5.716   -21.512 1.00 13.71  ? 70  PHE H CB  1 
ATOM   2218 C CG  . PHE B 2 70  ? 8.062   4.730   -20.405 1.00 15.45  ? 70  PHE H CG  1 
ATOM   2219 C CD1 . PHE B 2 70  ? 8.316   5.123   -19.096 1.00 19.80  ? 70  PHE H CD1 1 
ATOM   2220 C CD2 . PHE B 2 70  ? 7.773   3.391   -20.655 1.00 9.89   ? 70  PHE H CD2 1 
ATOM   2221 C CE1 . PHE B 2 70  ? 8.277   4.208   -18.080 1.00 13.18  ? 70  PHE H CE1 1 
ATOM   2222 C CE2 . PHE B 2 70  ? 7.738   2.476   -19.630 1.00 12.02  ? 70  PHE H CE2 1 
ATOM   2223 C CZ  . PHE B 2 70  ? 7.984   2.868   -18.352 1.00 13.92  ? 70  PHE H CZ  1 
ATOM   2224 N N   . SER B 2 71  ? 9.005   8.857   -22.396 1.00 26.95  ? 71  SER H N   1 
ATOM   2225 C CA  . SER B 2 71  ? 9.222   9.738   -23.534 1.00 25.68  ? 71  SER H CA  1 
ATOM   2226 C C   . SER B 2 71  ? 10.700  9.768   -23.950 1.00 26.42  ? 71  SER H C   1 
ATOM   2227 O O   . SER B 2 71  ? 11.593  9.314   -23.215 1.00 23.18  ? 71  SER H O   1 
ATOM   2228 C CB  . SER B 2 71  ? 8.724   11.151  -23.209 1.00 22.75  ? 71  SER H CB  1 
ATOM   2229 O OG  . SER B 2 71  ? 9.769   12.093  -23.149 1.00 32.71  ? 71  SER H OG  1 
ATOM   2230 N N   . LEU B 2 72  ? 10.943  10.294  -25.144 1.00 26.90  ? 72  LEU H N   1 
ATOM   2231 C CA  . LEU B 2 72  ? 12.296  10.383  -25.683 1.00 30.39  ? 72  LEU H CA  1 
ATOM   2232 C C   . LEU B 2 72  ? 12.564  11.674  -26.445 1.00 34.46  ? 72  LEU H C   1 
ATOM   2233 O O   . LEU B 2 72  ? 11.662  12.304  -26.989 1.00 35.78  ? 72  LEU H O   1 
ATOM   2234 C CB  . LEU B 2 72  ? 12.564  9.222   -26.628 1.00 25.31  ? 72  LEU H CB  1 
ATOM   2235 C CG  . LEU B 2 72  ? 12.491  7.788   -26.138 1.00 26.14  ? 72  LEU H CG  1 
ATOM   2236 C CD1 . LEU B 2 72  ? 12.728  6.851   -27.334 1.00 24.46  ? 72  LEU H CD1 1 
ATOM   2237 C CD2 . LEU B 2 72  ? 13.529  7.551   -25.030 1.00 19.95  ? 72  LEU H CD2 1 
ATOM   2238 N N   . GLU B 2 73  ? 13.831  12.062  -26.475 1.00 40.50  ? 73  GLU H N   1 
ATOM   2239 C CA  . GLU B 2 73  ? 14.261  13.243  -27.198 1.00 38.84  ? 73  GLU H CA  1 
ATOM   2240 C C   . GLU B 2 73  ? 15.404  12.729  -28.061 1.00 35.37  ? 73  GLU H C   1 
ATOM   2241 O O   . GLU B 2 73  ? 16.568  12.981  -27.768 1.00 31.14  ? 73  GLU H O   1 
ATOM   2242 C CB  . GLU B 2 73  ? 14.762  14.308  -26.229 1.00 44.48  ? 73  GLU H CB  1 
ATOM   2243 C CG  . GLU B 2 73  ? 14.486  15.724  -26.688 1.00 60.82  ? 73  GLU H CG  1 
ATOM   2244 C CD  . GLU B 2 73  ? 15.088  16.023  -28.047 1.00 71.07  ? 73  GLU H CD  1 
ATOM   2245 O OE1 . GLU B 2 73  ? 14.660  15.399  -29.044 1.00 77.77  ? 73  GLU H OE1 1 
ATOM   2246 O OE2 . GLU B 2 73  ? 15.991  16.885  -28.118 1.00 79.51  ? 73  GLU H OE2 1 
ATOM   2247 N N   . THR B 2 74  ? 15.055  11.988  -29.112 1.00 36.90  ? 74  THR H N   1 
ATOM   2248 C CA  . THR B 2 74  ? 16.036  11.393  -30.018 1.00 37.05  ? 74  THR H CA  1 
ATOM   2249 C C   . THR B 2 74  ? 17.119  12.364  -30.493 1.00 39.74  ? 74  THR H C   1 
ATOM   2250 O O   . THR B 2 74  ? 18.228  11.948  -30.823 1.00 42.94  ? 74  THR H O   1 
ATOM   2251 C CB  . THR B 2 74  ? 15.343  10.758  -31.236 1.00 40.89  ? 74  THR H CB  1 
ATOM   2252 O OG1 . THR B 2 74  ? 14.079  11.396  -31.454 1.00 44.69  ? 74  THR H OG1 1 
ATOM   2253 C CG2 . THR B 2 74  ? 15.120  9.255   -30.998 1.00 33.86  ? 74  THR H CG2 1 
ATOM   2254 N N   . SER B 2 75  ? 16.803  13.653  -30.520 1.00 36.84  ? 75  SER H N   1 
ATOM   2255 C CA  . SER B 2 75  ? 17.769  14.667  -30.922 1.00 38.60  ? 75  SER H CA  1 
ATOM   2256 C C   . SER B 2 75  ? 18.874  14.772  -29.858 1.00 41.81  ? 75  SER H C   1 
ATOM   2257 O O   . SER B 2 75  ? 20.070  14.668  -30.163 1.00 41.61  ? 75  SER H O   1 
ATOM   2258 C CB  . SER B 2 75  ? 17.054  16.012  -31.091 1.00 38.07  ? 75  SER H CB  1 
ATOM   2259 O OG  . SER B 2 75  ? 17.809  17.088  -30.567 1.00 42.64  ? 75  SER H OG  1 
ATOM   2260 N N   . ALA B 2 76  ? 18.472  14.958  -28.604 1.00 38.32  ? 76  ALA H N   1 
ATOM   2261 C CA  . ALA B 2 76  ? 19.427  15.075  -27.516 1.00 33.82  ? 76  ALA H CA  1 
ATOM   2262 C C   . ALA B 2 76  ? 19.830  13.716  -26.947 1.00 31.81  ? 76  ALA H C   1 
ATOM   2263 O O   . ALA B 2 76  ? 20.471  13.657  -25.893 1.00 33.70  ? 76  ALA H O   1 
ATOM   2264 C CB  . ALA B 2 76  ? 18.853  15.939  -26.419 1.00 33.80  ? 76  ALA H CB  1 
ATOM   2265 N N   . SER B 2 77  ? 19.461  12.633  -27.634 1.00 28.97  ? 77  SER H N   1 
ATOM   2266 C CA  . SER B 2 77  ? 19.807  11.284  -27.175 1.00 29.34  ? 77  SER H CA  1 
ATOM   2267 C C   . SER B 2 77  ? 19.358  11.092  -25.720 1.00 29.80  ? 77  SER H C   1 
ATOM   2268 O O   . SER B 2 77  ? 19.976  10.330  -24.965 1.00 26.74  ? 77  SER H O   1 
ATOM   2269 C CB  . SER B 2 77  ? 21.330  11.086  -27.263 1.00 37.71  ? 77  SER H CB  1 
ATOM   2270 O OG  . SER B 2 77  ? 21.670  9.796   -27.727 1.00 44.32  ? 77  SER H OG  1 
ATOM   2271 N N   . THR B 2 78  ? 18.275  11.775  -25.345 1.00 28.93  ? 78  THR H N   1 
ATOM   2272 C CA  . THR B 2 78  ? 17.755  11.743  -23.976 1.00 32.03  ? 78  THR H CA  1 
ATOM   2273 C C   . THR B 2 78  ? 16.383  11.083  -23.806 1.00 30.32  ? 78  THR H C   1 
ATOM   2274 O O   . THR B 2 78  ? 15.469  11.314  -24.597 1.00 25.90  ? 78  THR H O   1 
ATOM   2275 C CB  . THR B 2 78  ? 17.665  13.176  -23.411 1.00 33.91  ? 78  THR H CB  1 
ATOM   2276 O OG1 . THR B 2 78  ? 18.963  13.787  -23.450 1.00 28.03  ? 78  THR H OG1 1 
ATOM   2277 C CG2 . THR B 2 78  ? 17.173  13.153  -21.970 1.00 36.58  ? 78  THR H CG2 1 
ATOM   2278 N N   . ALA B 2 79  ? 16.266  10.258  -22.766 1.00 30.71  ? 79  ALA H N   1 
ATOM   2279 C CA  . ALA B 2 79  ? 15.035  9.547   -22.427 1.00 26.13  ? 79  ALA H CA  1 
ATOM   2280 C C   . ALA B 2 79  ? 14.463  10.140  -21.137 1.00 27.01  ? 79  ALA H C   1 
ATOM   2281 O O   . ALA B 2 79  ? 15.222  10.521  -20.255 1.00 29.32  ? 79  ALA H O   1 
ATOM   2282 C CB  . ALA B 2 79  ? 15.329  8.077   -22.235 1.00 21.78  ? 79  ALA H CB  1 
ATOM   2283 N N   . TYR B 2 80  ? 13.137  10.233  -21.030 1.00 29.32  ? 80  TYR H N   1 
ATOM   2284 C CA  . TYR B 2 80  ? 12.503  10.803  -19.836 1.00 27.86  ? 80  TYR H CA  1 
ATOM   2285 C C   . TYR B 2 80  ? 11.427  9.920   -19.217 1.00 32.36  ? 80  TYR H C   1 
ATOM   2286 O O   . TYR B 2 80  ? 10.751  9.150   -19.908 1.00 29.13  ? 80  TYR H O   1 
ATOM   2287 C CB  . TYR B 2 80  ? 11.841  12.147  -20.138 1.00 30.54  ? 80  TYR H CB  1 
ATOM   2288 C CG  . TYR B 2 80  ? 12.716  13.175  -20.793 1.00 32.67  ? 80  TYR H CG  1 
ATOM   2289 C CD1 . TYR B 2 80  ? 12.960  13.123  -22.161 1.00 29.96  ? 80  TYR H CD1 1 
ATOM   2290 C CD2 . TYR B 2 80  ? 13.293  14.211  -20.049 1.00 25.98  ? 80  TYR H CD2 1 
ATOM   2291 C CE1 . TYR B 2 80  ? 13.756  14.071  -22.787 1.00 36.56  ? 80  TYR H CE1 1 
ATOM   2292 C CE2 . TYR B 2 80  ? 14.099  15.176  -20.674 1.00 33.64  ? 80  TYR H CE2 1 
ATOM   2293 C CZ  . TYR B 2 80  ? 14.322  15.093  -22.047 1.00 35.85  ? 80  TYR H CZ  1 
ATOM   2294 O OH  . TYR B 2 80  ? 15.094  16.037  -22.691 1.00 42.08  ? 80  TYR H OH  1 
ATOM   2295 N N   . LEU B 2 81  ? 11.260  10.071  -17.905 1.00 32.87  ? 81  LEU H N   1 
ATOM   2296 C CA  . LEU B 2 81  ? 10.252  9.340   -17.150 1.00 28.19  ? 81  LEU H CA  1 
ATOM   2297 C C   . LEU B 2 81  ? 9.473   10.399  -16.378 1.00 30.76  ? 81  LEU H C   1 
ATOM   2298 O O   . LEU B 2 81  ? 10.069  11.238  -15.690 1.00 27.77  ? 81  LEU H O   1 
ATOM   2299 C CB  . LEU B 2 81  ? 10.900  8.388   -16.157 1.00 24.79  ? 81  LEU H CB  1 
ATOM   2300 C CG  . LEU B 2 81  ? 10.134  7.167   -15.612 1.00 33.70  ? 81  LEU H CG  1 
ATOM   2301 C CD1 . LEU B 2 81  ? 10.578  6.914   -14.167 1.00 24.48  ? 81  LEU H CD1 1 
ATOM   2302 C CD2 . LEU B 2 81  ? 8.621   7.362   -15.676 1.00 23.55  ? 81  LEU H CD2 1 
ATOM   2303 N N   . GLN B 2 82  ? 8.152   10.378  -16.519 1.00 26.10  ? 82  GLN H N   1 
ATOM   2304 C CA  . GLN B 2 82  ? 7.310   11.319  -15.811 1.00 26.08  ? 82  GLN H CA  1 
ATOM   2305 C C   . GLN B 2 82  ? 6.270   10.566  -14.975 1.00 25.53  ? 82  GLN H C   1 
ATOM   2306 O O   . GLN B 2 82  ? 5.662   9.604   -15.434 1.00 25.79  ? 82  GLN H O   1 
ATOM   2307 C CB  . GLN B 2 82  ? 6.613   12.274  -16.782 1.00 26.16  ? 82  GLN H CB  1 
ATOM   2308 C CG  . GLN B 2 82  ? 6.007   13.467  -16.055 1.00 35.90  ? 82  GLN H CG  1 
ATOM   2309 C CD  . GLN B 2 82  ? 5.201   14.367  -16.959 1.00 40.27  ? 82  GLN H CD  1 
ATOM   2310 O OE1 . GLN B 2 82  ? 4.004   14.556  -16.758 1.00 47.01  ? 82  GLN H OE1 1 
ATOM   2311 N NE2 . GLN B 2 82  ? 5.856   14.932  -17.963 1.00 39.86  ? 82  GLN H NE2 1 
ATOM   2312 N N   . ILE B 2 83  ? 6.101   11.000  -13.732 1.00 28.34  ? 83  ILE H N   1 
ATOM   2313 C CA  . ILE B 2 83  ? 5.147   10.384  -12.810 1.00 24.58  ? 83  ILE H CA  1 
ATOM   2314 C C   . ILE B 2 83  ? 4.294   11.520  -12.310 1.00 23.15  ? 83  ILE H C   1 
ATOM   2315 O O   . ILE B 2 83  ? 4.822   12.490  -11.782 1.00 22.41  ? 83  ILE H O   1 
ATOM   2316 C CB  . ILE B 2 83  ? 5.849   9.723   -11.617 1.00 21.63  ? 83  ILE H CB  1 
ATOM   2317 C CG1 . ILE B 2 83  ? 7.044   8.891   -12.116 1.00 19.42  ? 83  ILE H CG1 1 
ATOM   2318 C CG2 . ILE B 2 83  ? 4.873   8.823   -10.849 1.00 21.00  ? 83  ILE H CG2 1 
ATOM   2319 C CD1 . ILE B 2 83  ? 7.893   8.358   -11.016 1.00 11.04  ? 83  ILE H CD1 1 
ATOM   2320 N N   . ASN B 2 84  ? 2.981   11.444  -12.538 1.00 22.72  ? 84  ASN H N   1 
ATOM   2321 C CA  . ASN B 2 84  ? 2.098   12.510  -12.073 1.00 22.68  ? 84  ASN H CA  1 
ATOM   2322 C C   . ASN B 2 84  ? 1.260   11.998  -10.906 1.00 16.74  ? 84  ASN H C   1 
ATOM   2323 O O   . ASN B 2 84  ? 1.181   10.793  -10.679 1.00 12.81  ? 84  ASN H O   1 
ATOM   2324 C CB  . ASN B 2 84  ? 1.200   13.003  -13.210 1.00 34.86  ? 84  ASN H CB  1 
ATOM   2325 C CG  . ASN B 2 84  ? 1.136   12.033  -14.347 1.00 42.60  ? 84  ASN H CG  1 
ATOM   2326 O OD1 . ASN B 2 84  ? 0.305   11.125  -14.343 1.00 50.41  ? 84  ASN H OD1 1 
ATOM   2327 N ND2 . ASN B 2 84  ? 2.016   12.209  -15.336 1.00 44.80  ? 84  ASN H ND2 1 
ATOM   2328 N N   . ASN B 2 85  ? 0.653   12.921  -10.167 1.00 19.41  ? 85  ASN H N   1 
ATOM   2329 C CA  . ASN B 2 85  ? -0.161  12.572  -9.000  1.00 19.40  ? 85  ASN H CA  1 
ATOM   2330 C C   . ASN B 2 85  ? 0.649   11.652  -8.095  1.00 17.64  ? 85  ASN H C   1 
ATOM   2331 O O   . ASN B 2 85  ? 0.198   10.581  -7.691  1.00 17.23  ? 85  ASN H O   1 
ATOM   2332 C CB  . ASN B 2 85  ? -1.463  11.885  -9.434  1.00 20.72  ? 85  ASN H CB  1 
ATOM   2333 C CG  . ASN B 2 85  ? -2.389  11.625  -8.253  1.00 19.53  ? 85  ASN H CG  1 
ATOM   2334 O OD1 . ASN B 2 85  ? -2.254  12.252  -7.217  1.00 19.72  ? 85  ASN H OD1 1 
ATOM   2335 N ND2 . ASN B 2 85  ? -3.316  10.690  -8.410  1.00 18.91  ? 85  ASN H ND2 1 
ATOM   2336 N N   . LEU B 2 86  ? 1.872   12.097  -7.814  1.00 18.30  ? 86  LEU H N   1 
ATOM   2337 C CA  . LEU B 2 86  ? 2.865   11.413  -6.990  1.00 14.51  ? 86  LEU H CA  1 
ATOM   2338 C C   . LEU B 2 86  ? 2.323   10.931  -5.640  1.00 23.35  ? 86  LEU H C   1 
ATOM   2339 O O   . LEU B 2 86  ? 1.562   11.640  -4.996  1.00 19.36  ? 86  LEU H O   1 
ATOM   2340 C CB  . LEU B 2 86  ? 4.013   12.393  -6.715  1.00 20.95  ? 86  LEU H CB  1 
ATOM   2341 C CG  . LEU B 2 86  ? 5.424   12.363  -7.331  1.00 19.69  ? 86  LEU H CG  1 
ATOM   2342 C CD1 . LEU B 2 86  ? 5.619   11.150  -8.167  1.00 6.02   ? 86  LEU H CD1 1 
ATOM   2343 C CD2 . LEU B 2 86  ? 5.676   13.634  -8.105  1.00 15.99  ? 86  LEU H CD2 1 
ATOM   2344 N N   . LYS B 2 87  ? 2.742   9.735   -5.227  1.00 21.79  ? 87  LYS H N   1 
ATOM   2345 C CA  . LYS B 2 87  ? 2.355   9.144   -3.949  1.00 23.98  ? 87  LYS H CA  1 
ATOM   2346 C C   . LYS B 2 87  ? 3.608   8.808   -3.106  1.00 26.27  ? 87  LYS H C   1 
ATOM   2347 O O   . LYS B 2 87  ? 4.725   8.716   -3.645  1.00 28.68  ? 87  LYS H O   1 
ATOM   2348 C CB  . LYS B 2 87  ? 1.541   7.877   -4.208  1.00 22.26  ? 87  LYS H CB  1 
ATOM   2349 C CG  . LYS B 2 87  ? 0.144   8.181   -4.756  1.00 26.16  ? 87  LYS H CG  1 
ATOM   2350 C CD  . LYS B 2 87  ? -0.486  6.981   -5.447  1.00 27.00  ? 87  LYS H CD  1 
ATOM   2351 C CE  . LYS B 2 87  ? -1.529  7.413   -6.479  1.00 35.58  ? 87  LYS H CE  1 
ATOM   2352 N NZ  . LYS B 2 87  ? -1.983  8.819   -6.287  1.00 38.16  ? 87  LYS H NZ  1 
ATOM   2353 N N   . ASN B 2 88  ? 3.434   8.649   -1.792  1.00 21.96  ? 88  ASN H N   1 
ATOM   2354 C CA  . ASN B 2 88  ? 4.547   8.307   -0.905  1.00 19.69  ? 88  ASN H CA  1 
ATOM   2355 C C   . ASN B 2 88  ? 5.217   7.037   -1.406  1.00 19.45  ? 88  ASN H C   1 
ATOM   2356 O O   . ASN B 2 88  ? 6.451   6.921   -1.372  1.00 27.11  ? 88  ASN H O   1 
ATOM   2357 C CB  . ASN B 2 88  ? 4.096   8.051   0.561   1.00 12.92  ? 88  ASN H CB  1 
ATOM   2358 C CG  . ASN B 2 88  ? 3.557   9.298   1.250   1.00 17.16  ? 88  ASN H CG  1 
ATOM   2359 O OD1 . ASN B 2 88  ? 3.936   10.430  0.938   1.00 16.92  ? 88  ASN H OD1 1 
ATOM   2360 N ND2 . ASN B 2 88  ? 2.652   9.086   2.213   1.00 16.60  ? 88  ASN H ND2 1 
ATOM   2361 N N   . GLU B 2 89  ? 4.401   6.097   -1.876  1.00 18.90  ? 89  GLU H N   1 
ATOM   2362 C CA  . GLU B 2 89  ? 4.868   4.807   -2.372  1.00 18.17  ? 89  GLU H CA  1 
ATOM   2363 C C   . GLU B 2 89  ? 5.680   4.889   -3.654  1.00 17.95  ? 89  GLU H C   1 
ATOM   2364 O O   . GLU B 2 89  ? 6.183   3.865   -4.115  1.00 15.65  ? 89  GLU H O   1 
ATOM   2365 C CB  . GLU B 2 89  ? 3.703   3.859   -2.607  1.00 18.92  ? 89  GLU H CB  1 
ATOM   2366 C CG  . GLU B 2 89  ? 2.937   3.498   -1.361  1.00 35.16  ? 89  GLU H CG  1 
ATOM   2367 C CD  . GLU B 2 89  ? 1.750   4.358   -1.177  1.00 30.38  ? 89  GLU H CD  1 
ATOM   2368 O OE1 . GLU B 2 89  ? 1.486   5.148   -2.102  1.00 24.09  ? 89  GLU H OE1 1 
ATOM   2369 O OE2 . GLU B 2 89  ? 1.040   4.251   -0.155  1.00 43.13  ? 89  GLU H OE2 1 
ATOM   2370 N N   . ASP B 2 90  ? 5.734   6.078   -4.251  1.00 15.91  ? 90  ASP H N   1 
ATOM   2371 C CA  . ASP B 2 90  ? 6.567   6.304   -5.449  1.00 21.07  ? 90  ASP H CA  1 
ATOM   2372 C C   . ASP B 2 90  ? 8.009   6.591   -5.021  1.00 21.40  ? 90  ASP H C   1 
ATOM   2373 O O   . ASP B 2 90  ? 8.927   6.587   -5.860  1.00 23.34  ? 90  ASP H O   1 
ATOM   2374 C CB  . ASP B 2 90  ? 6.066   7.503   -6.257  1.00 13.49  ? 90  ASP H CB  1 
ATOM   2375 C CG  . ASP B 2 90  ? 4.710   7.225   -6.949  1.00 18.11  ? 90  ASP H CG  1 
ATOM   2376 O OD1 . ASP B 2 90  ? 4.371   6.070   -7.255  1.00 15.75  ? 90  ASP H OD1 1 
ATOM   2377 O OD2 . ASP B 2 90  ? 3.978   8.175   -7.199  1.00 13.99  ? 90  ASP H OD2 1 
ATOM   2378 N N   . THR B 2 91  ? 8.197   6.878   -3.726  1.00 19.47  ? 91  THR H N   1 
ATOM   2379 C CA  . THR B 2 91  ? 9.524   7.154   -3.167  1.00 16.63  ? 91  THR H CA  1 
ATOM   2380 C C   . THR B 2 91  ? 10.389  5.955   -3.545  1.00 18.80  ? 91  THR H C   1 
ATOM   2381 O O   . THR B 2 91  ? 10.095  4.831   -3.171  1.00 18.14  ? 91  THR H O   1 
ATOM   2382 C CB  . THR B 2 91  ? 9.478   7.316   -1.609  1.00 18.34  ? 91  THR H CB  1 
ATOM   2383 O OG1 . THR B 2 91  ? 8.832   8.551   -1.292  1.00 23.00  ? 91  THR H OG1 1 
ATOM   2384 C CG2 . THR B 2 91  ? 10.914  7.354   -0.984  1.00 18.78  ? 91  THR H CG2 1 
ATOM   2385 N N   . ALA B 2 92  ? 11.442  6.203   -4.330  1.00 20.43  ? 92  ALA H N   1 
ATOM   2386 C CA  . ALA B 2 92  ? 12.330  5.143   -4.764  1.00 15.09  ? 92  ALA H CA  1 
ATOM   2387 C C   . ALA B 2 92  ? 13.466  5.736   -5.597  1.00 15.54  ? 92  ALA H C   1 
ATOM   2388 O O   . ALA B 2 92  ? 13.589  6.942   -5.766  1.00 18.68  ? 92  ALA H O   1 
ATOM   2389 C CB  . ALA B 2 92  ? 11.576  4.137   -5.615  1.00 15.48  ? 92  ALA H CB  1 
ATOM   2390 N N   . THR B 2 93  ? 14.288  4.849   -6.128  1.00 20.36  ? 93  THR H N   1 
ATOM   2391 C CA  . THR B 2 93  ? 15.403  5.261   -6.975  1.00 21.25  ? 93  THR H CA  1 
ATOM   2392 C C   . THR B 2 93  ? 15.037  4.714   -8.316  1.00 6.41   ? 93  THR H C   1 
ATOM   2393 O O   . THR B 2 93  ? 14.779  3.552   -8.422  1.00 5.44   ? 93  THR H O   1 
ATOM   2394 C CB  . THR B 2 93  ? 16.711  4.621   -6.531  1.00 23.53  ? 93  THR H CB  1 
ATOM   2395 O OG1 . THR B 2 93  ? 17.143  5.231   -5.300  1.00 23.47  ? 93  THR H OG1 1 
ATOM   2396 C CG2 . THR B 2 93  ? 17.769  4.830   -7.640  1.00 13.36  ? 93  THR H CG2 1 
ATOM   2397 N N   . TYR B 2 94  ? 14.987  5.549   -9.341  1.00 17.42  ? 94  TYR H N   1 
ATOM   2398 C CA  . TYR B 2 94  ? 14.607  5.039   -10.658 1.00 14.28  ? 94  TYR H CA  1 
ATOM   2399 C C   . TYR B 2 94  ? 15.793  4.897   -11.606 1.00 16.54  ? 94  TYR H C   1 
ATOM   2400 O O   . TYR B 2 94  ? 16.524  5.838   -11.829 1.00 15.78  ? 94  TYR H O   1 
ATOM   2401 C CB  . TYR B 2 94  ? 13.540  5.957   -11.274 1.00 21.32  ? 94  TYR H CB  1 
ATOM   2402 C CG  . TYR B 2 94  ? 12.236  5.903   -10.490 1.00 21.33  ? 94  TYR H CG  1 
ATOM   2403 C CD1 . TYR B 2 94  ? 12.023  6.758   -9.414  1.00 20.54  ? 94  TYR H CD1 1 
ATOM   2404 C CD2 . TYR B 2 94  ? 11.253  4.967   -10.798 1.00 19.19  ? 94  TYR H CD2 1 
ATOM   2405 C CE1 . TYR B 2 94  ? 10.846  6.685   -8.642  1.00 20.37  ? 94  TYR H CE1 1 
ATOM   2406 C CE2 . TYR B 2 94  ? 10.070  4.879   -10.037 1.00 24.51  ? 94  TYR H CE2 1 
ATOM   2407 C CZ  . TYR B 2 94  ? 9.873   5.742   -8.961  1.00 24.95  ? 94  TYR H CZ  1 
ATOM   2408 O OH  . TYR B 2 94  ? 8.704   5.672   -8.224  1.00 19.40  ? 94  TYR H OH  1 
ATOM   2409 N N   . PHE B 2 95  ? 15.963  3.701   -12.148 1.00 21.11  ? 95  PHE H N   1 
ATOM   2410 C CA  . PHE B 2 95  ? 17.045  3.420   -13.074 1.00 25.73  ? 95  PHE H CA  1 
ATOM   2411 C C   . PHE B 2 95  ? 16.545  3.414   -14.492 1.00 26.60  ? 95  PHE H C   1 
ATOM   2412 O O   . PHE B 2 95  ? 15.468  2.891   -14.792 1.00 28.97  ? 95  PHE H O   1 
ATOM   2413 C CB  . PHE B 2 95  ? 17.644  2.044   -12.813 1.00 22.61  ? 95  PHE H CB  1 
ATOM   2414 C CG  . PHE B 2 95  ? 18.215  1.891   -11.457 1.00 24.59  ? 95  PHE H CG  1 
ATOM   2415 C CD1 . PHE B 2 95  ? 19.473  2.408   -11.161 1.00 22.16  ? 95  PHE H CD1 1 
ATOM   2416 C CD2 . PHE B 2 95  ? 17.515  1.197   -10.477 1.00 19.32  ? 95  PHE H CD2 1 
ATOM   2417 C CE1 . PHE B 2 95  ? 20.031  2.222   -9.898  1.00 23.82  ? 95  PHE H CE1 1 
ATOM   2418 C CE2 . PHE B 2 95  ? 18.058  1.011   -9.220  1.00 21.33  ? 95  PHE H CE2 1 
ATOM   2419 C CZ  . PHE B 2 95  ? 19.328  1.526   -8.926  1.00 24.57  ? 95  PHE H CZ  1 
ATOM   2420 N N   . CYS B 2 96  ? 17.354  4.012   -15.350 1.00 30.21  ? 96  CYS H N   1 
ATOM   2421 C CA  . CYS B 2 96  ? 17.133  4.061   -16.775 1.00 26.46  ? 96  CYS H CA  1 
ATOM   2422 C C   . CYS B 2 96  ? 18.161  2.986   -17.202 1.00 30.07  ? 96  CYS H C   1 
ATOM   2423 O O   . CYS B 2 96  ? 19.348  3.091   -16.872 1.00 27.47  ? 96  CYS H O   1 
ATOM   2424 C CB  . CYS B 2 96  ? 17.500  5.459   -17.264 1.00 35.82  ? 96  CYS H CB  1 
ATOM   2425 S SG  . CYS B 2 96  ? 18.624  5.523   -18.687 1.00 53.93  ? 96  CYS H SG  1 
ATOM   2426 N N   . VAL B 2 97  ? 17.693  1.953   -17.896 1.00 23.77  ? 97  VAL H N   1 
ATOM   2427 C CA  . VAL B 2 97  ? 18.517  0.817   -18.311 1.00 25.29  ? 97  VAL H CA  1 
ATOM   2428 C C   . VAL B 2 97  ? 18.456  0.531   -19.817 1.00 25.46  ? 97  VAL H C   1 
ATOM   2429 O O   . VAL B 2 97  ? 17.370  0.391   -20.387 1.00 26.85  ? 97  VAL H O   1 
ATOM   2430 C CB  . VAL B 2 97  ? 18.052  -0.482  -17.575 1.00 19.38  ? 97  VAL H CB  1 
ATOM   2431 C CG1 . VAL B 2 97  ? 19.095  -1.563  -17.677 1.00 25.38  ? 97  VAL H CG1 1 
ATOM   2432 C CG2 . VAL B 2 97  ? 17.727  -0.180  -16.105 1.00 21.36  ? 97  VAL H CG2 1 
ATOM   2433 N N   . GLN B 2 98  ? 19.614  0.435   -20.465 1.00 26.82  ? 98  GLN H N   1 
ATOM   2434 C CA  . GLN B 2 98  ? 19.641  0.117   -21.888 1.00 29.80  ? 98  GLN H CA  1 
ATOM   2435 C C   . GLN B 2 98  ? 19.680  -1.401  -22.023 1.00 27.54  ? 98  GLN H C   1 
ATOM   2436 O O   . GLN B 2 98  ? 20.457  -2.077  -21.342 1.00 28.65  ? 98  GLN H O   1 
ATOM   2437 C CB  . GLN B 2 98  ? 20.859  0.737   -22.565 1.00 32.73  ? 98  GLN H CB  1 
ATOM   2438 C CG  . GLN B 2 98  ? 20.531  2.008   -23.312 1.00 33.99  ? 98  GLN H CG  1 
ATOM   2439 C CD  . GLN B 2 98  ? 21.767  2.813   -23.618 1.00 30.73  ? 98  GLN H CD  1 
ATOM   2440 O OE1 . GLN B 2 98  ? 22.818  2.599   -23.014 1.00 34.09  ? 98  GLN H OE1 1 
ATOM   2441 N NE2 . GLN B 2 98  ? 21.654  3.740   -24.555 1.00 27.11  ? 98  GLN H NE2 1 
ATOM   2442 N N   . ALA B 2 99  ? 18.832  -1.926  -22.900 1.00 25.39  ? 99  ALA H N   1 
ATOM   2443 C CA  . ALA B 2 99  ? 18.715  -3.360  -23.128 1.00 29.36  ? 99  ALA H CA  1 
ATOM   2444 C C   . ALA B 2 99  ? 18.939  -3.747  -24.584 1.00 30.75  ? 99  ALA H C   1 
ATOM   2445 O O   . ALA B 2 99  ? 18.542  -3.025  -25.497 1.00 33.30  ? 99  ALA H O   1 
ATOM   2446 C CB  . ALA B 2 99  ? 17.334  -3.836  -22.695 1.00 26.72  ? 99  ALA H CB  1 
ATOM   2447 N N   . GLU B 2 100 ? 19.545  -4.912  -24.777 1.00 30.31  ? 100 GLU H N   1 
ATOM   2448 C CA  . GLU B 2 100 ? 19.822  -5.454  -26.101 1.00 35.47  ? 100 GLU H CA  1 
ATOM   2449 C C   . GLU B 2 100 ? 18.824  -6.571  -26.436 1.00 32.33  ? 100 GLU H C   1 
ATOM   2450 O O   . GLU B 2 100 ? 18.544  -7.433  -25.608 1.00 32.97  ? 100 GLU H O   1 
ATOM   2451 C CB  . GLU B 2 100 ? 21.255  -5.988  -26.141 1.00 38.53  ? 100 GLU H CB  1 
ATOM   2452 C CG  . GLU B 2 100 ? 21.759  -6.271  -27.534 1.00 49.10  ? 100 GLU H CG  1 
ATOM   2453 C CD  . GLU B 2 100 ? 21.704  -7.737  -27.847 1.00 54.26  ? 100 GLU H CD  1 
ATOM   2454 O OE1 . GLU B 2 100 ? 21.414  -8.520  -26.916 1.00 57.74  ? 100 GLU H OE1 1 
ATOM   2455 O OE2 . GLU B 2 100 ? 21.949  -8.104  -29.014 1.00 61.55  ? 100 GLU H OE2 1 
ATOM   2456 N N   . ARG B 2 101 ? 18.300  -6.542  -27.660 1.00 36.88  ? 101 ARG H N   1 
ATOM   2457 C CA  . ARG B 2 101 ? 17.310  -7.505  -28.148 1.00 41.92  ? 101 ARG H CA  1 
ATOM   2458 C C   . ARG B 2 101 ? 17.714  -8.974  -28.240 1.00 42.18  ? 101 ARG H C   1 
ATOM   2459 O O   . ARG B 2 101 ? 16.961  -9.856  -27.828 1.00 43.16  ? 101 ARG H O   1 
ATOM   2460 C CB  . ARG B 2 101 ? 16.807  -7.060  -29.524 1.00 48.55  ? 101 ARG H CB  1 
ATOM   2461 C CG  . ARG B 2 101 ? 15.488  -7.680  -29.934 1.00 54.66  ? 101 ARG H CG  1 
ATOM   2462 C CD  . ARG B 2 101 ? 14.685  -6.722  -30.797 1.00 69.98  ? 101 ARG H CD  1 
ATOM   2463 N NE  . ARG B 2 101 ? 15.048  -6.831  -32.206 1.00 85.73  ? 101 ARG H NE  1 
ATOM   2464 C CZ  . ARG B 2 101 ? 14.651  -7.815  -33.009 1.00 94.71  ? 101 ARG H CZ  1 
ATOM   2465 N NH1 . ARG B 2 101 ? 13.869  -8.782  -32.544 1.00 97.91  ? 101 ARG H NH1 1 
ATOM   2466 N NH2 . ARG B 2 101 ? 15.040  -7.834  -34.278 1.00 98.11  ? 101 ARG H NH2 1 
ATOM   2467 N N   . LEU B 2 102 ? 18.885  -9.243  -28.801 1.00 44.70  ? 102 LEU H N   1 
ATOM   2468 C CA  . LEU B 2 102 ? 19.342  -10.618 -28.956 1.00 46.06  ? 102 LEU H CA  1 
ATOM   2469 C C   . LEU B 2 102 ? 19.576  -11.323 -27.629 1.00 48.67  ? 102 LEU H C   1 
ATOM   2470 O O   . LEU B 2 102 ? 19.051  -12.415 -27.394 1.00 50.75  ? 102 LEU H O   1 
ATOM   2471 C CB  . LEU B 2 102 ? 20.622  -10.655 -29.795 1.00 44.46  ? 102 LEU H CB  1 
ATOM   2472 C CG  . LEU B 2 102 ? 20.496  -11.187 -31.226 1.00 44.61  ? 102 LEU H CG  1 
ATOM   2473 C CD1 . LEU B 2 102 ? 19.034  -11.219 -31.658 1.00 43.94  ? 102 LEU H CD1 1 
ATOM   2474 C CD2 . LEU B 2 102 ? 21.312  -10.300 -32.164 1.00 44.63  ? 102 LEU H CD2 1 
ATOM   2475 N N   . ARG B 2 103 ? 20.374  -10.698 -26.769 1.00 48.05  ? 103 ARG H N   1 
ATOM   2476 C CA  . ARG B 2 103 ? 20.683  -11.260 -25.466 1.00 44.34  ? 103 ARG H CA  1 
ATOM   2477 C C   . ARG B 2 103 ? 19.498  -11.071 -24.528 1.00 43.62  ? 103 ARG H C   1 
ATOM   2478 O O   . ARG B 2 103 ? 19.294  -11.857 -23.600 1.00 41.02  ? 103 ARG H O   1 
ATOM   2479 C CB  . ARG B 2 103 ? 21.913  -10.572 -24.888 1.00 44.04  ? 103 ARG H CB  1 
ATOM   2480 C CG  . ARG B 2 103 ? 23.225  -11.116 -25.409 1.00 48.07  ? 103 ARG H CG  1 
ATOM   2481 C CD  . ARG B 2 103 ? 24.376  -10.707 -24.497 1.00 47.77  ? 103 ARG H CD  1 
ATOM   2482 N NE  . ARG B 2 103 ? 24.409  -9.267  -24.285 1.00 49.78  ? 103 ARG H NE  1 
ATOM   2483 C CZ  . ARG B 2 103 ? 24.493  -8.381  -25.271 1.00 51.87  ? 103 ARG H CZ  1 
ATOM   2484 N NH1 . ARG B 2 103 ? 24.555  -8.800  -26.526 1.00 54.25  ? 103 ARG H NH1 1 
ATOM   2485 N NH2 . ARG B 2 103 ? 24.497  -7.082  -25.009 1.00 51.39  ? 103 ARG H NH2 1 
ATOM   2486 N N   . ARG B 2 104 ? 18.718  -10.025 -24.781 1.00 41.71  ? 104 ARG H N   1 
ATOM   2487 C CA  . ARG B 2 104 ? 17.554  -9.732  -23.959 1.00 41.97  ? 104 ARG H CA  1 
ATOM   2488 C C   . ARG B 2 104 ? 18.027  -9.502  -22.526 1.00 38.33  ? 104 ARG H C   1 
ATOM   2489 O O   . ARG B 2 104 ? 17.468  -10.049 -21.569 1.00 36.71  ? 104 ARG H O   1 
ATOM   2490 C CB  . ARG B 2 104 ? 16.563  -10.896 -24.020 1.00 42.02  ? 104 ARG H CB  1 
ATOM   2491 C CG  . ARG B 2 104 ? 15.374  -10.627 -24.927 1.00 54.18  ? 104 ARG H CG  1 
ATOM   2492 C CD  . ARG B 2 104 ? 14.849  -11.899 -25.570 1.00 58.82  ? 104 ARG H CD  1 
ATOM   2493 N NE  . ARG B 2 104 ? 13.574  -12.323 -24.993 1.00 64.79  ? 104 ARG H NE  1 
ATOM   2494 C CZ  . ARG B 2 104 ? 12.616  -12.950 -25.672 1.00 66.25  ? 104 ARG H CZ  1 
ATOM   2495 N NH1 . ARG B 2 104 ? 12.782  -13.232 -26.958 1.00 66.18  ? 104 ARG H NH1 1 
ATOM   2496 N NH2 . ARG B 2 104 ? 11.491  -13.293 -25.067 1.00 65.44  ? 104 ARG H NH2 1 
ATOM   2497 N N   . THR B 2 105 ? 19.068  -8.679  -22.402 1.00 34.42  ? 105 THR H N   1 
ATOM   2498 C CA  . THR B 2 105 ? 19.670  -8.353  -21.117 1.00 29.65  ? 105 THR H CA  1 
ATOM   2499 C C   . THR B 2 105 ? 19.639  -6.868  -20.846 1.00 27.54  ? 105 THR H C   1 
ATOM   2500 O O   . THR B 2 105 ? 19.484  -6.063  -21.765 1.00 28.93  ? 105 THR H O   1 
ATOM   2501 C CB  . THR B 2 105 ? 21.164  -8.768  -21.054 1.00 29.14  ? 105 THR H CB  1 
ATOM   2502 O OG1 . THR B 2 105 ? 21.894  -8.065  -22.068 1.00 32.24  ? 105 THR H OG1 1 
ATOM   2503 C CG2 . THR B 2 105 ? 21.325  -10.248 -21.276 1.00 31.82  ? 105 THR H CG2 1 
ATOM   2504 N N   . PHE B 2 106 ? 19.781  -6.526  -19.568 1.00 29.05  ? 106 PHE H N   1 
ATOM   2505 C CA  . PHE B 2 106 ? 19.844  -5.146  -19.114 1.00 28.47  ? 106 PHE H CA  1 
ATOM   2506 C C   . PHE B 2 106 ? 21.359  -4.872  -19.043 1.00 30.06  ? 106 PHE H C   1 
ATOM   2507 O O   . PHE B 2 106 ? 21.986  -5.037  -17.998 1.00 19.91  ? 106 PHE H O   1 
ATOM   2508 C CB  . PHE B 2 106 ? 19.200  -5.024  -17.731 1.00 23.06  ? 106 PHE H CB  1 
ATOM   2509 C CG  . PHE B 2 106 ? 17.710  -5.299  -17.722 1.00 32.57  ? 106 PHE H CG  1 
ATOM   2510 C CD1 . PHE B 2 106 ? 16.866  -4.653  -18.613 1.00 31.95  ? 106 PHE H CD1 1 
ATOM   2511 C CD2 . PHE B 2 106 ? 17.155  -6.220  -16.834 1.00 34.73  ? 106 PHE H CD2 1 
ATOM   2512 C CE1 . PHE B 2 106 ? 15.494  -4.924  -18.630 1.00 34.07  ? 106 PHE H CE1 1 
ATOM   2513 C CE2 . PHE B 2 106 ? 15.772  -6.495  -16.846 1.00 35.01  ? 106 PHE H CE2 1 
ATOM   2514 C CZ  . PHE B 2 106 ? 14.952  -5.846  -17.741 1.00 30.39  ? 106 PHE H CZ  1 
ATOM   2515 N N   . ASP B 2 107 ? 21.929  -4.465  -20.179 1.00 33.69  ? 107 ASP H N   1 
ATOM   2516 C CA  . ASP B 2 107 ? 23.365  -4.221  -20.318 1.00 33.51  ? 107 ASP H CA  1 
ATOM   2517 C C   . ASP B 2 107 ? 23.953  -3.050  -19.543 1.00 34.91  ? 107 ASP H C   1 
ATOM   2518 O O   . ASP B 2 107 ? 24.843  -3.247  -18.714 1.00 34.77  ? 107 ASP H O   1 
ATOM   2519 C CB  . ASP B 2 107 ? 23.712  -4.107  -21.806 1.00 34.97  ? 107 ASP H CB  1 
ATOM   2520 C CG  . ASP B 2 107 ? 23.307  -5.354  -22.587 1.00 37.54  ? 107 ASP H CG  1 
ATOM   2521 O OD1 . ASP B 2 107 ? 23.937  -6.411  -22.408 1.00 41.65  ? 107 ASP H OD1 1 
ATOM   2522 O OD2 . ASP B 2 107 ? 22.344  -5.286  -23.372 1.00 47.21  ? 107 ASP H OD2 1 
ATOM   2523 N N   . TYR B 2 108 ? 23.468  -1.840  -19.798 1.00 36.12  ? 108 TYR H N   1 
ATOM   2524 C CA  . TYR B 2 108 ? 23.976  -0.675  -19.079 1.00 37.04  ? 108 TYR H CA  1 
ATOM   2525 C C   . TYR B 2 108 ? 22.903  -0.022  -18.219 1.00 36.69  ? 108 TYR H C   1 
ATOM   2526 O O   . TYR B 2 108 ? 21.783  0.217   -18.682 1.00 36.20  ? 108 TYR H O   1 
ATOM   2527 C CB  . TYR B 2 108 ? 24.525  0.363   -20.052 1.00 50.07  ? 108 TYR H CB  1 
ATOM   2528 C CG  . TYR B 2 108 ? 25.400  1.423   -19.408 1.00 66.55  ? 108 TYR H CG  1 
ATOM   2529 C CD1 . TYR B 2 108 ? 24.844  2.607   -18.923 1.00 71.53  ? 108 TYR H CD1 1 
ATOM   2530 C CD2 . TYR B 2 108 ? 26.788  1.260   -19.314 1.00 70.40  ? 108 TYR H CD2 1 
ATOM   2531 C CE1 . TYR B 2 108 ? 25.640  3.609   -18.364 1.00 73.96  ? 108 TYR H CE1 1 
ATOM   2532 C CE2 . TYR B 2 108 ? 27.597  2.260   -18.753 1.00 73.02  ? 108 TYR H CE2 1 
ATOM   2533 C CZ  . TYR B 2 108 ? 27.013  3.435   -18.282 1.00 75.35  ? 108 TYR H CZ  1 
ATOM   2534 O OH  . TYR B 2 108 ? 27.787  4.444   -17.743 1.00 71.79  ? 108 TYR H OH  1 
ATOM   2535 N N   . TRP B 2 109 ? 23.251  0.274   -16.970 1.00 28.63  ? 109 TRP H N   1 
ATOM   2536 C CA  . TRP B 2 109 ? 22.321  0.913   -16.057 1.00 30.57  ? 109 TRP H CA  1 
ATOM   2537 C C   . TRP B 2 109 ? 22.771  2.326   -15.719 1.00 31.73  ? 109 TRP H C   1 
ATOM   2538 O O   . TRP B 2 109 ? 23.967  2.588   -15.565 1.00 35.00  ? 109 TRP H O   1 
ATOM   2539 C CB  . TRP B 2 109 ? 22.189  0.090   -14.762 1.00 22.90  ? 109 TRP H CB  1 
ATOM   2540 C CG  . TRP B 2 109 ? 21.607  -1.317  -14.966 1.00 25.93  ? 109 TRP H CG  1 
ATOM   2541 C CD1 . TRP B 2 109 ? 22.099  -2.304  -15.775 1.00 19.43  ? 109 TRP H CD1 1 
ATOM   2542 C CD2 . TRP B 2 109 ? 20.479  -1.893  -14.279 1.00 24.18  ? 109 TRP H CD2 1 
ATOM   2543 N NE1 . TRP B 2 109 ? 21.359  -3.455  -15.635 1.00 23.25  ? 109 TRP H NE1 1 
ATOM   2544 C CE2 . TRP B 2 109 ? 20.358  -3.229  -14.719 1.00 23.82  ? 109 TRP H CE2 1 
ATOM   2545 C CE3 . TRP B 2 109 ? 19.568  -1.404  -13.330 1.00 29.72  ? 109 TRP H CE3 1 
ATOM   2546 C CZ2 . TRP B 2 109 ? 19.360  -4.091  -14.245 1.00 26.33  ? 109 TRP H CZ2 1 
ATOM   2547 C CZ3 . TRP B 2 109 ? 18.561  -2.268  -12.849 1.00 27.30  ? 109 TRP H CZ3 1 
ATOM   2548 C CH2 . TRP B 2 109 ? 18.471  -3.596  -13.313 1.00 28.87  ? 109 TRP H CH2 1 
ATOM   2549 N N   . GLY B 2 110 ? 21.811  3.238   -15.616 1.00 22.07  ? 110 GLY H N   1 
ATOM   2550 C CA  . GLY B 2 110 ? 22.139  4.596   -15.249 1.00 23.26  ? 110 GLY H CA  1 
ATOM   2551 C C   . GLY B 2 110 ? 22.509  4.596   -13.777 1.00 20.14  ? 110 GLY H C   1 
ATOM   2552 O O   . GLY B 2 110 ? 22.453  3.559   -13.117 1.00 23.88  ? 110 GLY H O   1 
ATOM   2553 N N   . ALA B 2 111 ? 22.893  5.753   -13.256 1.00 24.10  ? 111 ALA H N   1 
ATOM   2554 C CA  . ALA B 2 111 ? 23.268  5.857   -11.851 1.00 26.51  ? 111 ALA H CA  1 
ATOM   2555 C C   . ALA B 2 111 ? 22.042  5.713   -10.938 1.00 28.41  ? 111 ALA H C   1 
ATOM   2556 O O   . ALA B 2 111 ? 22.151  5.276   -9.791  1.00 27.29  ? 111 ALA H O   1 
ATOM   2557 C CB  . ALA B 2 111 ? 23.937  7.197   -11.597 1.00 25.51  ? 111 ALA H CB  1 
ATOM   2558 N N   . GLY B 2 112 ? 20.884  6.092   -11.456 1.00 25.15  ? 112 GLY H N   1 
ATOM   2559 C CA  . GLY B 2 112 ? 19.658  6.008   -10.683 1.00 31.17  ? 112 GLY H CA  1 
ATOM   2560 C C   . GLY B 2 112 ? 19.304  7.368   -10.134 1.00 32.71  ? 112 GLY H C   1 
ATOM   2561 O O   . GLY B 2 112 ? 20.165  8.085   -9.625  1.00 32.95  ? 112 GLY H O   1 
ATOM   2562 N N   . THR B 2 113 ? 18.039  7.747   -10.266 1.00 29.90  ? 113 THR H N   1 
ATOM   2563 C CA  . THR B 2 113 ? 17.590  9.024   -9.753  1.00 23.36  ? 113 THR H CA  1 
ATOM   2564 C C   . THR B 2 113 ? 16.645  8.752   -8.570  1.00 27.30  ? 113 THR H C   1 
ATOM   2565 O O   . THR B 2 113 ? 15.662  8.006   -8.669  1.00 21.37  ? 113 THR H O   1 
ATOM   2566 C CB  . THR B 2 113 ? 16.862  9.842   -10.832 1.00 27.75  ? 113 THR H CB  1 
ATOM   2567 O OG1 . THR B 2 113 ? 17.799  10.262  -11.833 1.00 26.83  ? 113 THR H OG1 1 
ATOM   2568 C CG2 . THR B 2 113 ? 16.210  11.063  -10.217 1.00 26.94  ? 113 THR H CG2 1 
ATOM   2569 N N   . THR B 2 114 ? 16.961  9.380   -7.452  1.00 20.99  ? 114 THR H N   1 
ATOM   2570 C CA  . THR B 2 114 ? 16.195  9.196   -6.249  1.00 25.89  ? 114 THR H CA  1 
ATOM   2571 C C   . THR B 2 114 ? 15.067  10.197  -6.168  1.00 23.75  ? 114 THR H C   1 
ATOM   2572 O O   . THR B 2 114 ? 15.263  11.397  -6.351  1.00 20.79  ? 114 THR H O   1 
ATOM   2573 C CB  . THR B 2 114 ? 17.125  9.287   -5.038  1.00 26.37  ? 114 THR H CB  1 
ATOM   2574 O OG1 . THR B 2 114 ? 17.389  7.962   -4.565  1.00 40.12  ? 114 THR H OG1 1 
ATOM   2575 C CG2 . THR B 2 114 ? 16.533  10.118  -3.941  1.00 33.36  ? 114 THR H CG2 1 
ATOM   2576 N N   . VAL B 2 115 ? 13.867  9.678   -5.942  1.00 23.54  ? 115 VAL H N   1 
ATOM   2577 C CA  . VAL B 2 115 ? 12.689  10.533  -5.828  1.00 23.80  ? 115 VAL H CA  1 
ATOM   2578 C C   . VAL B 2 115 ? 12.068  10.327  -4.446  1.00 21.19  ? 115 VAL H C   1 
ATOM   2579 O O   . VAL B 2 115 ? 11.789  9.201   -4.053  1.00 20.18  ? 115 VAL H O   1 
ATOM   2580 C CB  . VAL B 2 115 ? 11.656  10.195  -6.927  1.00 27.25  ? 115 VAL H CB  1 
ATOM   2581 C CG1 . VAL B 2 115 ? 10.357  10.989  -6.690  1.00 26.10  ? 115 VAL H CG1 1 
ATOM   2582 C CG2 . VAL B 2 115 ? 12.259  10.543  -8.312  1.00 21.23  ? 115 VAL H CG2 1 
ATOM   2583 N N   . THR B 2 116 ? 11.906  11.413  -3.695  1.00 23.90  ? 116 THR H N   1 
ATOM   2584 C CA  . THR B 2 116 ? 11.321  11.327  -2.369  1.00 24.44  ? 116 THR H CA  1 
ATOM   2585 C C   . THR B 2 116 ? 10.005  12.109  -2.298  1.00 23.79  ? 116 THR H C   1 
ATOM   2586 O O   . THR B 2 116 ? 10.000  13.334  -2.434  1.00 25.38  ? 116 THR H O   1 
ATOM   2587 C CB  . THR B 2 116 ? 12.268  11.879  -1.312  1.00 26.83  ? 116 THR H CB  1 
ATOM   2588 O OG1 . THR B 2 116 ? 13.493  11.126  -1.328  1.00 21.57  ? 116 THR H OG1 1 
ATOM   2589 C CG2 . THR B 2 116 ? 11.596  11.779  0.079   1.00 19.53  ? 116 THR H CG2 1 
ATOM   2590 N N   . VAL B 2 117 ? 8.894   11.400  -2.095  1.00 26.35  ? 117 VAL H N   1 
ATOM   2591 C CA  . VAL B 2 117 ? 7.575   12.036  -2.019  1.00 22.31  ? 117 VAL H CA  1 
ATOM   2592 C C   . VAL B 2 117 ? 7.122   12.178  -0.583  1.00 21.47  ? 117 VAL H C   1 
ATOM   2593 O O   . VAL B 2 117 ? 6.936   11.180  0.108   1.00 18.99  ? 117 VAL H O   1 
ATOM   2594 C CB  . VAL B 2 117 ? 6.497   11.215  -2.738  1.00 23.78  ? 117 VAL H CB  1 
ATOM   2595 C CG1 . VAL B 2 117 ? 5.239   12.073  -2.882  1.00 21.64  ? 117 VAL H CG1 1 
ATOM   2596 C CG2 . VAL B 2 117 ? 7.002   10.742  -4.100  1.00 23.68  ? 117 VAL H CG2 1 
ATOM   2597 N N   . SER B 2 118 ? 6.901   13.411  -0.146  1.00 19.47  ? 118 SER H N   1 
ATOM   2598 C CA  . SER B 2 118 ? 6.508   13.633  1.237   1.00 24.64  ? 118 SER H CA  1 
ATOM   2599 C C   . SER B 2 118 ? 5.842   14.981  1.417   1.00 18.76  ? 118 SER H C   1 
ATOM   2600 O O   . SER B 2 118 ? 6.114   15.911  0.661   1.00 23.66  ? 118 SER H O   1 
ATOM   2601 C CB  . SER B 2 118 ? 7.744   13.540  2.132   1.00 21.36  ? 118 SER H CB  1 
ATOM   2602 O OG  . SER B 2 118 ? 7.424   13.794  3.483   1.00 18.86  ? 118 SER H OG  1 
ATOM   2603 N N   . SER B 2 119 ? 4.966   15.070  2.420   1.00 23.10  ? 119 SER H N   1 
ATOM   2604 C CA  . SER B 2 119 ? 4.240   16.292  2.739   1.00 20.86  ? 119 SER H CA  1 
ATOM   2605 C C   . SER B 2 119 ? 5.001   17.092  3.811   1.00 23.50  ? 119 SER H C   1 
ATOM   2606 O O   . SER B 2 119 ? 4.707   18.253  4.074   1.00 21.94  ? 119 SER H O   1 
ATOM   2607 C CB  . SER B 2 119 ? 2.816   15.949  3.238   1.00 26.87  ? 119 SER H CB  1 
ATOM   2608 O OG  . SER B 2 119 ? 2.828   15.206  4.457   1.00 28.92  ? 119 SER H OG  1 
ATOM   2609 N N   . ALA B 2 120 ? 6.014   16.480  4.402   1.00 23.47  ? 120 ALA H N   1 
ATOM   2610 C CA  . ALA B 2 120 ? 6.775   17.158  5.440   1.00 21.93  ? 120 ALA H CA  1 
ATOM   2611 C C   . ALA B 2 120 ? 7.493   18.399  4.938   1.00 23.34  ? 120 ALA H C   1 
ATOM   2612 O O   . ALA B 2 120 ? 7.863   18.505  3.765   1.00 25.31  ? 120 ALA H O   1 
ATOM   2613 C CB  . ALA B 2 120 ? 7.754   16.196  6.072   1.00 19.29  ? 120 ALA H CB  1 
ATOM   2614 N N   . SER B 2 121 ? 7.640   19.365  5.835   1.00 25.74  ? 121 SER H N   1 
ATOM   2615 C CA  . SER B 2 121 ? 8.317   20.612  5.528   1.00 28.70  ? 121 SER H CA  1 
ATOM   2616 C C   . SER B 2 121 ? 9.762   20.533  6.033   1.00 26.24  ? 121 SER H C   1 
ATOM   2617 O O   . SER B 2 121 ? 10.055  19.813  6.985   1.00 20.42  ? 121 SER H O   1 
ATOM   2618 C CB  . SER B 2 121 ? 7.581   21.767  6.202   1.00 30.84  ? 121 SER H CB  1 
ATOM   2619 O OG  . SER B 2 121 ? 6.455   22.166  5.433   1.00 38.75  ? 121 SER H OG  1 
ATOM   2620 N N   . THR B 2 122 ? 10.663  21.263  5.382   1.00 30.15  ? 122 THR H N   1 
ATOM   2621 C CA  . THR B 2 122 ? 12.062  21.270  5.783   1.00 28.95  ? 122 THR H CA  1 
ATOM   2622 C C   . THR B 2 122 ? 12.142  21.589  7.283   1.00 31.83  ? 122 THR H C   1 
ATOM   2623 O O   . THR B 2 122 ? 11.522  22.538  7.762   1.00 31.17  ? 122 THR H O   1 
ATOM   2624 C CB  . THR B 2 122 ? 12.866  22.319  4.966   1.00 32.64  ? 122 THR H CB  1 
ATOM   2625 O OG1 . THR B 2 122 ? 12.921  21.911  3.590   1.00 28.30  ? 122 THR H OG1 1 
ATOM   2626 C CG2 . THR B 2 122 ? 14.273  22.438  5.492   1.00 27.78  ? 122 THR H CG2 1 
ATOM   2627 N N   . LYS B 2 123 ? 12.889  20.780  8.025   1.00 29.44  ? 123 LYS H N   1 
ATOM   2628 C CA  . LYS B 2 123 ? 13.018  20.983  9.462   1.00 30.30  ? 123 LYS H CA  1 
ATOM   2629 C C   . LYS B 2 123 ? 14.369  20.525  9.985   1.00 31.16  ? 123 LYS H C   1 
ATOM   2630 O O   . LYS B 2 123 ? 14.814  19.414  9.711   1.00 34.29  ? 123 LYS H O   1 
ATOM   2631 C CB  . LYS B 2 123 ? 11.912  20.229  10.206  1.00 34.76  ? 123 LYS H CB  1 
ATOM   2632 C CG  . LYS B 2 123 ? 11.667  20.704  11.643  1.00 27.36  ? 123 LYS H CG  1 
ATOM   2633 C CD  . LYS B 2 123 ? 11.108  19.595  12.515  1.00 27.81  ? 123 LYS H CD  1 
ATOM   2634 C CE  . LYS B 2 123 ? 11.253  19.941  13.997  1.00 32.18  ? 123 LYS H CE  1 
ATOM   2635 N NZ  . LYS B 2 123 ? 12.615  19.583  14.551  1.00 36.39  ? 123 LYS H NZ  1 
ATOM   2636 N N   . GLY B 2 124 ? 15.020  21.398  10.741  1.00 33.05  ? 124 GLY H N   1 
ATOM   2637 C CA  . GLY B 2 124 ? 16.308  21.057  11.305  1.00 31.00  ? 124 GLY H CA  1 
ATOM   2638 C C   . GLY B 2 124 ? 16.088  20.104  12.456  1.00 28.69  ? 124 GLY H C   1 
ATOM   2639 O O   . GLY B 2 124 ? 15.039  20.127  13.083  1.00 32.72  ? 124 GLY H O   1 
ATOM   2640 N N   . PRO B 2 125 ? 17.066  19.255  12.771  1.00 29.71  ? 125 PRO H N   1 
ATOM   2641 C CA  . PRO B 2 125 ? 16.885  18.319  13.873  1.00 26.64  ? 125 PRO H CA  1 
ATOM   2642 C C   . PRO B 2 125 ? 17.138  18.916  15.247  1.00 24.81  ? 125 PRO H C   1 
ATOM   2643 O O   . PRO B 2 125 ? 17.683  20.013  15.383  1.00 25.89  ? 125 PRO H O   1 
ATOM   2644 C CB  . PRO B 2 125 ? 17.892  17.218  13.565  1.00 28.22  ? 125 PRO H CB  1 
ATOM   2645 C CG  . PRO B 2 125 ? 19.010  17.953  12.905  1.00 29.96  ? 125 PRO H CG  1 
ATOM   2646 C CD  . PRO B 2 125 ? 18.393  19.111  12.145  1.00 29.15  ? 125 PRO H CD  1 
ATOM   2647 N N   . SER B 2 126 ? 16.714  18.171  16.255  1.00 26.78  ? 126 SER H N   1 
ATOM   2648 C CA  . SER B 2 126 ? 16.928  18.510  17.654  1.00 27.18  ? 126 SER H CA  1 
ATOM   2649 C C   . SER B 2 126 ? 17.997  17.485  18.011  1.00 28.45  ? 126 SER H C   1 
ATOM   2650 O O   . SER B 2 126 ? 17.886  16.325  17.618  1.00 24.43  ? 126 SER H O   1 
ATOM   2651 C CB  . SER B 2 126 ? 15.675  18.232  18.489  1.00 31.50  ? 126 SER H CB  1 
ATOM   2652 O OG  . SER B 2 126 ? 14.566  18.983  18.025  1.00 35.03  ? 126 SER H OG  1 
ATOM   2653 N N   . VAL B 2 127 ? 19.030  17.914  18.731  1.00 25.80  ? 127 VAL H N   1 
ATOM   2654 C CA  . VAL B 2 127 ? 20.120  17.024  19.110  1.00 26.72  ? 127 VAL H CA  1 
ATOM   2655 C C   . VAL B 2 127 ? 20.157  16.822  20.612  1.00 24.48  ? 127 VAL H C   1 
ATOM   2656 O O   . VAL B 2 127 ? 20.325  17.773  21.368  1.00 25.00  ? 127 VAL H O   1 
ATOM   2657 C CB  . VAL B 2 127 ? 21.484  17.592  18.645  1.00 23.75  ? 127 VAL H CB  1 
ATOM   2658 C CG1 . VAL B 2 127 ? 22.593  16.600  18.948  1.00 23.09  ? 127 VAL H CG1 1 
ATOM   2659 C CG2 . VAL B 2 127 ? 21.425  17.901  17.143  1.00 23.02  ? 127 VAL H CG2 1 
ATOM   2660 N N   . PHE B 2 128 ? 19.988  15.575  21.032  1.00 20.30  ? 128 PHE H N   1 
ATOM   2661 C CA  . PHE B 2 128 ? 19.977  15.232  22.437  1.00 26.60  ? 128 PHE H CA  1 
ATOM   2662 C C   . PHE B 2 128 ? 21.135  14.297  22.778  1.00 26.26  ? 128 PHE H C   1 
ATOM   2663 O O   . PHE B 2 128 ? 21.484  13.413  22.001  1.00 28.08  ? 128 PHE H O   1 
ATOM   2664 C CB  . PHE B 2 128 ? 18.654  14.528  22.800  1.00 24.85  ? 128 PHE H CB  1 
ATOM   2665 C CG  . PHE B 2 128 ? 17.429  15.331  22.456  1.00 28.03  ? 128 PHE H CG  1 
ATOM   2666 C CD1 . PHE B 2 128 ? 17.175  16.547  23.092  1.00 30.37  ? 128 PHE H CD1 1 
ATOM   2667 C CD2 . PHE B 2 128 ? 16.542  14.882  21.485  1.00 27.02  ? 128 PHE H CD2 1 
ATOM   2668 C CE1 . PHE B 2 128 ? 16.055  17.312  22.758  1.00 30.90  ? 128 PHE H CE1 1 
ATOM   2669 C CE2 . PHE B 2 128 ? 15.415  15.639  21.142  1.00 22.34  ? 128 PHE H CE2 1 
ATOM   2670 C CZ  . PHE B 2 128 ? 15.175  16.853  21.774  1.00 25.62  ? 128 PHE H CZ  1 
ATOM   2671 N N   . PRO B 2 129 ? 21.744  14.487  23.950  1.00 27.94  ? 129 PRO H N   1 
ATOM   2672 C CA  . PRO B 2 129 ? 22.854  13.625  24.358  1.00 31.27  ? 129 PRO H CA  1 
ATOM   2673 C C   . PRO B 2 129 ? 22.398  12.237  24.745  1.00 29.30  ? 129 PRO H C   1 
ATOM   2674 O O   . PRO B 2 129 ? 21.272  12.041  25.188  1.00 36.46  ? 129 PRO H O   1 
ATOM   2675 C CB  . PRO B 2 129 ? 23.453  14.353  25.555  1.00 34.74  ? 129 PRO H CB  1 
ATOM   2676 C CG  . PRO B 2 129 ? 22.303  15.126  26.124  1.00 31.37  ? 129 PRO H CG  1 
ATOM   2677 C CD  . PRO B 2 129 ? 21.471  15.543  24.940  1.00 30.98  ? 129 PRO H CD  1 
ATOM   2678 N N   . LEU B 2 130 ? 23.283  11.268  24.547  1.00 31.29  ? 130 LEU H N   1 
ATOM   2679 C CA  . LEU B 2 130 ? 23.061  9.878   24.920  1.00 28.57  ? 130 LEU H CA  1 
ATOM   2680 C C   . LEU B 2 130 ? 24.198  9.703   25.933  1.00 33.43  ? 130 LEU H C   1 
ATOM   2681 O O   . LEU B 2 130 ? 25.261  9.172   25.604  1.00 28.76  ? 130 LEU H O   1 
ATOM   2682 C CB  . LEU B 2 130 ? 23.292  8.954   23.729  1.00 31.33  ? 130 LEU H CB  1 
ATOM   2683 C CG  . LEU B 2 130 ? 22.142  8.497   22.827  1.00 32.89  ? 130 LEU H CG  1 
ATOM   2684 C CD1 . LEU B 2 130 ? 21.280  9.665   22.440  1.00 36.54  ? 130 LEU H CD1 1 
ATOM   2685 C CD2 . LEU B 2 130 ? 22.715  7.832   21.582  1.00 31.66  ? 130 LEU H CD2 1 
ATOM   2686 N N   . ALA B 2 131 ? 23.963  10.176  27.158  1.00 30.54  ? 131 ALA H N   1 
ATOM   2687 C CA  . ALA B 2 131 ? 24.961  10.152  28.227  1.00 34.06  ? 131 ALA H CA  1 
ATOM   2688 C C   . ALA B 2 131 ? 25.552  8.807   28.614  1.00 35.15  ? 131 ALA H C   1 
ATOM   2689 O O   . ALA B 2 131 ? 24.844  7.804   28.718  1.00 36.26  ? 131 ALA H O   1 
ATOM   2690 C CB  . ALA B 2 131 ? 24.394  10.827  29.464  1.00 31.86  ? 131 ALA H CB  1 
ATOM   2691 N N   . PRO B 2 132 ? 26.883  8.766   28.814  1.00 38.02  ? 132 PRO H N   1 
ATOM   2692 C CA  . PRO B 2 132 ? 27.567  7.528   29.203  1.00 41.01  ? 132 PRO H CA  1 
ATOM   2693 C C   . PRO B 2 132 ? 27.118  7.114   30.607  1.00 47.36  ? 132 PRO H C   1 
ATOM   2694 O O   . PRO B 2 132 ? 26.993  7.964   31.490  1.00 42.74  ? 132 PRO H O   1 
ATOM   2695 C CB  . PRO B 2 132 ? 29.047  7.913   29.191  1.00 39.11  ? 132 PRO H CB  1 
ATOM   2696 C CG  . PRO B 2 132 ? 29.033  9.406   29.434  1.00 38.87  ? 132 PRO H CG  1 
ATOM   2697 C CD  . PRO B 2 132 ? 27.824  9.893   28.674  1.00 32.41  ? 132 PRO H CD  1 
ATOM   2698 N N   . SER B 2 133 ? 26.885  5.816   30.804  1.00 58.52  ? 133 SER H N   1 
ATOM   2699 C CA  . SER B 2 133 ? 26.458  5.290   32.103  1.00 69.14  ? 133 SER H CA  1 
ATOM   2700 C C   . SER B 2 133 ? 27.166  6.012   33.245  1.00 76.16  ? 133 SER H C   1 
ATOM   2701 O O   . SER B 2 133 ? 28.388  5.917   33.389  1.00 75.49  ? 133 SER H O   1 
ATOM   2702 C CB  . SER B 2 133 ? 26.754  3.787   32.193  1.00 70.74  ? 133 SER H CB  1 
ATOM   2703 O OG  . SER B 2 133 ? 25.905  3.142   33.129  1.00 69.82  ? 133 SER H OG  1 
ATOM   2704 N N   . SER B 2 134 ? 26.388  6.737   34.046  1.00 85.50  ? 134 SER H N   1 
ATOM   2705 C CA  . SER B 2 134 ? 26.920  7.487   35.181  1.00 93.22  ? 134 SER H CA  1 
ATOM   2706 C C   . SER B 2 134 ? 27.040  6.595   36.415  1.00 96.51  ? 134 SER H C   1 
ATOM   2707 O O   . SER B 2 134 ? 28.083  6.570   37.076  1.00 98.95  ? 134 SER H O   1 
ATOM   2708 C CB  . SER B 2 134 ? 26.016  8.684   35.496  1.00 94.06  ? 134 SER H CB  1 
ATOM   2709 O OG  . SER B 2 134 ? 24.677  8.274   35.717  1.00 92.75  ? 134 SER H OG  1 
ATOM   2710 N N   . LYS B 2 135 ? 25.970  5.864   36.718  1.00 97.83  ? 135 LYS H N   1 
ATOM   2711 C CA  . LYS B 2 135 ? 25.959  4.964   37.868  1.00 97.50  ? 135 LYS H CA  1 
ATOM   2712 C C   . LYS B 2 135 ? 26.895  3.781   37.616  1.00 99.21  ? 135 LYS H C   1 
ATOM   2713 O O   . LYS B 2 135 ? 26.885  2.791   38.351  1.00 99.26  ? 135 LYS H O   1 
ATOM   2714 C CB  . LYS B 2 135 ? 24.534  4.467   38.134  1.00 94.12  ? 135 LYS H CB  1 
ATOM   2715 C CG  . LYS B 2 135 ? 23.785  5.273   39.191  1.00 86.97  ? 135 LYS H CG  1 
ATOM   2716 C CD  . LYS B 2 135 ? 22.773  6.217   38.559  1.00 76.60  ? 135 LYS H CD  1 
ATOM   2717 C CE  . LYS B 2 135 ? 21.829  6.795   39.602  1.00 70.80  ? 135 LYS H CE  1 
ATOM   2718 N NZ  . LYS B 2 135 ? 21.198  8.052   39.123  1.00 67.46  ? 135 LYS H NZ  1 
ATOM   2719 N N   . SER B 2 136 ? 27.702  3.905   36.566  1.00 99.36  ? 136 SER H N   1 
ATOM   2720 C CA  . SER B 2 136 ? 28.671  2.884   36.183  1.00 99.21  ? 136 SER H CA  1 
ATOM   2721 C C   . SER B 2 136 ? 29.800  3.555   35.399  1.00 99.36  ? 136 SER H C   1 
ATOM   2722 O O   . SER B 2 136 ? 30.098  3.171   34.268  1.00 99.22  ? 136 SER H O   1 
ATOM   2723 C CB  . SER B 2 136 ? 27.999  1.815   35.318  1.00 99.75  ? 136 SER H CB  1 
ATOM   2724 O OG  . SER B 2 136 ? 28.747  0.610   35.332  1.00 99.67  ? 136 SER H OG  1 
ATOM   2725 N N   . THR B 2 137 ? 30.420  4.556   36.019  1.00 98.70  ? 137 THR H N   1 
ATOM   2726 C CA  . THR B 2 137 ? 31.509  5.325   35.412  1.00 98.73  ? 137 THR H CA  1 
ATOM   2727 C C   . THR B 2 137 ? 32.736  4.521   34.977  1.00 99.18  ? 137 THR H C   1 
ATOM   2728 O O   . THR B 2 137 ? 33.024  4.418   33.785  1.00 99.84  ? 137 THR H O   1 
ATOM   2729 C CB  . THR B 2 137 ? 32.002  6.438   36.366  1.00 99.28  ? 137 THR H CB  1 
ATOM   2730 O OG1 . THR B 2 137 ? 30.903  7.280   36.733  1.00 99.85  ? 137 THR H OG1 1 
ATOM   2731 C CG2 . THR B 2 137 ? 33.082  7.279   35.693  1.00 96.62  ? 137 THR H CG2 1 
ATOM   2732 N N   . SER B 2 138 ? 33.475  3.986   35.946  1.00 98.03  ? 138 SER H N   1 
ATOM   2733 C CA  . SER B 2 138 ? 34.679  3.211   35.652  1.00 96.86  ? 138 SER H CA  1 
ATOM   2734 C C   . SER B 2 138 ? 34.379  1.724   35.484  1.00 94.58  ? 138 SER H C   1 
ATOM   2735 O O   . SER B 2 138 ? 34.353  0.971   36.460  1.00 92.95  ? 138 SER H O   1 
ATOM   2736 C CB  . SER B 2 138 ? 35.714  3.403   36.767  1.00 99.42  ? 138 SER H CB  1 
ATOM   2737 O OG  . SER B 2 138 ? 36.878  4.056   36.284  1.00 100.00 ? 138 SER H OG  1 
ATOM   2738 N N   . GLY B 2 139 ? 34.158  1.311   34.239  1.00 91.60  ? 139 GLY H N   1 
ATOM   2739 C CA  . GLY B 2 139 ? 33.863  -0.083  33.961  1.00 87.23  ? 139 GLY H CA  1 
ATOM   2740 C C   . GLY B 2 139 ? 34.423  -0.562  32.634  1.00 81.64  ? 139 GLY H C   1 
ATOM   2741 O O   . GLY B 2 139 ? 33.835  -1.425  31.980  1.00 83.62  ? 139 GLY H O   1 
ATOM   2742 N N   . GLY B 2 140 ? 35.564  -0.008  32.234  1.00 74.10  ? 140 GLY H N   1 
ATOM   2743 C CA  . GLY B 2 140 ? 36.170  -0.404  30.976  1.00 65.01  ? 140 GLY H CA  1 
ATOM   2744 C C   . GLY B 2 140 ? 35.802  0.535   29.844  1.00 58.14  ? 140 GLY H C   1 
ATOM   2745 O O   . GLY B 2 140 ? 36.384  1.612   29.702  1.00 55.71  ? 140 GLY H O   1 
ATOM   2746 N N   . THR B 2 141 ? 34.830  0.128   29.033  1.00 53.38  ? 141 THR H N   1 
ATOM   2747 C CA  . THR B 2 141 ? 34.377  0.945   27.915  1.00 45.98  ? 141 THR H CA  1 
ATOM   2748 C C   . THR B 2 141 ? 33.077  1.659   28.238  1.00 47.65  ? 141 THR H C   1 
ATOM   2749 O O   . THR B 2 141 ? 32.155  1.075   28.814  1.00 47.84  ? 141 THR H O   1 
ATOM   2750 C CB  . THR B 2 141 ? 34.158  0.102   26.662  1.00 42.27  ? 141 THR H CB  1 
ATOM   2751 O OG1 . THR B 2 141 ? 35.360  -0.607  26.355  1.00 39.22  ? 141 THR H OG1 1 
ATOM   2752 C CG2 . THR B 2 141 ? 33.790  0.988   25.484  1.00 40.45  ? 141 THR H CG2 1 
ATOM   2753 N N   . ALA B 2 142 ? 33.011  2.928   27.855  1.00 47.88  ? 142 ALA H N   1 
ATOM   2754 C CA  . ALA B 2 142 ? 31.835  3.747   28.093  1.00 48.36  ? 142 ALA H CA  1 
ATOM   2755 C C   . ALA B 2 142 ? 30.971  3.800   26.836  1.00 50.53  ? 142 ALA H C   1 
ATOM   2756 O O   . ALA B 2 142 ? 31.456  3.565   25.729  1.00 47.34  ? 142 ALA H O   1 
ATOM   2757 C CB  . ALA B 2 142 ? 32.252  5.148   28.499  1.00 47.71  ? 142 ALA H CB  1 
ATOM   2758 N N   . ALA B 2 143 ? 29.693  4.114   27.039  1.00 49.03  ? 143 ALA H N   1 
ATOM   2759 C CA  . ALA B 2 143 ? 28.683  4.217   25.987  1.00 47.14  ? 143 ALA H CA  1 
ATOM   2760 C C   . ALA B 2 143 ? 28.880  5.477   25.149  1.00 43.62  ? 143 ALA H C   1 
ATOM   2761 O O   . ALA B 2 143 ? 29.690  5.478   24.237  1.00 49.71  ? 143 ALA H O   1 
ATOM   2762 C CB  . ALA B 2 143 ? 27.308  4.224   26.621  1.00 53.09  ? 143 ALA H CB  1 
ATOM   2763 N N   . LEU B 2 144 ? 28.131  6.538   25.447  1.00 38.31  ? 144 LEU H N   1 
ATOM   2764 C CA  . LEU B 2 144 ? 28.260  7.824   24.732  1.00 29.50  ? 144 LEU H CA  1 
ATOM   2765 C C   . LEU B 2 144 ? 27.628  7.977   23.330  1.00 27.70  ? 144 LEU H C   1 
ATOM   2766 O O   . LEU B 2 144 ? 27.878  7.192   22.413  1.00 24.13  ? 144 LEU H O   1 
ATOM   2767 C CB  . LEU B 2 144 ? 29.750  8.193   24.638  1.00 34.91  ? 144 LEU H CB  1 
ATOM   2768 C CG  . LEU B 2 144 ? 30.190  9.639   24.830  1.00 32.82  ? 144 LEU H CG  1 
ATOM   2769 C CD1 . LEU B 2 144 ? 31.329  9.690   25.827  1.00 29.67  ? 144 LEU H CD1 1 
ATOM   2770 C CD2 . LEU B 2 144 ? 30.609  10.226  23.505  1.00 38.33  ? 144 LEU H CD2 1 
ATOM   2771 N N   . GLY B 2 145 ? 26.840  9.025   23.141  1.00 24.57  ? 145 GLY H N   1 
ATOM   2772 C CA  . GLY B 2 145 ? 26.240  9.212   21.830  1.00 20.79  ? 145 GLY H CA  1 
ATOM   2773 C C   . GLY B 2 145 ? 25.420  10.467  21.707  1.00 23.41  ? 145 GLY H C   1 
ATOM   2774 O O   . GLY B 2 145 ? 25.383  11.284  22.619  1.00 21.69  ? 145 GLY H O   1 
ATOM   2775 N N   . CYS B 2 146 ? 24.791  10.619  20.543  1.00 23.72  ? 146 CYS H N   1 
ATOM   2776 C CA  . CYS B 2 146 ? 23.933  11.738  20.232  1.00 22.45  ? 146 CYS H CA  1 
ATOM   2777 C C   . CYS B 2 146 ? 22.733  11.209  19.421  1.00 24.32  ? 146 CYS H C   1 
ATOM   2778 O O   . CYS B 2 146 ? 22.896  10.397  18.498  1.00 18.36  ? 146 CYS H O   1 
ATOM   2779 C CB  . CYS B 2 146 ? 24.671  12.773  19.381  1.00 30.24  ? 146 CYS H CB  1 
ATOM   2780 S SG  . CYS B 2 146 ? 25.555  14.080  20.284  1.00 29.57  ? 146 CYS H SG  1 
ATOM   2781 N N   . LEU B 2 147 ? 21.539  11.656  19.794  1.00 25.91  ? 147 LEU H N   1 
ATOM   2782 C CA  . LEU B 2 147 ? 20.289  11.290  19.116  1.00 26.74  ? 147 LEU H CA  1 
ATOM   2783 C C   . LEU B 2 147 ? 19.876  12.493  18.271  1.00 22.18  ? 147 LEU H C   1 
ATOM   2784 O O   . LEU B 2 147 ? 19.498  13.511  18.817  1.00 22.39  ? 147 LEU H O   1 
ATOM   2785 C CB  . LEU B 2 147 ? 19.194  11.020  20.158  1.00 31.33  ? 147 LEU H CB  1 
ATOM   2786 C CG  . LEU B 2 147 ? 17.753  10.863  19.663  1.00 30.44  ? 147 LEU H CG  1 
ATOM   2787 C CD1 . LEU B 2 147 ? 17.720  9.871   18.512  1.00 24.65  ? 147 LEU H CD1 1 
ATOM   2788 C CD2 . LEU B 2 147 ? 16.857  10.385  20.826  1.00 26.37  ? 147 LEU H CD2 1 
ATOM   2789 N N   . VAL B 2 148 ? 19.944  12.392  16.949  1.00 25.36  ? 148 VAL H N   1 
ATOM   2790 C CA  . VAL B 2 148 ? 19.565  13.530  16.111  1.00 25.28  ? 148 VAL H CA  1 
ATOM   2791 C C   . VAL B 2 148 ? 18.179  13.187  15.556  1.00 30.10  ? 148 VAL H C   1 
ATOM   2792 O O   . VAL B 2 148 ? 18.014  12.395  14.633  1.00 23.76  ? 148 VAL H O   1 
ATOM   2793 C CB  . VAL B 2 148 ? 20.678  13.801  15.039  1.00 28.38  ? 148 VAL H CB  1 
ATOM   2794 C CG1 . VAL B 2 148 ? 21.603  12.607  14.967  1.00 30.65  ? 148 VAL H CG1 1 
ATOM   2795 C CG2 . VAL B 2 148 ? 20.106  14.168  13.708  1.00 21.44  ? 148 VAL H CG2 1 
ATOM   2796 N N   . LYS B 2 149 ? 17.174  13.799  16.169  1.00 28.18  ? 149 LYS H N   1 
ATOM   2797 C CA  . LYS B 2 149 ? 15.808  13.484  15.837  1.00 28.30  ? 149 LYS H CA  1 
ATOM   2798 C C   . LYS B 2 149 ? 14.909  14.572  15.274  1.00 23.60  ? 149 LYS H C   1 
ATOM   2799 O O   . LYS B 2 149 ? 15.112  15.774  15.476  1.00 24.66  ? 149 LYS H O   1 
ATOM   2800 C CB  . LYS B 2 149 ? 15.181  12.822  17.075  1.00 34.85  ? 149 LYS H CB  1 
ATOM   2801 C CG  . LYS B 2 149 ? 13.897  13.405  17.613  1.00 41.35  ? 149 LYS H CG  1 
ATOM   2802 C CD  . LYS B 2 149 ? 13.283  12.443  18.633  1.00 37.72  ? 149 LYS H CD  1 
ATOM   2803 C CE  . LYS B 2 149 ? 11.760  12.479  18.610  1.00 39.77  ? 149 LYS H CE  1 
ATOM   2804 N NZ  . LYS B 2 149 ? 11.205  11.118  18.442  1.00 35.74  ? 149 LYS H NZ  1 
ATOM   2805 N N   . ASP B 2 150 ? 13.914  14.103  14.532  1.00 20.88  ? 150 ASP H N   1 
ATOM   2806 C CA  . ASP B 2 150 ? 12.917  14.950  13.913  1.00 20.92  ? 150 ASP H CA  1 
ATOM   2807 C C   . ASP B 2 150 ? 13.443  15.963  12.940  1.00 15.26  ? 150 ASP H C   1 
ATOM   2808 O O   . ASP B 2 150 ? 13.350  17.147  13.186  1.00 22.85  ? 150 ASP H O   1 
ATOM   2809 C CB  . ASP B 2 150 ? 12.080  15.647  14.999  1.00 21.61  ? 150 ASP H CB  1 
ATOM   2810 C CG  . ASP B 2 150 ? 11.325  14.656  15.858  1.00 23.15  ? 150 ASP H CG  1 
ATOM   2811 O OD1 . ASP B 2 150 ? 11.228  13.485  15.430  1.00 24.86  ? 150 ASP H OD1 1 
ATOM   2812 O OD2 . ASP B 2 150 ? 10.842  15.037  16.950  1.00 23.82  ? 150 ASP H OD2 1 
ATOM   2813 N N   . TYR B 2 151 ? 13.998  15.502  11.818  1.00 21.67  ? 151 TYR H N   1 
ATOM   2814 C CA  . TYR B 2 151 ? 14.479  16.422  10.800  1.00 16.95  ? 151 TYR H CA  1 
ATOM   2815 C C   . TYR B 2 151 ? 13.956  15.986  9.451   1.00 19.09  ? 151 TYR H C   1 
ATOM   2816 O O   . TYR B 2 151 ? 13.558  14.845  9.271   1.00 22.07  ? 151 TYR H O   1 
ATOM   2817 C CB  . TYR B 2 151 ? 16.022  16.467  10.733  1.00 15.14  ? 151 TYR H CB  1 
ATOM   2818 C CG  . TYR B 2 151 ? 16.676  15.138  10.383  1.00 20.30  ? 151 TYR H CG  1 
ATOM   2819 C CD1 . TYR B 2 151 ? 16.926  14.772  9.050   1.00 21.43  ? 151 TYR H CD1 1 
ATOM   2820 C CD2 . TYR B 2 151 ? 17.060  14.251  11.380  1.00 19.25  ? 151 TYR H CD2 1 
ATOM   2821 C CE1 . TYR B 2 151 ? 17.552  13.539  8.737   1.00 7.96   ? 151 TYR H CE1 1 
ATOM   2822 C CE2 . TYR B 2 151 ? 17.679  13.034  11.070  1.00 17.59  ? 151 TYR H CE2 1 
ATOM   2823 C CZ  . TYR B 2 151 ? 17.920  12.700  9.744   1.00 10.94  ? 151 TYR H CZ  1 
ATOM   2824 O OH  . TYR B 2 151 ? 18.550  11.520  9.459   1.00 17.98  ? 151 TYR H OH  1 
ATOM   2825 N N   . PHE B 2 152 ? 13.953  16.913  8.504   1.00 19.31  ? 152 PHE H N   1 
ATOM   2826 C CA  . PHE B 2 152 ? 13.513  16.600  7.149   1.00 22.73  ? 152 PHE H CA  1 
ATOM   2827 C C   . PHE B 2 152 ? 14.029  17.654  6.182   1.00 16.16  ? 152 PHE H C   1 
ATOM   2828 O O   . PHE B 2 152 ? 14.051  18.836  6.501   1.00 21.28  ? 152 PHE H O   1 
ATOM   2829 C CB  . PHE B 2 152 ? 11.974  16.539  7.051   1.00 18.69  ? 152 PHE H CB  1 
ATOM   2830 C CG  . PHE B 2 152 ? 11.484  16.121  5.701   1.00 18.35  ? 152 PHE H CG  1 
ATOM   2831 C CD1 . PHE B 2 152 ? 11.286  17.069  4.699   1.00 18.30  ? 152 PHE H CD1 1 
ATOM   2832 C CD2 . PHE B 2 152 ? 11.328  14.771  5.392   1.00 15.02  ? 152 PHE H CD2 1 
ATOM   2833 C CE1 . PHE B 2 152 ? 10.951  16.684  3.413   1.00 22.66  ? 152 PHE H CE1 1 
ATOM   2834 C CE2 . PHE B 2 152 ? 10.995  14.385  4.108   1.00 15.81  ? 152 PHE H CE2 1 
ATOM   2835 C CZ  . PHE B 2 152 ? 10.808  15.335  3.117   1.00 18.40  ? 152 PHE H CZ  1 
ATOM   2836 N N   . PRO B 2 153 ? 14.546  17.225  5.020   1.00 16.38  ? 153 PRO H N   1 
ATOM   2837 C CA  . PRO B 2 153 ? 14.711  15.858  4.532   1.00 17.14  ? 153 PRO H CA  1 
ATOM   2838 C C   . PRO B 2 153 ? 16.127  15.325  4.860   1.00 20.11  ? 153 PRO H C   1 
ATOM   2839 O O   . PRO B 2 153 ? 16.896  15.918  5.631   1.00 24.22  ? 153 PRO H O   1 
ATOM   2840 C CB  . PRO B 2 153 ? 14.527  16.018  3.024   1.00 21.15  ? 153 PRO H CB  1 
ATOM   2841 C CG  . PRO B 2 153 ? 15.156  17.346  2.754   1.00 16.17  ? 153 PRO H CG  1 
ATOM   2842 C CD  . PRO B 2 153 ? 14.900  18.206  3.980   1.00 20.02  ? 153 PRO H CD  1 
ATOM   2843 N N   . GLU B 2 154 ? 16.461  14.203  4.254   1.00 24.75  ? 154 GLU H N   1 
ATOM   2844 C CA  . GLU B 2 154 ? 17.777  13.606  4.405   1.00 26.73  ? 154 GLU H CA  1 
ATOM   2845 C C   . GLU B 2 154 ? 18.694  14.436  3.505   1.00 27.92  ? 154 GLU H C   1 
ATOM   2846 O O   . GLU B 2 154 ? 18.232  15.041  2.555   1.00 28.21  ? 154 GLU H O   1 
ATOM   2847 C CB  . GLU B 2 154 ? 17.754  12.176  3.901   1.00 26.60  ? 154 GLU H CB  1 
ATOM   2848 C CG  . GLU B 2 154 ? 17.157  11.190  4.862   1.00 29.41  ? 154 GLU H CG  1 
ATOM   2849 C CD  . GLU B 2 154 ? 18.192  10.285  5.465   1.00 35.80  ? 154 GLU H CD  1 
ATOM   2850 O OE1 . GLU B 2 154 ? 19.073  10.787  6.218   1.00 35.26  ? 154 GLU H OE1 1 
ATOM   2851 O OE2 . GLU B 2 154 ? 18.108  9.069   5.186   1.00 35.28  ? 154 GLU H OE2 1 
ATOM   2852 N N   . PRO B 2 155 ? 20.011  14.445  3.774   1.00 27.41  ? 155 PRO H N   1 
ATOM   2853 C CA  . PRO B 2 155 ? 20.683  13.742  4.847   1.00 23.79  ? 155 PRO H CA  1 
ATOM   2854 C C   . PRO B 2 155 ? 21.158  14.658  5.965   1.00 21.91  ? 155 PRO H C   1 
ATOM   2855 O O   . PRO B 2 155 ? 20.941  15.868  5.971   1.00 23.21  ? 155 PRO H O   1 
ATOM   2856 C CB  . PRO B 2 155 ? 21.875  13.120  4.135   1.00 22.59  ? 155 PRO H CB  1 
ATOM   2857 C CG  . PRO B 2 155 ? 22.254  14.229  3.125   1.00 27.91  ? 155 PRO H CG  1 
ATOM   2858 C CD  . PRO B 2 155 ? 21.010  15.103  2.908   1.00 27.83  ? 155 PRO H CD  1 
ATOM   2859 N N   . VAL B 2 156 ? 21.839  14.032  6.901   1.00 20.87  ? 156 VAL H N   1 
ATOM   2860 C CA  . VAL B 2 156 ? 22.424  14.704  8.032   1.00 25.65  ? 156 VAL H CA  1 
ATOM   2861 C C   . VAL B 2 156 ? 23.831  14.096  8.076   1.00 24.08  ? 156 VAL H C   1 
ATOM   2862 O O   . VAL B 2 156 ? 24.040  12.961  7.653   1.00 23.59  ? 156 VAL H O   1 
ATOM   2863 C CB  . VAL B 2 156 ? 21.641  14.371  9.322   1.00 24.43  ? 156 VAL H CB  1 
ATOM   2864 C CG1 . VAL B 2 156 ? 22.549  13.706  10.340  1.00 30.64  ? 156 VAL H CG1 1 
ATOM   2865 C CG2 . VAL B 2 156 ? 21.005  15.644  9.887   1.00 19.73  ? 156 VAL H CG2 1 
ATOM   2866 N N   . THR B 2 157 ? 24.803  14.871  8.524   1.00 26.37  ? 157 THR H N   1 
ATOM   2867 C CA  . THR B 2 157 ? 26.160  14.348  8.653   1.00 23.87  ? 157 THR H CA  1 
ATOM   2868 C C   . THR B 2 157 ? 26.514  14.559  10.119  1.00 19.32  ? 157 THR H C   1 
ATOM   2869 O O   . THR B 2 157 ? 26.150  15.576  10.696  1.00 21.96  ? 157 THR H O   1 
ATOM   2870 C CB  . THR B 2 157 ? 27.173  15.139  7.789   1.00 22.53  ? 157 THR H CB  1 
ATOM   2871 O OG1 . THR B 2 157 ? 26.992  16.543  8.006   1.00 23.53  ? 157 THR H OG1 1 
ATOM   2872 C CG2 . THR B 2 157 ? 26.969  14.843  6.322   1.00 19.64  ? 157 THR H CG2 1 
ATOM   2873 N N   . VAL B 2 158 ? 27.187  13.587  10.719  1.00 22.40  ? 158 VAL H N   1 
ATOM   2874 C CA  . VAL B 2 158 ? 27.609  13.713  12.097  1.00 24.91  ? 158 VAL H CA  1 
ATOM   2875 C C   . VAL B 2 158 ? 29.075  13.299  12.281  1.00 20.43  ? 158 VAL H C   1 
ATOM   2876 O O   . VAL B 2 158 ? 29.493  12.212  11.889  1.00 24.41  ? 158 VAL H O   1 
ATOM   2877 C CB  . VAL B 2 158 ? 26.749  12.853  13.060  1.00 22.60  ? 158 VAL H CB  1 
ATOM   2878 C CG1 . VAL B 2 158 ? 27.224  13.072  14.504  1.00 25.06  ? 158 VAL H CG1 1 
ATOM   2879 C CG2 . VAL B 2 158 ? 25.292  13.250  12.958  1.00 24.99  ? 158 VAL H CG2 1 
ATOM   2880 N N   . SER B 2 159 ? 29.859  14.180  12.871  1.00 20.22  ? 159 SER H N   1 
ATOM   2881 C CA  . SER B 2 159 ? 31.240  13.831  13.158  1.00 22.78  ? 159 SER H CA  1 
ATOM   2882 C C   . SER B 2 159 ? 31.392  13.956  14.675  1.00 25.09  ? 159 SER H C   1 
ATOM   2883 O O   . SER B 2 159 ? 30.472  14.421  15.369  1.00 27.21  ? 159 SER H O   1 
ATOM   2884 C CB  . SER B 2 159 ? 32.214  14.755  12.414  1.00 15.65  ? 159 SER H CB  1 
ATOM   2885 O OG  . SER B 2 159 ? 31.812  16.116  12.440  1.00 22.00  ? 159 SER H OG  1 
ATOM   2886 N N   . TRP B 2 160 ? 32.533  13.529  15.196  1.00 27.97  ? 160 TRP H N   1 
ATOM   2887 C CA  . TRP B 2 160 ? 32.787  13.613  16.618  1.00 30.70  ? 160 TRP H CA  1 
ATOM   2888 C C   . TRP B 2 160 ? 34.110  14.345  16.839  1.00 35.85  ? 160 TRP H C   1 
ATOM   2889 O O   . TRP B 2 160 ? 35.116  14.024  16.207  1.00 32.35  ? 160 TRP H O   1 
ATOM   2890 C CB  . TRP B 2 160 ? 32.840  12.202  17.204  1.00 32.27  ? 160 TRP H CB  1 
ATOM   2891 C CG  . TRP B 2 160 ? 31.476  11.620  17.429  1.00 33.14  ? 160 TRP H CG  1 
ATOM   2892 C CD1 . TRP B 2 160 ? 30.757  10.836  16.567  1.00 29.89  ? 160 TRP H CD1 1 
ATOM   2893 C CD2 . TRP B 2 160 ? 30.684  11.746  18.612  1.00 33.49  ? 160 TRP H CD2 1 
ATOM   2894 N NE1 . TRP B 2 160 ? 29.565  10.463  17.147  1.00 34.89  ? 160 TRP H NE1 1 
ATOM   2895 C CE2 . TRP B 2 160 ? 29.496  11.008  18.403  1.00 36.40  ? 160 TRP H CE2 1 
ATOM   2896 C CE3 . TRP B 2 160 ? 30.864  12.409  19.833  1.00 32.29  ? 160 TRP H CE3 1 
ATOM   2897 C CZ2 . TRP B 2 160 ? 28.492  10.915  19.372  1.00 32.69  ? 160 TRP H CZ2 1 
ATOM   2898 C CZ3 . TRP B 2 160 ? 29.864  12.316  20.799  1.00 28.66  ? 160 TRP H CZ3 1 
ATOM   2899 C CH2 . TRP B 2 160 ? 28.694  11.574  20.559  1.00 33.31  ? 160 TRP H CH2 1 
ATOM   2900 N N   . ASN B 2 161 ? 34.097  15.332  17.726  1.00 33.99  ? 161 ASN H N   1 
ATOM   2901 C CA  . ASN B 2 161 ? 35.291  16.107  18.012  1.00 37.84  ? 161 ASN H CA  1 
ATOM   2902 C C   . ASN B 2 161 ? 35.869  16.670  16.719  1.00 39.39  ? 161 ASN H C   1 
ATOM   2903 O O   . ASN B 2 161 ? 37.071  16.592  16.466  1.00 39.49  ? 161 ASN H O   1 
ATOM   2904 C CB  . ASN B 2 161 ? 36.317  15.232  18.734  1.00 34.30  ? 161 ASN H CB  1 
ATOM   2905 C CG  . ASN B 2 161 ? 35.925  14.963  20.179  1.00 33.21  ? 161 ASN H CG  1 
ATOM   2906 O OD1 . ASN B 2 161 ? 36.543  14.148  20.869  1.00 34.56  ? 161 ASN H OD1 1 
ATOM   2907 N ND2 . ASN B 2 161 ? 34.887  15.660  20.644  1.00 28.59  ? 161 ASN H ND2 1 
ATOM   2908 N N   . SER B 2 162 ? 34.986  17.246  15.909  1.00 33.34  ? 162 SER H N   1 
ATOM   2909 C CA  . SER B 2 162 ? 35.356  17.837  14.631  1.00 30.99  ? 162 SER H CA  1 
ATOM   2910 C C   . SER B 2 162 ? 36.104  16.894  13.722  1.00 30.29  ? 162 SER H C   1 
ATOM   2911 O O   . SER B 2 162 ? 36.864  17.323  12.851  1.00 34.76  ? 162 SER H O   1 
ATOM   2912 C CB  . SER B 2 162 ? 36.166  19.122  14.829  1.00 31.95  ? 162 SER H CB  1 
ATOM   2913 O OG  . SER B 2 162 ? 35.376  20.141  15.427  1.00 36.55  ? 162 SER H OG  1 
ATOM   2914 N N   . GLY B 2 163 ? 35.868  15.603  13.891  1.00 23.45  ? 163 GLY H N   1 
ATOM   2915 C CA  . GLY B 2 163 ? 36.511  14.631  13.027  1.00 26.75  ? 163 GLY H CA  1 
ATOM   2916 C C   . GLY B 2 163 ? 37.744  13.926  13.562  1.00 27.49  ? 163 GLY H C   1 
ATOM   2917 O O   . GLY B 2 163 ? 38.255  12.986  12.934  1.00 25.44  ? 163 GLY H O   1 
ATOM   2918 N N   . ALA B 2 164 ? 38.218  14.354  14.723  1.00 27.95  ? 164 ALA H N   1 
ATOM   2919 C CA  . ALA B 2 164 ? 39.416  13.751  15.303  1.00 28.74  ? 164 ALA H CA  1 
ATOM   2920 C C   . ALA B 2 164 ? 39.089  12.373  15.847  1.00 28.60  ? 164 ALA H C   1 
ATOM   2921 O O   . ALA B 2 164 ? 39.981  11.530  15.993  1.00 25.49  ? 164 ALA H O   1 
ATOM   2922 C CB  . ALA B 2 164 ? 39.939  14.630  16.415  1.00 27.71  ? 164 ALA H CB  1 
ATOM   2923 N N   . LEU B 2 165 ? 37.804  12.153  16.141  1.00 27.53  ? 165 LEU H N   1 
ATOM   2924 C CA  . LEU B 2 165 ? 37.319  10.892  16.700  1.00 26.53  ? 165 LEU H CA  1 
ATOM   2925 C C   . LEU B 2 165 ? 36.534  10.096  15.666  1.00 26.28  ? 165 LEU H C   1 
ATOM   2926 O O   . LEU B 2 165 ? 35.445  10.529  15.256  1.00 22.14  ? 165 LEU H O   1 
ATOM   2927 C CB  . LEU B 2 165 ? 36.390  11.182  17.898  1.00 23.42  ? 165 LEU H CB  1 
ATOM   2928 C CG  . LEU B 2 165 ? 36.371  10.273  19.115  1.00 28.92  ? 165 LEU H CG  1 
ATOM   2929 C CD1 . LEU B 2 165 ? 34.997  10.386  19.762  1.00 28.32  ? 165 LEU H CD1 1 
ATOM   2930 C CD2 . LEU B 2 165 ? 36.658  8.838   18.758  1.00 26.27  ? 165 LEU H CD2 1 
ATOM   2931 N N   . THR B 2 166 ? 37.055  8.938   15.252  1.00 21.64  ? 166 THR H N   1 
ATOM   2932 C CA  . THR B 2 166 ? 36.370  8.118   14.258  1.00 21.61  ? 166 THR H CA  1 
ATOM   2933 C C   . THR B 2 166 ? 36.285  6.654   14.631  1.00 21.81  ? 166 THR H C   1 
ATOM   2934 O O   . THR B 2 166 ? 35.357  5.961   14.225  1.00 28.31  ? 166 THR H O   1 
ATOM   2935 C CB  . THR B 2 166 ? 37.051  8.193   12.829  1.00 26.78  ? 166 THR H CB  1 
ATOM   2936 O OG1 . THR B 2 166 ? 38.414  7.737   12.894  1.00 29.55  ? 166 THR H OG1 1 
ATOM   2937 C CG2 . THR B 2 166 ? 37.037  9.600   12.283  1.00 25.68  ? 166 THR H CG2 1 
ATOM   2938 N N   . SER B 2 167 ? 37.252  6.167   15.387  1.00 25.44  ? 167 SER H N   1 
ATOM   2939 C CA  . SER B 2 167 ? 37.241  4.778   15.818  1.00 28.43  ? 167 SER H CA  1 
ATOM   2940 C C   . SER B 2 167 ? 36.160  4.529   16.873  1.00 28.98  ? 167 SER H C   1 
ATOM   2941 O O   . SER B 2 167 ? 36.023  5.283   17.819  1.00 22.52  ? 167 SER H O   1 
ATOM   2942 C CB  . SER B 2 167 ? 38.592  4.379   16.404  1.00 35.27  ? 167 SER H CB  1 
ATOM   2943 O OG  . SER B 2 167 ? 39.462  5.499   16.509  1.00 45.01  ? 167 SER H OG  1 
ATOM   2944 N N   . GLY B 2 168 ? 35.444  3.419   16.728  1.00 26.88  ? 168 GLY H N   1 
ATOM   2945 C CA  . GLY B 2 168 ? 34.357  3.090   17.633  1.00 30.55  ? 168 GLY H CA  1 
ATOM   2946 C C   . GLY B 2 168 ? 33.045  3.772   17.232  1.00 30.39  ? 168 GLY H C   1 
ATOM   2947 O O   . GLY B 2 168 ? 31.967  3.332   17.621  1.00 34.45  ? 168 GLY H O   1 
ATOM   2948 N N   . VAL B 2 169 ? 33.142  4.840   16.445  1.00 31.39  ? 169 VAL H N   1 
ATOM   2949 C CA  . VAL B 2 169 ? 31.962  5.588   16.002  1.00 30.31  ? 169 VAL H CA  1 
ATOM   2950 C C   . VAL B 2 169 ? 30.999  4.784   15.121  1.00 30.28  ? 169 VAL H C   1 
ATOM   2951 O O   . VAL B 2 169 ? 31.413  4.122   14.169  1.00 28.48  ? 169 VAL H O   1 
ATOM   2952 C CB  . VAL B 2 169 ? 32.357  6.855   15.221  1.00 28.52  ? 169 VAL H CB  1 
ATOM   2953 C CG1 . VAL B 2 169 ? 31.094  7.565   14.693  1.00 26.16  ? 169 VAL H CG1 1 
ATOM   2954 C CG2 . VAL B 2 169 ? 33.133  7.811   16.138  1.00 25.62  ? 169 VAL H CG2 1 
ATOM   2955 N N   . HIS B 2 170 ? 29.704  4.843   15.428  1.00 28.73  ? 170 HIS H N   1 
ATOM   2956 C CA  . HIS B 2 170 ? 28.717  4.133   14.618  1.00 20.77  ? 170 HIS H CA  1 
ATOM   2957 C C   . HIS B 2 170 ? 27.546  5.061   14.429  1.00 24.33  ? 170 HIS H C   1 
ATOM   2958 O O   . HIS B 2 170 ? 26.831  5.354   15.387  1.00 25.35  ? 170 HIS H O   1 
ATOM   2959 C CB  . HIS B 2 170 ? 28.247  2.861   15.316  1.00 26.89  ? 170 HIS H CB  1 
ATOM   2960 C CG  . HIS B 2 170 ? 29.175  1.698   15.170  1.00 29.32  ? 170 HIS H CG  1 
ATOM   2961 N ND1 . HIS B 2 170 ? 30.220  1.471   16.040  1.00 35.52  ? 170 HIS H ND1 1 
ATOM   2962 C CD2 . HIS B 2 170 ? 29.193  0.670   14.291  1.00 31.19  ? 170 HIS H CD2 1 
ATOM   2963 C CE1 . HIS B 2 170 ? 30.841  0.356   15.702  1.00 31.56  ? 170 HIS H CE1 1 
ATOM   2964 N NE2 . HIS B 2 170 ? 30.238  -0.150  14.643  1.00 35.51  ? 170 HIS H NE2 1 
ATOM   2965 N N   . THR B 2 171 ? 27.378  5.553   13.204  1.00 23.16  ? 171 THR H N   1 
ATOM   2966 C CA  . THR B 2 171 ? 26.289  6.455   12.870  1.00 21.41  ? 171 THR H CA  1 
ATOM   2967 C C   . THR B 2 171 ? 25.293  5.603   12.094  1.00 22.92  ? 171 THR H C   1 
ATOM   2968 O O   . THR B 2 171 ? 25.585  5.102   11.012  1.00 19.02  ? 171 THR H O   1 
ATOM   2969 C CB  . THR B 2 171 ? 26.824  7.654   12.056  1.00 19.67  ? 171 THR H CB  1 
ATOM   2970 O OG1 . THR B 2 171 ? 27.589  8.474   12.930  1.00 16.73  ? 171 THR H OG1 1 
ATOM   2971 C CG2 . THR B 2 171 ? 25.712  8.521   11.507  1.00 16.13  ? 171 THR H CG2 1 
ATOM   2972 N N   . PHE B 2 172 ? 24.127  5.378   12.696  1.00 20.18  ? 172 PHE H N   1 
ATOM   2973 C CA  . PHE B 2 172 ? 23.115  4.540   12.071  1.00 17.19  ? 172 PHE H CA  1 
ATOM   2974 C C   . PHE B 2 172 ? 22.274  5.204   10.991  1.00 14.83  ? 172 PHE H C   1 
ATOM   2975 O O   . PHE B 2 172 ? 22.034  6.413   11.007  1.00 15.19  ? 172 PHE H O   1 
ATOM   2976 C CB  . PHE B 2 172 ? 22.178  4.010   13.145  1.00 18.93  ? 172 PHE H CB  1 
ATOM   2977 C CG  . PHE B 2 172 ? 22.852  3.159   14.141  1.00 14.10  ? 172 PHE H CG  1 
ATOM   2978 C CD1 . PHE B 2 172 ? 22.960  1.808   13.926  1.00 12.96  ? 172 PHE H CD1 1 
ATOM   2979 C CD2 . PHE B 2 172 ? 23.402  3.713   15.286  1.00 13.74  ? 172 PHE H CD2 1 
ATOM   2980 C CE1 . PHE B 2 172 ? 23.616  1.002   14.842  1.00 12.91  ? 172 PHE H CE1 1 
ATOM   2981 C CE2 . PHE B 2 172 ? 24.048  2.932   16.202  1.00 9.18   ? 172 PHE H CE2 1 
ATOM   2982 C CZ  . PHE B 2 172 ? 24.162  1.565   15.984  1.00 13.55  ? 172 PHE H CZ  1 
ATOM   2983 N N   . PRO B 2 173 ? 21.827  4.405   10.017  1.00 19.67  ? 173 PRO H N   1 
ATOM   2984 C CA  . PRO B 2 173 ? 20.986  4.907   8.932   1.00 17.79  ? 173 PRO H CA  1 
ATOM   2985 C C   . PRO B 2 173 ? 19.721  5.521   9.567   1.00 21.11  ? 173 PRO H C   1 
ATOM   2986 O O   . PRO B 2 173 ? 19.219  5.006   10.572  1.00 18.25  ? 173 PRO H O   1 
ATOM   2987 C CB  . PRO B 2 173 ? 20.631  3.655   8.122   1.00 20.83  ? 173 PRO H CB  1 
ATOM   2988 C CG  . PRO B 2 173 ? 21.207  2.482   8.846   1.00 17.66  ? 173 PRO H CG  1 
ATOM   2989 C CD  . PRO B 2 173 ? 22.137  2.967   9.907   1.00 18.63  ? 173 PRO H CD  1 
ATOM   2990 N N   . ALA B 2 174 ? 19.218  6.610   8.989   1.00 20.41  ? 174 ALA H N   1 
ATOM   2991 C CA  . ALA B 2 174 ? 18.032  7.257   9.523   1.00 23.46  ? 174 ALA H CA  1 
ATOM   2992 C C   . ALA B 2 174 ? 16.836  6.333   9.384   1.00 28.30  ? 174 ALA H C   1 
ATOM   2993 O O   . ALA B 2 174 ? 16.852  5.354   8.637   1.00 25.48  ? 174 ALA H O   1 
ATOM   2994 C CB  . ALA B 2 174 ? 17.758  8.557   8.824   1.00 20.58  ? 174 ALA H CB  1 
ATOM   2995 N N   . VAL B 2 175 ? 15.802  6.644   10.143  1.00 30.46  ? 175 VAL H N   1 
ATOM   2996 C CA  . VAL B 2 175 ? 14.597  5.852   10.137  1.00 30.69  ? 175 VAL H CA  1 
ATOM   2997 C C   . VAL B 2 175 ? 13.450  6.836   9.961   1.00 28.22  ? 175 VAL H C   1 
ATOM   2998 O O   . VAL B 2 175 ? 13.456  7.910   10.557  1.00 26.62  ? 175 VAL H O   1 
ATOM   2999 C CB  . VAL B 2 175 ? 14.499  5.062   11.458  1.00 29.48  ? 175 VAL H CB  1 
ATOM   3000 C CG1 . VAL B 2 175 ? 13.160  5.284   12.126  1.00 33.91  ? 175 VAL H CG1 1 
ATOM   3001 C CG2 . VAL B 2 175 ? 14.752  3.603   11.185  1.00 25.98  ? 175 VAL H CG2 1 
ATOM   3002 N N   . LEU B 2 176 ? 12.502  6.490   9.096   1.00 23.76  ? 176 LEU H N   1 
ATOM   3003 C CA  . LEU B 2 176 ? 11.374  7.354   8.858   1.00 24.04  ? 176 LEU H CA  1 
ATOM   3004 C C   . LEU B 2 176 ? 10.369  7.098   9.970   1.00 23.78  ? 176 LEU H C   1 
ATOM   3005 O O   . LEU B 2 176 ? 9.883   5.984   10.133  1.00 24.19  ? 176 LEU H O   1 
ATOM   3006 C CB  . LEU B 2 176 ? 10.735  7.064   7.502   1.00 26.02  ? 176 LEU H CB  1 
ATOM   3007 C CG  . LEU B 2 176 ? 9.738   8.162   7.117   1.00 20.11  ? 176 LEU H CG  1 
ATOM   3008 C CD1 . LEU B 2 176 ? 10.420  9.498   7.244   1.00 20.86  ? 176 LEU H CD1 1 
ATOM   3009 C CD2 . LEU B 2 176 ? 9.235   7.955   5.688   1.00 20.16  ? 176 LEU H CD2 1 
ATOM   3010 N N   . GLN B 2 177 ? 10.084  8.132   10.746  1.00 22.43  ? 177 GLN H N   1 
ATOM   3011 C CA  . GLN B 2 177 ? 9.144   7.989   11.839  1.00 26.30  ? 177 GLN H CA  1 
ATOM   3012 C C   . GLN B 2 177 ? 7.735   8.094   11.253  1.00 24.47  ? 177 GLN H C   1 
ATOM   3013 O O   . GLN B 2 177 ? 7.565   8.558   10.121  1.00 19.98  ? 177 GLN H O   1 
ATOM   3014 C CB  . GLN B 2 177 ? 9.402   9.079   12.871  1.00 19.17  ? 177 GLN H CB  1 
ATOM   3015 C CG  . GLN B 2 177 ? 10.852  9.087   13.389  1.00 29.36  ? 177 GLN H CG  1 
ATOM   3016 C CD  . GLN B 2 177 ? 11.117  10.189  14.399  1.00 31.84  ? 177 GLN H CD  1 
ATOM   3017 O OE1 . GLN B 2 177 ? 11.240  9.927   15.593  1.00 39.31  ? 177 GLN H OE1 1 
ATOM   3018 N NE2 . GLN B 2 177 ? 11.209  11.431  13.924  1.00 28.93  ? 177 GLN H NE2 1 
ATOM   3019 N N   . SER B 2 178 ? 6.739   7.661   12.025  1.00 24.90  ? 178 SER H N   1 
ATOM   3020 C CA  . SER B 2 178 ? 5.333   7.712   11.605  1.00 24.45  ? 178 SER H CA  1 
ATOM   3021 C C   . SER B 2 178 ? 4.911   9.150   11.364  1.00 22.80  ? 178 SER H C   1 
ATOM   3022 O O   . SER B 2 178 ? 3.900   9.408   10.717  1.00 18.72  ? 178 SER H O   1 
ATOM   3023 C CB  . SER B 2 178 ? 4.436   7.113   12.691  1.00 30.78  ? 178 SER H CB  1 
ATOM   3024 O OG  . SER B 2 178 ? 4.167   8.093   13.683  1.00 27.59  ? 178 SER H OG  1 
ATOM   3025 N N   . SER B 2 179 ? 5.675   10.086  11.924  1.00 20.83  ? 179 SER H N   1 
ATOM   3026 C CA  . SER B 2 179 ? 5.389   11.493  11.748  1.00 15.65  ? 179 SER H CA  1 
ATOM   3027 C C   . SER B 2 179 ? 5.869   11.980  10.386  1.00 19.39  ? 179 SER H C   1 
ATOM   3028 O O   . SER B 2 179 ? 5.513   13.080  9.959   1.00 19.08  ? 179 SER H O   1 
ATOM   3029 C CB  . SER B 2 179 ? 6.076   12.316  12.837  1.00 25.24  ? 179 SER H CB  1 
ATOM   3030 O OG  . SER B 2 179 ? 7.489   12.149  12.791  1.00 31.27  ? 179 SER H OG  1 
ATOM   3031 N N   . GLY B 2 180 ? 6.675   11.162  9.707   1.00 20.56  ? 180 GLY H N   1 
ATOM   3032 C CA  . GLY B 2 180 ? 7.207   11.557  8.406   1.00 23.05  ? 180 GLY H CA  1 
ATOM   3033 C C   . GLY B 2 180 ? 8.509   12.336  8.567   1.00 25.52  ? 180 GLY H C   1 
ATOM   3034 O O   . GLY B 2 180 ? 9.039   12.933  7.618   1.00 21.74  ? 180 GLY H O   1 
ATOM   3035 N N   . LEU B 2 181 ? 9.021   12.319  9.793   1.00 25.62  ? 181 LEU H N   1 
ATOM   3036 C CA  . LEU B 2 181 ? 10.259  13.002  10.142  1.00 26.26  ? 181 LEU H CA  1 
ATOM   3037 C C   . LEU B 2 181 ? 11.335  11.938  10.360  1.00 24.35  ? 181 LEU H C   1 
ATOM   3038 O O   . LEU B 2 181 ? 11.039  10.845  10.843  1.00 22.21  ? 181 LEU H O   1 
ATOM   3039 C CB  . LEU B 2 181 ? 10.055  13.812  11.421  1.00 27.21  ? 181 LEU H CB  1 
ATOM   3040 C CG  . LEU B 2 181 ? 9.961   15.335  11.340  1.00 29.84  ? 181 LEU H CG  1 
ATOM   3041 C CD1 . LEU B 2 181 ? 9.324   15.769  10.043  1.00 24.13  ? 181 LEU H CD1 1 
ATOM   3042 C CD2 . LEU B 2 181 ? 9.189   15.855  12.532  1.00 17.28  ? 181 LEU H CD2 1 
ATOM   3043 N N   . TYR B 2 182 ? 12.582  12.223  9.977   1.00 22.85  ? 182 TYR H N   1 
ATOM   3044 C CA  . TYR B 2 182 ? 13.628  11.228  10.201  1.00 15.25  ? 182 TYR H CA  1 
ATOM   3045 C C   . TYR B 2 182 ? 14.216  11.402  11.572  1.00 9.36   ? 182 TYR H C   1 
ATOM   3046 O O   . TYR B 2 182 ? 14.125  12.461  12.158  1.00 16.97  ? 182 TYR H O   1 
ATOM   3047 C CB  . TYR B 2 182 ? 14.771  11.349  9.187   1.00 18.01  ? 182 TYR H CB  1 
ATOM   3048 C CG  . TYR B 2 182 ? 14.349  11.031  7.773   1.00 11.68  ? 182 TYR H CG  1 
ATOM   3049 C CD1 . TYR B 2 182 ? 14.238  9.729   7.354   1.00 11.63  ? 182 TYR H CD1 1 
ATOM   3050 C CD2 . TYR B 2 182 ? 14.014  12.045  6.890   1.00 14.91  ? 182 TYR H CD2 1 
ATOM   3051 C CE1 . TYR B 2 182 ? 13.782  9.431   6.062   1.00 20.36  ? 182 TYR H CE1 1 
ATOM   3052 C CE2 . TYR B 2 182 ? 13.567  11.759  5.616   1.00 20.03  ? 182 TYR H CE2 1 
ATOM   3053 C CZ  . TYR B 2 182 ? 13.443  10.454  5.216   1.00 13.09  ? 182 TYR H CZ  1 
ATOM   3054 O OH  . TYR B 2 182 ? 12.901  10.168  3.984   1.00 25.83  ? 182 TYR H OH  1 
ATOM   3055 N N   . SER B 2 183 ? 14.858  10.341  12.047  1.00 14.96  ? 183 SER H N   1 
ATOM   3056 C CA  . SER B 2 183 ? 15.547  10.341  13.325  1.00 20.76  ? 183 SER H CA  1 
ATOM   3057 C C   . SER B 2 183 ? 16.716  9.366   13.234  1.00 19.20  ? 183 SER H C   1 
ATOM   3058 O O   . SER B 2 183 ? 16.612  8.344   12.569  1.00 15.00  ? 183 SER H O   1 
ATOM   3059 C CB  . SER B 2 183 ? 14.611  9.864   14.449  1.00 15.18  ? 183 SER H CB  1 
ATOM   3060 O OG  . SER B 2 183 ? 15.115  10.258  15.712  1.00 24.07  ? 183 SER H OG  1 
ATOM   3061 N N   . LEU B 2 184 ? 17.828  9.680   13.895  1.00 24.45  ? 184 LEU H N   1 
ATOM   3062 C CA  . LEU B 2 184 ? 18.961  8.754   13.929  1.00 23.44  ? 184 LEU H CA  1 
ATOM   3063 C C   . LEU B 2 184 ? 19.869  9.008   15.122  1.00 18.47  ? 184 LEU H C   1 
ATOM   3064 O O   . LEU B 2 184 ? 19.818  10.057  15.758  1.00 21.60  ? 184 LEU H O   1 
ATOM   3065 C CB  . LEU B 2 184 ? 19.797  8.841   12.633  1.00 27.62  ? 184 LEU H CB  1 
ATOM   3066 C CG  . LEU B 2 184 ? 20.780  9.991   12.369  1.00 25.52  ? 184 LEU H CG  1 
ATOM   3067 C CD1 . LEU B 2 184 ? 22.103  9.873   13.183  1.00 24.03  ? 184 LEU H CD1 1 
ATOM   3068 C CD2 . LEU B 2 184 ? 21.078  9.937   10.896  1.00 29.22  ? 184 LEU H CD2 1 
ATOM   3069 N N   . SER B 2 185 ? 20.691  8.022   15.441  1.00 23.48  ? 185 SER H N   1 
ATOM   3070 C CA  . SER B 2 185 ? 21.652  8.190   16.516  1.00 28.28  ? 185 SER H CA  1 
ATOM   3071 C C   . SER B 2 185 ? 23.054  7.842   16.007  1.00 25.83  ? 185 SER H C   1 
ATOM   3072 O O   . SER B 2 185 ? 23.213  7.010   15.117  1.00 16.49  ? 185 SER H O   1 
ATOM   3073 C CB  . SER B 2 185 ? 21.310  7.289   17.706  1.00 33.71  ? 185 SER H CB  1 
ATOM   3074 O OG  . SER B 2 185 ? 20.833  6.028   17.266  1.00 49.20  ? 185 SER H OG  1 
ATOM   3075 N N   . SER B 2 186 ? 24.050  8.522   16.570  1.00 27.55  ? 186 SER H N   1 
ATOM   3076 C CA  . SER B 2 186 ? 25.459  8.287   16.284  1.00 23.13  ? 186 SER H CA  1 
ATOM   3077 C C   . SER B 2 186 ? 26.054  7.977   17.647  1.00 18.86  ? 186 SER H C   1 
ATOM   3078 O O   . SER B 2 186 ? 25.957  8.786   18.567  1.00 17.24  ? 186 SER H O   1 
ATOM   3079 C CB  . SER B 2 186 ? 26.134  9.535   15.715  1.00 25.33  ? 186 SER H CB  1 
ATOM   3080 O OG  . SER B 2 186 ? 27.511  9.286   15.485  1.00 20.85  ? 186 SER H OG  1 
ATOM   3081 N N   . VAL B 2 187 ? 26.638  6.796   17.799  1.00 18.98  ? 187 VAL H N   1 
ATOM   3082 C CA  . VAL B 2 187 ? 27.237  6.441   19.084  1.00 21.90  ? 187 VAL H CA  1 
ATOM   3083 C C   . VAL B 2 187 ? 28.761  6.276   18.956  1.00 21.86  ? 187 VAL H C   1 
ATOM   3084 O O   . VAL B 2 187 ? 29.285  6.261   17.846  1.00 17.54  ? 187 VAL H O   1 
ATOM   3085 C CB  . VAL B 2 187 ? 26.648  5.128   19.612  1.00 18.97  ? 187 VAL H CB  1 
ATOM   3086 C CG1 . VAL B 2 187 ? 25.121  5.251   19.764  1.00 25.12  ? 187 VAL H CG1 1 
ATOM   3087 C CG2 . VAL B 2 187 ? 26.975  3.995   18.663  1.00 17.15  ? 187 VAL H CG2 1 
ATOM   3088 N N   . VAL B 2 188 ? 29.455  6.160   20.091  1.00 23.06  ? 188 VAL H N   1 
ATOM   3089 C CA  . VAL B 2 188 ? 30.920  5.966   20.115  1.00 29.45  ? 188 VAL H CA  1 
ATOM   3090 C C   . VAL B 2 188 ? 31.325  5.246   21.381  1.00 29.60  ? 188 VAL H C   1 
ATOM   3091 O O   . VAL B 2 188 ? 30.863  5.609   22.450  1.00 26.36  ? 188 VAL H O   1 
ATOM   3092 C CB  . VAL B 2 188 ? 31.718  7.287   20.162  1.00 30.58  ? 188 VAL H CB  1 
ATOM   3093 C CG1 . VAL B 2 188 ? 33.023  7.128   19.387  1.00 33.75  ? 188 VAL H CG1 1 
ATOM   3094 C CG2 . VAL B 2 188 ? 30.908  8.416   19.631  1.00 35.63  ? 188 VAL H CG2 1 
ATOM   3095 N N   . THR B 2 189 ? 32.184  4.236   21.264  1.00 30.12  ? 189 THR H N   1 
ATOM   3096 C CA  . THR B 2 189 ? 32.666  3.512   22.430  1.00 36.51  ? 189 THR H CA  1 
ATOM   3097 C C   . THR B 2 189 ? 34.043  4.064   22.832  1.00 40.15  ? 189 THR H C   1 
ATOM   3098 O O   . THR B 2 189 ? 34.998  3.996   22.056  1.00 36.06  ? 189 THR H O   1 
ATOM   3099 C CB  . THR B 2 189 ? 32.801  2.011   22.140  1.00 37.76  ? 189 THR H CB  1 
ATOM   3100 O OG1 . THR B 2 189 ? 32.757  1.790   20.727  1.00 47.98  ? 189 THR H OG1 1 
ATOM   3101 C CG2 . THR B 2 189 ? 31.664  1.242   22.785  1.00 43.43  ? 189 THR H CG2 1 
ATOM   3102 N N   . VAL B 2 190 ? 34.142  4.611   24.040  1.00 40.94  ? 190 VAL H N   1 
ATOM   3103 C CA  . VAL B 2 190 ? 35.408  5.165   24.534  1.00 42.44  ? 190 VAL H CA  1 
ATOM   3104 C C   . VAL B 2 190 ? 35.827  4.479   25.846  1.00 42.37  ? 190 VAL H C   1 
ATOM   3105 O O   . VAL B 2 190 ? 35.081  3.663   26.394  1.00 36.23  ? 190 VAL H O   1 
ATOM   3106 C CB  . VAL B 2 190 ? 35.288  6.699   24.772  1.00 44.25  ? 190 VAL H CB  1 
ATOM   3107 C CG1 . VAL B 2 190 ? 34.905  7.417   23.460  1.00 39.66  ? 190 VAL H CG1 1 
ATOM   3108 C CG2 . VAL B 2 190 ? 34.251  6.978   25.861  1.00 43.61  ? 190 VAL H CG2 1 
ATOM   3109 N N   . PRO B 2 191 ? 37.028  4.798   26.370  1.00 42.23  ? 191 PRO H N   1 
ATOM   3110 C CA  . PRO B 2 191 ? 37.413  4.136   27.617  1.00 39.48  ? 191 PRO H CA  1 
ATOM   3111 C C   . PRO B 2 191 ? 36.797  4.904   28.770  1.00 38.89  ? 191 PRO H C   1 
ATOM   3112 O O   . PRO B 2 191 ? 36.870  6.127   28.817  1.00 42.94  ? 191 PRO H O   1 
ATOM   3113 C CB  . PRO B 2 191 ? 38.940  4.206   27.612  1.00 38.72  ? 191 PRO H CB  1 
ATOM   3114 C CG  . PRO B 2 191 ? 39.266  5.428   26.783  1.00 42.70  ? 191 PRO H CG  1 
ATOM   3115 C CD  . PRO B 2 191 ? 38.055  5.756   25.917  1.00 41.23  ? 191 PRO H CD  1 
ATOM   3116 N N   . SER B 2 192 ? 36.171  4.184   29.686  1.00 40.09  ? 192 SER H N   1 
ATOM   3117 C CA  . SER B 2 192 ? 35.533  4.806   30.828  1.00 43.93  ? 192 SER H CA  1 
ATOM   3118 C C   . SER B 2 192 ? 36.490  5.763   31.514  1.00 46.38  ? 192 SER H C   1 
ATOM   3119 O O   . SER B 2 192 ? 36.074  6.790   32.047  1.00 51.86  ? 192 SER H O   1 
ATOM   3120 C CB  . SER B 2 192 ? 35.078  3.735   31.812  1.00 50.61  ? 192 SER H CB  1 
ATOM   3121 O OG  . SER B 2 192 ? 34.649  2.570   31.131  1.00 56.47  ? 192 SER H OG  1 
ATOM   3122 N N   . SER B 2 193 ? 37.775  5.431   31.497  1.00 45.77  ? 193 SER H N   1 
ATOM   3123 C CA  . SER B 2 193 ? 38.769  6.281   32.138  1.00 45.46  ? 193 SER H CA  1 
ATOM   3124 C C   . SER B 2 193 ? 38.866  7.645   31.471  1.00 44.50  ? 193 SER H C   1 
ATOM   3125 O O   . SER B 2 193 ? 39.149  8.647   32.130  1.00 44.80  ? 193 SER H O   1 
ATOM   3126 C CB  . SER B 2 193 ? 40.140  5.592   32.133  1.00 47.58  ? 193 SER H CB  1 
ATOM   3127 O OG  . SER B 2 193 ? 40.703  5.540   30.832  1.00 48.56  ? 193 SER H OG  1 
ATOM   3128 N N   . SER B 2 194 ? 38.614  7.689   30.167  1.00 44.63  ? 194 SER H N   1 
ATOM   3129 C CA  . SER B 2 194 ? 38.697  8.942   29.425  1.00 45.13  ? 194 SER H CA  1 
ATOM   3130 C C   . SER B 2 194 ? 37.549  9.878   29.761  1.00 47.02  ? 194 SER H C   1 
ATOM   3131 O O   . SER B 2 194 ? 37.627  11.078  29.499  1.00 47.76  ? 194 SER H O   1 
ATOM   3132 C CB  . SER B 2 194 ? 38.724  8.669   27.919  1.00 42.00  ? 194 SER H CB  1 
ATOM   3133 O OG  . SER B 2 194 ? 37.445  8.311   27.440  1.00 44.41  ? 194 SER H OG  1 
ATOM   3134 N N   . LEU B 2 195 ? 36.485  9.325   30.341  1.00 48.54  ? 195 LEU H N   1 
ATOM   3135 C CA  . LEU B 2 195 ? 35.319  10.116  30.727  1.00 48.52  ? 195 LEU H CA  1 
ATOM   3136 C C   . LEU B 2 195 ? 35.729  11.101  31.805  1.00 51.82  ? 195 LEU H C   1 
ATOM   3137 O O   . LEU B 2 195 ? 36.235  10.697  32.854  1.00 57.97  ? 195 LEU H O   1 
ATOM   3138 C CB  . LEU B 2 195 ? 34.213  9.218   31.290  1.00 44.49  ? 195 LEU H CB  1 
ATOM   3139 C CG  . LEU B 2 195 ? 33.655  8.075   30.441  1.00 41.02  ? 195 LEU H CG  1 
ATOM   3140 C CD1 . LEU B 2 195 ? 32.337  7.647   31.053  1.00 27.67  ? 195 LEU H CD1 1 
ATOM   3141 C CD2 . LEU B 2 195 ? 33.477  8.516   28.977  1.00 40.48  ? 195 LEU H CD2 1 
ATOM   3142 N N   . GLY B 2 196 ? 35.507  12.387  31.562  1.00 51.33  ? 196 GLY H N   1 
ATOM   3143 C CA  . GLY B 2 196 ? 35.879  13.374  32.559  1.00 53.05  ? 196 GLY H CA  1 
ATOM   3144 C C   . GLY B 2 196 ? 37.146  14.095  32.154  1.00 55.03  ? 196 GLY H C   1 
ATOM   3145 O O   . GLY B 2 196 ? 37.356  15.254  32.509  1.00 55.28  ? 196 GLY H O   1 
ATOM   3146 N N   . THR B 2 197 ? 38.006  13.407  31.413  1.00 56.13  ? 197 THR H N   1 
ATOM   3147 C CA  . THR B 2 197 ? 39.237  14.024  30.947  1.00 57.16  ? 197 THR H CA  1 
ATOM   3148 C C   . THR B 2 197 ? 39.065  14.389  29.483  1.00 56.48  ? 197 THR H C   1 
ATOM   3149 O O   . THR B 2 197 ? 39.341  15.519  29.078  1.00 58.48  ? 197 THR H O   1 
ATOM   3150 C CB  . THR B 2 197 ? 40.442  13.079  31.083  1.00 59.74  ? 197 THR H CB  1 
ATOM   3151 O OG1 . THR B 2 197 ? 39.997  11.786  31.513  1.00 64.92  ? 197 THR H OG1 1 
ATOM   3152 C CG2 . THR B 2 197 ? 41.430  13.634  32.098  1.00 61.09  ? 197 THR H CG2 1 
ATOM   3153 N N   . GLN B 2 198 ? 38.591  13.427  28.696  1.00 51.91  ? 198 GLN H N   1 
ATOM   3154 C CA  . GLN B 2 198 ? 38.385  13.636  27.272  1.00 47.54  ? 198 GLN H CA  1 
ATOM   3155 C C   . GLN B 2 198 ? 36.982  14.137  27.000  1.00 43.91  ? 198 GLN H C   1 
ATOM   3156 O O   . GLN B 2 198 ? 36.008  13.445  27.276  1.00 47.13  ? 198 GLN H O   1 
ATOM   3157 C CB  . GLN B 2 198 ? 38.612  12.335  26.504  1.00 48.21  ? 198 GLN H CB  1 
ATOM   3158 C CG  . GLN B 2 198 ? 38.419  12.485  25.002  1.00 51.60  ? 198 GLN H CG  1 
ATOM   3159 C CD  . GLN B 2 198 ? 39.358  13.511  24.394  1.00 49.30  ? 198 GLN H CD  1 
ATOM   3160 O OE1 . GLN B 2 198 ? 38.928  14.556  23.898  1.00 44.34  ? 198 GLN H OE1 1 
ATOM   3161 N NE2 . GLN B 2 198 ? 40.650  13.217  24.431  1.00 49.21  ? 198 GLN H NE2 1 
ATOM   3162 N N   . THR B 2 199 ? 36.880  15.339  26.453  1.00 40.19  ? 199 THR H N   1 
ATOM   3163 C CA  . THR B 2 199 ? 35.578  15.913  26.159  1.00 41.86  ? 199 THR H CA  1 
ATOM   3164 C C   . THR B 2 199 ? 35.081  15.387  24.816  1.00 39.61  ? 199 THR H C   1 
ATOM   3165 O O   . THR B 2 199 ? 35.866  15.209  23.882  1.00 38.01  ? 199 THR H O   1 
ATOM   3166 C CB  . THR B 2 199 ? 35.639  17.470  26.158  1.00 43.84  ? 199 THR H CB  1 
ATOM   3167 O OG1 . THR B 2 199 ? 34.989  17.986  24.989  1.00 51.26  ? 199 THR H OG1 1 
ATOM   3168 C CG2 . THR B 2 199 ? 37.084  17.950  26.193  1.00 51.73  ? 199 THR H CG2 1 
ATOM   3169 N N   . TYR B 2 200 ? 33.776  15.122  24.736  1.00 37.68  ? 200 TYR H N   1 
ATOM   3170 C CA  . TYR B 2 200 ? 33.163  14.595  23.517  1.00 35.87  ? 200 TYR H CA  1 
ATOM   3171 C C   . TYR B 2 200 ? 32.033  15.470  23.022  1.00 33.13  ? 200 TYR H C   1 
ATOM   3172 O O   . TYR B 2 200 ? 31.067  15.739  23.743  1.00 37.17  ? 200 TYR H O   1 
ATOM   3173 C CB  . TYR B 2 200 ? 32.647  13.172  23.746  1.00 31.46  ? 200 TYR H CB  1 
ATOM   3174 C CG  . TYR B 2 200 ? 33.733  12.217  24.165  1.00 32.50  ? 200 TYR H CG  1 
ATOM   3175 C CD1 . TYR B 2 200 ? 34.629  11.684  23.225  1.00 35.19  ? 200 TYR H CD1 1 
ATOM   3176 C CD2 . TYR B 2 200 ? 33.884  11.853  25.499  1.00 36.20  ? 200 TYR H CD2 1 
ATOM   3177 C CE1 . TYR B 2 200 ? 35.641  10.809  23.615  1.00 37.84  ? 200 TYR H CE1 1 
ATOM   3178 C CE2 . TYR B 2 200 ? 34.895  10.977  25.901  1.00 39.11  ? 200 TYR H CE2 1 
ATOM   3179 C CZ  . TYR B 2 200 ? 35.763  10.457  24.957  1.00 36.46  ? 200 TYR H CZ  1 
ATOM   3180 O OH  . TYR B 2 200 ? 36.724  9.561   25.355  1.00 39.06  ? 200 TYR H OH  1 
ATOM   3181 N N   . ILE B 2 201 ? 32.172  15.916  21.783  1.00 29.36  ? 201 ILE H N   1 
ATOM   3182 C CA  . ILE B 2 201 ? 31.190  16.772  21.137  1.00 28.62  ? 201 ILE H CA  1 
ATOM   3183 C C   . ILE B 2 201 ? 30.809  16.147  19.806  1.00 29.07  ? 201 ILE H C   1 
ATOM   3184 O O   . ILE B 2 201 ? 31.685  15.774  19.028  1.00 25.05  ? 201 ILE H O   1 
ATOM   3185 C CB  . ILE B 2 201 ? 31.797  18.162  20.860  1.00 28.11  ? 201 ILE H CB  1 
ATOM   3186 C CG1 . ILE B 2 201 ? 32.127  18.842  22.188  1.00 28.51  ? 201 ILE H CG1 1 
ATOM   3187 C CG2 . ILE B 2 201 ? 30.830  19.017  20.032  1.00 33.33  ? 201 ILE H CG2 1 
ATOM   3188 C CD1 . ILE B 2 201 ? 32.641  20.278  22.038  1.00 28.67  ? 201 ILE H CD1 1 
ATOM   3189 N N   . CYS B 2 202 ? 29.512  16.010  19.542  1.00 28.05  ? 202 CYS H N   1 
ATOM   3190 C CA  . CYS B 2 202 ? 29.094  15.466  18.262  1.00 24.89  ? 202 CYS H CA  1 
ATOM   3191 C C   . CYS B 2 202 ? 28.764  16.668  17.398  1.00 27.95  ? 202 CYS H C   1 
ATOM   3192 O O   . CYS B 2 202 ? 28.144  17.621  17.859  1.00 24.29  ? 202 CYS H O   1 
ATOM   3193 C CB  . CYS B 2 202 ? 27.897  14.525  18.411  1.00 27.38  ? 202 CYS H CB  1 
ATOM   3194 S SG  . CYS B 2 202 ? 26.287  15.280  18.797  1.00 32.34  ? 202 CYS H SG  1 
ATOM   3195 N N   . ASN B 2 203 ? 29.224  16.639  16.154  1.00 28.60  ? 203 ASN H N   1 
ATOM   3196 C CA  . ASN B 2 203 ? 28.994  17.740  15.229  1.00 30.25  ? 203 ASN H CA  1 
ATOM   3197 C C   . ASN B 2 203 ? 27.911  17.313  14.243  1.00 28.04  ? 203 ASN H C   1 
ATOM   3198 O O   . ASN B 2 203 ? 28.120  16.443  13.406  1.00 25.70  ? 203 ASN H O   1 
ATOM   3199 C CB  . ASN B 2 203 ? 30.298  18.079  14.481  1.00 30.79  ? 203 ASN H CB  1 
ATOM   3200 C CG  . ASN B 2 203 ? 31.528  17.976  15.375  1.00 28.30  ? 203 ASN H CG  1 
ATOM   3201 O OD1 . ASN B 2 203 ? 31.741  18.807  16.248  1.00 31.45  ? 203 ASN H OD1 1 
ATOM   3202 N ND2 . ASN B 2 203 ? 32.334  16.954  15.158  1.00 36.71  ? 203 ASN H ND2 1 
ATOM   3203 N N   . VAL B 2 204 ? 26.746  17.931  14.353  1.00 30.29  ? 204 VAL H N   1 
ATOM   3204 C CA  . VAL B 2 204 ? 25.636  17.565  13.497  1.00 29.34  ? 204 VAL H CA  1 
ATOM   3205 C C   . VAL B 2 204 ? 25.315  18.678  12.534  1.00 26.11  ? 204 VAL H C   1 
ATOM   3206 O O   . VAL B 2 204 ? 25.161  19.832  12.921  1.00 30.66  ? 204 VAL H O   1 
ATOM   3207 C CB  . VAL B 2 204 ? 24.382  17.225  14.350  1.00 29.08  ? 204 VAL H CB  1 
ATOM   3208 C CG1 . VAL B 2 204 ? 23.255  16.720  13.467  1.00 25.03  ? 204 VAL H CG1 1 
ATOM   3209 C CG2 . VAL B 2 204 ? 24.740  16.173  15.372  1.00 26.85  ? 204 VAL H CG2 1 
ATOM   3210 N N   . ASN B 2 205 ? 25.236  18.330  11.264  1.00 27.79  ? 205 ASN H N   1 
ATOM   3211 C CA  . ASN B 2 205 ? 24.921  19.329  10.278  1.00 31.38  ? 205 ASN H CA  1 
ATOM   3212 C C   . ASN B 2 205 ? 23.820  18.847  9.345   1.00 27.87  ? 205 ASN H C   1 
ATOM   3213 O O   . ASN B 2 205 ? 23.862  17.735  8.822   1.00 32.07  ? 205 ASN H O   1 
ATOM   3214 C CB  . ASN B 2 205 ? 26.174  19.692  9.477   1.00 38.39  ? 205 ASN H CB  1 
ATOM   3215 C CG  . ASN B 2 205 ? 25.888  20.703  8.390   1.00 47.12  ? 205 ASN H CG  1 
ATOM   3216 O OD1 . ASN B 2 205 ? 25.274  21.745  8.642   1.00 49.32  ? 205 ASN H OD1 1 
ATOM   3217 N ND2 . ASN B 2 205 ? 26.324  20.398  7.166   1.00 50.62  ? 205 ASN H ND2 1 
ATOM   3218 N N   . HIS B 2 206 ? 22.822  19.698  9.165   1.00 30.46  ? 206 HIS H N   1 
ATOM   3219 C CA  . HIS B 2 206 ? 21.719  19.403  8.271   1.00 30.86  ? 206 HIS H CA  1 
ATOM   3220 C C   . HIS B 2 206 ? 21.727  20.557  7.285   1.00 32.49  ? 206 HIS H C   1 
ATOM   3221 O O   . HIS B 2 206 ? 21.290  21.655  7.620   1.00 34.06  ? 206 HIS H O   1 
ATOM   3222 C CB  . HIS B 2 206 ? 20.392  19.384  9.035   1.00 30.95  ? 206 HIS H CB  1 
ATOM   3223 C CG  . HIS B 2 206 ? 19.233  18.928  8.206   1.00 22.68  ? 206 HIS H CG  1 
ATOM   3224 N ND1 . HIS B 2 206 ? 18.176  19.753  7.884   1.00 21.37  ? 206 HIS H ND1 1 
ATOM   3225 C CD2 . HIS B 2 206 ? 18.970  17.733  7.630   1.00 16.20  ? 206 HIS H CD2 1 
ATOM   3226 C CE1 . HIS B 2 206 ? 17.308  19.084  7.140   1.00 21.25  ? 206 HIS H CE1 1 
ATOM   3227 N NE2 . HIS B 2 206 ? 17.767  17.855  6.971   1.00 22.23  ? 206 HIS H NE2 1 
ATOM   3228 N N   . LYS B 2 207 ? 22.235  20.317  6.079   1.00 32.42  ? 207 LYS H N   1 
ATOM   3229 C CA  . LYS B 2 207 ? 22.305  21.375  5.078   1.00 40.48  ? 207 LYS H CA  1 
ATOM   3230 C C   . LYS B 2 207 ? 20.940  21.870  4.579   1.00 38.74  ? 207 LYS H C   1 
ATOM   3231 O O   . LYS B 2 207 ? 20.724  23.076  4.439   1.00 37.20  ? 207 LYS H O   1 
ATOM   3232 C CB  . LYS B 2 207 ? 23.135  20.921  3.878   1.00 46.61  ? 207 LYS H CB  1 
ATOM   3233 C CG  . LYS B 2 207 ? 22.923  21.764  2.621   1.00 57.67  ? 207 LYS H CG  1 
ATOM   3234 C CD  . LYS B 2 207 ? 24.202  21.870  1.806   1.00 64.13  ? 207 LYS H CD  1 
ATOM   3235 C CE  . LYS B 2 207 ? 23.974  21.731  0.313   1.00 65.34  ? 207 LYS H CE  1 
ATOM   3236 N NZ  . LYS B 2 207 ? 25.167  21.128  -0.348  1.00 67.04  ? 207 LYS H NZ  1 
ATOM   3237 N N   . PRO B 2 208 ? 20.004  20.947  4.298   1.00 31.33  ? 208 PRO H N   1 
ATOM   3238 C CA  . PRO B 2 208 ? 18.709  21.433  3.816   1.00 27.74  ? 208 PRO H CA  1 
ATOM   3239 C C   . PRO B 2 208 ? 18.126  22.561  4.658   1.00 26.63  ? 208 PRO H C   1 
ATOM   3240 O O   . PRO B 2 208 ? 17.486  23.450  4.126   1.00 28.02  ? 208 PRO H O   1 
ATOM   3241 C CB  . PRO B 2 208 ? 17.845  20.181  3.792   1.00 25.10  ? 208 PRO H CB  1 
ATOM   3242 C CG  . PRO B 2 208 ? 18.838  19.067  3.556   1.00 29.64  ? 208 PRO H CG  1 
ATOM   3243 C CD  . PRO B 2 208 ? 20.042  19.475  4.381   1.00 24.40  ? 208 PRO H CD  1 
ATOM   3244 N N   . SER B 2 209 ? 18.368  22.551  5.965   1.00 26.89  ? 209 SER H N   1 
ATOM   3245 C CA  . SER B 2 209 ? 17.828  23.605  6.825   1.00 29.82  ? 209 SER H CA  1 
ATOM   3246 C C   . SER B 2 209 ? 18.915  24.571  7.278   1.00 35.00  ? 209 SER H C   1 
ATOM   3247 O O   . SER B 2 209 ? 18.652  25.518  8.038   1.00 31.73  ? 209 SER H O   1 
ATOM   3248 C CB  . SER B 2 209 ? 17.171  22.993  8.063   1.00 28.96  ? 209 SER H CB  1 
ATOM   3249 O OG  . SER B 2 209 ? 18.035  22.051  8.685   1.00 30.65  ? 209 SER H OG  1 
ATOM   3250 N N   . ASN B 2 210 ? 20.133  24.321  6.809   1.00 33.96  ? 210 ASN H N   1 
ATOM   3251 C CA  . ASN B 2 210 ? 21.293  25.118  7.178   1.00 37.48  ? 210 ASN H CA  1 
ATOM   3252 C C   . ASN B 2 210 ? 21.416  25.126  8.688   1.00 37.35  ? 210 ASN H C   1 
ATOM   3253 O O   . ASN B 2 210 ? 21.726  26.145  9.299   1.00 40.81  ? 210 ASN H O   1 
ATOM   3254 C CB  . ASN B 2 210 ? 21.183  26.548  6.652   1.00 43.84  ? 210 ASN H CB  1 
ATOM   3255 C CG  . ASN B 2 210 ? 22.468  27.012  5.974   1.00 54.74  ? 210 ASN H CG  1 
ATOM   3256 O OD1 . ASN B 2 210 ? 23.007  28.072  6.295   1.00 58.66  ? 210 ASN H OD1 1 
ATOM   3257 N ND2 . ASN B 2 210 ? 22.968  26.207  5.034   1.00 54.07  ? 210 ASN H ND2 1 
ATOM   3258 N N   . THR B 2 211 ? 21.152  23.970  9.283   1.00 36.24  ? 211 THR H N   1 
ATOM   3259 C CA  . THR B 2 211 ? 21.231  23.808  10.724  1.00 32.32  ? 211 THR H CA  1 
ATOM   3260 C C   . THR B 2 211 ? 22.557  23.126  11.049  1.00 34.09  ? 211 THR H C   1 
ATOM   3261 O O   . THR B 2 211 ? 22.960  22.167  10.382  1.00 35.23  ? 211 THR H O   1 
ATOM   3262 C CB  . THR B 2 211 ? 20.113  22.909  11.255  1.00 32.18  ? 211 THR H CB  1 
ATOM   3263 O OG1 . THR B 2 211 ? 18.874  23.254  10.628  1.00 36.56  ? 211 THR H OG1 1 
ATOM   3264 C CG2 . THR B 2 211 ? 19.988  23.063  12.758  1.00 31.64  ? 211 THR H CG2 1 
ATOM   3265 N N   . LYS B 2 212 ? 23.231  23.637  12.070  1.00 33.31  ? 212 LYS H N   1 
ATOM   3266 C CA  . LYS B 2 212 ? 24.500  23.079  12.514  1.00 35.94  ? 212 LYS H CA  1 
ATOM   3267 C C   . LYS B 2 212 ? 24.503  23.172  14.024  1.00 32.75  ? 212 LYS H C   1 
ATOM   3268 O O   . LYS B 2 212 ? 24.313  24.243  14.583  1.00 39.82  ? 212 LYS H O   1 
ATOM   3269 C CB  . LYS B 2 212 ? 25.670  23.879  11.943  1.00 41.05  ? 212 LYS H CB  1 
ATOM   3270 C CG  . LYS B 2 212 ? 26.906  23.049  11.652  1.00 40.31  ? 212 LYS H CG  1 
ATOM   3271 C CD  . LYS B 2 212 ? 27.436  23.344  10.254  1.00 42.97  ? 212 LYS H CD  1 
ATOM   3272 C CE  . LYS B 2 212 ? 27.861  24.798  10.127  1.00 46.57  ? 212 LYS H CE  1 
ATOM   3273 N NZ  . LYS B 2 212 ? 28.533  25.285  11.363  1.00 54.33  ? 212 LYS H NZ  1 
ATOM   3274 N N   . VAL B 2 213 ? 24.701  22.048  14.689  1.00 30.32  ? 213 VAL H N   1 
ATOM   3275 C CA  . VAL B 2 213 ? 24.708  22.062  16.131  1.00 33.02  ? 213 VAL H CA  1 
ATOM   3276 C C   . VAL B 2 213 ? 25.819  21.194  16.681  1.00 33.57  ? 213 VAL H C   1 
ATOM   3277 O O   . VAL B 2 213 ? 26.119  20.123  16.161  1.00 34.31  ? 213 VAL H O   1 
ATOM   3278 C CB  . VAL B 2 213 ? 23.346  21.584  16.698  1.00 35.63  ? 213 VAL H CB  1 
ATOM   3279 C CG1 . VAL B 2 213 ? 22.698  20.639  15.726  1.00 34.74  ? 213 VAL H CG1 1 
ATOM   3280 C CG2 . VAL B 2 213 ? 23.527  20.925  18.061  1.00 35.63  ? 213 VAL H CG2 1 
ATOM   3281 N N   . ASP B 2 214 ? 26.436  21.685  17.740  1.00 34.10  ? 214 ASP H N   1 
ATOM   3282 C CA  . ASP B 2 214 ? 27.496  20.955  18.392  1.00 37.08  ? 214 ASP H CA  1 
ATOM   3283 C C   . ASP B 2 214 ? 26.945  20.682  19.770  1.00 39.54  ? 214 ASP H C   1 
ATOM   3284 O O   . ASP B 2 214 ? 26.437  21.580  20.442  1.00 45.06  ? 214 ASP H O   1 
ATOM   3285 C CB  . ASP B 2 214 ? 28.759  21.804  18.445  1.00 37.12  ? 214 ASP H CB  1 
ATOM   3286 C CG  . ASP B 2 214 ? 29.550  21.734  17.149  1.00 38.57  ? 214 ASP H CG  1 
ATOM   3287 O OD1 . ASP B 2 214 ? 29.487  20.697  16.459  1.00 38.30  ? 214 ASP H OD1 1 
ATOM   3288 O OD2 . ASP B 2 214 ? 30.236  22.714  16.814  1.00 43.53  ? 214 ASP H OD2 1 
ATOM   3289 N N   . LYS B 2 215 ? 27.014  19.427  20.174  1.00 35.69  ? 215 LYS H N   1 
ATOM   3290 C CA  . LYS B 2 215 ? 26.490  19.043  21.455  1.00 36.99  ? 215 LYS H CA  1 
ATOM   3291 C C   . LYS B 2 215 ? 27.528  18.308  22.270  1.00 35.16  ? 215 LYS H C   1 
ATOM   3292 O O   . LYS B 2 215 ? 28.004  17.250  21.873  1.00 29.84  ? 215 LYS H O   1 
ATOM   3293 C CB  . LYS B 2 215 ? 25.277  18.142  21.265  1.00 32.10  ? 215 LYS H CB  1 
ATOM   3294 C CG  . LYS B 2 215 ? 24.060  18.578  22.051  1.00 39.87  ? 215 LYS H CG  1 
ATOM   3295 C CD  . LYS B 2 215 ? 23.990  17.862  23.374  1.00 40.88  ? 215 LYS H CD  1 
ATOM   3296 C CE  . LYS B 2 215 ? 23.418  18.778  24.448  1.00 51.80  ? 215 LYS H CE  1 
ATOM   3297 N NZ  . LYS B 2 215 ? 22.122  19.402  24.041  1.00 52.70  ? 215 LYS H NZ  1 
ATOM   3298 N N   . LYS B 2 216 ? 27.887  18.883  23.408  1.00 38.48  ? 216 LYS H N   1 
ATOM   3299 C CA  . LYS B 2 216 ? 28.835  18.232  24.279  1.00 38.87  ? 216 LYS H CA  1 
ATOM   3300 C C   . LYS B 2 216 ? 28.028  17.124  24.924  1.00 37.86  ? 216 LYS H C   1 
ATOM   3301 O O   . LYS B 2 216 ? 26.860  17.322  25.278  1.00 40.30  ? 216 LYS H O   1 
ATOM   3302 C CB  . LYS B 2 216 ? 29.350  19.199  25.340  1.00 46.59  ? 216 LYS H CB  1 
ATOM   3303 C CG  . LYS B 2 216 ? 30.842  19.076  25.617  1.00 51.12  ? 216 LYS H CG  1 
ATOM   3304 C CD  . LYS B 2 216 ? 31.158  17.853  26.466  1.00 55.20  ? 216 LYS H CD  1 
ATOM   3305 C CE  . LYS B 2 216 ? 32.206  18.169  27.525  1.00 60.70  ? 216 LYS H CE  1 
ATOM   3306 N NZ  . LYS B 2 216 ? 32.022  19.521  28.125  1.00 58.36  ? 216 LYS H NZ  1 
ATOM   3307 N N   . VAL B 2 217 ? 28.630  15.950  25.046  1.00 30.86  ? 217 VAL H N   1 
ATOM   3308 C CA  . VAL B 2 217 ? 27.951  14.822  25.656  1.00 33.99  ? 217 VAL H CA  1 
ATOM   3309 C C   . VAL B 2 217 ? 28.725  14.417  26.902  1.00 36.12  ? 217 VAL H C   1 
ATOM   3310 O O   . VAL B 2 217 ? 28.218  14.655  28.023  1.00 39.56  ? 217 VAL H O   1 
ATOM   3311 C CB  . VAL B 2 217 ? 27.875  13.624  24.674  1.00 34.27  ? 217 VAL H CB  1 
ATOM   3312 C CG1 . VAL B 2 217 ? 26.903  12.561  25.208  1.00 33.96  ? 217 VAL H CG1 1 
ATOM   3313 C CG2 . VAL B 2 217 ? 27.427  14.119  23.292  1.00 30.44  ? 217 VAL H CG2 1 
ATOM   3314 N N   . GLU C 1 1   ? -20.425 -8.287  54.930  1.00 80.66  ? 1   GLU A N   1 
ATOM   3315 C CA  . GLU C 1 1   ? -18.992 -7.892  55.048  1.00 78.65  ? 1   GLU A CA  1 
ATOM   3316 C C   . GLU C 1 1   ? -18.109 -9.079  55.420  1.00 74.25  ? 1   GLU A C   1 
ATOM   3317 O O   . GLU C 1 1   ? -18.476 -9.920  56.242  1.00 72.46  ? 1   GLU A O   1 
ATOM   3318 C CB  . GLU C 1 1   ? -18.830 -6.791  56.101  1.00 81.14  ? 1   GLU A CB  1 
ATOM   3319 C CG  . GLU C 1 1   ? -20.044 -6.606  56.997  1.00 85.04  ? 1   GLU A CG  1 
ATOM   3320 C CD  . GLU C 1 1   ? -20.264 -7.779  57.940  1.00 89.88  ? 1   GLU A CD  1 
ATOM   3321 O OE1 . GLU C 1 1   ? -20.353 -8.929  57.457  1.00 92.61  ? 1   GLU A OE1 1 
ATOM   3322 O OE2 . GLU C 1 1   ? -20.351 -7.553  59.167  1.00 89.88  ? 1   GLU A OE2 1 
ATOM   3323 N N   . LEU C 1 2   ? -16.939 -9.144  54.801  1.00 70.15  ? 2   LEU A N   1 
ATOM   3324 C CA  . LEU C 1 2   ? -16.004 -10.216 55.086  1.00 64.78  ? 2   LEU A CA  1 
ATOM   3325 C C   . LEU C 1 2   ? -15.248 -9.864  56.364  1.00 59.89  ? 2   LEU A C   1 
ATOM   3326 O O   . LEU C 1 2   ? -14.608 -8.813  56.441  1.00 62.96  ? 2   LEU A O   1 
ATOM   3327 C CB  . LEU C 1 2   ? -15.029 -10.373 53.922  1.00 65.43  ? 2   LEU A CB  1 
ATOM   3328 C CG  . LEU C 1 2   ? -14.133 -11.604 53.982  1.00 69.14  ? 2   LEU A CG  1 
ATOM   3329 C CD1 . LEU C 1 2   ? -14.490 -12.547 52.851  1.00 72.79  ? 2   LEU A CD1 1 
ATOM   3330 C CD2 . LEU C 1 2   ? -12.681 -11.177 53.898  1.00 72.98  ? 2   LEU A CD2 1 
ATOM   3331 N N   . VAL C 1 3   ? -15.325 -10.733 57.367  1.00 52.75  ? 3   VAL A N   1 
ATOM   3332 C CA  . VAL C 1 3   ? -14.640 -10.491 58.634  1.00 50.47  ? 3   VAL A CA  1 
ATOM   3333 C C   . VAL C 1 3   ? -13.265 -11.143 58.707  1.00 49.58  ? 3   VAL A C   1 
ATOM   3334 O O   . VAL C 1 3   ? -13.120 -12.346 58.464  1.00 47.13  ? 3   VAL A O   1 
ATOM   3335 C CB  . VAL C 1 3   ? -15.448 -11.009 59.831  1.00 50.69  ? 3   VAL A CB  1 
ATOM   3336 C CG1 . VAL C 1 3   ? -15.410 -9.991  60.947  1.00 52.40  ? 3   VAL A CG1 1 
ATOM   3337 C CG2 . VAL C 1 3   ? -16.878 -11.300 59.418  1.00 54.06  ? 3   VAL A CG2 1 
ATOM   3338 N N   . MET C 1 4   ? -12.265 -10.335 59.055  1.00 48.79  ? 4   MET A N   1 
ATOM   3339 C CA  . MET C 1 4   ? -10.881 -10.795 59.182  1.00 45.53  ? 4   MET A CA  1 
ATOM   3340 C C   . MET C 1 4   ? -10.474 -10.784 60.648  1.00 44.94  ? 4   MET A C   1 
ATOM   3341 O O   . MET C 1 4   ? -10.345 -9.722  61.255  1.00 44.64  ? 4   MET A O   1 
ATOM   3342 C CB  . MET C 1 4   ? -9.951  -9.876  58.403  1.00 44.84  ? 4   MET A CB  1 
ATOM   3343 C CG  . MET C 1 4   ? -10.499 -9.443  57.069  1.00 44.72  ? 4   MET A CG  1 
ATOM   3344 S SD  . MET C 1 4   ? -9.652  -10.206 55.691  1.00 48.99  ? 4   MET A SD  1 
ATOM   3345 C CE  . MET C 1 4   ? -8.952  -11.667 56.454  1.00 50.46  ? 4   MET A CE  1 
ATOM   3346 N N   . THR C 1 5   ? -10.262 -11.969 61.207  1.00 43.36  ? 5   THR A N   1 
ATOM   3347 C CA  . THR C 1 5   ? -9.885  -12.101 62.604  1.00 43.76  ? 5   THR A CA  1 
ATOM   3348 C C   . THR C 1 5   ? -8.389  -12.400 62.792  1.00 43.89  ? 5   THR A C   1 
ATOM   3349 O O   . THR C 1 5   ? -7.915  -13.471 62.415  1.00 36.69  ? 5   THR A O   1 
ATOM   3350 C CB  . THR C 1 5   ? -10.710 -13.220 63.271  1.00 44.81  ? 5   THR A CB  1 
ATOM   3351 O OG1 . THR C 1 5   ? -12.108 -12.932 63.128  1.00 48.13  ? 5   THR A OG1 1 
ATOM   3352 C CG2 . THR C 1 5   ? -10.376 -13.322 64.741  1.00 47.60  ? 5   THR A CG2 1 
ATOM   3353 N N   . GLN C 1 6   ? -7.654  -11.450 63.371  1.00 44.44  ? 6   GLN A N   1 
ATOM   3354 C CA  . GLN C 1 6   ? -6.217  -11.629 63.606  1.00 45.87  ? 6   GLN A CA  1 
ATOM   3355 C C   . GLN C 1 6   ? -6.006  -12.233 64.988  1.00 48.94  ? 6   GLN A C   1 
ATOM   3356 O O   . GLN C 1 6   ? -6.230  -11.582 66.009  1.00 52.31  ? 6   GLN A O   1 
ATOM   3357 C CB  . GLN C 1 6   ? -5.477  -10.294 63.482  1.00 39.13  ? 6   GLN A CB  1 
ATOM   3358 C CG  . GLN C 1 6   ? -5.368  -9.801  62.055  1.00 36.57  ? 6   GLN A CG  1 
ATOM   3359 C CD  . GLN C 1 6   ? -4.703  -8.445  61.945  1.00 35.63  ? 6   GLN A CD  1 
ATOM   3360 O OE1 . GLN C 1 6   ? -5.282  -7.503  61.408  1.00 30.55  ? 6   GLN A OE1 1 
ATOM   3361 N NE2 . GLN C 1 6   ? -3.475  -8.341  62.448  1.00 29.70  ? 6   GLN A NE2 1 
ATOM   3362 N N   . THR C 1 7   ? -5.563  -13.486 65.002  1.00 54.89  ? 7   THR A N   1 
ATOM   3363 C CA  . THR C 1 7   ? -5.361  -14.238 66.231  1.00 58.87  ? 7   THR A CA  1 
ATOM   3364 C C   . THR C 1 7   ? -4.534  -13.582 67.329  1.00 59.47  ? 7   THR A C   1 
ATOM   3365 O O   . THR C 1 7   ? -5.076  -13.225 68.378  1.00 69.56  ? 7   THR A O   1 
ATOM   3366 C CB  . THR C 1 7   ? -4.780  -15.636 65.924  1.00 60.99  ? 7   THR A CB  1 
ATOM   3367 O OG1 . THR C 1 7   ? -5.612  -16.294 64.962  1.00 66.29  ? 7   THR A OG1 1 
ATOM   3368 C CG2 . THR C 1 7   ? -4.711  -16.481 67.189  1.00 61.01  ? 7   THR A CG2 1 
ATOM   3369 N N   . PRO C 1 8   ? -3.220  -13.391 67.117  1.00 54.24  ? 8   PRO A N   1 
ATOM   3370 C CA  . PRO C 1 8   ? -2.498  -12.764 68.232  1.00 47.37  ? 8   PRO A CA  1 
ATOM   3371 C C   . PRO C 1 8   ? -2.811  -11.277 68.357  1.00 44.85  ? 8   PRO A C   1 
ATOM   3372 O O   . PRO C 1 8   ? -2.341  -10.473 67.563  1.00 44.11  ? 8   PRO A O   1 
ATOM   3373 C CB  . PRO C 1 8   ? -1.019  -13.028 67.912  1.00 48.54  ? 8   PRO A CB  1 
ATOM   3374 C CG  . PRO C 1 8   ? -1.005  -13.831 66.608  1.00 50.98  ? 8   PRO A CG  1 
ATOM   3375 C CD  . PRO C 1 8   ? -2.346  -13.653 65.963  1.00 46.26  ? 8   PRO A CD  1 
ATOM   3376 N N   . LEU C 1 9   ? -3.612  -10.909 69.351  1.00 39.70  ? 9   LEU A N   1 
ATOM   3377 C CA  . LEU C 1 9   ? -3.951  -9.507  69.527  1.00 40.89  ? 9   LEU A CA  1 
ATOM   3378 C C   . LEU C 1 9   ? -2.692  -8.710  69.834  1.00 38.88  ? 9   LEU A C   1 
ATOM   3379 O O   . LEU C 1 9   ? -2.523  -7.577  69.376  1.00 32.66  ? 9   LEU A O   1 
ATOM   3380 C CB  . LEU C 1 9   ? -4.965  -9.338  70.657  1.00 43.12  ? 9   LEU A CB  1 
ATOM   3381 C CG  . LEU C 1 9   ? -5.912  -8.137  70.552  1.00 49.83  ? 9   LEU A CG  1 
ATOM   3382 C CD1 . LEU C 1 9   ? -5.503  -7.103  71.586  1.00 53.60  ? 9   LEU A CD1 1 
ATOM   3383 C CD2 . LEU C 1 9   ? -5.890  -7.536  69.142  1.00 53.05  ? 9   LEU A CD2 1 
ATOM   3384 N N   . SER C 1 10  ? -1.822  -9.320  70.630  1.00 41.14  ? 10  SER A N   1 
ATOM   3385 C CA  . SER C 1 10  ? -0.551  -8.727  71.018  1.00 43.76  ? 10  SER A CA  1 
ATOM   3386 C C   . SER C 1 10  ? 0.479   -9.849  70.976  1.00 45.29  ? 10  SER A C   1 
ATOM   3387 O O   . SER C 1 10  ? 0.204   -10.972 71.403  1.00 49.31  ? 10  SER A O   1 
ATOM   3388 C CB  . SER C 1 10  ? -0.633  -8.154  72.432  1.00 41.18  ? 10  SER A CB  1 
ATOM   3389 O OG  . SER C 1 10  ? 0.378   -7.184  72.651  1.00 46.82  ? 10  SER A OG  1 
ATOM   3390 N N   . LEU C 1 11  ? 1.664   -9.554  70.461  1.00 46.11  ? 11  LEU A N   1 
ATOM   3391 C CA  . LEU C 1 11  ? 2.699   -10.569 70.373  1.00 42.96  ? 11  LEU A CA  1 
ATOM   3392 C C   . LEU C 1 11  ? 4.000   -10.123 71.017  1.00 42.72  ? 11  LEU A C   1 
ATOM   3393 O O   . LEU C 1 11  ? 4.732   -9.303  70.464  1.00 39.84  ? 11  LEU A O   1 
ATOM   3394 C CB  . LEU C 1 11  ? 2.951   -10.931 68.905  1.00 43.68  ? 11  LEU A CB  1 
ATOM   3395 C CG  . LEU C 1 11  ? 3.219   -12.396 68.555  1.00 41.45  ? 11  LEU A CG  1 
ATOM   3396 C CD1 . LEU C 1 11  ? 3.751   -12.480 67.138  1.00 43.65  ? 11  LEU A CD1 1 
ATOM   3397 C CD2 . LEU C 1 11  ? 4.212   -12.994 69.528  1.00 39.13  ? 11  LEU A CD2 1 
ATOM   3398 N N   . PRO C 1 12  ? 4.293   -10.635 72.222  1.00 42.73  ? 12  PRO A N   1 
ATOM   3399 C CA  . PRO C 1 12  ? 5.544   -10.244 72.877  1.00 38.61  ? 12  PRO A CA  1 
ATOM   3400 C C   . PRO C 1 12  ? 6.671   -11.020 72.194  1.00 36.49  ? 12  PRO A C   1 
ATOM   3401 O O   . PRO C 1 12  ? 6.558   -12.229 71.956  1.00 36.27  ? 12  PRO A O   1 
ATOM   3402 C CB  . PRO C 1 12  ? 5.354   -10.663 74.341  1.00 37.74  ? 12  PRO A CB  1 
ATOM   3403 C CG  . PRO C 1 12  ? 3.957   -11.231 74.442  1.00 40.71  ? 12  PRO A CG  1 
ATOM   3404 C CD  . PRO C 1 12  ? 3.510   -11.571 73.042  1.00 42.91  ? 12  PRO A CD  1 
ATOM   3405 N N   . VAL C 1 13  ? 7.751   -10.331 71.874  1.00 31.25  ? 13  VAL A N   1 
ATOM   3406 C CA  . VAL C 1 13  ? 8.852   -10.988 71.201  1.00 35.89  ? 13  VAL A CA  1 
ATOM   3407 C C   . VAL C 1 13  ? 10.190  -10.405 71.651  1.00 36.15  ? 13  VAL A C   1 
ATOM   3408 O O   . VAL C 1 13  ? 10.257  -9.286  72.157  1.00 35.67  ? 13  VAL A O   1 
ATOM   3409 C CB  . VAL C 1 13  ? 8.690   -10.839 69.658  1.00 33.89  ? 13  VAL A CB  1 
ATOM   3410 C CG1 . VAL C 1 13  ? 8.976   -9.400  69.242  1.00 24.32  ? 13  VAL A CG1 1 
ATOM   3411 C CG2 . VAL C 1 13  ? 9.596   -11.831 68.926  1.00 37.68  ? 13  VAL A CG2 1 
ATOM   3412 N N   . SER C 1 14  ? 11.249  -11.188 71.491  1.00 38.58  ? 14  SER A N   1 
ATOM   3413 C CA  . SER C 1 14  ? 12.580  -10.742 71.844  1.00 30.19  ? 14  SER A CA  1 
ATOM   3414 C C   . SER C 1 14  ? 13.232  -10.398 70.517  1.00 35.56  ? 14  SER A C   1 
ATOM   3415 O O   . SER C 1 14  ? 12.987  -11.076 69.516  1.00 35.34  ? 14  SER A O   1 
ATOM   3416 C CB  . SER C 1 14  ? 13.348  -11.864 72.541  1.00 34.59  ? 14  SER A CB  1 
ATOM   3417 O OG  . SER C 1 14  ? 12.757  -12.179 73.789  1.00 35.09  ? 14  SER A OG  1 
ATOM   3418 N N   . LEU C 1 15  ? 14.040  -9.341  70.505  1.00 34.24  ? 15  LEU A N   1 
ATOM   3419 C CA  . LEU C 1 15  ? 14.730  -8.910  69.295  1.00 35.30  ? 15  LEU A CA  1 
ATOM   3420 C C   . LEU C 1 15  ? 15.624  -10.027 68.783  1.00 35.54  ? 15  LEU A C   1 
ATOM   3421 O O   . LEU C 1 15  ? 16.305  -10.697 69.562  1.00 35.34  ? 15  LEU A O   1 
ATOM   3422 C CB  . LEU C 1 15  ? 15.570  -7.658  69.570  1.00 33.59  ? 15  LEU A CB  1 
ATOM   3423 C CG  . LEU C 1 15  ? 14.799  -6.379  69.872  1.00 32.96  ? 15  LEU A CG  1 
ATOM   3424 C CD1 . LEU C 1 15  ? 15.756  -5.192  69.895  1.00 31.01  ? 15  LEU A CD1 1 
ATOM   3425 C CD2 . LEU C 1 15  ? 13.732  -6.174  68.817  1.00 28.23  ? 15  LEU A CD2 1 
ATOM   3426 N N   . GLY C 1 16  ? 15.606  -10.233 67.473  1.00 34.86  ? 16  GLY A N   1 
ATOM   3427 C CA  . GLY C 1 16  ? 16.404  -11.294 66.889  1.00 38.62  ? 16  GLY A CA  1 
ATOM   3428 C C   . GLY C 1 16  ? 15.601  -12.570 66.709  1.00 38.84  ? 16  GLY A C   1 
ATOM   3429 O O   . GLY C 1 16  ? 15.966  -13.435 65.921  1.00 40.58  ? 16  GLY A O   1 
ATOM   3430 N N   . ASP C 1 17  ? 14.498  -12.686 67.436  1.00 40.54  ? 17  ASP A N   1 
ATOM   3431 C CA  . ASP C 1 17  ? 13.657  -13.872 67.344  1.00 45.11  ? 17  ASP A CA  1 
ATOM   3432 C C   . ASP C 1 17  ? 12.693  -13.790 66.165  1.00 43.27  ? 17  ASP A C   1 
ATOM   3433 O O   . ASP C 1 17  ? 12.626  -12.773 65.475  1.00 44.57  ? 17  ASP A O   1 
ATOM   3434 C CB  . ASP C 1 17  ? 12.869  -14.050 68.645  1.00 55.04  ? 17  ASP A CB  1 
ATOM   3435 C CG  . ASP C 1 17  ? 13.744  -14.527 69.803  1.00 64.10  ? 17  ASP A CG  1 
ATOM   3436 O OD1 . ASP C 1 17  ? 14.969  -14.263 69.785  1.00 67.68  ? 17  ASP A OD1 1 
ATOM   3437 O OD2 . ASP C 1 17  ? 13.205  -15.167 70.732  1.00 66.72  ? 17  ASP A OD2 1 
ATOM   3438 N N   . GLN C 1 18  ? 11.957  -14.872 65.935  1.00 41.25  ? 18  GLN A N   1 
ATOM   3439 C CA  . GLN C 1 18  ? 10.992  -14.927 64.847  1.00 43.54  ? 18  GLN A CA  1 
ATOM   3440 C C   . GLN C 1 18  ? 9.586   -14.629 65.358  1.00 39.86  ? 18  GLN A C   1 
ATOM   3441 O O   . GLN C 1 18  ? 9.206   -15.055 66.440  1.00 41.78  ? 18  GLN A O   1 
ATOM   3442 C CB  . GLN C 1 18  ? 11.016  -16.307 64.183  1.00 48.87  ? 18  GLN A CB  1 
ATOM   3443 C CG  . GLN C 1 18  ? 9.645   -16.975 64.050  1.00 57.83  ? 18  GLN A CG  1 
ATOM   3444 C CD  . GLN C 1 18  ? 9.148   -17.036 62.614  1.00 61.39  ? 18  GLN A CD  1 
ATOM   3445 O OE1 . GLN C 1 18  ? 9.244   -18.071 61.957  1.00 61.93  ? 18  GLN A OE1 1 
ATOM   3446 N NE2 . GLN C 1 18  ? 8.610   -15.925 62.124  1.00 66.36  ? 18  GLN A NE2 1 
ATOM   3447 N N   . ALA C 1 19  ? 8.826   -13.877 64.577  1.00 37.69  ? 19  ALA A N   1 
ATOM   3448 C CA  . ALA C 1 19  ? 7.453   -13.542 64.936  1.00 35.40  ? 19  ALA A CA  1 
ATOM   3449 C C   . ALA C 1 19  ? 6.535   -14.143 63.888  1.00 35.95  ? 19  ALA A C   1 
ATOM   3450 O O   . ALA C 1 19  ? 6.878   -14.183 62.693  1.00 34.45  ? 19  ALA A O   1 
ATOM   3451 C CB  . ALA C 1 19  ? 7.264   -12.029 64.982  1.00 31.26  ? 19  ALA A CB  1 
ATOM   3452 N N   . SER C 1 20  ? 5.377   -14.616 64.339  1.00 33.68  ? 20  SER A N   1 
ATOM   3453 C CA  . SER C 1 20  ? 4.378   -15.208 63.463  1.00 41.69  ? 20  SER A CA  1 
ATOM   3454 C C   . SER C 1 20  ? 2.980   -14.681 63.832  1.00 44.00  ? 20  SER A C   1 
ATOM   3455 O O   . SER C 1 20  ? 2.492   -14.900 64.942  1.00 42.88  ? 20  SER A O   1 
ATOM   3456 C CB  . SER C 1 20  ? 4.419   -16.728 63.592  1.00 42.98  ? 20  SER A CB  1 
ATOM   3457 O OG  . SER C 1 20  ? 4.403   -17.342 62.320  1.00 49.57  ? 20  SER A OG  1 
ATOM   3458 N N   . ILE C 1 21  ? 2.355   -13.980 62.889  1.00 44.40  ? 21  ILE A N   1 
ATOM   3459 C CA  . ILE C 1 21  ? 1.033   -13.397 63.079  1.00 42.18  ? 21  ILE A CA  1 
ATOM   3460 C C   . ILE C 1 21  ? 0.033   -14.132 62.192  1.00 42.71  ? 21  ILE A C   1 
ATOM   3461 O O   . ILE C 1 21  ? 0.330   -14.478 61.048  1.00 41.38  ? 21  ILE A O   1 
ATOM   3462 C CB  . ILE C 1 21  ? 1.071   -11.882 62.756  1.00 41.60  ? 21  ILE A CB  1 
ATOM   3463 C CG1 . ILE C 1 21  ? 1.630   -11.128 63.968  1.00 41.61  ? 21  ILE A CG1 1 
ATOM   3464 C CG2 . ILE C 1 21  ? -0.309  -11.371 62.372  1.00 48.25  ? 21  ILE A CG2 1 
ATOM   3465 C CD1 . ILE C 1 21  ? 2.333   -9.838  63.634  1.00 41.19  ? 21  ILE A CD1 1 
ATOM   3466 N N   . SER C 1 22  ? -1.153  -14.375 62.734  1.00 41.67  ? 22  SER A N   1 
ATOM   3467 C CA  . SER C 1 22  ? -2.189  -15.114 62.027  1.00 42.94  ? 22  SER A CA  1 
ATOM   3468 C C   . SER C 1 22  ? -3.401  -14.253 61.704  1.00 42.14  ? 22  SER A C   1 
ATOM   3469 O O   . SER C 1 22  ? -3.804  -13.412 62.508  1.00 36.65  ? 22  SER A O   1 
ATOM   3470 C CB  . SER C 1 22  ? -2.634  -16.300 62.885  1.00 46.94  ? 22  SER A CB  1 
ATOM   3471 O OG  . SER C 1 22  ? -2.788  -17.471 62.106  1.00 58.87  ? 22  SER A OG  1 
ATOM   3472 N N   . CYS C 1 23  ? -3.971  -14.476 60.522  1.00 43.32  ? 23  CYS A N   1 
ATOM   3473 C CA  . CYS C 1 23  ? -5.155  -13.749 60.059  1.00 47.39  ? 23  CYS A CA  1 
ATOM   3474 C C   . CYS C 1 23  ? -6.093  -14.755 59.404  1.00 47.57  ? 23  CYS A C   1 
ATOM   3475 O O   . CYS C 1 23  ? -5.697  -15.492 58.500  1.00 46.39  ? 23  CYS A O   1 
ATOM   3476 C CB  . CYS C 1 23  ? -4.766  -12.663 59.043  1.00 49.15  ? 23  CYS A CB  1 
ATOM   3477 S SG  . CYS C 1 23  ? -6.168  -11.816 58.233  1.00 50.22  ? 23  CYS A SG  1 
ATOM   3478 N N   . ARG C 1 24  ? -7.330  -14.800 59.880  1.00 45.66  ? 24  ARG A N   1 
ATOM   3479 C CA  . ARG C 1 24  ? -8.318  -15.722 59.341  1.00 46.91  ? 24  ARG A CA  1 
ATOM   3480 C C   . ARG C 1 24  ? -9.488  -14.931 58.774  1.00 43.47  ? 24  ARG A C   1 
ATOM   3481 O O   . ARG C 1 24  ? -9.962  -13.987 59.401  1.00 40.52  ? 24  ARG A O   1 
ATOM   3482 C CB  . ARG C 1 24  ? -8.794  -16.658 60.453  1.00 50.21  ? 24  ARG A CB  1 
ATOM   3483 C CG  . ARG C 1 24  ? -9.462  -17.936 59.983  1.00 56.97  ? 24  ARG A CG  1 
ATOM   3484 C CD  . ARG C 1 24  ? -10.500 -18.376 60.999  1.00 61.26  ? 24  ARG A CD  1 
ATOM   3485 N NE  . ARG C 1 24  ? -11.010 -17.233 61.752  1.00 68.88  ? 24  ARG A NE  1 
ATOM   3486 C CZ  . ARG C 1 24  ? -11.586 -17.317 62.947  1.00 74.93  ? 24  ARG A CZ  1 
ATOM   3487 N NH1 . ARG C 1 24  ? -11.729 -18.497 63.536  1.00 76.09  ? 24  ARG A NH1 1 
ATOM   3488 N NH2 . ARG C 1 24  ? -12.020 -16.219 63.552  1.00 76.61  ? 24  ARG A NH2 1 
ATOM   3489 N N   . SER C 1 25  ? -9.946  -15.304 57.582  1.00 44.13  ? 25  SER A N   1 
ATOM   3490 C CA  . SER C 1 25  ? -11.070 -14.600 56.965  1.00 44.85  ? 25  SER A CA  1 
ATOM   3491 C C   . SER C 1 25  ? -12.393 -15.368 57.099  1.00 44.60  ? 25  SER A C   1 
ATOM   3492 O O   . SER C 1 25  ? -12.402 -16.590 57.244  1.00 43.93  ? 25  SER A O   1 
ATOM   3493 C CB  . SER C 1 25  ? -10.775 -14.307 55.484  1.00 45.48  ? 25  SER A CB  1 
ATOM   3494 O OG  . SER C 1 25  ? -10.767 -15.488 54.702  1.00 50.36  ? 25  SER A OG  1 
ATOM   3495 N N   . SER C 1 26  ? -13.502 -14.630 57.059  1.00 46.69  ? 26  SER A N   1 
ATOM   3496 C CA  . SER C 1 26  ? -14.849 -15.200 57.176  1.00 46.77  ? 26  SER A CA  1 
ATOM   3497 C C   . SER C 1 26  ? -15.170 -16.113 55.997  1.00 46.64  ? 26  SER A C   1 
ATOM   3498 O O   . SER C 1 26  ? -15.747 -17.184 56.176  1.00 45.17  ? 26  SER A O   1 
ATOM   3499 C CB  . SER C 1 26  ? -15.887 -14.080 57.250  1.00 46.09  ? 26  SER A CB  1 
ATOM   3500 O OG  . SER C 1 26  ? -15.755 -13.198 56.146  1.00 46.58  ? 26  SER A OG  1 
ATOM   3501 N N   . GLN C 1 27  ? -14.798 -15.677 54.794  1.00 47.20  ? 27  GLN A N   1 
ATOM   3502 C CA  . GLN C 1 27  ? -15.012 -16.458 53.573  1.00 47.90  ? 27  GLN A CA  1 
ATOM   3503 C C   . GLN C 1 27  ? -13.672 -16.620 52.863  1.00 48.18  ? 27  GLN A C   1 
ATOM   3504 O O   . GLN C 1 27  ? -12.708 -15.921 53.177  1.00 48.34  ? 27  GLN A O   1 
ATOM   3505 C CB  . GLN C 1 27  ? -15.986 -15.744 52.636  1.00 49.79  ? 27  GLN A CB  1 
ATOM   3506 C CG  . GLN C 1 27  ? -17.181 -15.132 53.342  1.00 58.92  ? 27  GLN A CG  1 
ATOM   3507 C CD  . GLN C 1 27  ? -17.892 -14.100 52.494  1.00 61.21  ? 27  GLN A CD  1 
ATOM   3508 O OE1 . GLN C 1 27  ? -17.897 -14.187 51.266  1.00 64.51  ? 27  GLN A OE1 1 
ATOM   3509 N NE2 . GLN C 1 27  ? -18.496 -13.113 53.147  1.00 61.25  ? 27  GLN A NE2 1 
ATOM   3510 N N   . SER C 1 28  ? -13.599 -17.545 51.913  1.00 47.92  ? 28  SER A N   1 
ATOM   3511 C CA  . SER C 1 28  ? -12.357 -17.729 51.184  1.00 48.02  ? 28  SER A CA  1 
ATOM   3512 C C   . SER C 1 28  ? -12.067 -16.426 50.452  1.00 49.82  ? 28  SER A C   1 
ATOM   3513 O O   . SER C 1 28  ? -12.975 -15.813 49.888  1.00 48.35  ? 28  SER A O   1 
ATOM   3514 C CB  . SER C 1 28  ? -12.478 -18.856 50.165  1.00 49.18  ? 28  SER A CB  1 
ATOM   3515 O OG  . SER C 1 28  ? -11.726 -18.542 49.001  1.00 53.95  ? 28  SER A OG  1 
ATOM   3516 N N   . LEU C 1 29  ? -10.805 -16.004 50.472  1.00 48.58  ? 29  LEU A N   1 
ATOM   3517 C CA  . LEU C 1 29  ? -10.395 -14.774 49.812  1.00 49.38  ? 29  LEU A CA  1 
ATOM   3518 C C   . LEU C 1 29  ? -9.913  -15.080 48.410  1.00 48.53  ? 29  LEU A C   1 
ATOM   3519 O O   . LEU C 1 29  ? -9.246  -14.259 47.780  1.00 48.89  ? 29  LEU A O   1 
ATOM   3520 C CB  . LEU C 1 29  ? -9.278  -14.085 50.599  1.00 50.72  ? 29  LEU A CB  1 
ATOM   3521 C CG  . LEU C 1 29  ? -9.535  -13.917 52.094  1.00 50.96  ? 29  LEU A CG  1 
ATOM   3522 C CD1 . LEU C 1 29  ? -8.536  -12.945 52.681  1.00 50.19  ? 29  LEU A CD1 1 
ATOM   3523 C CD2 . LEU C 1 29  ? -10.958 -13.424 52.308  1.00 56.28  ? 29  LEU A CD2 1 
ATOM   3524 N N   . VAL C 1 30  ? -10.247 -16.274 47.929  1.00 49.03  ? 30  VAL A N   1 
ATOM   3525 C CA  . VAL C 1 30  ? -9.866  -16.679 46.584  1.00 48.59  ? 30  VAL A CA  1 
ATOM   3526 C C   . VAL C 1 30  ? -10.864 -16.095 45.598  1.00 50.01  ? 30  VAL A C   1 
ATOM   3527 O O   . VAL C 1 30  ? -11.995 -16.563 45.514  1.00 50.13  ? 30  VAL A O   1 
ATOM   3528 C CB  . VAL C 1 30  ? -9.879  -18.207 46.422  1.00 50.31  ? 30  VAL A CB  1 
ATOM   3529 C CG1 . VAL C 1 30  ? -9.270  -18.577 45.076  1.00 49.68  ? 30  VAL A CG1 1 
ATOM   3530 C CG2 . VAL C 1 30  ? -9.112  -18.865 47.564  1.00 45.58  ? 30  VAL A CG2 1 
ATOM   3531 N N   . HIS C 1 31  ? -10.447 -15.070 44.865  1.00 49.51  ? 31  HIS A N   1 
ATOM   3532 C CA  . HIS C 1 31  ? -11.310 -14.434 43.885  1.00 53.36  ? 31  HIS A CA  1 
ATOM   3533 C C   . HIS C 1 31  ? -11.601 -15.443 42.775  1.00 55.49  ? 31  HIS A C   1 
ATOM   3534 O O   . HIS C 1 31  ? -10.831 -16.378 42.563  1.00 57.02  ? 31  HIS A O   1 
ATOM   3535 C CB  . HIS C 1 31  ? -10.617 -13.194 43.310  1.00 54.98  ? 31  HIS A CB  1 
ATOM   3536 C CG  . HIS C 1 31  ? -11.528 -12.298 42.526  1.00 59.10  ? 31  HIS A CG  1 
ATOM   3537 N ND1 . HIS C 1 31  ? -11.957 -11.076 42.998  1.00 61.66  ? 31  HIS A ND1 1 
ATOM   3538 C CD2 . HIS C 1 31  ? -12.089 -12.446 41.303  1.00 58.88  ? 31  HIS A CD2 1 
ATOM   3539 C CE1 . HIS C 1 31  ? -12.743 -10.510 42.100  1.00 59.55  ? 31  HIS A CE1 1 
ATOM   3540 N NE2 . HIS C 1 31  ? -12.840 -11.321 41.063  1.00 61.62  ? 31  HIS A NE2 1 
ATOM   3541 N N   . SER C 1 32  ? -12.715 -15.262 42.074  1.00 56.66  ? 32  SER A N   1 
ATOM   3542 C CA  . SER C 1 32  ? -13.075 -16.180 40.998  1.00 57.47  ? 32  SER A CA  1 
ATOM   3543 C C   . SER C 1 32  ? -12.086 -16.088 39.832  1.00 56.05  ? 32  SER A C   1 
ATOM   3544 O O   . SER C 1 32  ? -12.037 -16.979 38.983  1.00 55.17  ? 32  SER A O   1 
ATOM   3545 C CB  . SER C 1 32  ? -14.511 -15.906 40.512  1.00 55.09  ? 32  SER A CB  1 
ATOM   3546 O OG  . SER C 1 32  ? -14.584 -14.714 39.751  1.00 51.95  ? 32  SER A OG  1 
ATOM   3547 N N   . ASN C 1 33  ? -11.295 -15.017 39.797  1.00 55.78  ? 33  ASN A N   1 
ATOM   3548 C CA  . ASN C 1 33  ? -10.309 -14.844 38.737  1.00 56.41  ? 33  ASN A CA  1 
ATOM   3549 C C   . ASN C 1 33  ? -9.025  -15.602 39.081  1.00 56.20  ? 33  ASN A C   1 
ATOM   3550 O O   . ASN C 1 33  ? -8.085  -15.667 38.278  1.00 51.69  ? 33  ASN A O   1 
ATOM   3551 C CB  . ASN C 1 33  ? -10.010 -13.354 38.516  1.00 60.36  ? 33  ASN A CB  1 
ATOM   3552 C CG  . ASN C 1 33  ? -9.146  -12.754 39.614  1.00 61.18  ? 33  ASN A CG  1 
ATOM   3553 O OD1 . ASN C 1 33  ? -9.131  -13.234 40.748  1.00 59.01  ? 33  ASN A OD1 1 
ATOM   3554 N ND2 . ASN C 1 33  ? -8.424  -11.692 39.278  1.00 59.58  ? 33  ASN A ND2 1 
ATOM   3555 N N   . GLY C 1 34  ? -8.996  -16.180 40.279  1.00 53.68  ? 34  GLY A N   1 
ATOM   3556 C CA  . GLY C 1 34  ? -7.834  -16.941 40.698  1.00 52.80  ? 34  GLY A CA  1 
ATOM   3557 C C   . GLY C 1 34  ? -7.065  -16.347 41.862  1.00 50.37  ? 34  GLY A C   1 
ATOM   3558 O O   . GLY C 1 34  ? -6.942  -16.977 42.911  1.00 52.75  ? 34  GLY A O   1 
ATOM   3559 N N   . ASN C 1 35  ? -6.545  -15.136 41.681  1.00 47.10  ? 35  ASN A N   1 
ATOM   3560 C CA  . ASN C 1 35  ? -5.776  -14.471 42.725  1.00 45.76  ? 35  ASN A CA  1 
ATOM   3561 C C   . ASN C 1 35  ? -6.470  -14.460 44.076  1.00 43.28  ? 35  ASN A C   1 
ATOM   3562 O O   . ASN C 1 35  ? -7.693  -14.541 44.163  1.00 48.20  ? 35  ASN A O   1 
ATOM   3563 C CB  . ASN C 1 35  ? -5.473  -13.023 42.340  1.00 46.81  ? 35  ASN A CB  1 
ATOM   3564 C CG  . ASN C 1 35  ? -5.116  -12.871 40.880  1.00 49.68  ? 35  ASN A CG  1 
ATOM   3565 O OD1 . ASN C 1 35  ? -5.776  -13.428 40.008  1.00 55.94  ? 35  ASN A OD1 1 
ATOM   3566 N ND2 . ASN C 1 35  ? -4.070  -12.102 40.604  1.00 52.45  ? 35  ASN A ND2 1 
ATOM   3567 N N   . THR C 1 36  ? -5.661  -14.357 45.124  1.00 41.01  ? 36  THR A N   1 
ATOM   3568 C CA  . THR C 1 36  ? -6.136  -14.274 46.493  1.00 40.14  ? 36  THR A CA  1 
ATOM   3569 C C   . THR C 1 36  ? -5.595  -12.934 46.995  1.00 42.20  ? 36  THR A C   1 
ATOM   3570 O O   . THR C 1 36  ? -4.416  -12.819 47.338  1.00 40.19  ? 36  THR A O   1 
ATOM   3571 C CB  . THR C 1 36  ? -5.569  -15.413 47.368  1.00 39.04  ? 36  THR A CB  1 
ATOM   3572 O OG1 . THR C 1 36  ? -6.055  -16.672 46.889  1.00 40.14  ? 36  THR A OG1 1 
ATOM   3573 C CG2 . THR C 1 36  ? -6.009  -15.246 48.818  1.00 39.92  ? 36  THR A CG2 1 
ATOM   3574 N N   . TYR C 1 37  ? -6.456  -11.920 47.015  1.00 39.19  ? 37  TYR A N   1 
ATOM   3575 C CA  . TYR C 1 37  ? -6.069  -10.589 47.456  1.00 35.70  ? 37  TYR A CA  1 
ATOM   3576 C C   . TYR C 1 37  ? -6.053  -10.420 48.960  1.00 36.84  ? 37  TYR A C   1 
ATOM   3577 O O   . TYR C 1 37  ? -6.965  -9.821  49.542  1.00 34.59  ? 37  TYR A O   1 
ATOM   3578 C CB  . TYR C 1 37  ? -6.994  -9.550  46.849  1.00 36.79  ? 37  TYR A CB  1 
ATOM   3579 C CG  . TYR C 1 37  ? -7.089  -9.656  45.352  1.00 38.34  ? 37  TYR A CG  1 
ATOM   3580 C CD1 . TYR C 1 37  ? -8.046  -10.480 44.753  1.00 37.30  ? 37  TYR A CD1 1 
ATOM   3581 C CD2 . TYR C 1 37  ? -6.212  -8.953  44.533  1.00 34.26  ? 37  TYR A CD2 1 
ATOM   3582 C CE1 . TYR C 1 37  ? -8.122  -10.600 43.363  1.00 41.39  ? 37  TYR A CE1 1 
ATOM   3583 C CE2 . TYR C 1 37  ? -6.277  -9.064  43.147  1.00 40.06  ? 37  TYR A CE2 1 
ATOM   3584 C CZ  . TYR C 1 37  ? -7.232  -9.888  42.566  1.00 42.37  ? 37  TYR A CZ  1 
ATOM   3585 O OH  . TYR C 1 37  ? -7.294  -9.994  41.195  1.00 43.58  ? 37  TYR A OH  1 
ATOM   3586 N N   . LEU C 1 38  ? -5.005  -10.957 49.582  1.00 33.71  ? 38  LEU A N   1 
ATOM   3587 C CA  . LEU C 1 38  ? -4.814  -10.860 51.017  1.00 30.76  ? 38  LEU A CA  1 
ATOM   3588 C C   . LEU C 1 38  ? -3.470  -10.147 51.197  1.00 35.17  ? 38  LEU A C   1 
ATOM   3589 O O   . LEU C 1 38  ? -2.428  -10.663 50.793  1.00 34.03  ? 38  LEU A O   1 
ATOM   3590 C CB  . LEU C 1 38  ? -4.789  -12.262 51.629  1.00 27.36  ? 38  LEU A CB  1 
ATOM   3591 C CG  . LEU C 1 38  ? -4.803  -12.427 53.153  1.00 32.85  ? 38  LEU A CG  1 
ATOM   3592 C CD1 . LEU C 1 38  ? -3.354  -12.388 53.670  1.00 31.76  ? 38  LEU A CD1 1 
ATOM   3593 C CD2 . LEU C 1 38  ? -5.654  -11.345 53.809  1.00 28.88  ? 38  LEU A CD2 1 
ATOM   3594 N N   . HIS C 1 39  ? -3.512  -8.954  51.786  1.00 32.04  ? 39  HIS A N   1 
ATOM   3595 C CA  . HIS C 1 39  ? -2.322  -8.131  52.000  1.00 29.45  ? 39  HIS A CA  1 
ATOM   3596 C C   . HIS C 1 39  ? -2.045  -7.874  53.473  1.00 29.66  ? 39  HIS A C   1 
ATOM   3597 O O   . HIS C 1 39  ? -2.951  -8.009  54.300  1.00 23.42  ? 39  HIS A O   1 
ATOM   3598 C CB  . HIS C 1 39  ? -2.495  -6.795  51.264  1.00 28.88  ? 39  HIS A CB  1 
ATOM   3599 C CG  . HIS C 1 39  ? -3.135  -6.937  49.920  1.00 34.78  ? 39  HIS A CG  1 
ATOM   3600 N ND1 . HIS C 1 39  ? -4.484  -6.749  49.715  1.00 41.98  ? 39  HIS A ND1 1 
ATOM   3601 C CD2 . HIS C 1 39  ? -2.621  -7.294  48.718  1.00 35.79  ? 39  HIS A CD2 1 
ATOM   3602 C CE1 . HIS C 1 39  ? -4.774  -6.981  48.448  1.00 41.50  ? 39  HIS A CE1 1 
ATOM   3603 N NE2 . HIS C 1 39  ? -3.659  -7.313  47.820  1.00 43.05  ? 39  HIS A NE2 1 
ATOM   3604 N N   . TRP C 1 40  ? -0.792  -7.509  53.782  1.00 29.16  ? 40  TRP A N   1 
ATOM   3605 C CA  . TRP C 1 40  ? -0.333  -7.228  55.152  1.00 27.10  ? 40  TRP A CA  1 
ATOM   3606 C C   . TRP C 1 40  ? 0.324   -5.848  55.267  1.00 30.94  ? 40  TRP A C   1 
ATOM   3607 O O   . TRP C 1 40  ? 1.219   -5.495  54.478  1.00 30.79  ? 40  TRP A O   1 
ATOM   3608 C CB  . TRP C 1 40  ? 0.693   -8.273  55.620  1.00 23.25  ? 40  TRP A CB  1 
ATOM   3609 C CG  . TRP C 1 40  ? 0.168   -9.655  55.825  1.00 14.09  ? 40  TRP A CG  1 
ATOM   3610 C CD1 . TRP C 1 40  ? 0.203   -10.675 54.936  1.00 16.39  ? 40  TRP A CD1 1 
ATOM   3611 C CD2 . TRP C 1 40  ? -0.377  -10.192 57.039  1.00 16.21  ? 40  TRP A CD2 1 
ATOM   3612 N NE1 . TRP C 1 40  ? -0.279  -11.832 55.519  1.00 18.70  ? 40  TRP A NE1 1 
ATOM   3613 C CE2 . TRP C 1 40  ? -0.638  -11.556 56.812  1.00 18.95  ? 40  TRP A CE2 1 
ATOM   3614 C CE3 . TRP C 1 40  ? -0.665  -9.649  58.300  1.00 20.11  ? 40  TRP A CE3 1 
ATOM   3615 C CZ2 . TRP C 1 40  ? -1.176  -12.394 57.803  1.00 18.72  ? 40  TRP A CZ2 1 
ATOM   3616 C CZ3 . TRP C 1 40  ? -1.199  -10.482 59.286  1.00 18.77  ? 40  TRP A CZ3 1 
ATOM   3617 C CH2 . TRP C 1 40  ? -1.447  -11.833 59.030  1.00 18.64  ? 40  TRP A CH2 1 
ATOM   3618 N N   . TYR C 1 41  ? -0.095  -5.089  56.275  1.00 25.95  ? 41  TYR A N   1 
ATOM   3619 C CA  . TYR C 1 41  ? 0.417   -3.745  56.511  1.00 22.58  ? 41  TYR A CA  1 
ATOM   3620 C C   . TYR C 1 41  ? 0.942   -3.597  57.931  1.00 19.96  ? 41  TYR A C   1 
ATOM   3621 O O   . TYR C 1 41  ? 0.557   -4.343  58.806  1.00 20.34  ? 41  TYR A O   1 
ATOM   3622 C CB  . TYR C 1 41  ? -0.693  -2.709  56.306  1.00 24.16  ? 41  TYR A CB  1 
ATOM   3623 C CG  . TYR C 1 41  ? -1.407  -2.771  54.973  1.00 24.38  ? 41  TYR A CG  1 
ATOM   3624 C CD1 . TYR C 1 41  ? -2.275  -3.821  54.665  1.00 22.74  ? 41  TYR A CD1 1 
ATOM   3625 C CD2 . TYR C 1 41  ? -1.229  -1.765  54.027  1.00 25.75  ? 41  TYR A CD2 1 
ATOM   3626 C CE1 . TYR C 1 41  ? -2.956  -3.863  53.434  1.00 25.59  ? 41  TYR A CE1 1 
ATOM   3627 C CE2 . TYR C 1 41  ? -1.901  -1.800  52.809  1.00 26.94  ? 41  TYR A CE2 1 
ATOM   3628 C CZ  . TYR C 1 41  ? -2.762  -2.850  52.517  1.00 17.89  ? 41  TYR A CZ  1 
ATOM   3629 O OH  . TYR C 1 41  ? -3.424  -2.866  51.309  1.00 28.88  ? 41  TYR A OH  1 
ATOM   3630 N N   . LEU C 1 42  ? 1.830   -2.628  58.143  1.00 21.91  ? 42  LEU A N   1 
ATOM   3631 C CA  . LEU C 1 42  ? 2.372   -2.352  59.470  1.00 22.38  ? 42  LEU A CA  1 
ATOM   3632 C C   . LEU C 1 42  ? 2.149   -0.868  59.750  1.00 20.51  ? 42  LEU A C   1 
ATOM   3633 O O   . LEU C 1 42  ? 2.416   -0.025  58.898  1.00 23.79  ? 42  LEU A O   1 
ATOM   3634 C CB  . LEU C 1 42  ? 3.881   -2.673  59.535  1.00 27.44  ? 42  LEU A CB  1 
ATOM   3635 C CG  . LEU C 1 42  ? 4.672   -1.985  60.656  1.00 27.70  ? 42  LEU A CG  1 
ATOM   3636 C CD1 . LEU C 1 42  ? 4.335   -2.678  61.972  1.00 26.80  ? 42  LEU A CD1 1 
ATOM   3637 C CD2 . LEU C 1 42  ? 6.198   -2.028  60.389  1.00 27.66  ? 42  LEU A CD2 1 
ATOM   3638 N N   . GLN C 1 43  ? 1.661   -0.542  60.945  1.00 19.66  ? 43  GLN A N   1 
ATOM   3639 C CA  . GLN C 1 43  ? 1.442   0.844   61.323  1.00 20.02  ? 43  GLN A CA  1 
ATOM   3640 C C   . GLN C 1 43  ? 2.223   1.145   62.606  1.00 29.06  ? 43  GLN A C   1 
ATOM   3641 O O   . GLN C 1 43  ? 2.049   0.486   63.628  1.00 28.40  ? 43  GLN A O   1 
ATOM   3642 C CB  . GLN C 1 43  ? -0.059  1.121   61.550  1.00 22.91  ? 43  GLN A CB  1 
ATOM   3643 C CG  . GLN C 1 43  ? -0.389  2.599   61.648  1.00 18.47  ? 43  GLN A CG  1 
ATOM   3644 C CD  . GLN C 1 43  ? -1.874  2.885   61.893  1.00 20.91  ? 43  GLN A CD  1 
ATOM   3645 O OE1 . GLN C 1 43  ? -2.357  3.975   61.595  1.00 19.04  ? 43  GLN A OE1 1 
ATOM   3646 N NE2 . GLN C 1 43  ? -2.594  1.911   62.437  1.00 19.59  ? 43  GLN A NE2 1 
ATOM   3647 N N   . LYS C 1 44  ? 3.109   2.128   62.556  1.00 36.90  ? 44  LYS A N   1 
ATOM   3648 C CA  . LYS C 1 44  ? 3.854   2.464   63.756  1.00 43.36  ? 44  LYS A CA  1 
ATOM   3649 C C   . LYS C 1 44  ? 3.201   3.692   64.350  1.00 43.69  ? 44  LYS A C   1 
ATOM   3650 O O   . LYS C 1 44  ? 2.607   4.499   63.634  1.00 43.89  ? 44  LYS A O   1 
ATOM   3651 C CB  . LYS C 1 44  ? 5.331   2.728   63.436  1.00 43.25  ? 44  LYS A CB  1 
ATOM   3652 C CG  . LYS C 1 44  ? 6.010   1.535   62.782  1.00 46.21  ? 44  LYS A CG  1 
ATOM   3653 C CD  . LYS C 1 44  ? 7.515   1.615   62.897  1.00 52.18  ? 44  LYS A CD  1 
ATOM   3654 C CE  . LYS C 1 44  ? 8.154   1.881   61.546  1.00 59.13  ? 44  LYS A CE  1 
ATOM   3655 N NZ  . LYS C 1 44  ? 9.627   2.101   61.663  1.00 62.13  ? 44  LYS A NZ  1 
ATOM   3656 N N   . PRO C 1 45  ? 3.272   3.835   65.675  1.00 47.07  ? 45  PRO A N   1 
ATOM   3657 C CA  . PRO C 1 45  ? 2.676   4.985   66.350  1.00 49.02  ? 45  PRO A CA  1 
ATOM   3658 C C   . PRO C 1 45  ? 2.900   6.299   65.617  1.00 49.03  ? 45  PRO A C   1 
ATOM   3659 O O   . PRO C 1 45  ? 4.025   6.625   65.224  1.00 49.72  ? 45  PRO A O   1 
ATOM   3660 C CB  . PRO C 1 45  ? 3.325   4.973   67.737  1.00 52.58  ? 45  PRO A CB  1 
ATOM   3661 C CG  . PRO C 1 45  ? 4.303   3.808   67.735  1.00 49.16  ? 45  PRO A CG  1 
ATOM   3662 C CD  . PRO C 1 45  ? 3.899   2.907   66.630  1.00 49.21  ? 45  PRO A CD  1 
ATOM   3663 N N   . GLY C 1 46  ? 1.808   7.035   65.424  1.00 49.05  ? 46  GLY A N   1 
ATOM   3664 C CA  . GLY C 1 46  ? 1.864   8.327   64.763  1.00 45.91  ? 46  GLY A CA  1 
ATOM   3665 C C   . GLY C 1 46  ? 2.032   8.292   63.259  1.00 45.51  ? 46  GLY A C   1 
ATOM   3666 O O   . GLY C 1 46  ? 1.899   9.322   62.605  1.00 48.19  ? 46  GLY A O   1 
ATOM   3667 N N   . GLN C 1 47  ? 2.325   7.116   62.709  1.00 46.52  ? 47  GLN A N   1 
ATOM   3668 C CA  . GLN C 1 47  ? 2.524   6.964   61.269  1.00 41.54  ? 47  GLN A CA  1 
ATOM   3669 C C   . GLN C 1 47  ? 1.304   6.360   60.563  1.00 40.47  ? 47  GLN A C   1 
ATOM   3670 O O   . GLN C 1 47  ? 0.389   5.807   61.201  1.00 35.28  ? 47  GLN A O   1 
ATOM   3671 C CB  . GLN C 1 47  ? 3.750   6.075   60.997  1.00 43.89  ? 47  GLN A CB  1 
ATOM   3672 C CG  . GLN C 1 47  ? 5.059   6.831   60.727  1.00 40.43  ? 47  GLN A CG  1 
ATOM   3673 C CD  . GLN C 1 47  ? 6.298   5.985   61.004  1.00 40.72  ? 47  GLN A CD  1 
ATOM   3674 O OE1 . GLN C 1 47  ? 7.109   6.314   61.868  1.00 39.14  ? 47  GLN A OE1 1 
ATOM   3675 N NE2 . GLN C 1 47  ? 6.442   4.887   60.271  1.00 40.18  ? 47  GLN A NE2 1 
ATOM   3676 N N   . SER C 1 48  ? 1.290   6.480   59.238  1.00 36.97  ? 48  SER A N   1 
ATOM   3677 C CA  . SER C 1 48  ? 0.213   5.908   58.454  1.00 33.45  ? 48  SER A CA  1 
ATOM   3678 C C   . SER C 1 48  ? 0.646   4.480   58.209  1.00 32.18  ? 48  SER A C   1 
ATOM   3679 O O   . SER C 1 48  ? 1.842   4.174   58.280  1.00 32.53  ? 48  SER A O   1 
ATOM   3680 C CB  . SER C 1 48  ? 0.056   6.649   57.128  1.00 37.64  ? 48  SER A CB  1 
ATOM   3681 O OG  . SER C 1 48  ? 0.975   6.171   56.161  1.00 43.65  ? 48  SER A OG  1 
ATOM   3682 N N   . PRO C 1 49  ? -0.316  3.578   57.949  1.00 29.30  ? 49  PRO A N   1 
ATOM   3683 C CA  . PRO C 1 49  ? -0.011  2.167   57.690  1.00 28.34  ? 49  PRO A CA  1 
ATOM   3684 C C   . PRO C 1 49  ? 0.893   2.047   56.469  1.00 24.27  ? 49  PRO A C   1 
ATOM   3685 O O   . PRO C 1 49  ? 0.864   2.901   55.610  1.00 23.73  ? 49  PRO A O   1 
ATOM   3686 C CB  . PRO C 1 49  ? -1.387  1.535   57.459  1.00 25.49  ? 49  PRO A CB  1 
ATOM   3687 C CG  . PRO C 1 49  ? -2.362  2.500   58.106  1.00 26.98  ? 49  PRO A CG  1 
ATOM   3688 C CD  . PRO C 1 49  ? -1.765  3.848   57.906  1.00 31.53  ? 49  PRO A CD  1 
ATOM   3689 N N   . LYS C 1 50  ? 1.700   0.990   56.417  1.00 28.31  ? 50  LYS A N   1 
ATOM   3690 C CA  . LYS C 1 50  ? 2.626   0.780   55.301  1.00 29.14  ? 50  LYS A CA  1 
ATOM   3691 C C   . LYS C 1 50  ? 2.464   -0.605  54.722  1.00 23.04  ? 50  LYS A C   1 
ATOM   3692 O O   . LYS C 1 50  ? 2.464   -1.586  55.456  1.00 24.81  ? 50  LYS A O   1 
ATOM   3693 C CB  . LYS C 1 50  ? 4.072   0.960   55.772  1.00 36.49  ? 50  LYS A CB  1 
ATOM   3694 C CG  . LYS C 1 50  ? 4.641   2.335   55.497  1.00 49.75  ? 50  LYS A CG  1 
ATOM   3695 C CD  . LYS C 1 50  ? 4.468   3.270   56.682  1.00 52.46  ? 50  LYS A CD  1 
ATOM   3696 C CE  . LYS C 1 50  ? 5.166   4.592   56.418  1.00 50.37  ? 50  LYS A CE  1 
ATOM   3697 N NZ  . LYS C 1 50  ? 4.297   5.760   56.715  1.00 60.02  ? 50  LYS A NZ  1 
ATOM   3698 N N   . LEU C 1 51  ? 2.326   -0.686  53.402  1.00 20.61  ? 51  LEU A N   1 
ATOM   3699 C CA  . LEU C 1 51  ? 2.161   -1.980  52.736  1.00 23.29  ? 51  LEU A CA  1 
ATOM   3700 C C   . LEU C 1 51  ? 3.435   -2.829  52.817  1.00 28.46  ? 51  LEU A C   1 
ATOM   3701 O O   . LEU C 1 51  ? 4.528   -2.373  52.465  1.00 31.91  ? 51  LEU A O   1 
ATOM   3702 C CB  . LEU C 1 51  ? 1.759   -1.774  51.265  1.00 19.87  ? 51  LEU A CB  1 
ATOM   3703 C CG  . LEU C 1 51  ? 1.506   -3.011  50.400  1.00 21.04  ? 51  LEU A CG  1 
ATOM   3704 C CD1 . LEU C 1 51  ? 0.554   -3.979  51.087  1.00 23.46  ? 51  LEU A CD1 1 
ATOM   3705 C CD2 . LEU C 1 51  ? 0.926   -2.564  49.068  1.00 26.45  ? 51  LEU A CD2 1 
ATOM   3706 N N   . LEU C 1 52  ? 3.282   -4.074  53.251  1.00 24.95  ? 52  LEU A N   1 
ATOM   3707 C CA  . LEU C 1 52  ? 4.408   -4.972  53.413  1.00 27.36  ? 52  LEU A CA  1 
ATOM   3708 C C   . LEU C 1 52  ? 4.365   -6.116  52.431  1.00 29.58  ? 52  LEU A C   1 
ATOM   3709 O O   . LEU C 1 52  ? 5.300   -6.329  51.660  1.00 35.01  ? 52  LEU A O   1 
ATOM   3710 C CB  . LEU C 1 52  ? 4.420   -5.554  54.834  1.00 25.40  ? 52  LEU A CB  1 
ATOM   3711 C CG  . LEU C 1 52  ? 4.786   -4.648  56.009  1.00 25.95  ? 52  LEU A CG  1 
ATOM   3712 C CD1 . LEU C 1 52  ? 5.115   -5.509  57.224  1.00 26.31  ? 52  LEU A CD1 1 
ATOM   3713 C CD2 . LEU C 1 52  ? 5.963   -3.784  55.653  1.00 32.92  ? 52  LEU A CD2 1 
ATOM   3714 N N   . ILE C 1 53  ? 3.261   -6.846  52.476  1.00 32.10  ? 53  ILE A N   1 
ATOM   3715 C CA  . ILE C 1 53  ? 3.033   -8.008  51.642  1.00 29.61  ? 53  ILE A CA  1 
ATOM   3716 C C   . ILE C 1 53  ? 1.692   -7.870  50.910  1.00 33.78  ? 53  ILE A C   1 
ATOM   3717 O O   . ILE C 1 53  ? 0.718   -7.342  51.462  1.00 32.56  ? 53  ILE A O   1 
ATOM   3718 C CB  . ILE C 1 53  ? 3.016   -9.277  52.528  1.00 24.85  ? 53  ILE A CB  1 
ATOM   3719 C CG1 . ILE C 1 53  ? 4.363   -9.412  53.247  1.00 30.17  ? 53  ILE A CG1 1 
ATOM   3720 C CG2 . ILE C 1 53  ? 2.634   -10.505 51.708  1.00 23.68  ? 53  ILE A CG2 1 
ATOM   3721 C CD1 . ILE C 1 53  ? 5.268   -10.539 52.733  1.00 19.27  ? 53  ILE A CD1 1 
ATOM   3722 N N   . TYR C 1 54  ? 1.656   -8.322  49.661  1.00 35.14  ? 54  TYR A N   1 
ATOM   3723 C CA  . TYR C 1 54  ? 0.436   -8.282  48.867  1.00 37.46  ? 54  TYR A CA  1 
ATOM   3724 C C   . TYR C 1 54  ? 0.215   -9.632  48.198  1.00 40.46  ? 54  TYR A C   1 
ATOM   3725 O O   . TYR C 1 54  ? 1.167   -10.364 47.920  1.00 45.00  ? 54  TYR A O   1 
ATOM   3726 C CB  . TYR C 1 54  ? 0.492   -7.155  47.833  1.00 38.40  ? 54  TYR A CB  1 
ATOM   3727 C CG  . TYR C 1 54  ? 1.531   -7.299  46.739  1.00 38.24  ? 54  TYR A CG  1 
ATOM   3728 C CD1 . TYR C 1 54  ? 1.307   -8.142  45.649  1.00 38.38  ? 54  TYR A CD1 1 
ATOM   3729 C CD2 . TYR C 1 54  ? 2.719   -6.560  46.774  1.00 38.85  ? 54  TYR A CD2 1 
ATOM   3730 C CE1 . TYR C 1 54  ? 2.229   -8.252  44.616  1.00 40.31  ? 54  TYR A CE1 1 
ATOM   3731 C CE2 . TYR C 1 54  ? 3.664   -6.662  45.736  1.00 40.63  ? 54  TYR A CE2 1 
ATOM   3732 C CZ  . TYR C 1 54  ? 3.406   -7.513  44.661  1.00 45.76  ? 54  TYR A CZ  1 
ATOM   3733 O OH  . TYR C 1 54  ? 4.307   -7.627  43.621  1.00 47.46  ? 54  TYR A OH  1 
ATOM   3734 N N   . LYS C 1 55  ? -1.046  -9.961  47.953  1.00 38.54  ? 55  LYS A N   1 
ATOM   3735 C CA  . LYS C 1 55  ? -1.407  -11.234 47.356  1.00 36.40  ? 55  LYS A CA  1 
ATOM   3736 C C   . LYS C 1 55  ? -0.733  -12.380 48.093  1.00 35.84  ? 55  LYS A C   1 
ATOM   3737 O O   . LYS C 1 55  ? -0.032  -13.197 47.507  1.00 36.77  ? 55  LYS A O   1 
ATOM   3738 C CB  . LYS C 1 55  ? -1.040  -11.255 45.877  1.00 36.24  ? 55  LYS A CB  1 
ATOM   3739 C CG  . LYS C 1 55  ? -1.553  -10.032 45.121  1.00 45.33  ? 55  LYS A CG  1 
ATOM   3740 C CD  . LYS C 1 55  ? -2.513  -10.399 44.003  1.00 40.39  ? 55  LYS A CD  1 
ATOM   3741 C CE  . LYS C 1 55  ? -1.758  -10.795 42.749  1.00 48.79  ? 55  LYS A CE  1 
ATOM   3742 N NZ  . LYS C 1 55  ? -1.910  -9.810  41.638  1.00 52.12  ? 55  LYS A NZ  1 
ATOM   3743 N N   . VAL C 1 56  ? -0.940  -12.415 49.402  1.00 32.85  ? 56  VAL A N   1 
ATOM   3744 C CA  . VAL C 1 56  ? -0.411  -13.471 50.247  1.00 30.65  ? 56  VAL A CA  1 
ATOM   3745 C C   . VAL C 1 56  ? 1.100   -13.562 50.533  1.00 31.90  ? 56  VAL A C   1 
ATOM   3746 O O   . VAL C 1 56  ? 1.506   -13.602 51.694  1.00 24.64  ? 56  VAL A O   1 
ATOM   3747 C CB  . VAL C 1 56  ? -0.857  -14.835 49.700  1.00 32.40  ? 56  VAL A CB  1 
ATOM   3748 C CG1 . VAL C 1 56  ? -0.608  -15.920 50.739  1.00 22.40  ? 56  VAL A CG1 1 
ATOM   3749 C CG2 . VAL C 1 56  ? -2.343  -14.774 49.310  1.00 25.98  ? 56  VAL A CG2 1 
ATOM   3750 N N   . SER C 1 57  ? 1.919   -13.587 49.484  1.00 34.70  ? 57  SER A N   1 
ATOM   3751 C CA  . SER C 1 57  ? 3.361   -13.774 49.646  1.00 32.44  ? 57  SER A CA  1 
ATOM   3752 C C   . SER C 1 57  ? 4.293   -12.835 48.898  1.00 33.08  ? 57  SER A C   1 
ATOM   3753 O O   . SER C 1 57  ? 5.504   -13.049 48.902  1.00 34.12  ? 57  SER A O   1 
ATOM   3754 C CB  . SER C 1 57  ? 3.707   -15.190 49.219  1.00 33.83  ? 57  SER A CB  1 
ATOM   3755 O OG  . SER C 1 57  ? 3.094   -15.461 47.962  1.00 39.52  ? 57  SER A OG  1 
ATOM   3756 N N   . ASN C 1 58  ? 3.749   -11.816 48.254  1.00 28.85  ? 58  ASN A N   1 
ATOM   3757 C CA  . ASN C 1 58  ? 4.562   -10.896 47.491  1.00 29.41  ? 58  ASN A CA  1 
ATOM   3758 C C   . ASN C 1 58  ? 5.008   -9.717  48.321  1.00 31.66  ? 58  ASN A C   1 
ATOM   3759 O O   . ASN C 1 58  ? 4.193   -8.991  48.868  1.00 27.02  ? 58  ASN A O   1 
ATOM   3760 C CB  . ASN C 1 58  ? 3.787   -10.390 46.285  1.00 32.20  ? 58  ASN A CB  1 
ATOM   3761 C CG  . ASN C 1 58  ? 3.468   -11.483 45.305  1.00 34.52  ? 58  ASN A CG  1 
ATOM   3762 O OD1 . ASN C 1 58  ? 4.186   -11.676 44.327  1.00 43.89  ? 58  ASN A OD1 1 
ATOM   3763 N ND2 . ASN C 1 58  ? 2.388   -12.205 45.552  1.00 34.95  ? 58  ASN A ND2 1 
ATOM   3764 N N   . ARG C 1 59  ? 6.312   -9.507  48.399  1.00 31.51  ? 59  ARG A N   1 
ATOM   3765 C CA  . ARG C 1 59  ? 6.810   -8.398  49.181  1.00 33.81  ? 59  ARG A CA  1 
ATOM   3766 C C   . ARG C 1 59  ? 6.813   -7.128  48.355  1.00 37.27  ? 59  ARG A C   1 
ATOM   3767 O O   . ARG C 1 59  ? 7.302   -7.099  47.224  1.00 39.08  ? 59  ARG A O   1 
ATOM   3768 C CB  . ARG C 1 59  ? 8.209   -8.708  49.721  1.00 30.10  ? 59  ARG A CB  1 
ATOM   3769 C CG  . ARG C 1 59  ? 8.163   -9.458  51.042  1.00 28.87  ? 59  ARG A CG  1 
ATOM   3770 C CD  . ARG C 1 59  ? 9.497   -9.404  51.773  1.00 37.22  ? 59  ARG A CD  1 
ATOM   3771 N NE  . ARG C 1 59  ? 10.603  -9.271  50.848  1.00 28.16  ? 59  ARG A NE  1 
ATOM   3772 C CZ  . ARG C 1 59  ? 11.212  -10.295 50.273  1.00 37.83  ? 59  ARG A CZ  1 
ATOM   3773 N NH1 . ARG C 1 59  ? 10.803  -11.525 50.546  1.00 35.10  ? 59  ARG A NH1 1 
ATOM   3774 N NH2 . ARG C 1 59  ? 12.210  -10.085 49.413  1.00 35.97  ? 59  ARG A NH2 1 
ATOM   3775 N N   . PHE C 1 60  ? 6.241   -6.080  48.933  1.00 35.05  ? 60  PHE A N   1 
ATOM   3776 C CA  . PHE C 1 60  ? 6.163   -4.791  48.283  1.00 34.90  ? 60  PHE A CA  1 
ATOM   3777 C C   . PHE C 1 60  ? 7.575   -4.222  48.151  1.00 38.32  ? 60  PHE A C   1 
ATOM   3778 O O   . PHE C 1 60  ? 8.460   -4.562  48.928  1.00 40.02  ? 60  PHE A O   1 
ATOM   3779 C CB  . PHE C 1 60  ? 5.276   -3.856  49.104  1.00 30.96  ? 60  PHE A CB  1 
ATOM   3780 C CG  . PHE C 1 60  ? 4.821   -2.650  48.353  1.00 26.61  ? 60  PHE A CG  1 
ATOM   3781 C CD1 . PHE C 1 60  ? 4.198   -2.775  47.118  1.00 30.05  ? 60  PHE A CD1 1 
ATOM   3782 C CD2 . PHE C 1 60  ? 5.046   -1.379  48.861  1.00 32.07  ? 60  PHE A CD2 1 
ATOM   3783 C CE1 . PHE C 1 60  ? 3.811   -1.654  46.401  1.00 33.07  ? 60  PHE A CE1 1 
ATOM   3784 C CE2 . PHE C 1 60  ? 4.659   -0.247  48.146  1.00 34.28  ? 60  PHE A CE2 1 
ATOM   3785 C CZ  . PHE C 1 60  ? 4.043   -0.388  46.916  1.00 32.82  ? 60  PHE A CZ  1 
ATOM   3786 N N   . SER C 1 61  ? 7.772   -3.358  47.166  1.00 38.06  ? 61  SER A N   1 
ATOM   3787 C CA  . SER C 1 61  ? 9.073   -2.765  46.906  1.00 42.65  ? 61  SER A CA  1 
ATOM   3788 C C   . SER C 1 61  ? 9.693   -2.101  48.126  1.00 41.80  ? 61  SER A C   1 
ATOM   3789 O O   . SER C 1 61  ? 9.058   -1.280  48.779  1.00 43.43  ? 61  SER A O   1 
ATOM   3790 C CB  . SER C 1 61  ? 8.957   -1.739  45.776  1.00 47.37  ? 61  SER A CB  1 
ATOM   3791 O OG  . SER C 1 61  ? 7.633   -1.239  45.674  1.00 58.17  ? 61  SER A OG  1 
ATOM   3792 N N   . GLY C 1 62  ? 10.942  -2.464  48.419  1.00 40.70  ? 62  GLY A N   1 
ATOM   3793 C CA  . GLY C 1 62  ? 11.653  -1.883  49.548  1.00 35.75  ? 62  GLY A CA  1 
ATOM   3794 C C   . GLY C 1 62  ? 11.507  -2.656  50.840  1.00 31.09  ? 62  GLY A C   1 
ATOM   3795 O O   . GLY C 1 62  ? 12.182  -2.367  51.825  1.00 30.64  ? 62  GLY A O   1 
ATOM   3796 N N   . VAL C 1 63  ? 10.639  -3.659  50.840  1.00 30.65  ? 63  VAL A N   1 
ATOM   3797 C CA  . VAL C 1 63  ? 10.411  -4.447  52.039  1.00 26.94  ? 63  VAL A CA  1 
ATOM   3798 C C   . VAL C 1 63  ? 11.471  -5.535  52.310  1.00 27.98  ? 63  VAL A C   1 
ATOM   3799 O O   . VAL C 1 63  ? 11.690  -6.424  51.478  1.00 24.95  ? 63  VAL A O   1 
ATOM   3800 C CB  . VAL C 1 63  ? 9.031   -5.113  51.973  1.00 25.11  ? 63  VAL A CB  1 
ATOM   3801 C CG1 . VAL C 1 63  ? 8.830   -5.990  53.203  1.00 15.23  ? 63  VAL A CG1 1 
ATOM   3802 C CG2 . VAL C 1 63  ? 7.918   -4.029  51.859  1.00 25.68  ? 63  VAL A CG2 1 
ATOM   3803 N N   . PRO C 1 64  ? 12.113  -5.493  53.498  1.00 30.17  ? 64  PRO A N   1 
ATOM   3804 C CA  . PRO C 1 64  ? 13.145  -6.465  53.894  1.00 28.26  ? 64  PRO A CA  1 
ATOM   3805 C C   . PRO C 1 64  ? 12.690  -7.913  53.731  1.00 31.06  ? 64  PRO A C   1 
ATOM   3806 O O   . PRO C 1 64  ? 11.567  -8.258  54.088  1.00 34.07  ? 64  PRO A O   1 
ATOM   3807 C CB  . PRO C 1 64  ? 13.412  -6.122  55.355  1.00 25.35  ? 64  PRO A CB  1 
ATOM   3808 C CG  . PRO C 1 64  ? 13.057  -4.710  55.469  1.00 26.05  ? 64  PRO A CG  1 
ATOM   3809 C CD  . PRO C 1 64  ? 11.901  -4.482  54.550  1.00 26.05  ? 64  PRO A CD  1 
ATOM   3810 N N   . ASP C 1 65  ? 13.577  -8.771  53.234  1.00 29.37  ? 65  ASP A N   1 
ATOM   3811 C CA  . ASP C 1 65  ? 13.221  -10.166 53.017  1.00 25.97  ? 65  ASP A CA  1 
ATOM   3812 C C   . ASP C 1 65  ? 13.011  -10.988 54.279  1.00 19.68  ? 65  ASP A C   1 
ATOM   3813 O O   . ASP C 1 65  ? 12.715  -12.179 54.206  1.00 23.83  ? 65  ASP A O   1 
ATOM   3814 C CB  . ASP C 1 65  ? 14.261  -10.851 52.107  1.00 30.27  ? 65  ASP A CB  1 
ATOM   3815 C CG  . ASP C 1 65  ? 15.638  -10.920 52.737  1.00 28.75  ? 65  ASP A CG  1 
ATOM   3816 O OD1 . ASP C 1 65  ? 15.883  -10.191 53.715  1.00 33.65  ? 65  ASP A OD1 1 
ATOM   3817 O OD2 . ASP C 1 65  ? 16.472  -11.699 52.247  1.00 29.21  ? 65  ASP A OD2 1 
ATOM   3818 N N   . ARG C 1 66  ? 13.161  -10.380 55.446  1.00 22.29  ? 66  ARG A N   1 
ATOM   3819 C CA  . ARG C 1 66  ? 12.939  -11.130 56.681  1.00 21.59  ? 66  ARG A CA  1 
ATOM   3820 C C   . ARG C 1 66  ? 11.414  -11.294 56.851  1.00 26.88  ? 66  ARG A C   1 
ATOM   3821 O O   . ARG C 1 66  ? 10.927  -12.115 57.639  1.00 24.51  ? 66  ARG A O   1 
ATOM   3822 C CB  . ARG C 1 66  ? 13.566  -10.381 57.861  1.00 22.40  ? 66  ARG A CB  1 
ATOM   3823 C CG  . ARG C 1 66  ? 12.731  -9.272  58.464  1.00 30.99  ? 66  ARG A CG  1 
ATOM   3824 C CD  . ARG C 1 66  ? 13.539  -8.465  59.465  1.00 33.99  ? 66  ARG A CD  1 
ATOM   3825 N NE  . ARG C 1 66  ? 14.289  -7.419  58.778  1.00 44.29  ? 66  ARG A NE  1 
ATOM   3826 C CZ  . ARG C 1 66  ? 14.114  -6.120  58.979  1.00 44.22  ? 66  ARG A CZ  1 
ATOM   3827 N NH1 . ARG C 1 66  ? 13.216  -5.705  59.851  1.00 40.64  ? 66  ARG A NH1 1 
ATOM   3828 N NH2 . ARG C 1 66  ? 14.830  -5.239  58.293  1.00 49.02  ? 66  ARG A NH2 1 
ATOM   3829 N N   . PHE C 1 67  ? 10.671  -10.516 56.067  1.00 26.39  ? 67  PHE A N   1 
ATOM   3830 C CA  . PHE C 1 67  ? 9.210   -10.552 56.081  1.00 26.10  ? 67  PHE A CA  1 
ATOM   3831 C C   . PHE C 1 67  ? 8.709   -11.534 55.052  1.00 26.95  ? 67  PHE A C   1 
ATOM   3832 O O   . PHE C 1 67  ? 9.085   -11.459 53.881  1.00 28.74  ? 67  PHE A O   1 
ATOM   3833 C CB  . PHE C 1 67  ? 8.640   -9.184  55.749  1.00 21.05  ? 67  PHE A CB  1 
ATOM   3834 C CG  . PHE C 1 67  ? 8.778   -8.179  56.856  1.00 25.16  ? 67  PHE A CG  1 
ATOM   3835 C CD1 . PHE C 1 67  ? 8.051   -8.317  58.033  1.00 23.46  ? 67  PHE A CD1 1 
ATOM   3836 C CD2 . PHE C 1 67  ? 9.592   -7.063  56.697  1.00 27.73  ? 67  PHE A CD2 1 
ATOM   3837 C CE1 . PHE C 1 67  ? 8.126   -7.355  59.035  1.00 27.21  ? 67  PHE A CE1 1 
ATOM   3838 C CE2 . PHE C 1 67  ? 9.676   -6.090  57.701  1.00 24.50  ? 67  PHE A CE2 1 
ATOM   3839 C CZ  . PHE C 1 67  ? 8.940   -6.236  58.867  1.00 28.07  ? 67  PHE A CZ  1 
ATOM   3840 N N   . SER C 1 68  ? 7.866   -12.464 55.475  1.00 25.70  ? 68  SER A N   1 
ATOM   3841 C CA  . SER C 1 68  ? 7.319   -13.424 54.533  1.00 31.24  ? 68  SER A CA  1 
ATOM   3842 C C   . SER C 1 68  ? 5.867   -13.769 54.847  1.00 32.86  ? 68  SER A C   1 
ATOM   3843 O O   . SER C 1 68  ? 5.439   -13.716 55.999  1.00 31.71  ? 68  SER A O   1 
ATOM   3844 C CB  . SER C 1 68  ? 8.183   -14.690 54.481  1.00 30.47  ? 68  SER A CB  1 
ATOM   3845 O OG  . SER C 1 68  ? 8.293   -15.320 55.734  1.00 34.39  ? 68  SER A OG  1 
ATOM   3846 N N   . GLY C 1 69  ? 5.101   -14.089 53.808  1.00 37.71  ? 69  GLY A N   1 
ATOM   3847 C CA  . GLY C 1 69  ? 3.708   -14.429 54.017  1.00 37.66  ? 69  GLY A CA  1 
ATOM   3848 C C   . GLY C 1 69  ? 3.288   -15.714 53.334  1.00 41.03  ? 69  GLY A C   1 
ATOM   3849 O O   . GLY C 1 69  ? 3.811   -16.069 52.269  1.00 41.17  ? 69  GLY A O   1 
ATOM   3850 N N   . SER C 1 70  ? 2.352   -16.422 53.962  1.00 40.13  ? 70  SER A N   1 
ATOM   3851 C CA  . SER C 1 70  ? 1.812   -17.659 53.416  1.00 42.06  ? 70  SER A CA  1 
ATOM   3852 C C   . SER C 1 70  ? 0.316   -17.739 53.763  1.00 45.32  ? 70  SER A C   1 
ATOM   3853 O O   . SER C 1 70  ? -0.166  -17.006 54.626  1.00 45.27  ? 70  SER A O   1 
ATOM   3854 C CB  . SER C 1 70  ? 2.577   -18.878 53.965  1.00 41.54  ? 70  SER A CB  1 
ATOM   3855 O OG  . SER C 1 70  ? 2.764   -18.820 55.369  1.00 38.87  ? 70  SER A OG  1 
ATOM   3856 N N   . GLY C 1 71  ? -0.420  -18.610 53.077  1.00 48.29  ? 71  GLY A N   1 
ATOM   3857 C CA  . GLY C 1 71  ? -1.847  -18.741 53.339  1.00 50.94  ? 71  GLY A CA  1 
ATOM   3858 C C   . GLY C 1 71  ? -2.589  -19.302 52.139  1.00 51.04  ? 71  GLY A C   1 
ATOM   3859 O O   . GLY C 1 71  ? -2.153  -19.117 51.005  1.00 53.65  ? 71  GLY A O   1 
ATOM   3860 N N   . SER C 1 72  ? -3.717  -19.963 52.380  1.00 52.73  ? 72  SER A N   1 
ATOM   3861 C CA  . SER C 1 72  ? -4.495  -20.580 51.301  1.00 52.72  ? 72  SER A CA  1 
ATOM   3862 C C   . SER C 1 72  ? -5.732  -19.821 50.812  1.00 51.19  ? 72  SER A C   1 
ATOM   3863 O O   . SER C 1 72  ? -5.749  -19.285 49.696  1.00 52.02  ? 72  SER A O   1 
ATOM   3864 C CB  . SER C 1 72  ? -4.921  -21.986 51.720  1.00 51.99  ? 72  SER A CB  1 
ATOM   3865 O OG  . SER C 1 72  ? -3.983  -22.948 51.278  1.00 56.49  ? 72  SER A OG  1 
ATOM   3866 N N   . GLY C 1 73  ? -6.773  -19.804 51.637  1.00 48.07  ? 73  GLY A N   1 
ATOM   3867 C CA  . GLY C 1 73  ? -8.005  -19.129 51.259  1.00 45.81  ? 73  GLY A CA  1 
ATOM   3868 C C   . GLY C 1 73  ? -8.718  -18.512 52.445  1.00 44.40  ? 73  GLY A C   1 
ATOM   3869 O O   . GLY C 1 73  ? -9.157  -17.372 52.384  1.00 46.10  ? 73  GLY A O   1 
ATOM   3870 N N   . THR C 1 74  ? -8.822  -19.260 53.535  1.00 46.98  ? 74  THR A N   1 
ATOM   3871 C CA  . THR C 1 74  ? -9.482  -18.758 54.733  1.00 51.15  ? 74  THR A CA  1 
ATOM   3872 C C   . THR C 1 74  ? -8.473  -18.342 55.809  1.00 52.46  ? 74  THR A C   1 
ATOM   3873 O O   . THR C 1 74  ? -8.748  -17.450 56.621  1.00 50.85  ? 74  THR A O   1 
ATOM   3874 C CB  . THR C 1 74  ? -10.419 -19.818 55.328  1.00 53.25  ? 74  THR A CB  1 
ATOM   3875 O OG1 . THR C 1 74  ? -10.976 -19.325 56.552  1.00 57.91  ? 74  THR A OG1 1 
ATOM   3876 C CG2 . THR C 1 74  ? -9.651  -21.113 55.603  1.00 56.55  ? 74  THR A CG2 1 
ATOM   3877 N N   . ASP C 1 75  ? -7.309  -18.989 55.812  1.00 53.50  ? 75  ASP A N   1 
ATOM   3878 C CA  . ASP C 1 75  ? -6.267  -18.684 56.784  1.00 53.98  ? 75  ASP A CA  1 
ATOM   3879 C C   . ASP C 1 75  ? -4.974  -18.203 56.125  1.00 52.15  ? 75  ASP A C   1 
ATOM   3880 O O   . ASP C 1 75  ? -4.608  -18.656 55.042  1.00 50.41  ? 75  ASP A O   1 
ATOM   3881 C CB  . ASP C 1 75  ? -5.990  -19.912 57.654  1.00 60.19  ? 75  ASP A CB  1 
ATOM   3882 C CG  . ASP C 1 75  ? -7.005  -20.068 58.777  1.00 68.13  ? 75  ASP A CG  1 
ATOM   3883 O OD1 . ASP C 1 75  ? -8.048  -20.725 58.552  1.00 72.36  ? 75  ASP A OD1 1 
ATOM   3884 O OD2 . ASP C 1 75  ? -6.764  -19.532 59.883  1.00 68.44  ? 75  ASP A OD2 1 
ATOM   3885 N N   . PHE C 1 76  ? -4.295  -17.269 56.785  1.00 48.40  ? 76  PHE A N   1 
ATOM   3886 C CA  . PHE C 1 76  ? -3.043  -16.707 56.280  1.00 44.69  ? 76  PHE A CA  1 
ATOM   3887 C C   . PHE C 1 76  ? -2.098  -16.365 57.424  1.00 43.48  ? 76  PHE A C   1 
ATOM   3888 O O   . PHE C 1 76  ? -2.530  -16.088 58.546  1.00 41.82  ? 76  PHE A O   1 
ATOM   3889 C CB  . PHE C 1 76  ? -3.320  -15.457 55.450  1.00 41.34  ? 76  PHE A CB  1 
ATOM   3890 C CG  . PHE C 1 76  ? -4.299  -15.681 54.341  1.00 37.40  ? 76  PHE A CG  1 
ATOM   3891 C CD1 . PHE C 1 76  ? -5.663  -15.576 54.577  1.00 35.60  ? 76  PHE A CD1 1 
ATOM   3892 C CD2 . PHE C 1 76  ? -3.862  -16.020 53.073  1.00 34.82  ? 76  PHE A CD2 1 
ATOM   3893 C CE1 . PHE C 1 76  ? -6.576  -15.810 53.562  1.00 35.49  ? 76  PHE A CE1 1 
ATOM   3894 C CE2 . PHE C 1 76  ? -4.763  -16.258 52.042  1.00 36.68  ? 76  PHE A CE2 1 
ATOM   3895 C CZ  . PHE C 1 76  ? -6.128  -16.154 52.287  1.00 37.72  ? 76  PHE A CZ  1 
ATOM   3896 N N   . THR C 1 77  ? -0.801  -16.381 57.136  1.00 40.35  ? 77  THR A N   1 
ATOM   3897 C CA  . THR C 1 77  ? 0.197   -16.096 58.160  1.00 37.00  ? 77  THR A CA  1 
ATOM   3898 C C   . THR C 1 77  ? 1.335   -15.198 57.682  1.00 35.98  ? 77  THR A C   1 
ATOM   3899 O O   . THR C 1 77  ? 1.841   -15.335 56.560  1.00 29.76  ? 77  THR A O   1 
ATOM   3900 C CB  . THR C 1 77  ? 0.811   -17.414 58.709  1.00 37.17  ? 77  THR A CB  1 
ATOM   3901 O OG1 . THR C 1 77  ? -0.086  -18.005 59.656  1.00 39.75  ? 77  THR A OG1 1 
ATOM   3902 C CG2 . THR C 1 77  ? 2.144   -17.150 59.394  1.00 34.04  ? 77  THR A CG2 1 
ATOM   3903 N N   . LEU C 1 78  ? 1.726   -14.269 58.545  1.00 31.60  ? 78  LEU A N   1 
ATOM   3904 C CA  . LEU C 1 78  ? 2.828   -13.389 58.241  1.00 27.99  ? 78  LEU A CA  1 
ATOM   3905 C C   . LEU C 1 78  ? 3.896   -13.803 59.234  1.00 32.30  ? 78  LEU A C   1 
ATOM   3906 O O   . LEU C 1 78  ? 3.603   -14.050 60.413  1.00 25.90  ? 78  LEU A O   1 
ATOM   3907 C CB  . LEU C 1 78  ? 2.452   -11.932 58.462  1.00 22.57  ? 78  LEU A CB  1 
ATOM   3908 C CG  . LEU C 1 78  ? 3.578   -10.899 58.352  1.00 25.21  ? 78  LEU A CG  1 
ATOM   3909 C CD1 . LEU C 1 78  ? 3.810   -10.473 56.900  1.00 27.42  ? 78  LEU A CD1 1 
ATOM   3910 C CD2 . LEU C 1 78  ? 3.172   -9.687  59.177  1.00 26.04  ? 78  LEU A CD2 1 
ATOM   3911 N N   . LYS C 1 79  ? 5.125   -13.918 58.747  1.00 30.42  ? 79  LYS A N   1 
ATOM   3912 C CA  . LYS C 1 79  ? 6.223   -14.303 59.608  1.00 37.82  ? 79  LYS A CA  1 
ATOM   3913 C C   . LYS C 1 79  ? 7.360   -13.322 59.450  1.00 35.88  ? 79  LYS A C   1 
ATOM   3914 O O   . LYS C 1 79  ? 7.620   -12.815 58.360  1.00 38.74  ? 79  LYS A O   1 
ATOM   3915 C CB  . LYS C 1 79  ? 6.713   -15.707 59.263  1.00 41.47  ? 79  LYS A CB  1 
ATOM   3916 C CG  . LYS C 1 79  ? 5.620   -16.739 59.051  1.00 44.78  ? 79  LYS A CG  1 
ATOM   3917 C CD  . LYS C 1 79  ? 6.186   -18.136 59.231  1.00 44.44  ? 79  LYS A CD  1 
ATOM   3918 C CE  . LYS C 1 79  ? 5.187   -19.208 58.833  1.00 47.95  ? 79  LYS A CE  1 
ATOM   3919 N NZ  . LYS C 1 79  ? 5.642   -20.553 59.289  1.00 46.94  ? 79  LYS A NZ  1 
ATOM   3920 N N   . ILE C 1 80  ? 8.026   -13.036 60.553  1.00 38.99  ? 80  ILE A N   1 
ATOM   3921 C CA  . ILE C 1 80  ? 9.167   -12.142 60.518  1.00 38.71  ? 80  ILE A CA  1 
ATOM   3922 C C   . ILE C 1 80  ? 10.315  -12.910 61.151  1.00 42.33  ? 80  ILE A C   1 
ATOM   3923 O O   . ILE C 1 80  ? 10.294  -13.179 62.357  1.00 42.25  ? 80  ILE A O   1 
ATOM   3924 C CB  . ILE C 1 80  ? 8.940   -10.853 61.346  1.00 37.41  ? 80  ILE A CB  1 
ATOM   3925 C CG1 . ILE C 1 80  ? 7.536   -10.283 61.098  1.00 30.78  ? 80  ILE A CG1 1 
ATOM   3926 C CG2 . ILE C 1 80  ? 10.005  -9.828  60.995  1.00 36.28  ? 80  ILE A CG2 1 
ATOM   3927 C CD1 . ILE C 1 80  ? 7.179   -9.120  62.035  1.00 28.21  ? 80  ILE A CD1 1 
ATOM   3928 N N   . SER C 1 81  ? 11.290  -13.297 60.335  1.00 40.53  ? 81  SER A N   1 
ATOM   3929 C CA  . SER C 1 81  ? 12.468  -13.988 60.843  1.00 44.53  ? 81  SER A CA  1 
ATOM   3930 C C   . SER C 1 81  ? 13.323  -12.886 61.456  1.00 44.86  ? 81  SER A C   1 
ATOM   3931 O O   . SER C 1 81  ? 13.443  -11.802 60.887  1.00 49.84  ? 81  SER A O   1 
ATOM   3932 C CB  . SER C 1 81  ? 13.236  -14.656 59.709  1.00 43.18  ? 81  SER A CB  1 
ATOM   3933 O OG  . SER C 1 81  ? 13.793  -15.879 60.153  1.00 60.09  ? 81  SER A OG  1 
ATOM   3934 N N   . ARG C 1 82  ? 13.908  -13.147 62.613  1.00 42.84  ? 82  ARG A N   1 
ATOM   3935 C CA  . ARG C 1 82  ? 14.725  -12.134 63.271  1.00 42.92  ? 82  ARG A CA  1 
ATOM   3936 C C   . ARG C 1 82  ? 13.998  -10.790 63.316  1.00 39.86  ? 82  ARG A C   1 
ATOM   3937 O O   . ARG C 1 82  ? 14.020  -10.022 62.357  1.00 36.43  ? 82  ARG A O   1 
ATOM   3938 C CB  . ARG C 1 82  ? 16.069  -11.988 62.552  1.00 48.51  ? 82  ARG A CB  1 
ATOM   3939 C CG  . ARG C 1 82  ? 16.909  -13.265 62.550  1.00 54.74  ? 82  ARG A CG  1 
ATOM   3940 C CD  . ARG C 1 82  ? 17.642  -13.447 61.230  1.00 66.03  ? 82  ARG A CD  1 
ATOM   3941 N NE  . ARG C 1 82  ? 17.502  -14.797 60.682  1.00 70.04  ? 82  ARG A NE  1 
ATOM   3942 C CZ  . ARG C 1 82  ? 17.527  -15.083 59.380  1.00 73.14  ? 82  ARG A CZ  1 
ATOM   3943 N NH1 . ARG C 1 82  ? 17.686  -14.112 58.486  1.00 69.26  ? 82  ARG A NH1 1 
ATOM   3944 N NH2 . ARG C 1 82  ? 17.393  -16.341 58.971  1.00 71.16  ? 82  ARG A NH2 1 
ATOM   3945 N N   . VAL C 1 83  ? 13.351  -10.517 64.445  1.00 39.48  ? 83  VAL A N   1 
ATOM   3946 C CA  . VAL C 1 83  ? 12.616  -9.270  64.637  1.00 31.74  ? 83  VAL A CA  1 
ATOM   3947 C C   . VAL C 1 83  ? 13.585  -8.141  64.949  1.00 32.26  ? 83  VAL A C   1 
ATOM   3948 O O   . VAL C 1 83  ? 14.514  -8.314  65.741  1.00 36.03  ? 83  VAL A O   1 
ATOM   3949 C CB  . VAL C 1 83  ? 11.603  -9.390  65.822  1.00 32.50  ? 83  VAL A CB  1 
ATOM   3950 C CG1 . VAL C 1 83  ? 11.064  -8.020  66.197  1.00 31.29  ? 83  VAL A CG1 1 
ATOM   3951 C CG2 . VAL C 1 83  ? 10.447  -10.311 65.439  1.00 27.79  ? 83  VAL A CG2 1 
ATOM   3952 N N   . GLU C 1 84  ? 13.374  -6.985  64.334  1.00 33.31  ? 84  GLU A N   1 
ATOM   3953 C CA  . GLU C 1 84  ? 14.229  -5.825  64.582  1.00 33.91  ? 84  GLU A CA  1 
ATOM   3954 C C   . GLU C 1 84  ? 13.438  -4.737  65.289  1.00 32.70  ? 84  GLU A C   1 
ATOM   3955 O O   . GLU C 1 84  ? 12.209  -4.725  65.244  1.00 33.31  ? 84  GLU A O   1 
ATOM   3956 C CB  . GLU C 1 84  ? 14.765  -5.257  63.274  1.00 41.31  ? 84  GLU A CB  1 
ATOM   3957 C CG  . GLU C 1 84  ? 14.929  -6.292  62.197  1.00 57.21  ? 84  GLU A CG  1 
ATOM   3958 C CD  . GLU C 1 84  ? 16.377  -6.564  61.884  1.00 61.62  ? 84  GLU A CD  1 
ATOM   3959 O OE1 . GLU C 1 84  ? 17.087  -5.603  61.524  1.00 65.60  ? 84  GLU A OE1 1 
ATOM   3960 O OE2 . GLU C 1 84  ? 16.797  -7.737  61.997  1.00 65.82  ? 84  GLU A OE2 1 
ATOM   3961 N N   . ALA C 1 85  ? 14.147  -3.816  65.926  1.00 26.25  ? 85  ALA A N   1 
ATOM   3962 C CA  . ALA C 1 85  ? 13.499  -2.728  66.625  1.00 29.50  ? 85  ALA A CA  1 
ATOM   3963 C C   . ALA C 1 85  ? 12.508  -1.984  65.745  1.00 33.13  ? 85  ALA A C   1 
ATOM   3964 O O   . ALA C 1 85  ? 11.414  -1.621  66.197  1.00 36.08  ? 85  ALA A O   1 
ATOM   3965 C CB  . ALA C 1 85  ? 14.539  -1.757  67.144  1.00 30.60  ? 85  ALA A CB  1 
ATOM   3966 N N   . GLU C 1 86  ? 12.885  -1.761  64.488  1.00 30.44  ? 86  GLU A N   1 
ATOM   3967 C CA  . GLU C 1 86  ? 12.046  -1.012  63.570  1.00 28.57  ? 86  GLU A CA  1 
ATOM   3968 C C   . GLU C 1 86  ? 10.799  -1.767  63.105  1.00 25.05  ? 86  GLU A C   1 
ATOM   3969 O O   . GLU C 1 86  ? 9.967   -1.208  62.408  1.00 26.50  ? 86  GLU A O   1 
ATOM   3970 C CB  . GLU C 1 86  ? 12.865  -0.594  62.351  1.00 29.62  ? 86  GLU A CB  1 
ATOM   3971 C CG  . GLU C 1 86  ? 13.428  -1.771  61.568  1.00 46.89  ? 86  GLU A CG  1 
ATOM   3972 C CD  . GLU C 1 86  ? 14.636  -1.387  60.737  1.00 60.50  ? 86  GLU A CD  1 
ATOM   3973 O OE1 . GLU C 1 86  ? 15.719  -1.168  61.326  1.00 65.87  ? 86  GLU A OE1 1 
ATOM   3974 O OE2 . GLU C 1 86  ? 14.497  -1.301  59.494  1.00 69.21  ? 86  GLU A OE2 1 
ATOM   3975 N N   . ASP C 1 87  ? 10.696  -3.037  63.466  1.00 24.19  ? 87  ASP A N   1 
ATOM   3976 C CA  . ASP C 1 87  ? 9.563   -3.862  63.076  1.00 27.17  ? 87  ASP A CA  1 
ATOM   3977 C C   . ASP C 1 87  ? 8.417   -3.776  64.088  1.00 31.54  ? 87  ASP A C   1 
ATOM   3978 O O   . ASP C 1 87  ? 7.353   -4.369  63.871  1.00 25.97  ? 87  ASP A O   1 
ATOM   3979 C CB  . ASP C 1 87  ? 9.968   -5.332  62.987  1.00 20.64  ? 87  ASP A CB  1 
ATOM   3980 C CG  . ASP C 1 87  ? 11.033  -5.597  61.943  1.00 28.32  ? 87  ASP A CG  1 
ATOM   3981 O OD1 . ASP C 1 87  ? 11.219  -4.756  61.032  1.00 25.76  ? 87  ASP A OD1 1 
ATOM   3982 O OD2 . ASP C 1 87  ? 11.680  -6.669  62.045  1.00 24.42  ? 87  ASP A OD2 1 
ATOM   3983 N N   . LEU C 1 88  ? 8.652   -3.078  65.197  1.00 31.38  ? 88  LEU A N   1 
ATOM   3984 C CA  . LEU C 1 88  ? 7.660   -2.952  66.260  1.00 35.44  ? 88  LEU A CA  1 
ATOM   3985 C C   . LEU C 1 88  ? 6.539   -1.974  65.947  1.00 33.87  ? 88  LEU A C   1 
ATOM   3986 O O   . LEU C 1 88  ? 6.783   -0.807  65.637  1.00 33.19  ? 88  LEU A O   1 
ATOM   3987 C CB  . LEU C 1 88  ? 8.344   -2.550  67.570  1.00 32.67  ? 88  LEU A CB  1 
ATOM   3988 C CG  . LEU C 1 88  ? 9.085   -3.667  68.313  1.00 34.27  ? 88  LEU A CG  1 
ATOM   3989 C CD1 . LEU C 1 88  ? 9.388   -3.189  69.719  1.00 38.45  ? 88  LEU A CD1 1 
ATOM   3990 C CD2 . LEU C 1 88  ? 8.249   -4.932  68.366  1.00 36.10  ? 88  LEU A CD2 1 
ATOM   3991 N N   . GLY C 1 89  ? 5.306   -2.469  66.030  1.00 32.25  ? 89  GLY A N   1 
ATOM   3992 C CA  . GLY C 1 89  ? 4.144   -1.638  65.764  1.00 20.59  ? 89  GLY A CA  1 
ATOM   3993 C C   . GLY C 1 89  ? 2.924   -2.526  65.653  1.00 22.86  ? 89  GLY A C   1 
ATOM   3994 O O   . GLY C 1 89  ? 2.885   -3.598  66.240  1.00 24.66  ? 89  GLY A O   1 
ATOM   3995 N N   . VAL C 1 90  ? 1.932   -2.092  64.885  1.00 22.39  ? 90  VAL A N   1 
ATOM   3996 C CA  . VAL C 1 90  ? 0.713   -2.875  64.705  1.00 23.96  ? 90  VAL A CA  1 
ATOM   3997 C C   . VAL C 1 90  ? 0.587   -3.359  63.272  1.00 18.68  ? 90  VAL A C   1 
ATOM   3998 O O   . VAL C 1 90  ? 0.675   -2.575  62.333  1.00 23.11  ? 90  VAL A O   1 
ATOM   3999 C CB  . VAL C 1 90  ? -0.519  -2.038  65.062  1.00 25.26  ? 90  VAL A CB  1 
ATOM   4000 C CG1 . VAL C 1 90  ? -1.793  -2.881  64.927  1.00 30.13  ? 90  VAL A CG1 1 
ATOM   4001 C CG2 . VAL C 1 90  ? -0.365  -1.526  66.486  1.00 26.46  ? 90  VAL A CG2 1 
ATOM   4002 N N   . TYR C 1 91  ? 0.371   -4.659  63.122  1.00 22.84  ? 91  TYR A N   1 
ATOM   4003 C CA  . TYR C 1 91  ? 0.229   -5.284  61.822  1.00 21.21  ? 91  TYR A CA  1 
ATOM   4004 C C   . TYR C 1 91  ? -1.237  -5.540  61.508  1.00 28.48  ? 91  TYR A C   1 
ATOM   4005 O O   . TYR C 1 91  ? -1.990  -6.072  62.333  1.00 25.89  ? 91  TYR A O   1 
ATOM   4006 C CB  . TYR C 1 91  ? 0.994   -6.611  61.799  1.00 27.90  ? 91  TYR A CB  1 
ATOM   4007 C CG  . TYR C 1 91  ? 2.499   -6.417  61.823  1.00 32.62  ? 91  TYR A CG  1 
ATOM   4008 C CD1 . TYR C 1 91  ? 3.164   -6.131  63.017  1.00 34.95  ? 91  TYR A CD1 1 
ATOM   4009 C CD2 . TYR C 1 91  ? 3.250   -6.471  60.643  1.00 33.19  ? 91  TYR A CD2 1 
ATOM   4010 C CE1 . TYR C 1 91  ? 4.545   -5.897  63.037  1.00 33.59  ? 91  TYR A CE1 1 
ATOM   4011 C CE2 . TYR C 1 91  ? 4.631   -6.241  60.653  1.00 33.47  ? 91  TYR A CE2 1 
ATOM   4012 C CZ  . TYR C 1 91  ? 5.268   -5.953  61.849  1.00 34.15  ? 91  TYR A CZ  1 
ATOM   4013 O OH  . TYR C 1 91  ? 6.619   -5.699  61.855  1.00 26.22  ? 91  TYR A OH  1 
ATOM   4014 N N   . PHE C 1 92  ? -1.631  -5.154  60.303  1.00 26.68  ? 92  PHE A N   1 
ATOM   4015 C CA  . PHE C 1 92  ? -2.995  -5.327  59.851  1.00 29.22  ? 92  PHE A CA  1 
ATOM   4016 C C   . PHE C 1 92  ? -3.002  -6.177  58.597  1.00 27.08  ? 92  PHE A C   1 
ATOM   4017 O O   . PHE C 1 92  ? -2.168  -5.979  57.709  1.00 29.03  ? 92  PHE A O   1 
ATOM   4018 C CB  . PHE C 1 92  ? -3.621  -3.965  59.509  1.00 28.56  ? 92  PHE A CB  1 
ATOM   4019 C CG  . PHE C 1 92  ? -3.856  -3.083  60.699  1.00 35.77  ? 92  PHE A CG  1 
ATOM   4020 C CD1 . PHE C 1 92  ? -4.992  -3.248  61.489  1.00 42.51  ? 92  PHE A CD1 1 
ATOM   4021 C CD2 . PHE C 1 92  ? -2.958  -2.071  61.023  1.00 39.64  ? 92  PHE A CD2 1 
ATOM   4022 C CE1 . PHE C 1 92  ? -5.229  -2.417  62.587  1.00 42.56  ? 92  PHE A CE1 1 
ATOM   4023 C CE2 . PHE C 1 92  ? -3.184  -1.236  62.117  1.00 41.56  ? 92  PHE A CE2 1 
ATOM   4024 C CZ  . PHE C 1 92  ? -4.326  -1.411  62.900  1.00 42.82  ? 92  PHE A CZ  1 
ATOM   4025 N N   . CYS C 1 93  ? -3.906  -7.147  58.543  1.00 26.78  ? 93  CYS A N   1 
ATOM   4026 C CA  . CYS C 1 93  ? -4.058  -7.950  57.347  1.00 30.68  ? 93  CYS A CA  1 
ATOM   4027 C C   . CYS C 1 93  ? -5.229  -7.264  56.648  1.00 30.19  ? 93  CYS A C   1 
ATOM   4028 O O   . CYS C 1 93  ? -6.003  -6.545  57.283  1.00 29.29  ? 93  CYS A O   1 
ATOM   4029 C CB  . CYS C 1 93  ? -4.367  -9.423  57.672  1.00 35.60  ? 93  CYS A CB  1 
ATOM   4030 S SG  . CYS C 1 93  ? -5.872  -9.832  58.619  1.00 39.43  ? 93  CYS A SG  1 
ATOM   4031 N N   . SER C 1 94  ? -5.340  -7.443  55.344  1.00 27.88  ? 94  SER A N   1 
ATOM   4032 C CA  . SER C 1 94  ? -6.408  -6.806  54.616  1.00 26.54  ? 94  SER A CA  1 
ATOM   4033 C C   . SER C 1 94  ? -6.819  -7.629  53.407  1.00 30.48  ? 94  SER A C   1 
ATOM   4034 O O   . SER C 1 94  ? -5.978  -8.264  52.774  1.00 29.31  ? 94  SER A O   1 
ATOM   4035 C CB  . SER C 1 94  ? -5.958  -5.416  54.211  1.00 21.52  ? 94  SER A CB  1 
ATOM   4036 O OG  . SER C 1 94  ? -6.742  -4.888  53.162  1.00 35.39  ? 94  SER A OG  1 
ATOM   4037 N N   . GLN C 1 95  ? -8.122  -7.641  53.118  1.00 30.50  ? 95  GLN A N   1 
ATOM   4038 C CA  . GLN C 1 95  ? -8.669  -8.384  51.979  1.00 31.66  ? 95  GLN A CA  1 
ATOM   4039 C C   . GLN C 1 95  ? -9.248  -7.405  50.962  1.00 33.06  ? 95  GLN A C   1 
ATOM   4040 O O   . GLN C 1 95  ? -9.873  -6.413  51.331  1.00 30.16  ? 95  GLN A O   1 
ATOM   4041 C CB  . GLN C 1 95  ? -9.751  -9.365  52.464  1.00 34.44  ? 95  GLN A CB  1 
ATOM   4042 C CG  . GLN C 1 95  ? -10.949 -9.573  51.524  1.00 41.24  ? 95  GLN A CG  1 
ATOM   4043 C CD  . GLN C 1 95  ? -12.028 -8.543  51.721  1.00 31.68  ? 95  GLN A CD  1 
ATOM   4044 O OE1 . GLN C 1 95  ? -12.589 -8.033  50.770  1.00 38.71  ? 95  GLN A OE1 1 
ATOM   4045 N NE2 . GLN C 1 95  ? -12.315 -8.223  52.970  1.00 41.97  ? 95  GLN A NE2 1 
ATOM   4046 N N   . SER C 1 96  ? -9.012  -7.676  49.682  1.00 33.91  ? 96  SER A N   1 
ATOM   4047 C CA  . SER C 1 96  ? -9.519  -6.831  48.611  1.00 36.29  ? 96  SER A CA  1 
ATOM   4048 C C   . SER C 1 96  ? -10.240 -7.712  47.589  1.00 37.13  ? 96  SER A C   1 
ATOM   4049 O O   . SER C 1 96  ? -10.456 -7.318  46.442  1.00 31.56  ? 96  SER A O   1 
ATOM   4050 C CB  . SER C 1 96  ? -8.371  -6.077  47.935  1.00 43.09  ? 96  SER A CB  1 
ATOM   4051 O OG  . SER C 1 96  ? -8.825  -5.338  46.815  1.00 50.34  ? 96  SER A OG  1 
ATOM   4052 N N   . THR C 1 97  ? -10.607 -8.916  48.015  1.00 36.26  ? 97  THR A N   1 
ATOM   4053 C CA  . THR C 1 97  ? -11.314 -9.836  47.143  1.00 39.10  ? 97  THR A CA  1 
ATOM   4054 C C   . THR C 1 97  ? -12.820 -9.573  47.132  1.00 43.98  ? 97  THR A C   1 
ATOM   4055 O O   . THR C 1 97  ? -13.428 -9.536  46.071  1.00 47.37  ? 97  THR A O   1 
ATOM   4056 C CB  . THR C 1 97  ? -11.108 -11.300 47.565  1.00 36.70  ? 97  THR A CB  1 
ATOM   4057 O OG1 . THR C 1 97  ? -9.736  -11.667 47.393  1.00 36.75  ? 97  THR A OG1 1 
ATOM   4058 C CG2 . THR C 1 97  ? -11.977 -12.220 46.707  1.00 33.04  ? 97  THR A CG2 1 
ATOM   4059 N N   . HIS C 1 98  ? -13.413 -9.372  48.306  1.00 49.78  ? 98  HIS A N   1 
ATOM   4060 C CA  . HIS C 1 98  ? -14.854 -9.162  48.401  1.00 59.85  ? 98  HIS A CA  1 
ATOM   4061 C C   . HIS C 1 98  ? -15.363 -7.723  48.450  1.00 63.07  ? 98  HIS A C   1 
ATOM   4062 O O   . HIS C 1 98  ? -14.666 -6.812  48.906  1.00 64.89  ? 98  HIS A O   1 
ATOM   4063 C CB  . HIS C 1 98  ? -15.401 -9.941  49.598  1.00 63.71  ? 98  HIS A CB  1 
ATOM   4064 C CG  . HIS C 1 98  ? -15.541 -11.409 49.344  1.00 73.53  ? 98  HIS A CG  1 
ATOM   4065 N ND1 . HIS C 1 98  ? -16.638 -11.955 48.708  1.00 79.39  ? 98  HIS A ND1 1 
ATOM   4066 C CD2 . HIS C 1 98  ? -14.720 -12.448 49.633  1.00 74.93  ? 98  HIS A CD2 1 
ATOM   4067 C CE1 . HIS C 1 98  ? -16.487 -13.264 48.620  1.00 80.97  ? 98  HIS A CE1 1 
ATOM   4068 N NE2 . HIS C 1 98  ? -15.330 -13.589 49.173  1.00 78.43  ? 98  HIS A NE2 1 
ATOM   4069 N N   . VAL C 1 99  ? -16.601 -7.560  47.974  1.00 67.87  ? 99  VAL A N   1 
ATOM   4070 C CA  . VAL C 1 99  ? -17.334 -6.288  47.901  1.00 67.22  ? 99  VAL A CA  1 
ATOM   4071 C C   . VAL C 1 99  ? -16.632 -5.096  48.556  1.00 61.44  ? 99  VAL A C   1 
ATOM   4072 O O   . VAL C 1 99  ? -16.062 -4.262  47.858  1.00 60.62  ? 99  VAL A O   1 
ATOM   4073 C CB  . VAL C 1 99  ? -18.765 -6.449  48.489  1.00 71.94  ? 99  VAL A CB  1 
ATOM   4074 C CG1 . VAL C 1 99  ? -19.627 -5.254  48.109  1.00 74.72  ? 99  VAL A CG1 1 
ATOM   4075 C CG2 . VAL C 1 99  ? -19.392 -7.749  47.988  1.00 75.87  ? 99  VAL A CG2 1 
ATOM   4076 N N   . PRO C 1 100 ? -16.698 -4.969  49.896  1.00 56.79  ? 100 PRO A N   1 
ATOM   4077 C CA  . PRO C 1 100 ? -16.009 -3.830  50.508  1.00 52.22  ? 100 PRO A CA  1 
ATOM   4078 C C   . PRO C 1 100 ? -14.674 -4.303  51.089  1.00 46.42  ? 100 PRO A C   1 
ATOM   4079 O O   . PRO C 1 100 ? -14.633 -5.254  51.874  1.00 49.54  ? 100 PRO A O   1 
ATOM   4080 C CB  . PRO C 1 100 ? -16.968 -3.390  51.607  1.00 50.26  ? 100 PRO A CB  1 
ATOM   4081 C CG  . PRO C 1 100 ? -17.737 -4.683  51.969  1.00 54.31  ? 100 PRO A CG  1 
ATOM   4082 C CD  . PRO C 1 100 ? -17.399 -5.748  50.929  1.00 56.86  ? 100 PRO A CD  1 
ATOM   4083 N N   . PRO C 1 101 ? -13.565 -3.667  50.693  1.00 39.80  ? 101 PRO A N   1 
ATOM   4084 C CA  . PRO C 1 101 ? -12.253 -4.068  51.212  1.00 32.25  ? 101 PRO A CA  1 
ATOM   4085 C C   . PRO C 1 101 ? -12.204 -3.924  52.726  1.00 27.86  ? 101 PRO A C   1 
ATOM   4086 O O   . PRO C 1 101 ? -12.462 -2.855  53.252  1.00 27.99  ? 101 PRO A O   1 
ATOM   4087 C CB  . PRO C 1 101 ? -11.282 -3.112  50.522  1.00 28.95  ? 101 PRO A CB  1 
ATOM   4088 C CG  . PRO C 1 101 ? -12.116 -1.989  50.044  1.00 29.11  ? 101 PRO A CG  1 
ATOM   4089 C CD  . PRO C 1 101 ? -13.454 -2.565  49.724  1.00 34.77  ? 101 PRO A CD  1 
ATOM   4090 N N   . THR C 1 102 ? -11.844 -4.987  53.430  1.00 24.09  ? 102 THR A N   1 
ATOM   4091 C CA  . THR C 1 102 ? -11.802 -4.891  54.881  1.00 26.98  ? 102 THR A CA  1 
ATOM   4092 C C   . THR C 1 102 ? -10.441 -5.220  55.500  1.00 27.37  ? 102 THR A C   1 
ATOM   4093 O O   . THR C 1 102 ? -9.613  -5.879  54.877  1.00 26.34  ? 102 THR A O   1 
ATOM   4094 C CB  . THR C 1 102 ? -12.895 -5.775  55.500  1.00 24.90  ? 102 THR A CB  1 
ATOM   4095 O OG1 . THR C 1 102 ? -12.660 -7.138  55.146  1.00 19.27  ? 102 THR A OG1 1 
ATOM   4096 C CG2 . THR C 1 102 ? -14.276 -5.368  54.955  1.00 25.31  ? 102 THR A CG2 1 
ATOM   4097 N N   . PHE C 1 103 ? -10.244 -4.753  56.732  1.00 24.54  ? 103 PHE A N   1 
ATOM   4098 C CA  . PHE C 1 103 ? -9.009  -4.939  57.482  1.00 24.73  ? 103 PHE A CA  1 
ATOM   4099 C C   . PHE C 1 103 ? -9.214  -5.796  58.725  1.00 30.88  ? 103 PHE A C   1 
ATOM   4100 O O   . PHE C 1 103 ? -10.289 -5.789  59.331  1.00 25.91  ? 103 PHE A O   1 
ATOM   4101 C CB  . PHE C 1 103 ? -8.475  -3.589  57.972  1.00 26.16  ? 103 PHE A CB  1 
ATOM   4102 C CG  . PHE C 1 103 ? -8.088  -2.638  56.885  1.00 29.09  ? 103 PHE A CG  1 
ATOM   4103 C CD1 . PHE C 1 103 ? -9.014  -1.741  56.369  1.00 32.82  ? 103 PHE A CD1 1 
ATOM   4104 C CD2 . PHE C 1 103 ? -6.777  -2.599  56.410  1.00 33.82  ? 103 PHE A CD2 1 
ATOM   4105 C CE1 . PHE C 1 103 ? -8.643  -0.815  55.397  1.00 28.58  ? 103 PHE A CE1 1 
ATOM   4106 C CE2 . PHE C 1 103 ? -6.398  -1.678  55.439  1.00 34.43  ? 103 PHE A CE2 1 
ATOM   4107 C CZ  . PHE C 1 103 ? -7.334  -0.784  54.932  1.00 35.62  ? 103 PHE A CZ  1 
ATOM   4108 N N   . GLY C 1 104 ? -8.163  -6.510  59.114  1.00 24.84  ? 104 GLY A N   1 
ATOM   4109 C CA  . GLY C 1 104 ? -8.214  -7.302  60.322  1.00 23.83  ? 104 GLY A CA  1 
ATOM   4110 C C   . GLY C 1 104 ? -8.092  -6.310  61.470  1.00 22.68  ? 104 GLY A C   1 
ATOM   4111 O O   . GLY C 1 104 ? -7.862  -5.115  61.246  1.00 26.32  ? 104 GLY A O   1 
ATOM   4112 N N   . GLY C 1 105 ? -8.227  -6.795  62.699  1.00 24.67  ? 105 GLY A N   1 
ATOM   4113 C CA  . GLY C 1 105 ? -8.166  -5.911  63.846  1.00 26.91  ? 105 GLY A CA  1 
ATOM   4114 C C   . GLY C 1 105 ? -6.805  -5.404  64.276  1.00 30.41  ? 105 GLY A C   1 
ATOM   4115 O O   . GLY C 1 105 ? -6.721  -4.531  65.135  1.00 27.10  ? 105 GLY A O   1 
ATOM   4116 N N   . GLY C 1 106 ? -5.737  -5.934  63.690  1.00 32.17  ? 106 GLY A N   1 
ATOM   4117 C CA  . GLY C 1 106 ? -4.409  -5.481  64.070  1.00 26.34  ? 106 GLY A CA  1 
ATOM   4118 C C   . GLY C 1 106 ? -3.798  -6.323  65.176  1.00 28.76  ? 106 GLY A C   1 
ATOM   4119 O O   . GLY C 1 106 ? -4.489  -6.774  66.096  1.00 27.19  ? 106 GLY A O   1 
ATOM   4120 N N   . THR C 1 107 ? -2.495  -6.554  65.063  1.00 24.53  ? 107 THR A N   1 
ATOM   4121 C CA  . THR C 1 107 ? -1.725  -7.328  66.032  1.00 26.22  ? 107 THR A CA  1 
ATOM   4122 C C   . THR C 1 107 ? -0.569  -6.411  66.470  1.00 30.85  ? 107 THR A C   1 
ATOM   4123 O O   . THR C 1 107 ? 0.142   -5.843  65.633  1.00 26.71  ? 107 THR A O   1 
ATOM   4124 C CB  . THR C 1 107 ? -1.191  -8.641  65.372  1.00 31.93  ? 107 THR A CB  1 
ATOM   4125 O OG1 . THR C 1 107 ? -2.298  -9.515  65.117  1.00 21.64  ? 107 THR A OG1 1 
ATOM   4126 C CG2 . THR C 1 107 ? -0.170  -9.372  66.271  1.00 29.93  ? 107 THR A CG2 1 
ATOM   4127 N N   . LYS C 1 108 ? -0.429  -6.223  67.780  1.00 32.15  ? 108 LYS A N   1 
ATOM   4128 C CA  . LYS C 1 108 ? 0.616   -5.370  68.306  1.00 31.92  ? 108 LYS A CA  1 
ATOM   4129 C C   . LYS C 1 108 ? 1.832   -6.205  68.646  1.00 30.99  ? 108 LYS A C   1 
ATOM   4130 O O   . LYS C 1 108 ? 1.767   -7.094  69.501  1.00 28.55  ? 108 LYS A O   1 
ATOM   4131 C CB  . LYS C 1 108 ? 0.137   -4.646  69.559  1.00 33.74  ? 108 LYS A CB  1 
ATOM   4132 C CG  . LYS C 1 108 ? 0.649   -3.216  69.694  1.00 35.51  ? 108 LYS A CG  1 
ATOM   4133 C CD  . LYS C 1 108 ? 1.699   -3.101  70.787  1.00 40.48  ? 108 LYS A CD  1 
ATOM   4134 C CE  . LYS C 1 108 ? 1.213   -2.258  71.963  1.00 45.88  ? 108 LYS A CE  1 
ATOM   4135 N NZ  . LYS C 1 108 ? 0.794   -0.887  71.543  1.00 47.10  ? 108 LYS A NZ  1 
ATOM   4136 N N   . LEU C 1 109 ? 2.933   -5.925  67.952  1.00 31.99  ? 109 LEU A N   1 
ATOM   4137 C CA  . LEU C 1 109 ? 4.193   -6.625  68.185  1.00 30.16  ? 109 LEU A CA  1 
ATOM   4138 C C   . LEU C 1 109 ? 4.913   -5.782  69.231  1.00 27.73  ? 109 LEU A C   1 
ATOM   4139 O O   . LEU C 1 109 ? 5.124   -4.586  69.040  1.00 30.70  ? 109 LEU A O   1 
ATOM   4140 C CB  . LEU C 1 109 ? 5.015   -6.710  66.880  1.00 34.78  ? 109 LEU A CB  1 
ATOM   4141 C CG  . LEU C 1 109 ? 6.360   -7.455  66.921  1.00 32.83  ? 109 LEU A CG  1 
ATOM   4142 C CD1 . LEU C 1 109 ? 6.155   -8.974  66.926  1.00 31.32  ? 109 LEU A CD1 1 
ATOM   4143 C CD2 . LEU C 1 109 ? 7.187   -7.046  65.722  1.00 38.14  ? 109 LEU A CD2 1 
ATOM   4144 N N   . GLU C 1 110 ? 5.254   -6.396  70.355  1.00 28.39  ? 110 GLU A N   1 
ATOM   4145 C CA  . GLU C 1 110 ? 5.937   -5.678  71.424  1.00 30.42  ? 110 GLU A CA  1 
ATOM   4146 C C   . GLU C 1 110 ? 7.168   -6.441  71.936  1.00 30.23  ? 110 GLU A C   1 
ATOM   4147 O O   . GLU C 1 110 ? 7.425   -7.580  71.528  1.00 28.53  ? 110 GLU A O   1 
ATOM   4148 C CB  . GLU C 1 110 ? 4.964   -5.426  72.578  1.00 31.63  ? 110 GLU A CB  1 
ATOM   4149 C CG  . GLU C 1 110 ? 4.598   -6.669  73.346  1.00 34.41  ? 110 GLU A CG  1 
ATOM   4150 C CD  . GLU C 1 110 ? 3.761   -6.365  74.568  1.00 41.98  ? 110 GLU A CD  1 
ATOM   4151 O OE1 . GLU C 1 110 ? 2.820   -5.550  74.458  1.00 42.93  ? 110 GLU A OE1 1 
ATOM   4152 O OE2 . GLU C 1 110 ? 4.043   -6.942  75.635  1.00 39.00  ? 110 GLU A OE2 1 
ATOM   4153 N N   . ILE C 1 111 ? 7.916   -5.805  72.832  1.00 29.64  ? 111 ILE A N   1 
ATOM   4154 C CA  . ILE C 1 111 ? 9.127   -6.406  73.403  1.00 33.03  ? 111 ILE A CA  1 
ATOM   4155 C C   . ILE C 1 111 ? 8.851   -7.257  74.636  1.00 35.25  ? 111 ILE A C   1 
ATOM   4156 O O   . ILE C 1 111 ? 8.269   -6.791  75.632  1.00 26.29  ? 111 ILE A O   1 
ATOM   4157 C CB  . ILE C 1 111 ? 10.154  -5.331  73.805  1.00 30.85  ? 111 ILE A CB  1 
ATOM   4158 C CG1 . ILE C 1 111 ? 10.754  -4.702  72.551  1.00 34.77  ? 111 ILE A CG1 1 
ATOM   4159 C CG2 . ILE C 1 111 ? 11.253  -5.941  74.661  1.00 37.65  ? 111 ILE A CG2 1 
ATOM   4160 C CD1 . ILE C 1 111 ? 11.880  -5.520  71.930  1.00 40.39  ? 111 ILE A CD1 1 
ATOM   4161 N N   . LYS C 1 112 ? 9.294   -8.508  74.569  1.00 34.89  ? 112 LYS A N   1 
ATOM   4162 C CA  . LYS C 1 112 ? 9.110   -9.435  75.663  1.00 35.89  ? 112 LYS A CA  1 
ATOM   4163 C C   . LYS C 1 112 ? 10.231  -9.284  76.679  1.00 35.15  ? 112 LYS A C   1 
ATOM   4164 O O   . LYS C 1 112 ? 11.404  -9.233  76.320  1.00 41.55  ? 112 LYS A O   1 
ATOM   4165 C CB  . LYS C 1 112 ? 9.098   -10.866 75.140  1.00 37.03  ? 112 LYS A CB  1 
ATOM   4166 C CG  . LYS C 1 112 ? 9.148   -11.914 76.234  1.00 48.19  ? 112 LYS A CG  1 
ATOM   4167 C CD  . LYS C 1 112 ? 7.889   -12.770 76.244  1.00 52.03  ? 112 LYS A CD  1 
ATOM   4168 C CE  . LYS C 1 112 ? 7.918   -13.783 77.385  1.00 54.67  ? 112 LYS A CE  1 
ATOM   4169 N NZ  . LYS C 1 112 ? 8.129   -15.173 76.893  1.00 54.30  ? 112 LYS A NZ  1 
ATOM   4170 N N   . ARG C 1 113 ? 9.859   -9.207  77.952  1.00 35.78  ? 113 ARG A N   1 
ATOM   4171 C CA  . ARG C 1 113 ? 10.824  -9.076  79.034  1.00 30.74  ? 113 ARG A CA  1 
ATOM   4172 C C   . ARG C 1 113 ? 10.387  -9.960  80.187  1.00 32.71  ? 113 ARG A C   1 
ATOM   4173 O O   . ARG C 1 113 ? 9.561   -10.856 80.000  1.00 39.64  ? 113 ARG A O   1 
ATOM   4174 C CB  . ARG C 1 113 ? 10.929  -7.621  79.485  1.00 26.40  ? 113 ARG A CB  1 
ATOM   4175 C CG  . ARG C 1 113 ? 9.632   -6.972  79.908  1.00 31.67  ? 113 ARG A CG  1 
ATOM   4176 C CD  . ARG C 1 113 ? 9.657   -6.674  81.390  1.00 35.33  ? 113 ARG A CD  1 
ATOM   4177 N NE  . ARG C 1 113 ? 10.629  -5.649  81.746  1.00 38.28  ? 113 ARG A NE  1 
ATOM   4178 C CZ  . ARG C 1 113 ? 11.341  -5.653  82.867  1.00 37.69  ? 113 ARG A CZ  1 
ATOM   4179 N NH1 . ARG C 1 113 ? 11.199  -6.631  83.748  1.00 46.02  ? 113 ARG A NH1 1 
ATOM   4180 N NH2 . ARG C 1 113 ? 12.182  -4.664  83.122  1.00 33.92  ? 113 ARG A NH2 1 
ATOM   4181 N N   . THR C 1 114 ? 10.938  -9.738  81.374  1.00 33.16  ? 114 THR A N   1 
ATOM   4182 C CA  . THR C 1 114 ? 10.553  -10.561 82.514  1.00 32.38  ? 114 THR A CA  1 
ATOM   4183 C C   . THR C 1 114 ? 9.405   -9.932  83.254  1.00 32.14  ? 114 THR A C   1 
ATOM   4184 O O   . THR C 1 114 ? 9.286   -8.706  83.325  1.00 30.77  ? 114 THR A O   1 
ATOM   4185 C CB  . THR C 1 114 ? 11.687  -10.743 83.540  1.00 28.73  ? 114 THR A CB  1 
ATOM   4186 O OG1 . THR C 1 114 ? 12.536  -9.591  83.531  1.00 41.45  ? 114 THR A OG1 1 
ATOM   4187 C CG2 . THR C 1 114 ? 12.488  -11.985 83.219  1.00 32.05  ? 114 THR A CG2 1 
ATOM   4188 N N   . VAL C 1 115 ? 8.571   -10.790 83.821  1.00 34.65  ? 115 VAL A N   1 
ATOM   4189 C CA  . VAL C 1 115 ? 7.427   -10.341 84.583  1.00 31.55  ? 115 VAL A CA  1 
ATOM   4190 C C   . VAL C 1 115 ? 7.883   -9.345  85.636  1.00 31.54  ? 115 VAL A C   1 
ATOM   4191 O O   . VAL C 1 115 ? 8.857   -9.582  86.347  1.00 34.45  ? 115 VAL A O   1 
ATOM   4192 C CB  . VAL C 1 115 ? 6.749   -11.527 85.280  1.00 29.83  ? 115 VAL A CB  1 
ATOM   4193 C CG1 . VAL C 1 115 ? 5.596   -11.045 86.125  1.00 24.16  ? 115 VAL A CG1 1 
ATOM   4194 C CG2 . VAL C 1 115 ? 6.280   -12.527 84.238  1.00 27.41  ? 115 VAL A CG2 1 
ATOM   4195 N N   . ALA C 1 116 ? 7.193   -8.216  85.707  1.00 31.26  ? 116 ALA A N   1 
ATOM   4196 C CA  . ALA C 1 116 ? 7.497   -7.200  86.700  1.00 33.88  ? 116 ALA A CA  1 
ATOM   4197 C C   . ALA C 1 116 ? 6.177   -6.753  87.338  1.00 34.82  ? 116 ALA A C   1 
ATOM   4198 O O   . ALA C 1 116 ? 5.281   -6.280  86.656  1.00 37.07  ? 116 ALA A O   1 
ATOM   4199 C CB  . ALA C 1 116 ? 8.202   -6.022  86.053  1.00 29.37  ? 116 ALA A CB  1 
ATOM   4200 N N   . ALA C 1 117 ? 6.053   -6.926  88.649  1.00 37.46  ? 117 ALA A N   1 
ATOM   4201 C CA  . ALA C 1 117 ? 4.840   -6.522  89.337  1.00 36.13  ? 117 ALA A CA  1 
ATOM   4202 C C   . ALA C 1 117 ? 4.861   -5.019  89.452  1.00 37.05  ? 117 ALA A C   1 
ATOM   4203 O O   . ALA C 1 117 ? 5.923   -4.409  89.562  1.00 37.82  ? 117 ALA A O   1 
ATOM   4204 C CB  . ALA C 1 117 ? 4.764   -7.147  90.721  1.00 36.23  ? 117 ALA A CB  1 
ATOM   4205 N N   . PRO C 1 118 ? 3.680   -4.392  89.433  1.00 34.21  ? 118 PRO A N   1 
ATOM   4206 C CA  . PRO C 1 118 ? 3.654   -2.940  89.539  1.00 34.81  ? 118 PRO A CA  1 
ATOM   4207 C C   . PRO C 1 118 ? 3.931   -2.437  90.946  1.00 31.99  ? 118 PRO A C   1 
ATOM   4208 O O   . PRO C 1 118 ? 3.790   -3.169  91.922  1.00 34.79  ? 118 PRO A O   1 
ATOM   4209 C CB  . PRO C 1 118 ? 2.240   -2.578  89.085  1.00 34.09  ? 118 PRO A CB  1 
ATOM   4210 C CG  . PRO C 1 118 ? 1.427   -3.752  89.478  1.00 35.88  ? 118 PRO A CG  1 
ATOM   4211 C CD  . PRO C 1 118 ? 2.326   -4.963  89.322  1.00 36.51  ? 118 PRO A CD  1 
ATOM   4212 N N   . SER C 1 119 ? 4.354   -1.189  91.030  1.00 27.06  ? 119 SER A N   1 
ATOM   4213 C CA  . SER C 1 119 ? 4.575   -0.535  92.302  1.00 36.50  ? 119 SER A CA  1 
ATOM   4214 C C   . SER C 1 119 ? 3.288   0.287   92.367  1.00 34.39  ? 119 SER A C   1 
ATOM   4215 O O   . SER C 1 119 ? 3.024   1.085   91.474  1.00 35.52  ? 119 SER A O   1 
ATOM   4216 C CB  . SER C 1 119 ? 5.789   0.395   92.237  1.00 40.84  ? 119 SER A CB  1 
ATOM   4217 O OG  . SER C 1 119 ? 6.805   -0.151  91.410  1.00 53.92  ? 119 SER A OG  1 
ATOM   4218 N N   . VAL C 1 120 ? 2.478   0.079   93.399  1.00 37.16  ? 120 VAL A N   1 
ATOM   4219 C CA  . VAL C 1 120 ? 1.206   0.793   93.507  1.00 32.45  ? 120 VAL A CA  1 
ATOM   4220 C C   . VAL C 1 120 ? 1.186   1.998   94.439  1.00 31.54  ? 120 VAL A C   1 
ATOM   4221 O O   . VAL C 1 120 ? 1.518   1.884   95.619  1.00 31.33  ? 120 VAL A O   1 
ATOM   4222 C CB  . VAL C 1 120 ? 0.074   -0.162  93.953  1.00 33.99  ? 120 VAL A CB  1 
ATOM   4223 C CG1 . VAL C 1 120 ? -1.276  0.467   93.652  1.00 26.90  ? 120 VAL A CG1 1 
ATOM   4224 C CG2 . VAL C 1 120 ? 0.207   -1.508  93.253  1.00 26.21  ? 120 VAL A CG2 1 
ATOM   4225 N N   . PHE C 1 121 ? 0.773   3.147   93.909  1.00 29.16  ? 121 PHE A N   1 
ATOM   4226 C CA  . PHE C 1 121 ? 0.673   4.373   94.703  1.00 26.78  ? 121 PHE A CA  1 
ATOM   4227 C C   . PHE C 1 121 ? -0.744  4.951   94.609  1.00 29.91  ? 121 PHE A C   1 
ATOM   4228 O O   . PHE C 1 121 ? -1.343  4.966   93.535  1.00 26.63  ? 121 PHE A O   1 
ATOM   4229 C CB  . PHE C 1 121 ? 1.662   5.416   94.195  1.00 28.31  ? 121 PHE A CB  1 
ATOM   4230 C CG  . PHE C 1 121 ? 3.095   4.974   94.282  1.00 28.69  ? 121 PHE A CG  1 
ATOM   4231 C CD1 . PHE C 1 121 ? 3.821   5.153   95.459  1.00 30.15  ? 121 PHE A CD1 1 
ATOM   4232 C CD2 . PHE C 1 121 ? 3.706   4.342   93.203  1.00 30.30  ? 121 PHE A CD2 1 
ATOM   4233 C CE1 . PHE C 1 121 ? 5.130   4.705   95.562  1.00 28.01  ? 121 PHE A CE1 1 
ATOM   4234 C CE2 . PHE C 1 121 ? 5.031   3.887   93.294  1.00 33.30  ? 121 PHE A CE2 1 
ATOM   4235 C CZ  . PHE C 1 121 ? 5.738   4.069   94.477  1.00 24.13  ? 121 PHE A CZ  1 
ATOM   4236 N N   . ILE C 1 122 ? -1.280  5.426   95.728  1.00 27.89  ? 122 ILE A N   1 
ATOM   4237 C CA  . ILE C 1 122 ? -2.616  6.009   95.721  1.00 31.09  ? 122 ILE A CA  1 
ATOM   4238 C C   . ILE C 1 122 ? -2.515  7.448   96.172  1.00 29.27  ? 122 ILE A C   1 
ATOM   4239 O O   . ILE C 1 122 ? -1.785  7.748   97.109  1.00 31.68  ? 122 ILE A O   1 
ATOM   4240 C CB  . ILE C 1 122 ? -3.603  5.251   96.671  1.00 32.74  ? 122 ILE A CB  1 
ATOM   4241 C CG1 . ILE C 1 122 ? -4.985  5.922   96.626  1.00 31.80  ? 122 ILE A CG1 1 
ATOM   4242 C CG2 . ILE C 1 122 ? -3.059  5.249   98.111  1.00 34.02  ? 122 ILE A CG2 1 
ATOM   4243 C CD1 . ILE C 1 122 ? -6.175  4.969   96.867  1.00 25.09  ? 122 ILE A CD1 1 
ATOM   4244 N N   . PHE C 1 123 ? -3.244  8.332   95.489  1.00 29.51  ? 123 PHE A N   1 
ATOM   4245 C CA  . PHE C 1 123 ? -3.255  9.752   95.821  1.00 29.82  ? 123 PHE A CA  1 
ATOM   4246 C C   . PHE C 1 123 ? -4.673  10.268  96.062  1.00 33.51  ? 123 PHE A C   1 
ATOM   4247 O O   . PHE C 1 123 ? -5.578  10.049  95.250  1.00 30.27  ? 123 PHE A O   1 
ATOM   4248 C CB  . PHE C 1 123 ? -2.654  10.594  94.688  1.00 32.61  ? 123 PHE A CB  1 
ATOM   4249 C CG  . PHE C 1 123 ? -1.288  10.164  94.267  1.00 34.04  ? 123 PHE A CG  1 
ATOM   4250 C CD1 . PHE C 1 123 ? -1.126  9.169   93.308  1.00 32.73  ? 123 PHE A CD1 1 
ATOM   4251 C CD2 . PHE C 1 123 ? -0.161  10.734  94.846  1.00 38.44  ? 123 PHE A CD2 1 
ATOM   4252 C CE1 . PHE C 1 123 ? 0.138   8.743   92.930  1.00 37.45  ? 123 PHE A CE1 1 
ATOM   4253 C CE2 . PHE C 1 123 ? 1.116   10.312  94.473  1.00 38.39  ? 123 PHE A CE2 1 
ATOM   4254 C CZ  . PHE C 1 123 ? 1.259   9.313   93.511  1.00 34.20  ? 123 PHE A CZ  1 
ATOM   4255 N N   . PRO C 1 124 ? -4.889  10.939  97.195  1.00 33.85  ? 124 PRO A N   1 
ATOM   4256 C CA  . PRO C 1 124 ? -6.210  11.492  97.509  1.00 35.68  ? 124 PRO A CA  1 
ATOM   4257 C C   . PRO C 1 124 ? -6.356  12.828  96.779  1.00 36.83  ? 124 PRO A C   1 
ATOM   4258 O O   . PRO C 1 124 ? -5.381  13.370  96.250  1.00 33.95  ? 124 PRO A O   1 
ATOM   4259 C CB  . PRO C 1 124 ? -6.168  11.681  99.031  1.00 35.13  ? 124 PRO A CB  1 
ATOM   4260 C CG  . PRO C 1 124 ? -4.850  11.061  99.487  1.00 35.28  ? 124 PRO A CG  1 
ATOM   4261 C CD  . PRO C 1 124 ? -3.949  11.154  98.301  1.00 36.29  ? 124 PRO A CD  1 
ATOM   4262 N N   . PRO C 1 125 ? -7.571  13.385  96.741  1.00 35.97  ? 125 PRO A N   1 
ATOM   4263 C CA  . PRO C 1 125 ? -7.696  14.667  96.045  1.00 35.96  ? 125 PRO A CA  1 
ATOM   4264 C C   . PRO C 1 125 ? -6.995  15.740  96.871  1.00 34.34  ? 125 PRO A C   1 
ATOM   4265 O O   . PRO C 1 125 ? -6.822  15.580  98.078  1.00 38.30  ? 125 PRO A O   1 
ATOM   4266 C CB  . PRO C 1 125 ? -9.209  14.888  95.961  1.00 31.51  ? 125 PRO A CB  1 
ATOM   4267 C CG  . PRO C 1 125 ? -9.739  14.151  97.153  1.00 36.99  ? 125 PRO A CG  1 
ATOM   4268 C CD  . PRO C 1 125 ? -8.855  12.929  97.304  1.00 37.01  ? 125 PRO A CD  1 
ATOM   4269 N N   . SER C 1 126 ? -6.582  16.822  96.227  1.00 32.71  ? 126 SER A N   1 
ATOM   4270 C CA  . SER C 1 126 ? -5.906  17.900  96.935  1.00 36.31  ? 126 SER A CA  1 
ATOM   4271 C C   . SER C 1 126 ? -6.934  18.871  97.489  1.00 38.45  ? 126 SER A C   1 
ATOM   4272 O O   . SER C 1 126 ? -8.051  18.949  96.980  1.00 38.47  ? 126 SER A O   1 
ATOM   4273 C CB  . SER C 1 126 ? -4.969  18.651  95.989  1.00 33.25  ? 126 SER A CB  1 
ATOM   4274 O OG  . SER C 1 126 ? -5.691  19.162  94.889  1.00 25.40  ? 126 SER A OG  1 
ATOM   4275 N N   . ASP C 1 127 ? -6.552  19.615  98.522  1.00 41.96  ? 127 ASP A N   1 
ATOM   4276 C CA  . ASP C 1 127 ? -7.452  20.583  99.135  1.00 47.01  ? 127 ASP A CA  1 
ATOM   4277 C C   . ASP C 1 127 ? -7.910  21.608  98.103  1.00 46.67  ? 127 ASP A C   1 
ATOM   4278 O O   . ASP C 1 127 ? -9.079  21.991  98.068  1.00 49.63  ? 127 ASP A O   1 
ATOM   4279 C CB  . ASP C 1 127 ? -6.751  21.310  100.282 1.00 53.21  ? 127 ASP A CB  1 
ATOM   4280 C CG  . ASP C 1 127 ? -6.735  20.506  101.559 1.00 61.16  ? 127 ASP A CG  1 
ATOM   4281 O OD1 . ASP C 1 127 ? -7.520  19.536  101.680 1.00 65.17  ? 127 ASP A OD1 1 
ATOM   4282 O OD2 . ASP C 1 127 ? -5.930  20.850  102.447 1.00 66.68  ? 127 ASP A OD2 1 
ATOM   4283 N N   . GLU C 1 128 ? -6.973  22.050  97.270  1.00 42.67  ? 128 GLU A N   1 
ATOM   4284 C CA  . GLU C 1 128 ? -7.258  23.032  96.231  1.00 41.07  ? 128 GLU A CA  1 
ATOM   4285 C C   . GLU C 1 128 ? -8.361  22.542  95.301  1.00 34.14  ? 128 GLU A C   1 
ATOM   4286 O O   . GLU C 1 128 ? -9.253  23.304  94.947  1.00 36.69  ? 128 GLU A O   1 
ATOM   4287 C CB  . GLU C 1 128 ? -5.991  23.330  95.419  1.00 42.74  ? 128 GLU A CB  1 
ATOM   4288 C CG  . GLU C 1 128 ? -5.099  22.120  95.228  1.00 56.61  ? 128 GLU A CG  1 
ATOM   4289 C CD  . GLU C 1 128 ? -3.826  22.202  96.051  1.00 60.99  ? 128 GLU A CD  1 
ATOM   4290 O OE1 . GLU C 1 128 ? -2.901  22.936  95.632  1.00 56.49  ? 128 GLU A OE1 1 
ATOM   4291 O OE2 . GLU C 1 128 ? -3.756  21.535  97.110  1.00 61.24  ? 128 GLU A OE2 1 
ATOM   4292 N N   . GLN C 1 129 ? -8.302  21.272  94.911  1.00 33.24  ? 129 GLN A N   1 
ATOM   4293 C CA  . GLN C 1 129 ? -9.319  20.709  94.024  1.00 32.51  ? 129 GLN A CA  1 
ATOM   4294 C C   . GLN C 1 129 ? -10.640 20.579  94.764  1.00 33.46  ? 129 GLN A C   1 
ATOM   4295 O O   . GLN C 1 129 ? -11.673 21.044  94.293  1.00 36.80  ? 129 GLN A O   1 
ATOM   4296 C CB  . GLN C 1 129 ? -8.916  19.330  93.517  1.00 26.56  ? 129 GLN A CB  1 
ATOM   4297 C CG  . GLN C 1 129 ? -9.809  18.872  92.385  1.00 25.62  ? 129 GLN A CG  1 
ATOM   4298 C CD  . GLN C 1 129 ? -9.655  17.424  92.033  1.00 24.06  ? 129 GLN A CD  1 
ATOM   4299 O OE1 . GLN C 1 129 ? -9.074  16.638  92.786  1.00 25.34  ? 129 GLN A OE1 1 
ATOM   4300 N NE2 . GLN C 1 129 ? -10.178 17.051  90.872  1.00 23.93  ? 129 GLN A NE2 1 
ATOM   4301 N N   . LEU C 1 130 ? -10.605 19.919  95.914  1.00 33.05  ? 130 LEU A N   1 
ATOM   4302 C CA  . LEU C 1 130 ? -11.813 19.754  96.718  1.00 35.70  ? 130 LEU A CA  1 
ATOM   4303 C C   . LEU C 1 130 ? -12.505 21.116  96.778  1.00 37.88  ? 130 LEU A C   1 
ATOM   4304 O O   . LEU C 1 130 ? -13.707 21.235  96.542  1.00 42.45  ? 130 LEU A O   1 
ATOM   4305 C CB  . LEU C 1 130 ? -11.442 19.287  98.126  1.00 29.06  ? 130 LEU A CB  1 
ATOM   4306 C CG  . LEU C 1 130 ? -11.229 17.783  98.231  1.00 30.56  ? 130 LEU A CG  1 
ATOM   4307 C CD1 . LEU C 1 130 ? -10.398 17.482  99.456  1.00 30.76  ? 130 LEU A CD1 1 
ATOM   4308 C CD2 . LEU C 1 130 ? -12.591 17.077  98.293  1.00 41.81  ? 130 LEU A CD2 1 
ATOM   4309 N N   . LYS C 1 131 ? -11.719 22.147  97.060  1.00 42.45  ? 131 LYS A N   1 
ATOM   4310 C CA  . LYS C 1 131 ? -12.230 23.511  97.150  1.00 47.90  ? 131 LYS A CA  1 
ATOM   4311 C C   . LYS C 1 131 ? -13.039 23.944  95.923  1.00 48.53  ? 131 LYS A C   1 
ATOM   4312 O O   . LYS C 1 131 ? -13.758 24.948  95.970  1.00 49.76  ? 131 LYS A O   1 
ATOM   4313 C CB  . LYS C 1 131 ? -11.061 24.478  97.362  1.00 51.39  ? 131 LYS A CB  1 
ATOM   4314 C CG  . LYS C 1 131 ? -11.466 25.871  97.832  1.00 57.14  ? 131 LYS A CG  1 
ATOM   4315 C CD  . LYS C 1 131 ? -10.550 26.402  98.935  1.00 60.97  ? 131 LYS A CD  1 
ATOM   4316 C CE  . LYS C 1 131 ? -9.143  25.814  98.856  1.00 65.38  ? 131 LYS A CE  1 
ATOM   4317 N NZ  . LYS C 1 131 ? -8.180  26.738  98.198  1.00 70.46  ? 131 LYS A NZ  1 
ATOM   4318 N N   . SER C 1 132 ? -12.930 23.193  94.829  1.00 49.65  ? 132 SER A N   1 
ATOM   4319 C CA  . SER C 1 132 ? -13.655 23.525  93.599  1.00 47.40  ? 132 SER A CA  1 
ATOM   4320 C C   . SER C 1 132 ? -14.819 22.583  93.273  1.00 47.12  ? 132 SER A C   1 
ATOM   4321 O O   . SER C 1 132 ? -15.307 22.559  92.142  1.00 50.73  ? 132 SER A O   1 
ATOM   4322 C CB  . SER C 1 132 ? -12.678 23.579  92.414  1.00 46.96  ? 132 SER A CB  1 
ATOM   4323 O OG  . SER C 1 132 ? -12.076 22.318  92.169  1.00 44.11  ? 132 SER A OG  1 
ATOM   4324 N N   . GLY C 1 133 ? -15.243 21.792  94.254  1.00 45.77  ? 133 GLY A N   1 
ATOM   4325 C CA  . GLY C 1 133 ? -16.371 20.896  94.051  1.00 41.98  ? 133 GLY A CA  1 
ATOM   4326 C C   . GLY C 1 133 ? -16.060 19.497  93.567  1.00 43.61  ? 133 GLY A C   1 
ATOM   4327 O O   . GLY C 1 133 ? -16.937 18.625  93.609  1.00 43.66  ? 133 GLY A O   1 
ATOM   4328 N N   . THR C 1 134 ? -14.827 19.266  93.115  1.00 42.95  ? 134 THR A N   1 
ATOM   4329 C CA  . THR C 1 134 ? -14.438 17.949  92.612  1.00 40.56  ? 134 THR A CA  1 
ATOM   4330 C C   . THR C 1 134 ? -13.461 17.202  93.508  1.00 35.02  ? 134 THR A C   1 
ATOM   4331 O O   . THR C 1 134 ? -12.768 17.788  94.326  1.00 36.84  ? 134 THR A O   1 
ATOM   4332 C CB  . THR C 1 134 ? -13.788 18.037  91.213  1.00 43.50  ? 134 THR A CB  1 
ATOM   4333 O OG1 . THR C 1 134 ? -13.488 19.402  90.908  1.00 49.26  ? 134 THR A OG1 1 
ATOM   4334 C CG2 . THR C 1 134 ? -14.722 17.474  90.163  1.00 46.01  ? 134 THR A CG2 1 
ATOM   4335 N N   . ALA C 1 135 ? -13.414 15.892  93.338  1.00 29.66  ? 135 ALA A N   1 
ATOM   4336 C CA  . ALA C 1 135 ? -12.509 15.068  94.104  1.00 31.46  ? 135 ALA A CA  1 
ATOM   4337 C C   . ALA C 1 135 ? -11.977 13.957  93.204  1.00 34.30  ? 135 ALA A C   1 
ATOM   4338 O O   . ALA C 1 135 ? -12.694 12.995  92.919  1.00 28.52  ? 135 ALA A O   1 
ATOM   4339 C CB  . ALA C 1 135 ? -13.220 14.478  95.296  1.00 35.08  ? 135 ALA A CB  1 
ATOM   4340 N N   . SER C 1 136 ? -10.735 14.106  92.734  1.00 29.68  ? 136 SER A N   1 
ATOM   4341 C CA  . SER C 1 136 ? -10.136 13.080  91.895  1.00 27.77  ? 136 SER A CA  1 
ATOM   4342 C C   . SER C 1 136 ? -9.206  12.257  92.773  1.00 25.79  ? 136 SER A C   1 
ATOM   4343 O O   . SER C 1 136 ? -8.409  12.800  93.523  1.00 28.37  ? 136 SER A O   1 
ATOM   4344 C CB  . SER C 1 136 ? -9.334  13.706  90.740  1.00 26.29  ? 136 SER A CB  1 
ATOM   4345 O OG  . SER C 1 136 ? -10.173 14.374  89.814  1.00 32.07  ? 136 SER A OG  1 
ATOM   4346 N N   . VAL C 1 137 ? -9.322  10.944  92.687  1.00 24.49  ? 137 VAL A N   1 
ATOM   4347 C CA  . VAL C 1 137 ? -8.468  10.053  93.457  1.00 27.27  ? 137 VAL A CA  1 
ATOM   4348 C C   . VAL C 1 137 ? -7.682  9.306   92.379  1.00 27.23  ? 137 VAL A C   1 
ATOM   4349 O O   . VAL C 1 137 ? -8.264  8.864   91.389  1.00 27.21  ? 137 VAL A O   1 
ATOM   4350 C CB  . VAL C 1 137 ? -9.314  9.079   94.330  1.00 25.75  ? 137 VAL A CB  1 
ATOM   4351 C CG1 . VAL C 1 137 ? -8.427  8.346   95.323  1.00 27.47  ? 137 VAL A CG1 1 
ATOM   4352 C CG2 . VAL C 1 137 ? -10.378 9.866   95.082  1.00 22.98  ? 137 VAL A CG2 1 
ATOM   4353 N N   . VAL C 1 138 ? -6.369  9.173   92.576  1.00 26.67  ? 138 VAL A N   1 
ATOM   4354 C CA  . VAL C 1 138 ? -5.488  8.537   91.592  1.00 24.44  ? 138 VAL A CA  1 
ATOM   4355 C C   . VAL C 1 138 ? -4.741  7.297   92.077  1.00 25.66  ? 138 VAL A C   1 
ATOM   4356 O O   . VAL C 1 138 ? -4.110  7.306   93.133  1.00 30.92  ? 138 VAL A O   1 
ATOM   4357 C CB  . VAL C 1 138 ? -4.414  9.560   91.073  1.00 20.64  ? 138 VAL A CB  1 
ATOM   4358 C CG1 . VAL C 1 138 ? -3.474  8.888   90.093  1.00 21.73  ? 138 VAL A CG1 1 
ATOM   4359 C CG2 . VAL C 1 138 ? -5.085  10.758  90.411  1.00 15.18  ? 138 VAL A CG2 1 
ATOM   4360 N N   . CYS C 1 139 ? -4.815  6.231   91.294  1.00 24.37  ? 139 CYS A N   1 
ATOM   4361 C CA  . CYS C 1 139 ? -4.095  5.003   91.600  1.00 28.06  ? 139 CYS A CA  1 
ATOM   4362 C C   . CYS C 1 139 ? -3.006  4.859   90.519  1.00 26.05  ? 139 CYS A C   1 
ATOM   4363 O O   . CYS C 1 139 ? -3.305  4.883   89.327  1.00 27.51  ? 139 CYS A O   1 
ATOM   4364 C CB  . CYS C 1 139 ? -5.038  3.805   91.555  1.00 29.63  ? 139 CYS A CB  1 
ATOM   4365 S SG  . CYS C 1 139 ? -4.380  2.244   92.234  1.00 38.28  ? 139 CYS A SG  1 
ATOM   4366 N N   . LEU C 1 140 ? -1.750  4.713   90.934  1.00 26.64  ? 140 LEU A N   1 
ATOM   4367 C CA  . LEU C 1 140 ? -0.643  4.585   89.974  1.00 25.89  ? 140 LEU A CA  1 
ATOM   4368 C C   . LEU C 1 140 ? 0.038   3.224   90.004  1.00 25.15  ? 140 LEU A C   1 
ATOM   4369 O O   . LEU C 1 140 ? 0.499   2.779   91.053  1.00 25.98  ? 140 LEU A O   1 
ATOM   4370 C CB  . LEU C 1 140 ? 0.404   5.679   90.235  1.00 32.31  ? 140 LEU A CB  1 
ATOM   4371 C CG  . LEU C 1 140 ? 1.802   5.443   89.651  1.00 33.60  ? 140 LEU A CG  1 
ATOM   4372 C CD1 . LEU C 1 140 ? 1.801   5.745   88.136  1.00 30.99  ? 140 LEU A CD1 1 
ATOM   4373 C CD2 . LEU C 1 140 ? 2.795   6.323   90.365  1.00 32.36  ? 140 LEU A CD2 1 
ATOM   4374 N N   . LEU C 1 141 ? 0.049   2.532   88.866  1.00 23.40  ? 141 LEU A N   1 
ATOM   4375 C CA  . LEU C 1 141 ? 0.734   1.247   88.780  1.00 25.19  ? 141 LEU A CA  1 
ATOM   4376 C C   . LEU C 1 141 ? 2.015   1.547   87.968  1.00 27.61  ? 141 LEU A C   1 
ATOM   4377 O O   . LEU C 1 141 ? 1.964   1.778   86.756  1.00 26.67  ? 141 LEU A O   1 
ATOM   4378 C CB  . LEU C 1 141 ? -0.131  0.213   88.068  1.00 19.67  ? 141 LEU A CB  1 
ATOM   4379 C CG  . LEU C 1 141 ? -1.298  -0.420  88.834  1.00 26.37  ? 141 LEU A CG  1 
ATOM   4380 C CD1 . LEU C 1 141 ? -2.328  0.657   89.201  1.00 17.98  ? 141 LEU A CD1 1 
ATOM   4381 C CD2 . LEU C 1 141 ? -1.943  -1.492  87.974  1.00 24.69  ? 141 LEU A CD2 1 
ATOM   4382 N N   . ASN C 1 142 ? 3.152   1.557   88.653  1.00 27.08  ? 142 ASN A N   1 
ATOM   4383 C CA  . ASN C 1 142 ? 4.442   1.880   88.031  1.00 28.35  ? 142 ASN A CA  1 
ATOM   4384 C C   . ASN C 1 142 ? 5.277   0.720   87.524  1.00 28.18  ? 142 ASN A C   1 
ATOM   4385 O O   . ASN C 1 142 ? 5.444   -0.280  88.208  1.00 30.68  ? 142 ASN A O   1 
ATOM   4386 C CB  . ASN C 1 142 ? 5.301   2.681   89.017  1.00 25.31  ? 142 ASN A CB  1 
ATOM   4387 C CG  . ASN C 1 142 ? 6.103   3.771   88.341  1.00 31.97  ? 142 ASN A CG  1 
ATOM   4388 O OD1 . ASN C 1 142 ? 5.544   4.655   87.692  1.00 37.07  ? 142 ASN A OD1 1 
ATOM   4389 N ND2 . ASN C 1 142 ? 7.426   3.712   88.482  1.00 29.25  ? 142 ASN A ND2 1 
ATOM   4390 N N   . ASN C 1 143 ? 5.811   0.892   86.319  1.00 31.92  ? 143 ASN A N   1 
ATOM   4391 C CA  . ASN C 1 143 ? 6.688   -0.077  85.659  1.00 32.69  ? 143 ASN A CA  1 
ATOM   4392 C C   . ASN C 1 143 ? 6.394   -1.565  85.838  1.00 32.19  ? 143 ASN A C   1 
ATOM   4393 O O   . ASN C 1 143 ? 7.126   -2.270  86.539  1.00 32.07  ? 143 ASN A O   1 
ATOM   4394 C CB  . ASN C 1 143 ? 8.141   0.198   86.077  1.00 34.05  ? 143 ASN A CB  1 
ATOM   4395 C CG  . ASN C 1 143 ? 8.485   1.676   86.027  1.00 31.13  ? 143 ASN A CG  1 
ATOM   4396 O OD1 . ASN C 1 143 ? 9.246   2.176   86.851  1.00 45.39  ? 143 ASN A OD1 1 
ATOM   4397 N ND2 . ASN C 1 143 ? 7.918   2.382   85.065  1.00 40.81  ? 143 ASN A ND2 1 
ATOM   4398 N N   . PHE C 1 144 ? 5.360   -2.051  85.164  1.00 30.04  ? 144 PHE A N   1 
ATOM   4399 C CA  . PHE C 1 144 ? 4.993   -3.462  85.255  1.00 29.60  ? 144 PHE A CA  1 
ATOM   4400 C C   . PHE C 1 144 ? 4.977   -4.189  83.909  1.00 30.07  ? 144 PHE A C   1 
ATOM   4401 O O   . PHE C 1 144 ? 4.970   -3.567  82.837  1.00 29.15  ? 144 PHE A O   1 
ATOM   4402 C CB  . PHE C 1 144 ? 3.616   -3.604  85.935  1.00 29.20  ? 144 PHE A CB  1 
ATOM   4403 C CG  . PHE C 1 144 ? 2.487   -2.964  85.169  1.00 26.29  ? 144 PHE A CG  1 
ATOM   4404 C CD1 . PHE C 1 144 ? 2.150   -1.635  85.380  1.00 29.12  ? 144 PHE A CD1 1 
ATOM   4405 C CD2 . PHE C 1 144 ? 1.775   -3.684  84.212  1.00 27.76  ? 144 PHE A CD2 1 
ATOM   4406 C CE1 . PHE C 1 144 ? 1.132   -1.029  84.647  1.00 16.86  ? 144 PHE A CE1 1 
ATOM   4407 C CE2 . PHE C 1 144 ? 0.752   -3.078  83.475  1.00 22.75  ? 144 PHE A CE2 1 
ATOM   4408 C CZ  . PHE C 1 144 ? 0.439   -1.750  83.697  1.00 21.56  ? 144 PHE A CZ  1 
ATOM   4409 N N   . TYR C 1 145 ? 4.959   -5.517  83.971  1.00 27.13  ? 145 TYR A N   1 
ATOM   4410 C CA  . TYR C 1 145 ? 4.927   -6.322  82.756  1.00 29.89  ? 145 TYR A CA  1 
ATOM   4411 C C   . TYR C 1 145 ? 4.441   -7.724  83.095  1.00 29.87  ? 145 TYR A C   1 
ATOM   4412 O O   . TYR C 1 145 ? 4.839   -8.294  84.112  1.00 34.82  ? 145 TYR A O   1 
ATOM   4413 C CB  . TYR C 1 145 ? 6.325   -6.397  82.125  1.00 27.99  ? 145 TYR A CB  1 
ATOM   4414 C CG  . TYR C 1 145 ? 6.317   -7.067  80.770  1.00 24.47  ? 145 TYR A CG  1 
ATOM   4415 C CD1 . TYR C 1 145 ? 6.412   -8.447  80.662  1.00 21.64  ? 145 TYR A CD1 1 
ATOM   4416 C CD2 . TYR C 1 145 ? 6.136   -6.325  79.606  1.00 19.91  ? 145 TYR A CD2 1 
ATOM   4417 C CE1 . TYR C 1 145 ? 6.318   -9.085  79.433  1.00 26.19  ? 145 TYR A CE1 1 
ATOM   4418 C CE2 . TYR C 1 145 ? 6.041   -6.962  78.356  1.00 22.20  ? 145 TYR A CE2 1 
ATOM   4419 C CZ  . TYR C 1 145 ? 6.129   -8.337  78.286  1.00 21.50  ? 145 TYR A CZ  1 
ATOM   4420 O OH  . TYR C 1 145 ? 5.995   -8.984  77.082  1.00 29.96  ? 145 TYR A OH  1 
ATOM   4421 N N   . PRO C 1 146 ? 3.550   -8.295  82.266  1.00 31.32  ? 146 PRO A N   1 
ATOM   4422 C CA  . PRO C 1 146 ? 2.940   -7.759  81.042  1.00 31.31  ? 146 PRO A CA  1 
ATOM   4423 C C   . PRO C 1 146 ? 1.978   -6.588  81.251  1.00 33.92  ? 146 PRO A C   1 
ATOM   4424 O O   . PRO C 1 146 ? 1.803   -6.099  82.366  1.00 29.86  ? 146 PRO A O   1 
ATOM   4425 C CB  . PRO C 1 146 ? 2.238   -8.967  80.420  1.00 32.08  ? 146 PRO A CB  1 
ATOM   4426 C CG  . PRO C 1 146 ? 2.062   -9.936  81.534  1.00 32.42  ? 146 PRO A CG  1 
ATOM   4427 C CD  . PRO C 1 146 ? 3.143   -9.685  82.531  1.00 33.72  ? 146 PRO A CD  1 
ATOM   4428 N N   . ARG C 1 147 ? 1.352   -6.142  80.168  1.00 31.73  ? 147 ARG A N   1 
ATOM   4429 C CA  . ARG C 1 147 ? 0.434   -5.011  80.241  1.00 34.48  ? 147 ARG A CA  1 
ATOM   4430 C C   . ARG C 1 147 ? -0.804  -5.277  81.062  1.00 32.29  ? 147 ARG A C   1 
ATOM   4431 O O   . ARG C 1 147 ? -1.300  -4.385  81.742  1.00 30.41  ? 147 ARG A O   1 
ATOM   4432 C CB  . ARG C 1 147 ? -0.015  -4.578  78.847  1.00 32.00  ? 147 ARG A CB  1 
ATOM   4433 C CG  . ARG C 1 147 ? -0.979  -3.406  78.893  1.00 40.40  ? 147 ARG A CG  1 
ATOM   4434 C CD  . ARG C 1 147 ? -0.553  -2.282  77.983  1.00 49.68  ? 147 ARG A CD  1 
ATOM   4435 N NE  . ARG C 1 147 ? -0.945  -2.535  76.602  1.00 65.19  ? 147 ARG A NE  1 
ATOM   4436 C CZ  . ARG C 1 147 ? -1.489  -1.625  75.801  1.00 73.00  ? 147 ARG A CZ  1 
ATOM   4437 N NH1 . ARG C 1 147 ? -1.705  -0.395  76.244  1.00 75.68  ? 147 ARG A NH1 1 
ATOM   4438 N NH2 . ARG C 1 147 ? -1.816  -1.945  74.556  1.00 77.93  ? 147 ARG A NH2 1 
ATOM   4439 N N   . GLU C 1 148 ? -1.305  -6.504  80.983  1.00 36.56  ? 148 GLU A N   1 
ATOM   4440 C CA  . GLU C 1 148 ? -2.513  -6.882  81.695  1.00 41.76  ? 148 GLU A CA  1 
ATOM   4441 C C   . GLU C 1 148 ? -2.426  -6.603  83.178  1.00 38.63  ? 148 GLU A C   1 
ATOM   4442 O O   . GLU C 1 148 ? -1.586  -7.161  83.888  1.00 37.03  ? 148 GLU A O   1 
ATOM   4443 C CB  . GLU C 1 148 ? -2.820  -8.359  81.458  1.00 49.52  ? 148 GLU A CB  1 
ATOM   4444 C CG  . GLU C 1 148 ? -2.827  -8.742  79.992  1.00 66.29  ? 148 GLU A CG  1 
ATOM   4445 C CD  . GLU C 1 148 ? -1.492  -9.293  79.530  1.00 75.58  ? 148 GLU A CD  1 
ATOM   4446 O OE1 . GLU C 1 148 ? -0.959  -10.200 80.204  1.00 82.64  ? 148 GLU A OE1 1 
ATOM   4447 O OE2 . GLU C 1 148 ? -0.978  -8.820  78.494  1.00 78.38  ? 148 GLU A OE2 1 
ATOM   4448 N N   . ALA C 1 149 ? -3.304  -5.716  83.626  1.00 35.41  ? 149 ALA A N   1 
ATOM   4449 C CA  . ALA C 1 149 ? -3.387  -5.333  85.019  1.00 37.29  ? 149 ALA A CA  1 
ATOM   4450 C C   . ALA C 1 149 ? -4.869  -5.178  85.314  1.00 38.43  ? 149 ALA A C   1 
ATOM   4451 O O   . ALA C 1 149 ? -5.670  -5.002  84.392  1.00 43.89  ? 149 ALA A O   1 
ATOM   4452 C CB  . ALA C 1 149 ? -2.670  -4.015  85.244  1.00 36.04  ? 149 ALA A CB  1 
ATOM   4453 N N   . LYS C 1 150 ? -5.234  -5.243  86.589  1.00 41.45  ? 150 LYS A N   1 
ATOM   4454 C CA  . LYS C 1 150 ? -6.633  -5.103  86.979  1.00 39.16  ? 150 LYS A CA  1 
ATOM   4455 C C   . LYS C 1 150 ? -6.717  -4.219  88.204  1.00 37.30  ? 150 LYS A C   1 
ATOM   4456 O O   . LYS C 1 150 ? -6.265  -4.597  89.283  1.00 41.10  ? 150 LYS A O   1 
ATOM   4457 C CB  . LYS C 1 150 ? -7.229  -6.476  87.284  1.00 44.50  ? 150 LYS A CB  1 
ATOM   4458 C CG  . LYS C 1 150 ? -8.699  -6.594  86.958  1.00 45.60  ? 150 LYS A CG  1 
ATOM   4459 C CD  . LYS C 1 150 ? -9.541  -6.172  88.144  1.00 49.21  ? 150 LYS A CD  1 
ATOM   4460 C CE  . LYS C 1 150 ? -9.678  -7.308  89.142  1.00 58.00  ? 150 LYS A CE  1 
ATOM   4461 N NZ  . LYS C 1 150 ? -10.200 -8.551  88.496  1.00 61.58  ? 150 LYS A NZ  1 
ATOM   4462 N N   . VAL C 1 151 ? -7.293  -3.037  88.040  1.00 37.01  ? 151 VAL A N   1 
ATOM   4463 C CA  . VAL C 1 151 ? -7.423  -2.099  89.151  1.00 40.21  ? 151 VAL A CA  1 
ATOM   4464 C C   . VAL C 1 151 ? -8.884  -1.900  89.578  1.00 41.85  ? 151 VAL A C   1 
ATOM   4465 O O   . VAL C 1 151 ? -9.684  -1.293  88.859  1.00 40.74  ? 151 VAL A O   1 
ATOM   4466 C CB  . VAL C 1 151 ? -6.810  -0.729  88.782  1.00 42.04  ? 151 VAL A CB  1 
ATOM   4467 C CG1 . VAL C 1 151 ? -6.577  0.101   90.040  1.00 40.97  ? 151 VAL A CG1 1 
ATOM   4468 C CG2 . VAL C 1 151 ? -5.494  -0.939  88.017  1.00 41.19  ? 151 VAL A CG2 1 
ATOM   4469 N N   . GLN C 1 152 ? -9.224  -2.406  90.759  1.00 41.00  ? 152 GLN A N   1 
ATOM   4470 C CA  . GLN C 1 152 ? -10.586 -2.287  91.274  1.00 40.46  ? 152 GLN A CA  1 
ATOM   4471 C C   . GLN C 1 152 ? -10.677 -1.240  92.363  1.00 37.85  ? 152 GLN A C   1 
ATOM   4472 O O   . GLN C 1 152 ? -9.907  -1.260  93.331  1.00 34.02  ? 152 GLN A O   1 
ATOM   4473 C CB  . GLN C 1 152 ? -11.068 -3.630  91.822  1.00 42.83  ? 152 GLN A CB  1 
ATOM   4474 C CG  . GLN C 1 152 ? -11.079 -4.750  90.790  1.00 52.84  ? 152 GLN A CG  1 
ATOM   4475 C CD  . GLN C 1 152 ? -12.475 -5.293  90.522  1.00 59.74  ? 152 GLN A CD  1 
ATOM   4476 O OE1 . GLN C 1 152 ? -13.207 -4.764  89.686  1.00 63.60  ? 152 GLN A OE1 1 
ATOM   4477 N NE2 . GLN C 1 152 ? -12.848 -6.358  91.230  1.00 59.14  ? 152 GLN A NE2 1 
ATOM   4478 N N   . TRP C 1 153 ? -11.614 -0.315  92.200  1.00 33.43  ? 153 TRP A N   1 
ATOM   4479 C CA  . TRP C 1 153 ? -11.804 0.732   93.188  1.00 36.97  ? 153 TRP A CA  1 
ATOM   4480 C C   . TRP C 1 153 ? -12.861 0.311   94.215  1.00 39.52  ? 153 TRP A C   1 
ATOM   4481 O O   . TRP C 1 153 ? -13.871 -0.316  93.870  1.00 35.25  ? 153 TRP A O   1 
ATOM   4482 C CB  . TRP C 1 153 ? -12.224 2.031   92.499  1.00 32.25  ? 153 TRP A CB  1 
ATOM   4483 C CG  . TRP C 1 153 ? -11.093 2.787   91.846  1.00 30.86  ? 153 TRP A CG  1 
ATOM   4484 C CD1 . TRP C 1 153 ? -10.815 2.847   90.508  1.00 30.73  ? 153 TRP A CD1 1 
ATOM   4485 C CD2 . TRP C 1 153 ? -10.136 3.643   92.490  1.00 27.81  ? 153 TRP A CD2 1 
ATOM   4486 N NE1 . TRP C 1 153 ? -9.760  3.686   90.282  1.00 27.01  ? 153 TRP A NE1 1 
ATOM   4487 C CE2 . TRP C 1 153 ? -9.322  4.190   91.479  1.00 29.38  ? 153 TRP A CE2 1 
ATOM   4488 C CE3 . TRP C 1 153 ? -9.889  4.002   93.824  1.00 27.78  ? 153 TRP A CE3 1 
ATOM   4489 C CZ2 . TRP C 1 153 ? -8.274  5.082   91.757  1.00 26.90  ? 153 TRP A CZ2 1 
ATOM   4490 C CZ3 . TRP C 1 153 ? -8.848  4.893   94.097  1.00 25.79  ? 153 TRP A CZ3 1 
ATOM   4491 C CH2 . TRP C 1 153 ? -8.058  5.420   93.065  1.00 27.69  ? 153 TRP A CH2 1 
ATOM   4492 N N   . LYS C 1 154 ? -12.606 0.645   95.477  1.00 38.53  ? 154 LYS A N   1 
ATOM   4493 C CA  . LYS C 1 154 ? -13.515 0.332   96.571  1.00 41.05  ? 154 LYS A CA  1 
ATOM   4494 C C   . LYS C 1 154 ? -13.637 1.557   97.455  1.00 41.88  ? 154 LYS A C   1 
ATOM   4495 O O   . LYS C 1 154 ? -12.628 2.113   97.881  1.00 40.73  ? 154 LYS A O   1 
ATOM   4496 C CB  . LYS C 1 154 ? -12.979 -0.830  97.418  1.00 42.52  ? 154 LYS A CB  1 
ATOM   4497 C CG  . LYS C 1 154 ? -12.911 -2.166  96.700  1.00 45.37  ? 154 LYS A CG  1 
ATOM   4498 C CD  . LYS C 1 154 ? -12.923 -3.306  97.701  1.00 50.31  ? 154 LYS A CD  1 
ATOM   4499 C CE  . LYS C 1 154 ? -11.511 -3.756  98.034  1.00 52.83  ? 154 LYS A CE  1 
ATOM   4500 N NZ  . LYS C 1 154 ? -11.475 -4.826  99.075  1.00 55.97  ? 154 LYS A NZ  1 
ATOM   4501 N N   . VAL C 1 155 ? -14.871 1.992   97.699  1.00 40.41  ? 155 VAL A N   1 
ATOM   4502 C CA  . VAL C 1 155 ? -15.138 3.138   98.561  1.00 40.20  ? 155 VAL A CA  1 
ATOM   4503 C C   . VAL C 1 155 ? -15.898 2.513   99.725  1.00 41.76  ? 155 VAL A C   1 
ATOM   4504 O O   . VAL C 1 155 ? -17.011 2.019   99.543  1.00 45.16  ? 155 VAL A O   1 
ATOM   4505 C CB  . VAL C 1 155 ? -16.022 4.195   97.857  1.00 37.58  ? 155 VAL A CB  1 
ATOM   4506 C CG1 . VAL C 1 155 ? -16.279 5.374   98.790  1.00 34.97  ? 155 VAL A CG1 1 
ATOM   4507 C CG2 . VAL C 1 155 ? -15.336 4.682   96.584  1.00 36.66  ? 155 VAL A CG2 1 
ATOM   4508 N N   . ASP C 1 156 ? -15.274 2.512   100.903 1.00 39.88  ? 156 ASP A N   1 
ATOM   4509 C CA  . ASP C 1 156 ? -15.842 1.909   102.108 1.00 38.42  ? 156 ASP A CA  1 
ATOM   4510 C C   . ASP C 1 156 ? -16.209 0.470   101.826 1.00 37.86  ? 156 ASP A C   1 
ATOM   4511 O O   . ASP C 1 156 ? -17.289 0.015   102.174 1.00 40.45  ? 156 ASP A O   1 
ATOM   4512 C CB  . ASP C 1 156 ? -17.066 2.687   102.584 1.00 33.61  ? 156 ASP A CB  1 
ATOM   4513 C CG  . ASP C 1 156 ? -16.683 3.997   103.223 1.00 31.80  ? 156 ASP A CG  1 
ATOM   4514 O OD1 . ASP C 1 156 ? -15.599 4.054   103.840 1.00 35.86  ? 156 ASP A OD1 1 
ATOM   4515 O OD2 . ASP C 1 156 ? -17.445 4.966   103.101 1.00 32.33  ? 156 ASP A OD2 1 
ATOM   4516 N N   . ASN C 1 157 ? -15.284 -0.231  101.179 1.00 37.12  ? 157 ASN A N   1 
ATOM   4517 C CA  . ASN C 1 157 ? -15.433 -1.631  100.810 1.00 37.50  ? 157 ASN A CA  1 
ATOM   4518 C C   . ASN C 1 157 ? -16.412 -1.930  99.679  1.00 36.89  ? 157 ASN A C   1 
ATOM   4519 O O   . ASN C 1 157 ? -16.511 -3.076  99.242  1.00 37.59  ? 157 ASN A O   1 
ATOM   4520 C CB  . ASN C 1 157 ? -15.803 -2.465  102.033 1.00 47.97  ? 157 ASN A CB  1 
ATOM   4521 C CG  . ASN C 1 157 ? -14.807 -3.575  102.290 1.00 52.56  ? 157 ASN A CG  1 
ATOM   4522 O OD1 . ASN C 1 157 ? -14.671 -4.503  101.488 1.00 57.18  ? 157 ASN A OD1 1 
ATOM   4523 N ND2 . ASN C 1 157 ? -14.095 -3.483  103.406 1.00 56.09  ? 157 ASN A ND2 1 
ATOM   4524 N N   . ALA C 1 158 ? -17.116 -0.914  99.194  1.00 35.51  ? 158 ALA A N   1 
ATOM   4525 C CA  . ALA C 1 158 ? -18.081 -1.098  98.105  1.00 37.03  ? 158 ALA A CA  1 
ATOM   4526 C C   . ALA C 1 158 ? -17.378 -0.922  96.763  1.00 36.95  ? 158 ALA A C   1 
ATOM   4527 O O   . ALA C 1 158 ? -16.811 0.133   96.485  1.00 33.21  ? 158 ALA A O   1 
ATOM   4528 C CB  . ALA C 1 158 ? -19.224 -0.086  98.233  1.00 37.10  ? 158 ALA A CB  1 
ATOM   4529 N N   . LEU C 1 159 ? -17.422 -1.960  95.936  1.00 36.96  ? 159 LEU A N   1 
ATOM   4530 C CA  . LEU C 1 159 ? -16.774 -1.924  94.632  1.00 38.18  ? 159 LEU A CA  1 
ATOM   4531 C C   . LEU C 1 159 ? -17.374 -0.868  93.719  1.00 37.34  ? 159 LEU A C   1 
ATOM   4532 O O   . LEU C 1 159 ? -18.596 -0.795  93.555  1.00 39.42  ? 159 LEU A O   1 
ATOM   4533 C CB  . LEU C 1 159 ? -16.880 -3.295  93.974  1.00 46.83  ? 159 LEU A CB  1 
ATOM   4534 C CG  . LEU C 1 159 ? -16.366 -3.446  92.542  1.00 56.80  ? 159 LEU A CG  1 
ATOM   4535 C CD1 . LEU C 1 159 ? -14.921 -2.942  92.422  1.00 64.65  ? 159 LEU A CD1 1 
ATOM   4536 C CD2 . LEU C 1 159 ? -16.448 -4.912  92.154  1.00 62.59  ? 159 LEU A CD2 1 
ATOM   4537 N N   . GLN C 1 160 ? -16.516 -0.052  93.118  1.00 30.93  ? 160 GLN A N   1 
ATOM   4538 C CA  . GLN C 1 160 ? -16.969 1.002   92.218  1.00 25.78  ? 160 GLN A CA  1 
ATOM   4539 C C   . GLN C 1 160 ? -17.008 0.514   90.792  1.00 28.57  ? 160 GLN A C   1 
ATOM   4540 O O   . GLN C 1 160 ? -16.328 -0.445  90.425  1.00 30.08  ? 160 GLN A O   1 
ATOM   4541 C CB  . GLN C 1 160 ? -16.063 2.227   92.302  1.00 22.50  ? 160 GLN A CB  1 
ATOM   4542 C CG  . GLN C 1 160 ? -15.984 2.862   93.672  1.00 22.95  ? 160 GLN A CG  1 
ATOM   4543 C CD  . GLN C 1 160 ? -17.305 3.382   94.166  1.00 23.47  ? 160 GLN A CD  1 
ATOM   4544 O OE1 . GLN C 1 160 ? -17.685 4.510   93.871  1.00 34.21  ? 160 GLN A OE1 1 
ATOM   4545 N NE2 . GLN C 1 160 ? -18.009 2.570   94.936  1.00 30.93  ? 160 GLN A NE2 1 
ATOM   4546 N N   . SER C 1 161 ? -17.821 1.178   89.982  1.00 31.64  ? 161 SER A N   1 
ATOM   4547 C CA  . SER C 1 161 ? -17.937 0.813   88.586  1.00 34.15  ? 161 SER A CA  1 
ATOM   4548 C C   . SER C 1 161 ? -18.491 1.976   87.784  1.00 36.22  ? 161 SER A C   1 
ATOM   4549 O O   . SER C 1 161 ? -19.391 2.686   88.233  1.00 38.44  ? 161 SER A O   1 
ATOM   4550 C CB  . SER C 1 161 ? -18.833 -0.417  88.438  1.00 37.21  ? 161 SER A CB  1 
ATOM   4551 O OG  . SER C 1 161 ? -19.715 -0.267  87.345  1.00 41.85  ? 161 SER A OG  1 
ATOM   4552 N N   . GLY C 1 162 ? -17.924 2.187   86.601  1.00 35.74  ? 162 GLY A N   1 
ATOM   4553 C CA  . GLY C 1 162 ? -18.384 3.264   85.748  1.00 29.10  ? 162 GLY A CA  1 
ATOM   4554 C C   . GLY C 1 162 ? -17.892 4.663   86.075  1.00 29.22  ? 162 GLY A C   1 
ATOM   4555 O O   . GLY C 1 162 ? -18.041 5.565   85.236  1.00 26.74  ? 162 GLY A O   1 
ATOM   4556 N N   . ASN C 1 163 ? -17.321 4.873   87.263  1.00 23.04  ? 163 ASN A N   1 
ATOM   4557 C CA  . ASN C 1 163 ? -16.837 6.211   87.606  1.00 24.55  ? 163 ASN A CA  1 
ATOM   4558 C C   . ASN C 1 163 ? -15.309 6.405   87.598  1.00 26.68  ? 163 ASN A C   1 
ATOM   4559 O O   . ASN C 1 163 ? -14.784 7.315   88.240  1.00 23.76  ? 163 ASN A O   1 
ATOM   4560 C CB  . ASN C 1 163 ? -17.406 6.662   88.955  1.00 21.90  ? 163 ASN A CB  1 
ATOM   4561 C CG  . ASN C 1 163 ? -17.062 5.726   90.074  1.00 27.76  ? 163 ASN A CG  1 
ATOM   4562 O OD1 . ASN C 1 163 ? -16.750 4.549   89.854  1.00 33.31  ? 163 ASN A OD1 1 
ATOM   4563 N ND2 . ASN C 1 163 ? -17.115 6.240   91.298  1.00 30.95  ? 163 ASN A ND2 1 
ATOM   4564 N N   . SER C 1 164 ? -14.590 5.558   86.873  1.00 28.04  ? 164 SER A N   1 
ATOM   4565 C CA  . SER C 1 164 ? -13.140 5.732   86.791  1.00 27.42  ? 164 SER A CA  1 
ATOM   4566 C C   . SER C 1 164 ? -12.658 5.579   85.351  1.00 28.54  ? 164 SER A C   1 
ATOM   4567 O O   . SER C 1 164 ? -13.318 4.953   84.512  1.00 27.83  ? 164 SER A O   1 
ATOM   4568 C CB  . SER C 1 164 ? -12.415 4.746   87.707  1.00 21.88  ? 164 SER A CB  1 
ATOM   4569 O OG  . SER C 1 164 ? -12.644 3.418   87.301  1.00 29.77  ? 164 SER A OG  1 
ATOM   4570 N N   . GLN C 1 165 ? -11.521 6.193   85.059  1.00 28.26  ? 165 GLN A N   1 
ATOM   4571 C CA  . GLN C 1 165 ? -10.930 6.137   83.727  1.00 25.80  ? 165 GLN A CA  1 
ATOM   4572 C C   . GLN C 1 165 ? -9.434  5.852   83.916  1.00 30.10  ? 165 GLN A C   1 
ATOM   4573 O O   . GLN C 1 165 ? -8.792  6.408   84.815  1.00 27.20  ? 165 GLN A O   1 
ATOM   4574 C CB  . GLN C 1 165 ? -11.125 7.481   83.016  1.00 25.08  ? 165 GLN A CB  1 
ATOM   4575 C CG  . GLN C 1 165 ? -12.422 7.589   82.250  1.00 24.41  ? 165 GLN A CG  1 
ATOM   4576 C CD  . GLN C 1 165 ? -12.584 8.903   81.505  1.00 21.23  ? 165 GLN A CD  1 
ATOM   4577 O OE1 . GLN C 1 165 ? -12.471 9.995   82.079  1.00 23.38  ? 165 GLN A OE1 1 
ATOM   4578 N NE2 . GLN C 1 165 ? -12.853 8.803   80.219  1.00 23.27  ? 165 GLN A NE2 1 
ATOM   4579 N N   . GLU C 1 166 ? -8.884  4.972   83.089  1.00 27.97  ? 166 GLU A N   1 
ATOM   4580 C CA  . GLU C 1 166 ? -7.475  4.660   83.197  1.00 28.53  ? 166 GLU A CA  1 
ATOM   4581 C C   . GLU C 1 166 ? -6.713  4.910   81.904  1.00 26.98  ? 166 GLU A C   1 
ATOM   4582 O O   . GLU C 1 166 ? -7.255  4.790   80.800  1.00 19.12  ? 166 GLU A O   1 
ATOM   4583 C CB  . GLU C 1 166 ? -7.289  3.225   83.654  1.00 29.81  ? 166 GLU A CB  1 
ATOM   4584 C CG  . GLU C 1 166 ? -7.294  2.218   82.567  1.00 30.04  ? 166 GLU A CG  1 
ATOM   4585 C CD  . GLU C 1 166 ? -7.411  0.836   83.139  1.00 34.53  ? 166 GLU A CD  1 
ATOM   4586 O OE1 . GLU C 1 166 ? -7.678  0.738   84.352  1.00 39.45  ? 166 GLU A OE1 1 
ATOM   4587 O OE2 . GLU C 1 166 ? -7.239  -0.146  82.388  1.00 47.77  ? 166 GLU A OE2 1 
ATOM   4588 N N   . SER C 1 167 ? -5.447  5.271   82.071  1.00 24.85  ? 167 SER A N   1 
ATOM   4589 C CA  . SER C 1 167 ? -4.551  5.590   80.964  1.00 23.79  ? 167 SER A CA  1 
ATOM   4590 C C   . SER C 1 167 ? -3.326  4.714   81.134  1.00 22.65  ? 167 SER A C   1 
ATOM   4591 O O   . SER C 1 167 ? -2.947  4.412   82.260  1.00 23.69  ? 167 SER A O   1 
ATOM   4592 C CB  . SER C 1 167 ? -4.162  7.066   81.051  1.00 19.32  ? 167 SER A CB  1 
ATOM   4593 O OG  . SER C 1 167 ? -3.831  7.599   79.781  1.00 30.68  ? 167 SER A OG  1 
ATOM   4594 N N   . VAL C 1 168 ? -2.722  4.295   80.024  1.00 21.69  ? 168 VAL A N   1 
ATOM   4595 C CA  . VAL C 1 168 ? -1.536  3.438   80.057  1.00 27.85  ? 168 VAL A CA  1 
ATOM   4596 C C   . VAL C 1 168 ? -0.452  3.973   79.107  1.00 28.42  ? 168 VAL A C   1 
ATOM   4597 O O   . VAL C 1 168 ? -0.758  4.443   78.006  1.00 27.66  ? 168 VAL A O   1 
ATOM   4598 C CB  . VAL C 1 168 ? -1.897  1.994   79.655  1.00 27.76  ? 168 VAL A CB  1 
ATOM   4599 C CG1 . VAL C 1 168 ? -2.297  1.946   78.189  1.00 35.68  ? 168 VAL A CG1 1 
ATOM   4600 C CG2 . VAL C 1 168 ? -0.713  1.073   79.893  1.00 28.84  ? 168 VAL A CG2 1 
ATOM   4601 N N   . THR C 1 169 ? 0.810   3.922   79.533  1.00 27.23  ? 169 THR A N   1 
ATOM   4602 C CA  . THR C 1 169 ? 1.891   4.418   78.683  1.00 25.52  ? 169 THR A CA  1 
ATOM   4603 C C   . THR C 1 169 ? 2.410   3.341   77.731  1.00 26.97  ? 169 THR A C   1 
ATOM   4604 O O   . THR C 1 169 ? 2.122   2.149   77.898  1.00 29.47  ? 169 THR A O   1 
ATOM   4605 C CB  . THR C 1 169 ? 3.084   5.008   79.526  1.00 18.56  ? 169 THR A CB  1 
ATOM   4606 O OG1 . THR C 1 169 ? 3.516   4.077   80.516  1.00 19.04  ? 169 THR A OG1 1 
ATOM   4607 C CG2 . THR C 1 169 ? 2.655   6.295   80.214  1.00 20.96  ? 169 THR A CG2 1 
ATOM   4608 N N   . GLU C 1 170 ? 3.139   3.770   76.706  1.00 25.99  ? 170 GLU A N   1 
ATOM   4609 C CA  . GLU C 1 170 ? 3.723   2.848   75.732  1.00 31.61  ? 170 GLU A CA  1 
ATOM   4610 C C   . GLU C 1 170 ? 4.897   2.147   76.408  1.00 28.97  ? 170 GLU A C   1 
ATOM   4611 O O   . GLU C 1 170 ? 5.510   2.707   77.310  1.00 31.17  ? 170 GLU A O   1 
ATOM   4612 C CB  . GLU C 1 170 ? 4.222   3.622   74.503  1.00 34.52  ? 170 GLU A CB  1 
ATOM   4613 C CG  . GLU C 1 170 ? 3.106   4.180   73.611  1.00 40.64  ? 170 GLU A CG  1 
ATOM   4614 C CD  . GLU C 1 170 ? 1.981   3.189   73.389  1.00 45.85  ? 170 GLU A CD  1 
ATOM   4615 O OE1 . GLU C 1 170 ? 2.257   1.972   73.291  1.00 50.93  ? 170 GLU A OE1 1 
ATOM   4616 O OE2 . GLU C 1 170 ? 0.816   3.628   73.317  1.00 58.63  ? 170 GLU A OE2 1 
ATOM   4617 N N   . GLN C 1 171 ? 5.198   0.920   75.999  1.00 30.46  ? 171 GLN A N   1 
ATOM   4618 C CA  . GLN C 1 171 ? 6.307   0.187   76.601  1.00 28.84  ? 171 GLN A CA  1 
ATOM   4619 C C   . GLN C 1 171 ? 7.505   1.128   76.699  1.00 30.87  ? 171 GLN A C   1 
ATOM   4620 O O   . GLN C 1 171 ? 7.817   1.862   75.744  1.00 22.65  ? 171 GLN A O   1 
ATOM   4621 C CB  . GLN C 1 171 ? 6.660   -1.005  75.740  1.00 27.08  ? 171 GLN A CB  1 
ATOM   4622 C CG  . GLN C 1 171 ? 7.386   -2.111  76.450  1.00 27.49  ? 171 GLN A CG  1 
ATOM   4623 C CD  . GLN C 1 171 ? 7.375   -3.391  75.652  1.00 26.70  ? 171 GLN A CD  1 
ATOM   4624 O OE1 . GLN C 1 171 ? 7.694   -4.468  76.160  1.00 31.26  ? 171 GLN A OE1 1 
ATOM   4625 N NE2 . GLN C 1 171 ? 6.997   -3.282  74.400  1.00 21.43  ? 171 GLN A NE2 1 
ATOM   4626 N N   . ASP C 1 172 ? 8.151   1.144   77.860  1.00 31.83  ? 172 ASP A N   1 
ATOM   4627 C CA  . ASP C 1 172 ? 9.307   2.017   78.046  1.00 36.73  ? 172 ASP A CA  1 
ATOM   4628 C C   . ASP C 1 172 ? 10.448  1.559   77.135  1.00 34.41  ? 172 ASP A C   1 
ATOM   4629 O O   . ASP C 1 172 ? 10.664  0.364   76.945  1.00 36.12  ? 172 ASP A O   1 
ATOM   4630 C CB  . ASP C 1 172 ? 9.766   1.996   79.510  1.00 35.20  ? 172 ASP A CB  1 
ATOM   4631 C CG  . ASP C 1 172 ? 10.960  2.906   79.753  1.00 35.62  ? 172 ASP A CG  1 
ATOM   4632 O OD1 . ASP C 1 172 ? 10.749  4.115   80.004  1.00 32.49  ? 172 ASP A OD1 1 
ATOM   4633 O OD2 . ASP C 1 172 ? 12.110  2.413   79.686  1.00 29.77  ? 172 ASP A OD2 1 
ATOM   4634 N N   . SER C 1 173 ? 11.164  2.517   76.566  1.00 39.86  ? 173 SER A N   1 
ATOM   4635 C CA  . SER C 1 173 ? 12.279  2.214   75.675  1.00 43.36  ? 173 SER A CA  1 
ATOM   4636 C C   . SER C 1 173 ? 13.418  1.520   76.415  1.00 43.21  ? 173 SER A C   1 
ATOM   4637 O O   . SER C 1 173 ? 14.001  0.564   75.913  1.00 49.01  ? 173 SER A O   1 
ATOM   4638 C CB  . SER C 1 173 ? 12.792  3.501   75.038  1.00 42.88  ? 173 SER A CB  1 
ATOM   4639 O OG  . SER C 1 173 ? 12.583  4.598   75.908  1.00 50.87  ? 173 SER A OG  1 
ATOM   4640 N N   . LYS C 1 174 ? 13.725  2.000   77.614  1.00 40.51  ? 174 LYS A N   1 
ATOM   4641 C CA  . LYS C 1 174 ? 14.802  1.434   78.413  1.00 36.89  ? 174 LYS A CA  1 
ATOM   4642 C C   . LYS C 1 174 ? 14.484  0.079   79.037  1.00 37.80  ? 174 LYS A C   1 
ATOM   4643 O O   . LYS C 1 174 ? 15.134  -0.916  78.710  1.00 39.37  ? 174 LYS A O   1 
ATOM   4644 C CB  . LYS C 1 174 ? 15.205  2.429   79.505  1.00 39.24  ? 174 LYS A CB  1 
ATOM   4645 C CG  . LYS C 1 174 ? 16.565  3.087   79.285  1.00 51.51  ? 174 LYS A CG  1 
ATOM   4646 C CD  . LYS C 1 174 ? 16.491  4.480   78.663  1.00 57.24  ? 174 LYS A CD  1 
ATOM   4647 C CE  . LYS C 1 174 ? 16.990  5.569   79.623  1.00 62.39  ? 174 LYS A CE  1 
ATOM   4648 N NZ  . LYS C 1 174 ? 18.400  6.029   79.389  1.00 57.38  ? 174 LYS A NZ  1 
ATOM   4649 N N   . ASP C 1 175 ? 13.484  0.023   79.922  1.00 34.14  ? 175 ASP A N   1 
ATOM   4650 C CA  . ASP C 1 175 ? 13.149  -1.232  80.591  1.00 30.72  ? 175 ASP A CA  1 
ATOM   4651 C C   . ASP C 1 175 ? 11.971  -2.039  80.048  1.00 32.00  ? 175 ASP A C   1 
ATOM   4652 O O   . ASP C 1 175 ? 11.587  -3.048  80.643  1.00 33.15  ? 175 ASP A O   1 
ATOM   4653 C CB  . ASP C 1 175 ? 12.949  -0.989  82.095  1.00 33.50  ? 175 ASP A CB  1 
ATOM   4654 C CG  . ASP C 1 175 ? 11.748  -0.114  82.386  1.00 26.26  ? 175 ASP A CG  1 
ATOM   4655 O OD1 . ASP C 1 175 ? 10.742  -0.226  81.669  1.00 27.22  ? 175 ASP A OD1 1 
ATOM   4656 O OD2 . ASP C 1 175 ? 11.819  0.687   83.328  1.00 30.13  ? 175 ASP A OD2 1 
ATOM   4657 N N   . SER C 1 176 ? 11.380  -1.595  78.943  1.00 28.51  ? 176 SER A N   1 
ATOM   4658 C CA  . SER C 1 176 ? 10.285  -2.345  78.329  1.00 29.24  ? 176 SER A CA  1 
ATOM   4659 C C   . SER C 1 176 ? 9.018   -2.580  79.171  1.00 30.19  ? 176 SER A C   1 
ATOM   4660 O O   . SER C 1 176 ? 8.189   -3.422  78.815  1.00 31.74  ? 176 SER A O   1 
ATOM   4661 C CB  . SER C 1 176 ? 10.810  -3.701  77.855  1.00 28.85  ? 176 SER A CB  1 
ATOM   4662 O OG  . SER C 1 176 ? 11.674  -3.547  76.736  1.00 35.32  ? 176 SER A OG  1 
ATOM   4663 N N   . THR C 1 177 ? 8.864   -1.846  80.269  1.00 29.91  ? 177 THR A N   1 
ATOM   4664 C CA  . THR C 1 177 ? 7.681   -1.989  81.120  1.00 28.53  ? 177 THR A CA  1 
ATOM   4665 C C   . THR C 1 177 ? 6.567   -1.045  80.686  1.00 26.45  ? 177 THR A C   1 
ATOM   4666 O O   . THR C 1 177 ? 6.687   -0.330  79.701  1.00 27.91  ? 177 THR A O   1 
ATOM   4667 C CB  . THR C 1 177 ? 7.975   -1.656  82.588  1.00 21.21  ? 177 THR A CB  1 
ATOM   4668 O OG1 . THR C 1 177 ? 8.451   -0.304  82.682  1.00 21.87  ? 177 THR A OG1 1 
ATOM   4669 C CG2 . THR C 1 177 ? 8.987   -2.632  83.179  1.00 24.44  ? 177 THR A CG2 1 
ATOM   4670 N N   . TYR C 1 178 ? 5.473   -1.067  81.440  1.00 31.82  ? 178 TYR A N   1 
ATOM   4671 C CA  . TYR C 1 178 ? 4.315   -0.222  81.169  1.00 25.02  ? 178 TYR A CA  1 
ATOM   4672 C C   . TYR C 1 178 ? 3.938   0.403   82.493  1.00 28.09  ? 178 TYR A C   1 
ATOM   4673 O O   . TYR C 1 178 ? 4.289   -0.122  83.551  1.00 24.59  ? 178 TYR A O   1 
ATOM   4674 C CB  . TYR C 1 178 ? 3.108   -1.049  80.698  1.00 27.46  ? 178 TYR A CB  1 
ATOM   4675 C CG  . TYR C 1 178 ? 3.237   -1.730  79.359  1.00 22.90  ? 178 TYR A CG  1 
ATOM   4676 C CD1 . TYR C 1 178 ? 2.942   -1.057  78.173  1.00 25.42  ? 178 TYR A CD1 1 
ATOM   4677 C CD2 . TYR C 1 178 ? 3.613   -3.062  79.278  1.00 25.50  ? 178 TYR A CD2 1 
ATOM   4678 C CE1 . TYR C 1 178 ? 3.019   -1.708  76.946  1.00 20.81  ? 178 TYR A CE1 1 
ATOM   4679 C CE2 . TYR C 1 178 ? 3.689   -3.718  78.055  1.00 18.07  ? 178 TYR A CE2 1 
ATOM   4680 C CZ  . TYR C 1 178 ? 3.395   -3.041  76.905  1.00 21.04  ? 178 TYR A CZ  1 
ATOM   4681 O OH  . TYR C 1 178 ? 3.484   -3.696  75.705  1.00 28.18  ? 178 TYR A OH  1 
ATOM   4682 N N   . SER C 1 179 ? 3.244   1.534   82.432  1.00 30.61  ? 179 SER A N   1 
ATOM   4683 C CA  . SER C 1 179 ? 2.753   2.198   83.634  1.00 31.07  ? 179 SER A CA  1 
ATOM   4684 C C   . SER C 1 179 ? 1.297   2.571   83.343  1.00 30.01  ? 179 SER A C   1 
ATOM   4685 O O   . SER C 1 179 ? 0.910   2.744   82.180  1.00 23.80  ? 179 SER A O   1 
ATOM   4686 C CB  . SER C 1 179 ? 3.573   3.442   83.966  1.00 27.32  ? 179 SER A CB  1 
ATOM   4687 O OG  . SER C 1 179 ? 4.788   3.059   84.602  1.00 35.28  ? 179 SER A OG  1 
ATOM   4688 N N   . LEU C 1 180 ? 0.497   2.691   84.396  1.00 23.27  ? 180 LEU A N   1 
ATOM   4689 C CA  . LEU C 1 180 ? -0.916  2.987   84.236  1.00 25.02  ? 180 LEU A CA  1 
ATOM   4690 C C   . LEU C 1 180 ? -1.438  3.830   85.385  1.00 27.39  ? 180 LEU A C   1 
ATOM   4691 O O   . LEU C 1 180 ? -0.978  3.686   86.524  1.00 23.10  ? 180 LEU A O   1 
ATOM   4692 C CB  . LEU C 1 180 ? -1.691  1.670   84.168  1.00 22.56  ? 180 LEU A CB  1 
ATOM   4693 C CG  . LEU C 1 180 ? -3.226  1.651   84.235  1.00 25.09  ? 180 LEU A CG  1 
ATOM   4694 C CD1 . LEU C 1 180 ? -3.709  0.399   83.518  1.00 20.25  ? 180 LEU A CD1 1 
ATOM   4695 C CD2 . LEU C 1 180 ? -3.716  1.649   85.683  1.00 21.30  ? 180 LEU A CD2 1 
ATOM   4696 N N   . SER C 1 181 ? -2.372  4.725   85.069  1.00 25.00  ? 181 SER A N   1 
ATOM   4697 C CA  . SER C 1 181 ? -3.020  5.586   86.055  1.00 29.33  ? 181 SER A CA  1 
ATOM   4698 C C   . SER C 1 181 ? -4.525  5.339   85.965  1.00 29.58  ? 181 SER A C   1 
ATOM   4699 O O   . SER C 1 181 ? -5.081  5.278   84.866  1.00 32.77  ? 181 SER A O   1 
ATOM   4700 C CB  . SER C 1 181 ? -2.775  7.061   85.754  1.00 29.31  ? 181 SER A CB  1 
ATOM   4701 O OG  . SER C 1 181 ? -3.625  7.490   84.704  1.00 27.78  ? 181 SER A OG  1 
ATOM   4702 N N   . SER C 1 182 ? -5.180  5.169   87.107  1.00 27.60  ? 182 SER A N   1 
ATOM   4703 C CA  . SER C 1 182 ? -6.636  4.992   87.119  1.00 27.36  ? 182 SER A CA  1 
ATOM   4704 C C   . SER C 1 182 ? -7.177  6.086   88.008  1.00 27.27  ? 182 SER A C   1 
ATOM   4705 O O   . SER C 1 182 ? -6.834  6.174   89.185  1.00 30.87  ? 182 SER A O   1 
ATOM   4706 C CB  . SER C 1 182 ? -7.047  3.645   87.688  1.00 24.48  ? 182 SER A CB  1 
ATOM   4707 O OG  . SER C 1 182 ? -8.458  3.545   87.660  1.00 30.22  ? 182 SER A OG  1 
ATOM   4708 N N   . THR C 1 183 ? -7.992  6.951   87.436  1.00 26.33  ? 183 THR A N   1 
ATOM   4709 C CA  . THR C 1 183 ? -8.558  8.044   88.198  1.00 31.61  ? 183 THR A CA  1 
ATOM   4710 C C   . THR C 1 183 ? -10.019 7.771   88.545  1.00 34.29  ? 183 THR A C   1 
ATOM   4711 O O   . THR C 1 183 ? -10.829 7.467   87.674  1.00 31.27  ? 183 THR A O   1 
ATOM   4712 C CB  . THR C 1 183 ? -8.482  9.341   87.401  1.00 27.44  ? 183 THR A CB  1 
ATOM   4713 O OG1 . THR C 1 183 ? -7.169  9.470   86.869  1.00 33.51  ? 183 THR A OG1 1 
ATOM   4714 C CG2 . THR C 1 183 ? -8.791  10.557  88.283  1.00 19.95  ? 183 THR A CG2 1 
ATOM   4715 N N   . LEU C 1 184 ? -10.336 7.864   89.830  1.00 36.78  ? 184 LEU A N   1 
ATOM   4716 C CA  . LEU C 1 184 ? -11.700 7.674   90.291  1.00 33.33  ? 184 LEU A CA  1 
ATOM   4717 C C   . LEU C 1 184 ? -12.199 9.083   90.526  1.00 33.39  ? 184 LEU A C   1 
ATOM   4718 O O   . LEU C 1 184 ? -11.605 9.839   91.305  1.00 30.82  ? 184 LEU A O   1 
ATOM   4719 C CB  . LEU C 1 184 ? -11.728 6.907   91.609  1.00 31.48  ? 184 LEU A CB  1 
ATOM   4720 C CG  . LEU C 1 184 ? -13.115 6.846   92.268  1.00 30.74  ? 184 LEU A CG  1 
ATOM   4721 C CD1 . LEU C 1 184 ? -13.945 5.734   91.628  1.00 26.71  ? 184 LEU A CD1 1 
ATOM   4722 C CD2 . LEU C 1 184 ? -12.962 6.628   93.758  1.00 25.07  ? 184 LEU A CD2 1 
ATOM   4723 N N   . THR C 1 185 ? -13.283 9.454   89.865  1.00 33.77  ? 185 THR A N   1 
ATOM   4724 C CA  . THR C 1 185 ? -13.801 10.801  90.055  1.00 40.35  ? 185 THR A CA  1 
ATOM   4725 C C   . THR C 1 185 ? -15.160 10.814  90.750  1.00 38.14  ? 185 THR A C   1 
ATOM   4726 O O   . THR C 1 185 ? -16.022 9.972   90.479  1.00 34.32  ? 185 THR A O   1 
ATOM   4727 C CB  . THR C 1 185 ? -13.899 11.550  88.715  1.00 44.55  ? 185 THR A CB  1 
ATOM   4728 O OG1 . THR C 1 185 ? -13.462 10.693  87.650  1.00 50.32  ? 185 THR A OG1 1 
ATOM   4729 C CG2 . THR C 1 185 ? -13.017 12.794  88.752  1.00 50.19  ? 185 THR A CG2 1 
ATOM   4730 N N   . LEU C 1 186 ? -15.331 11.769  91.659  1.00 35.90  ? 186 LEU A N   1 
ATOM   4731 C CA  . LEU C 1 186 ? -16.576 11.906  92.408  1.00 36.26  ? 186 LEU A CA  1 
ATOM   4732 C C   . LEU C 1 186 ? -16.775 13.371  92.731  1.00 34.68  ? 186 LEU A C   1 
ATOM   4733 O O   . LEU C 1 186 ? -15.834 14.169  92.661  1.00 33.49  ? 186 LEU A O   1 
ATOM   4734 C CB  . LEU C 1 186 ? -16.519 11.116  93.722  1.00 39.96  ? 186 LEU A CB  1 
ATOM   4735 C CG  . LEU C 1 186 ? -15.786 9.777   93.768  1.00 47.19  ? 186 LEU A CG  1 
ATOM   4736 C CD1 . LEU C 1 186 ? -15.325 9.495   95.198  1.00 49.87  ? 186 LEU A CD1 1 
ATOM   4737 C CD2 . LEU C 1 186 ? -16.714 8.671   93.279  1.00 47.71  ? 186 LEU A CD2 1 
ATOM   4738 N N   . SER C 1 187 ? -18.004 13.737  93.070  1.00 34.12  ? 187 SER A N   1 
ATOM   4739 C CA  . SER C 1 187 ? -18.283 15.116  93.435  1.00 31.40  ? 187 SER A CA  1 
ATOM   4740 C C   . SER C 1 187 ? -17.755 15.251  94.866  1.00 29.41  ? 187 SER A C   1 
ATOM   4741 O O   . SER C 1 187 ? -17.615 14.246  95.572  1.00 27.59  ? 187 SER A O   1 
ATOM   4742 C CB  . SER C 1 187 ? -19.792 15.389  93.381  1.00 37.53  ? 187 SER A CB  1 
ATOM   4743 O OG  . SER C 1 187 ? -20.489 14.643  94.366  1.00 36.74  ? 187 SER A OG  1 
ATOM   4744 N N   . LYS C 1 188 ? -17.450 16.477  95.282  1.00 28.14  ? 188 LYS A N   1 
ATOM   4745 C CA  . LYS C 1 188 ? -16.929 16.721  96.625  1.00 35.08  ? 188 LYS A CA  1 
ATOM   4746 C C   . LYS C 1 188 ? -17.904 16.193  97.670  1.00 35.64  ? 188 LYS A C   1 
ATOM   4747 O O   . LYS C 1 188 ? -17.507 15.539  98.638  1.00 36.85  ? 188 LYS A O   1 
ATOM   4748 C CB  . LYS C 1 188 ? -16.697 18.220  96.814  1.00 36.82  ? 188 LYS A CB  1 
ATOM   4749 C CG  . LYS C 1 188 ? -16.190 18.642  98.176  1.00 41.11  ? 188 LYS A CG  1 
ATOM   4750 C CD  . LYS C 1 188 ? -16.446 20.132  98.381  1.00 43.76  ? 188 LYS A CD  1 
ATOM   4751 C CE  . LYS C 1 188 ? -15.733 20.678  99.611  1.00 47.39  ? 188 LYS A CE  1 
ATOM   4752 N NZ  . LYS C 1 188 ? -16.473 20.406  100.877 1.00 49.92  ? 188 LYS A NZ  1 
ATOM   4753 N N   . ALA C 1 189 ? -19.188 16.463  97.461  1.00 40.59  ? 189 ALA A N   1 
ATOM   4754 C CA  . ALA C 1 189 ? -20.221 16.009  98.389  1.00 42.12  ? 189 ALA A CA  1 
ATOM   4755 C C   . ALA C 1 189 ? -20.159 14.491  98.547  1.00 45.34  ? 189 ALA A C   1 
ATOM   4756 O O   . ALA C 1 189 ? -20.029 13.981  99.661  1.00 46.47  ? 189 ALA A O   1 
ATOM   4757 C CB  . ALA C 1 189 ? -21.589 16.436  97.889  1.00 38.21  ? 189 ALA A CB  1 
ATOM   4758 N N   . ASP C 1 190 ? -20.246 13.775  97.430  1.00 45.83  ? 190 ASP A N   1 
ATOM   4759 C CA  . ASP C 1 190 ? -20.178 12.319  97.459  1.00 50.06  ? 190 ASP A CA  1 
ATOM   4760 C C   . ASP C 1 190 ? -18.863 11.846  98.069  1.00 51.03  ? 190 ASP A C   1 
ATOM   4761 O O   . ASP C 1 190 ? -18.830 10.846  98.790  1.00 50.67  ? 190 ASP A O   1 
ATOM   4762 C CB  . ASP C 1 190 ? -20.321 11.763  96.047  1.00 57.15  ? 190 ASP A CB  1 
ATOM   4763 C CG  . ASP C 1 190 ? -21.758 11.752  95.577  1.00 66.21  ? 190 ASP A CG  1 
ATOM   4764 O OD1 . ASP C 1 190 ? -22.661 11.688  96.442  1.00 71.05  ? 190 ASP A OD1 1 
ATOM   4765 O OD2 . ASP C 1 190 ? -21.989 11.812  94.352  1.00 70.40  ? 190 ASP A OD2 1 
ATOM   4766 N N   . TYR C 1 191 ? -17.783 12.569  97.776  1.00 48.97  ? 191 TYR A N   1 
ATOM   4767 C CA  . TYR C 1 191 ? -16.461 12.236  98.298  1.00 44.79  ? 191 TYR A CA  1 
ATOM   4768 C C   . TYR C 1 191 ? -16.438 12.311  99.821  1.00 42.94  ? 191 TYR A C   1 
ATOM   4769 O O   . TYR C 1 191 ? -15.911 11.423  100.485 1.00 42.45  ? 191 TYR A O   1 
ATOM   4770 C CB  . TYR C 1 191 ? -15.402 13.191  97.732  1.00 41.78  ? 191 TYR A CB  1 
ATOM   4771 C CG  . TYR C 1 191 ? -14.026 12.969  98.330  1.00 30.33  ? 191 TYR A CG  1 
ATOM   4772 C CD1 . TYR C 1 191 ? -13.343 11.774  98.113  1.00 32.27  ? 191 TYR A CD1 1 
ATOM   4773 C CD2 . TYR C 1 191 ? -13.427 13.930  99.141  1.00 31.43  ? 191 TYR A CD2 1 
ATOM   4774 C CE1 . TYR C 1 191 ? -12.098 11.531  98.691  1.00 29.15  ? 191 TYR A CE1 1 
ATOM   4775 C CE2 . TYR C 1 191 ? -12.170 13.695  99.732  1.00 27.33  ? 191 TYR A CE2 1 
ATOM   4776 C CZ  . TYR C 1 191 ? -11.518 12.480  99.495  1.00 29.55  ? 191 TYR A CZ  1 
ATOM   4777 O OH  . TYR C 1 191 ? -10.307 12.180  100.083 1.00 28.17  ? 191 TYR A OH  1 
ATOM   4778 N N   . GLU C 1 192 ? -17.012 13.378  100.365 1.00 45.95  ? 192 GLU A N   1 
ATOM   4779 C CA  . GLU C 1 192 ? -17.060 13.578  101.812 1.00 47.78  ? 192 GLU A CA  1 
ATOM   4780 C C   . GLU C 1 192 ? -18.121 12.701  102.468 1.00 46.43  ? 192 GLU A C   1 
ATOM   4781 O O   . GLU C 1 192 ? -18.330 12.756  103.677 1.00 48.18  ? 192 GLU A O   1 
ATOM   4782 C CB  . GLU C 1 192 ? -17.335 15.048  102.125 1.00 44.17  ? 192 GLU A CB  1 
ATOM   4783 C CG  . GLU C 1 192 ? -16.068 15.838  102.416 1.00 49.46  ? 192 GLU A CG  1 
ATOM   4784 C CD  . GLU C 1 192 ? -16.127 17.257  101.895 1.00 50.88  ? 192 GLU A CD  1 
ATOM   4785 O OE1 . GLU C 1 192 ? -17.232 17.726  101.562 1.00 55.24  ? 192 GLU A OE1 1 
ATOM   4786 O OE2 . GLU C 1 192 ? -15.062 17.906  101.822 1.00 59.29  ? 192 GLU A OE2 1 
ATOM   4787 N N   . LYS C 1 193 ? -18.769 11.879  101.653 1.00 47.70  ? 193 LYS A N   1 
ATOM   4788 C CA  . LYS C 1 193 ? -19.813 10.973  102.103 1.00 47.94  ? 193 LYS A CA  1 
ATOM   4789 C C   . LYS C 1 193 ? -19.249 9.591   102.442 1.00 47.89  ? 193 LYS A C   1 
ATOM   4790 O O   . LYS C 1 193 ? -19.995 8.698   102.846 1.00 49.08  ? 193 LYS A O   1 
ATOM   4791 C CB  . LYS C 1 193 ? -20.874 10.833  101.004 1.00 47.67  ? 193 LYS A CB  1 
ATOM   4792 C CG  . LYS C 1 193 ? -22.305 11.090  101.446 1.00 51.92  ? 193 LYS A CG  1 
ATOM   4793 C CD  . LYS C 1 193 ? -23.223 11.309  100.243 1.00 57.57  ? 193 LYS A CD  1 
ATOM   4794 C CE  . LYS C 1 193 ? -23.628 9.987   99.588  1.00 61.39  ? 193 LYS A CE  1 
ATOM   4795 N NZ  . LYS C 1 193 ? -22.762 9.635   98.418  1.00 63.64  ? 193 LYS A NZ  1 
ATOM   4796 N N   . HIS C 1 194 ? -17.940 9.403   102.283 1.00 42.99  ? 194 HIS A N   1 
ATOM   4797 C CA  . HIS C 1 194 ? -17.346 8.100   102.572 1.00 37.77  ? 194 HIS A CA  1 
ATOM   4798 C C   . HIS C 1 194 ? -16.011 8.130   103.306 1.00 33.85  ? 194 HIS A C   1 
ATOM   4799 O O   . HIS C 1 194 ? -15.339 9.148   103.354 1.00 32.63  ? 194 HIS A O   1 
ATOM   4800 C CB  . HIS C 1 194 ? -17.200 7.309   101.283 1.00 41.22  ? 194 HIS A CB  1 
ATOM   4801 C CG  . HIS C 1 194 ? -18.503 6.873   100.693 1.00 46.74  ? 194 HIS A CG  1 
ATOM   4802 N ND1 . HIS C 1 194 ? -19.163 7.605   99.729  1.00 48.76  ? 194 HIS A ND1 1 
ATOM   4803 C CD2 . HIS C 1 194 ? -19.254 5.766   100.908 1.00 44.53  ? 194 HIS A CD2 1 
ATOM   4804 C CE1 . HIS C 1 194 ? -20.263 6.965   99.374  1.00 48.78  ? 194 HIS A CE1 1 
ATOM   4805 N NE2 . HIS C 1 194 ? -20.340 5.848   100.074 1.00 48.79  ? 194 HIS A NE2 1 
ATOM   4806 N N   . LYS C 1 195 ? -15.624 6.979   103.847 1.00 34.55  ? 195 LYS A N   1 
ATOM   4807 C CA  . LYS C 1 195 ? -14.396 6.856   104.628 1.00 36.42  ? 195 LYS A CA  1 
ATOM   4808 C C   . LYS C 1 195 ? -13.167 6.355   103.886 1.00 31.80  ? 195 LYS A C   1 
ATOM   4809 O O   . LYS C 1 195 ? -12.282 7.124   103.557 1.00 26.93  ? 195 LYS A O   1 
ATOM   4810 C CB  . LYS C 1 195 ? -14.643 5.940   105.826 1.00 40.53  ? 195 LYS A CB  1 
ATOM   4811 C CG  . LYS C 1 195 ? -14.137 6.474   107.149 1.00 44.07  ? 195 LYS A CG  1 
ATOM   4812 C CD  . LYS C 1 195 ? -14.589 5.568   108.287 1.00 52.12  ? 195 LYS A CD  1 
ATOM   4813 C CE  . LYS C 1 195 ? -16.025 5.874   108.724 1.00 55.91  ? 195 LYS A CE  1 
ATOM   4814 N NZ  . LYS C 1 195 ? -17.048 4.955   108.130 1.00 50.75  ? 195 LYS A NZ  1 
ATOM   4815 N N   . VAL C 1 196 ? -13.116 5.052   103.652 1.00 33.86  ? 196 VAL A N   1 
ATOM   4816 C CA  . VAL C 1 196 ? -11.992 4.438   102.982 1.00 35.78  ? 196 VAL A CA  1 
ATOM   4817 C C   . VAL C 1 196 ? -12.097 4.429   101.472 1.00 37.60  ? 196 VAL A C   1 
ATOM   4818 O O   . VAL C 1 196 ? -13.132 4.093   100.895 1.00 38.22  ? 196 VAL A O   1 
ATOM   4819 C CB  . VAL C 1 196 ? -11.783 2.987   103.444 1.00 38.08  ? 196 VAL A CB  1 
ATOM   4820 C CG1 . VAL C 1 196 ? -10.492 2.882   104.222 1.00 39.21  ? 196 VAL A CG1 1 
ATOM   4821 C CG2 . VAL C 1 196 ? -12.960 2.534   104.300 1.00 44.61  ? 196 VAL A CG2 1 
ATOM   4822 N N   . TYR C 1 197 ? -10.990 4.800   100.845 1.00 36.99  ? 197 TYR A N   1 
ATOM   4823 C CA  . TYR C 1 197 ? -10.868 4.843   99.401  1.00 29.82  ? 197 TYR A CA  1 
ATOM   4824 C C   . TYR C 1 197 ? -9.696  3.923   99.099  1.00 34.40  ? 197 TYR A C   1 
ATOM   4825 O O   . TYR C 1 197 ? -8.579  4.138   99.588  1.00 28.73  ? 197 TYR A O   1 
ATOM   4826 C CB  . TYR C 1 197 ? -10.585 6.275   98.969  1.00 29.41  ? 197 TYR A CB  1 
ATOM   4827 C CG  . TYR C 1 197 ? -11.817 7.135   98.993  1.00 30.01  ? 197 TYR A CG  1 
ATOM   4828 C CD1 . TYR C 1 197 ? -12.733 7.099   97.942  1.00 33.10  ? 197 TYR A CD1 1 
ATOM   4829 C CD2 . TYR C 1 197 ? -12.092 7.966   100.079 1.00 30.21  ? 197 TYR A CD2 1 
ATOM   4830 C CE1 . TYR C 1 197 ? -13.895 7.867   97.968  1.00 34.85  ? 197 TYR A CE1 1 
ATOM   4831 C CE2 . TYR C 1 197 ? -13.244 8.740   100.121 1.00 25.90  ? 197 TYR A CE2 1 
ATOM   4832 C CZ  . TYR C 1 197 ? -14.149 8.685   99.055  1.00 35.06  ? 197 TYR A CZ  1 
ATOM   4833 O OH  . TYR C 1 197 ? -15.314 9.438   99.060  1.00 36.81  ? 197 TYR A OH  1 
ATOM   4834 N N   . ALA C 1 198 ? -9.965  2.877   98.323  1.00 34.55  ? 198 ALA A N   1 
ATOM   4835 C CA  . ALA C 1 198 ? -8.947  1.903   97.992  1.00 35.15  ? 198 ALA A CA  1 
ATOM   4836 C C   . ALA C 1 198 ? -8.952  1.441   96.551  1.00 37.33  ? 198 ALA A C   1 
ATOM   4837 O O   . ALA C 1 198 ? -10.000 1.355   95.914  1.00 33.43  ? 198 ALA A O   1 
ATOM   4838 C CB  . ALA C 1 198 ? -9.097  0.700   98.887  1.00 31.34  ? 198 ALA A CB  1 
ATOM   4839 N N   . CYS C 1 199 ? -7.762  1.161   96.033  1.00 35.34  ? 199 CYS A N   1 
ATOM   4840 C CA  . CYS C 1 199 ? -7.656  0.630   94.691  1.00 39.03  ? 199 CYS A CA  1 
ATOM   4841 C C   . CYS C 1 199 ? -6.860  -0.647  94.860  1.00 37.92  ? 199 CYS A C   1 
ATOM   4842 O O   . CYS C 1 199 ? -5.775  -0.656  95.441  1.00 40.72  ? 199 CYS A O   1 
ATOM   4843 C CB  . CYS C 1 199 ? -6.971  1.609   93.726  1.00 44.17  ? 199 CYS A CB  1 
ATOM   4844 S SG  . CYS C 1 199 ? -5.243  2.034   94.073  1.00 48.17  ? 199 CYS A SG  1 
ATOM   4845 N N   . GLU C 1 200 ? -7.439  -1.736  94.387  1.00 38.54  ? 200 GLU A N   1 
ATOM   4846 C CA  . GLU C 1 200 ? -6.825  -3.041  94.483  1.00 39.72  ? 200 GLU A CA  1 
ATOM   4847 C C   . GLU C 1 200 ? -6.312  -3.454  93.123  1.00 36.97  ? 200 GLU A C   1 
ATOM   4848 O O   . GLU C 1 200 ? -7.088  -3.671  92.192  1.00 34.87  ? 200 GLU A O   1 
ATOM   4849 C CB  . GLU C 1 200 ? -7.853  -4.066  94.969  1.00 42.10  ? 200 GLU A CB  1 
ATOM   4850 C CG  . GLU C 1 200 ? -7.328  -5.488  95.011  1.00 55.43  ? 200 GLU A CG  1 
ATOM   4851 C CD  . GLU C 1 200 ? -8.262  -6.425  95.751  1.00 66.20  ? 200 GLU A CD  1 
ATOM   4852 O OE1 . GLU C 1 200 ? -9.497  -6.249  95.641  1.00 70.67  ? 200 GLU A OE1 1 
ATOM   4853 O OE2 . GLU C 1 200 ? -7.761  -7.339  96.443  1.00 68.97  ? 200 GLU A OE2 1 
ATOM   4854 N N   . VAL C 1 201 ? -4.996  -3.561  93.010  1.00 39.33  ? 201 VAL A N   1 
ATOM   4855 C CA  . VAL C 1 201 ? -4.388  -3.956  91.754  1.00 36.54  ? 201 VAL A CA  1 
ATOM   4856 C C   . VAL C 1 201 ? -4.128  -5.451  91.814  1.00 35.78  ? 201 VAL A C   1 
ATOM   4857 O O   . VAL C 1 201 ? -3.716  -5.980  92.843  1.00 36.48  ? 201 VAL A O   1 
ATOM   4858 C CB  . VAL C 1 201 ? -3.058  -3.211  91.526  1.00 40.44  ? 201 VAL A CB  1 
ATOM   4859 C CG1 . VAL C 1 201 ? -2.384  -3.721  90.271  1.00 29.47  ? 201 VAL A CG1 1 
ATOM   4860 C CG2 . VAL C 1 201 ? -3.314  -1.712  91.441  1.00 39.10  ? 201 VAL A CG2 1 
ATOM   4861 N N   . THR C 1 202 ? -4.411  -6.139  90.722  1.00 35.46  ? 202 THR A N   1 
ATOM   4862 C CA  . THR C 1 202 ? -4.166  -7.567  90.653  1.00 41.52  ? 202 THR A CA  1 
ATOM   4863 C C   . THR C 1 202 ? -3.429  -7.797  89.327  1.00 45.88  ? 202 THR A C   1 
ATOM   4864 O O   . THR C 1 202 ? -4.016  -7.755  88.246  1.00 50.49  ? 202 THR A O   1 
ATOM   4865 C CB  . THR C 1 202 ? -5.494  -8.368  90.740  1.00 45.22  ? 202 THR A CB  1 
ATOM   4866 O OG1 . THR C 1 202 ? -5.873  -8.828  89.440  1.00 54.75  ? 202 THR A OG1 1 
ATOM   4867 C CG2 . THR C 1 202 ? -6.617  -7.498  91.315  1.00 42.89  ? 202 THR A CG2 1 
ATOM   4868 N N   . HIS C 1 203 ? -2.120  -8.005  89.428  1.00 47.27  ? 203 HIS A N   1 
ATOM   4869 C CA  . HIS C 1 203 ? -1.269  -8.205  88.259  1.00 46.62  ? 203 HIS A CA  1 
ATOM   4870 C C   . HIS C 1 203 ? -0.544  -9.550  88.317  1.00 46.44  ? 203 HIS A C   1 
ATOM   4871 O O   . HIS C 1 203 ? -0.218  -10.044 89.393  1.00 47.86  ? 203 HIS A O   1 
ATOM   4872 C CB  . HIS C 1 203 ? -0.259  -7.052  88.161  1.00 38.19  ? 203 HIS A CB  1 
ATOM   4873 C CG  . HIS C 1 203 ? 0.805   -7.264  87.135  1.00 38.91  ? 203 HIS A CG  1 
ATOM   4874 N ND1 . HIS C 1 203 ? 0.599   -7.035  85.792  1.00 36.68  ? 203 HIS A ND1 1 
ATOM   4875 C CD2 . HIS C 1 203 ? 2.073   -7.725  87.247  1.00 36.38  ? 203 HIS A CD2 1 
ATOM   4876 C CE1 . HIS C 1 203 ? 1.693   -7.350  85.121  1.00 32.95  ? 203 HIS A CE1 1 
ATOM   4877 N NE2 . HIS C 1 203 ? 2.602   -7.771  85.983  1.00 34.63  ? 203 HIS A NE2 1 
ATOM   4878 N N   . GLN C 1 204 ? -0.293  -10.138 87.152  1.00 44.90  ? 204 GLN A N   1 
ATOM   4879 C CA  . GLN C 1 204 ? 0.379   -11.430 87.082  1.00 43.31  ? 204 GLN A CA  1 
ATOM   4880 C C   . GLN C 1 204 ? 1.704   -11.476 87.859  1.00 42.34  ? 204 GLN A C   1 
ATOM   4881 O O   . GLN C 1 204 ? 2.239   -12.546 88.108  1.00 40.48  ? 204 GLN A O   1 
ATOM   4882 C CB  . GLN C 1 204 ? 0.600   -11.819 85.616  1.00 44.27  ? 204 GLN A CB  1 
ATOM   4883 C CG  . GLN C 1 204 ? 2.045   -11.779 85.147  1.00 51.64  ? 204 GLN A CG  1 
ATOM   4884 C CD  . GLN C 1 204 ? 2.419   -12.997 84.330  1.00 54.79  ? 204 GLN A CD  1 
ATOM   4885 O OE1 . GLN C 1 204 ? 2.135   -13.067 83.136  1.00 60.12  ? 204 GLN A OE1 1 
ATOM   4886 N NE2 . GLN C 1 204 ? 3.056   -13.970 84.974  1.00 59.58  ? 204 GLN A NE2 1 
ATOM   4887 N N   . GLY C 1 205 ? 2.222   -10.317 88.250  1.00 41.67  ? 205 GLY A N   1 
ATOM   4888 C CA  . GLY C 1 205 ? 3.465   -10.277 89.005  1.00 43.31  ? 205 GLY A CA  1 
ATOM   4889 C C   . GLY C 1 205 ? 3.263   -10.189 90.514  1.00 43.76  ? 205 GLY A C   1 
ATOM   4890 O O   . GLY C 1 205 ? 4.224   -10.254 91.293  1.00 36.54  ? 205 GLY A O   1 
ATOM   4891 N N   . LEU C 1 206 ? 2.015   -10.026 90.937  1.00 42.23  ? 206 LEU A N   1 
ATOM   4892 C CA  . LEU C 1 206 ? 1.706   -9.941  92.357  1.00 44.19  ? 206 LEU A CA  1 
ATOM   4893 C C   . LEU C 1 206 ? 1.297   -11.335 92.823  1.00 48.12  ? 206 LEU A C   1 
ATOM   4894 O O   . LEU C 1 206 ? 0.631   -12.065 92.092  1.00 47.65  ? 206 LEU A O   1 
ATOM   4895 C CB  . LEU C 1 206 ? 0.567   -8.938  92.603  1.00 42.22  ? 206 LEU A CB  1 
ATOM   4896 C CG  . LEU C 1 206 ? 0.758   -7.465  92.204  1.00 38.53  ? 206 LEU A CG  1 
ATOM   4897 C CD1 . LEU C 1 206 ? -0.544  -6.708  92.429  1.00 34.75  ? 206 LEU A CD1 1 
ATOM   4898 C CD2 . LEU C 1 206 ? 1.870   -6.829  93.020  1.00 27.67  ? 206 LEU A CD2 1 
ATOM   4899 N N   . SER C 1 207 ? 1.718   -11.706 94.029  1.00 50.95  ? 207 SER A N   1 
ATOM   4900 C CA  . SER C 1 207 ? 1.403   -13.019 94.588  1.00 56.51  ? 207 SER A CA  1 
ATOM   4901 C C   . SER C 1 207 ? -0.096  -13.093 94.793  1.00 56.09  ? 207 SER A C   1 
ATOM   4902 O O   . SER C 1 207 ? -0.738  -14.102 94.510  1.00 53.25  ? 207 SER A O   1 
ATOM   4903 C CB  . SER C 1 207 ? 2.118   -13.206 95.928  1.00 59.37  ? 207 SER A CB  1 
ATOM   4904 O OG  . SER C 1 207 ? 2.764   -12.007 96.325  1.00 64.27  ? 207 SER A OG  1 
ATOM   4905 N N   . SER C 1 208 ? -0.636  -11.996 95.299  1.00 54.90  ? 208 SER A N   1 
ATOM   4906 C CA  . SER C 1 208 ? -2.056  -11.863 95.545  1.00 53.65  ? 208 SER A CA  1 
ATOM   4907 C C   . SER C 1 208 ? -2.348  -10.392 95.317  1.00 52.23  ? 208 SER A C   1 
ATOM   4908 O O   . SER C 1 208 ? -1.474  -9.547  95.511  1.00 49.87  ? 208 SER A O   1 
ATOM   4909 C CB  . SER C 1 208 ? -2.397  -12.270 96.988  1.00 50.86  ? 208 SER A CB  1 
ATOM   4910 O OG  . SER C 1 208 ? -1.929  -11.322 97.937  1.00 41.85  ? 208 SER A OG  1 
ATOM   4911 N N   . PRO C 1 209 ? -3.565  -10.070 94.856  1.00 50.83  ? 209 PRO A N   1 
ATOM   4912 C CA  . PRO C 1 209 ? -3.909  -8.664  94.620  1.00 48.44  ? 209 PRO A CA  1 
ATOM   4913 C C   . PRO C 1 209 ? -3.424  -7.738  95.738  1.00 45.42  ? 209 PRO A C   1 
ATOM   4914 O O   . PRO C 1 209 ? -3.608  -8.028  96.920  1.00 44.17  ? 209 PRO A O   1 
ATOM   4915 C CB  . PRO C 1 209 ? -5.429  -8.689  94.506  1.00 45.50  ? 209 PRO A CB  1 
ATOM   4916 C CG  . PRO C 1 209 ? -5.731  -10.046 93.951  1.00 49.35  ? 209 PRO A CG  1 
ATOM   4917 C CD  . PRO C 1 209 ? -4.669  -10.980 94.496  1.00 51.85  ? 209 PRO A CD  1 
ATOM   4918 N N   . VAL C 1 210 ? -2.783  -6.638  95.350  1.00 40.19  ? 210 VAL A N   1 
ATOM   4919 C CA  . VAL C 1 210 ? -2.291  -5.658  96.305  1.00 38.26  ? 210 VAL A CA  1 
ATOM   4920 C C   . VAL C 1 210 ? -3.256  -4.482  96.321  1.00 36.33  ? 210 VAL A C   1 
ATOM   4921 O O   . VAL C 1 210 ? -3.729  -4.049  95.276  1.00 37.46  ? 210 VAL A O   1 
ATOM   4922 C CB  . VAL C 1 210 ? -0.890  -5.115  95.918  1.00 38.52  ? 210 VAL A CB  1 
ATOM   4923 C CG1 . VAL C 1 210 ? -0.432  -4.105  96.959  1.00 35.25  ? 210 VAL A CG1 1 
ATOM   4924 C CG2 . VAL C 1 210 ? 0.120   -6.256  95.816  1.00 35.66  ? 210 VAL A CG2 1 
ATOM   4925 N N   . THR C 1 211 ? -3.560  -3.969  97.505  1.00 36.12  ? 211 THR A N   1 
ATOM   4926 C CA  . THR C 1 211 ? -4.456  -2.831  97.599  1.00 35.73  ? 211 THR A CA  1 
ATOM   4927 C C   . THR C 1 211 ? -3.791  -1.698  98.372  1.00 37.22  ? 211 THR A C   1 
ATOM   4928 O O   . THR C 1 211 ? -2.992  -1.937  99.272  1.00 40.75  ? 211 THR A O   1 
ATOM   4929 C CB  . THR C 1 211 ? -5.807  -3.218  98.280  1.00 38.43  ? 211 THR A CB  1 
ATOM   4930 O OG1 . THR C 1 211 ? -6.035  -2.372  99.415  1.00 46.71  ? 211 THR A OG1 1 
ATOM   4931 C CG2 . THR C 1 211 ? -5.794  -4.668  98.732  1.00 31.46  ? 211 THR A CG2 1 
ATOM   4932 N N   . LYS C 1 212 ? -4.095  -0.463  97.988  1.00 37.28  ? 212 LYS A N   1 
ATOM   4933 C CA  . LYS C 1 212 ? -3.555  0.709   98.665  1.00 39.52  ? 212 LYS A CA  1 
ATOM   4934 C C   . LYS C 1 212 ? -4.758  1.556   99.071  1.00 42.60  ? 212 LYS A C   1 
ATOM   4935 O O   . LYS C 1 212 ? -5.777  1.563   98.371  1.00 44.33  ? 212 LYS A O   1 
ATOM   4936 C CB  . LYS C 1 212 ? -2.642  1.510   97.728  1.00 39.31  ? 212 LYS A CB  1 
ATOM   4937 C CG  . LYS C 1 212 ? -1.275  0.876   97.491  1.00 43.29  ? 212 LYS A CG  1 
ATOM   4938 C CD  . LYS C 1 212 ? -0.517  0.703   98.793  1.00 43.47  ? 212 LYS A CD  1 
ATOM   4939 C CE  . LYS C 1 212 ? 0.972   0.652   98.563  1.00 43.58  ? 212 LYS A CE  1 
ATOM   4940 N NZ  . LYS C 1 212 ? 1.490   -0.731  98.695  1.00 40.52  ? 212 LYS A NZ  1 
ATOM   4941 N N   . SER C 1 213 ? -4.653  2.269   100.190 1.00 41.40  ? 213 SER A N   1 
ATOM   4942 C CA  . SER C 1 213 ? -5.774  3.087   100.622 1.00 43.48  ? 213 SER A CA  1 
ATOM   4943 C C   . SER C 1 213 ? -5.419  4.197   101.576 1.00 40.40  ? 213 SER A C   1 
ATOM   4944 O O   . SER C 1 213 ? -4.295  4.286   102.059 1.00 38.19  ? 213 SER A O   1 
ATOM   4945 C CB  . SER C 1 213 ? -6.849  2.215   101.273 1.00 46.06  ? 213 SER A CB  1 
ATOM   4946 O OG  . SER C 1 213 ? -6.289  1.087   101.916 1.00 42.31  ? 213 SER A OG  1 
ATOM   4947 N N   . PHE C 1 214 ? -6.405  5.053   101.817 1.00 40.93  ? 214 PHE A N   1 
ATOM   4948 C CA  . PHE C 1 214 ? -6.284  6.170   102.741 1.00 41.22  ? 214 PHE A CA  1 
ATOM   4949 C C   . PHE C 1 214 ? -7.680  6.442   103.320 1.00 40.80  ? 214 PHE A C   1 
ATOM   4950 O O   . PHE C 1 214 ? -8.671  5.900   102.817 1.00 31.89  ? 214 PHE A O   1 
ATOM   4951 C CB  . PHE C 1 214 ? -5.718  7.406   102.031 1.00 40.30  ? 214 PHE A CB  1 
ATOM   4952 C CG  . PHE C 1 214 ? -6.673  8.059   101.075 1.00 41.85  ? 214 PHE A CG  1 
ATOM   4953 C CD1 . PHE C 1 214 ? -7.594  9.005   101.525 1.00 40.27  ? 214 PHE A CD1 1 
ATOM   4954 C CD2 . PHE C 1 214 ? -6.644  7.744   99.721  1.00 40.00  ? 214 PHE A CD2 1 
ATOM   4955 C CE1 . PHE C 1 214 ? -8.473  9.624   100.640 1.00 36.23  ? 214 PHE A CE1 1 
ATOM   4956 C CE2 . PHE C 1 214 ? -7.518  8.360   98.829  1.00 40.09  ? 214 PHE A CE2 1 
ATOM   4957 C CZ  . PHE C 1 214 ? -8.434  9.302   99.291  1.00 38.56  ? 214 PHE A CZ  1 
ATOM   4958 N N   . ASN C 1 215 ? -7.752  7.271   104.365 1.00 39.83  ? 215 ASN A N   1 
ATOM   4959 C CA  . ASN C 1 215 ? -9.018  7.587   105.020 1.00 43.29  ? 215 ASN A CA  1 
ATOM   4960 C C   . ASN C 1 215 ? -9.687  8.926   104.701 1.00 46.36  ? 215 ASN A C   1 
ATOM   4961 O O   . ASN C 1 215 ? -10.510 9.017   103.798 1.00 44.18  ? 215 ASN A O   1 
ATOM   4962 C CB  . ASN C 1 215 ? -8.854  7.479   106.537 1.00 42.89  ? 215 ASN A CB  1 
ATOM   4963 C CG  . ASN C 1 215 ? -8.622  6.064   106.992 1.00 42.20  ? 215 ASN A CG  1 
ATOM   4964 O OD1 . ASN C 1 215 ? -9.232  5.121   106.480 1.00 43.18  ? 215 ASN A OD1 1 
ATOM   4965 N ND2 . ASN C 1 215 ? -7.732  5.900   107.957 1.00 49.31  ? 215 ASN A ND2 1 
ATOM   4966 N N   . ARG C 1 216 ? -9.338  9.952   105.469 1.00 51.76  ? 216 ARG A N   1 
ATOM   4967 C CA  . ARG C 1 216 ? -9.913  11.294  105.348 1.00 58.09  ? 216 ARG A CA  1 
ATOM   4968 C C   . ARG C 1 216 ? -10.850 11.557  104.167 1.00 61.84  ? 216 ARG A C   1 
ATOM   4969 O O   . ARG C 1 216 ? -10.586 12.423  103.335 1.00 65.27  ? 216 ARG A O   1 
ATOM   4970 C CB  . ARG C 1 216 ? -8.798  12.342  105.358 1.00 61.30  ? 216 ARG A CB  1 
ATOM   4971 C CG  . ARG C 1 216 ? -9.198  13.658  106.017 1.00 65.81  ? 216 ARG A CG  1 
ATOM   4972 C CD  . ARG C 1 216 ? -8.664  13.759  107.434 1.00 69.73  ? 216 ARG A CD  1 
ATOM   4973 N NE  . ARG C 1 216 ? -7.229  13.509  107.486 1.00 81.36  ? 216 ARG A NE  1 
ATOM   4974 C CZ  . ARG C 1 216 ? -6.691  12.335  107.794 1.00 87.27  ? 216 ARG A CZ  1 
ATOM   4975 N NH1 . ARG C 1 216 ? -7.476  11.305  108.077 1.00 89.59  ? 216 ARG A NH1 1 
ATOM   4976 N NH2 . ARG C 1 216 ? -5.373  12.189  107.818 1.00 94.53  ? 216 ARG A NH2 1 
ATOM   4977 N N   . GLY C 1 217 ? -11.959 10.822  104.116 1.00 62.99  ? 217 GLY A N   1 
ATOM   4978 C CA  . GLY C 1 217 ? -12.927 11.001  103.047 1.00 60.54  ? 217 GLY A CA  1 
ATOM   4979 C C   . GLY C 1 217 ? -14.074 11.914  103.449 1.00 58.85  ? 217 GLY A C   1 
ATOM   4980 O O   . GLY C 1 217 ? -14.146 13.046  102.925 1.00 57.36  ? 217 GLY A O   1 
ATOM   4981 O OXT . GLY C 1 217 ? -14.899 11.501  104.294 1.00 54.24  ? 217 GLY A OXT 1 
ATOM   4982 N N   . GLN D 2 1   ? 9.267   7.019   44.331  1.00 99.59  ? 1   GLN B N   1 
ATOM   4983 C CA  . GLN D 2 1   ? 8.678   8.390   44.353  1.00 99.82  ? 1   GLN B CA  1 
ATOM   4984 C C   . GLN D 2 1   ? 7.419   8.432   45.222  1.00 99.83  ? 1   GLN B C   1 
ATOM   4985 O O   . GLN D 2 1   ? 7.476   8.194   46.431  1.00 99.92  ? 1   GLN B O   1 
ATOM   4986 C CB  . GLN D 2 1   ? 8.342   8.835   42.923  1.00 98.52  ? 1   GLN B CB  1 
ATOM   4987 C CG  . GLN D 2 1   ? 7.989   10.312  42.785  1.00 97.30  ? 1   GLN B CG  1 
ATOM   4988 C CD  . GLN D 2 1   ? 6.788   10.547  41.885  1.00 96.81  ? 1   GLN B CD  1 
ATOM   4989 O OE1 . GLN D 2 1   ? 6.892   10.473  40.659  1.00 95.53  ? 1   GLN B OE1 1 
ATOM   4990 N NE2 . GLN D 2 1   ? 5.640   10.833  42.491  1.00 93.11  ? 1   GLN B NE2 1 
ATOM   4991 N N   . VAL D 2 2   ? 6.286   8.728   44.591  1.00 98.47  ? 2   VAL B N   1 
ATOM   4992 C CA  . VAL D 2 2   ? 5.004   8.812   45.278  1.00 95.64  ? 2   VAL B CA  1 
ATOM   4993 C C   . VAL D 2 2   ? 5.056   9.821   46.416  1.00 91.59  ? 2   VAL B C   1 
ATOM   4994 O O   . VAL D 2 2   ? 6.125   10.127  46.947  1.00 93.46  ? 2   VAL B O   1 
ATOM   4995 C CB  . VAL D 2 2   ? 4.561   7.442   45.853  1.00 97.43  ? 2   VAL B CB  1 
ATOM   4996 C CG1 . VAL D 2 2   ? 3.044   7.321   45.782  1.00 96.84  ? 2   VAL B CG1 1 
ATOM   4997 C CG2 . VAL D 2 2   ? 5.214   6.305   45.079  1.00 97.98  ? 2   VAL B CG2 1 
ATOM   4998 N N   . GLN D 2 3   ? 3.889   10.343  46.773  1.00 83.21  ? 3   GLN B N   1 
ATOM   4999 C CA  . GLN D 2 3   ? 3.765   11.317  47.848  1.00 71.33  ? 3   GLN B CA  1 
ATOM   5000 C C   . GLN D 2 3   ? 2.333   11.808  47.912  1.00 61.02  ? 3   GLN B C   1 
ATOM   5001 O O   . GLN D 2 3   ? 1.768   12.241  46.907  1.00 59.59  ? 3   GLN B O   1 
ATOM   5002 C CB  . GLN D 2 3   ? 4.702   12.505  47.627  1.00 72.38  ? 3   GLN B CB  1 
ATOM   5003 C CG  . GLN D 2 3   ? 5.419   12.956  48.892  1.00 71.26  ? 3   GLN B CG  1 
ATOM   5004 C CD  . GLN D 2 3   ? 6.456   14.030  48.621  1.00 71.60  ? 3   GLN B CD  1 
ATOM   5005 O OE1 . GLN D 2 3   ? 6.853   14.769  49.524  1.00 67.53  ? 3   GLN B OE1 1 
ATOM   5006 N NE2 . GLN D 2 3   ? 6.900   14.123  47.369  1.00 68.69  ? 3   GLN B NE2 1 
ATOM   5007 N N   . LEU D 2 4   ? 1.755   11.728  49.104  1.00 50.11  ? 4   LEU B N   1 
ATOM   5008 C CA  . LEU D 2 4   ? 0.388   12.157  49.327  1.00 36.48  ? 4   LEU B CA  1 
ATOM   5009 C C   . LEU D 2 4   ? 0.377   13.180  50.454  1.00 30.79  ? 4   LEU B C   1 
ATOM   5010 O O   . LEU D 2 4   ? 0.764   12.889  51.583  1.00 29.12  ? 4   LEU B O   1 
ATOM   5011 C CB  . LEU D 2 4   ? -0.474  10.944  49.655  1.00 29.38  ? 4   LEU B CB  1 
ATOM   5012 C CG  . LEU D 2 4   ? -0.815  10.093  48.429  1.00 27.08  ? 4   LEU B CG  1 
ATOM   5013 C CD1 . LEU D 2 4   ? -1.624  8.879   48.845  1.00 26.57  ? 4   LEU B CD1 1 
ATOM   5014 C CD2 . LEU D 2 4   ? -1.624  10.926  47.435  1.00 27.31  ? 4   LEU B CD2 1 
ATOM   5015 N N   . LEU D 2 5   ? -0.070  14.385  50.129  1.00 28.44  ? 5   LEU B N   1 
ATOM   5016 C CA  . LEU D 2 5   ? -0.100  15.474  51.081  1.00 28.45  ? 5   LEU B CA  1 
ATOM   5017 C C   . LEU D 2 5   ? -1.490  15.867  51.588  1.00 31.29  ? 5   LEU B C   1 
ATOM   5018 O O   . LEU D 2 5   ? -2.281  16.474  50.860  1.00 30.56  ? 5   LEU B O   1 
ATOM   5019 C CB  . LEU D 2 5   ? 0.588   16.695  50.466  1.00 29.45  ? 5   LEU B CB  1 
ATOM   5020 C CG  . LEU D 2 5   ? 1.306   17.530  51.526  1.00 32.46  ? 5   LEU B CG  1 
ATOM   5021 C CD1 . LEU D 2 5   ? 2.782   17.160  51.517  1.00 36.27  ? 5   LEU B CD1 1 
ATOM   5022 C CD2 . LEU D 2 5   ? 1.087   19.018  51.276  1.00 28.66  ? 5   LEU B CD2 1 
ATOM   5023 N N   . GLU D 2 6   ? -1.769  15.540  52.853  1.00 31.84  ? 6   GLU B N   1 
ATOM   5024 C CA  . GLU D 2 6   ? -3.056  15.856  53.462  1.00 27.51  ? 6   GLU B CA  1 
ATOM   5025 C C   . GLU D 2 6   ? -3.041  17.203  54.178  1.00 28.14  ? 6   GLU B C   1 
ATOM   5026 O O   . GLU D 2 6   ? -1.991  17.675  54.621  1.00 32.47  ? 6   GLU B O   1 
ATOM   5027 C CB  . GLU D 2 6   ? -3.459  14.738  54.425  1.00 30.52  ? 6   GLU B CB  1 
ATOM   5028 C CG  . GLU D 2 6   ? -3.324  13.342  53.831  1.00 32.42  ? 6   GLU B CG  1 
ATOM   5029 C CD  . GLU D 2 6   ? -4.379  12.365  54.326  1.00 38.44  ? 6   GLU B CD  1 
ATOM   5030 O OE1 . GLU D 2 6   ? -5.560  12.764  54.439  1.00 37.11  ? 6   GLU B OE1 1 
ATOM   5031 O OE2 . GLU D 2 6   ? -4.025  11.199  54.592  1.00 36.23  ? 6   GLU B OE2 1 
ATOM   5032 N N   . SER D 2 7   ? -4.219  17.816  54.289  1.00 22.35  ? 7   SER B N   1 
ATOM   5033 C CA  . SER D 2 7   ? -4.380  19.118  54.924  1.00 15.53  ? 7   SER B CA  1 
ATOM   5034 C C   . SER D 2 7   ? -4.212  18.988  56.436  1.00 14.10  ? 7   SER B C   1 
ATOM   5035 O O   . SER D 2 7   ? -4.188  17.886  56.952  1.00 21.64  ? 7   SER B O   1 
ATOM   5036 C CB  . SER D 2 7   ? -5.762  19.676  54.587  1.00 20.12  ? 7   SER B CB  1 
ATOM   5037 O OG  . SER D 2 7   ? -6.677  18.594  54.505  1.00 20.32  ? 7   SER B OG  1 
ATOM   5038 N N   . GLY D 2 8   ? -4.077  20.120  57.123  1.00 23.16  ? 8   GLY B N   1 
ATOM   5039 C CA  . GLY D 2 8   ? -3.861  20.115  58.566  1.00 26.53  ? 8   GLY B CA  1 
ATOM   5040 C C   . GLY D 2 8   ? -5.002  19.573  59.425  1.00 31.21  ? 8   GLY B C   1 
ATOM   5041 O O   . GLY D 2 8   ? -6.065  19.232  58.914  1.00 29.58  ? 8   GLY B O   1 
ATOM   5042 N N   . PRO D 2 9   ? -4.795  19.476  60.752  1.00 35.58  ? 9   PRO B N   1 
ATOM   5043 C CA  . PRO D 2 9   ? -5.809  18.969  61.690  1.00 31.39  ? 9   PRO B CA  1 
ATOM   5044 C C   . PRO D 2 9   ? -7.013  19.903  61.797  1.00 33.26  ? 9   PRO B C   1 
ATOM   5045 O O   . PRO D 2 9   ? -6.873  21.117  61.714  1.00 28.76  ? 9   PRO B O   1 
ATOM   5046 C CB  . PRO D 2 9   ? -5.064  18.841  63.026  1.00 31.52  ? 9   PRO B CB  1 
ATOM   5047 C CG  . PRO D 2 9   ? -3.838  19.709  62.893  1.00 34.37  ? 9   PRO B CG  1 
ATOM   5048 C CD  . PRO D 2 9   ? -3.534  19.863  61.417  1.00 32.55  ? 9   PRO B CD  1 
ATOM   5049 N N   . GLU D 2 10  ? -8.195  19.326  61.989  1.00 32.10  ? 10  GLU B N   1 
ATOM   5050 C CA  . GLU D 2 10  ? -9.410  20.124  62.067  1.00 30.30  ? 10  GLU B CA  1 
ATOM   5051 C C   . GLU D 2 10  ? -10.167 19.960  63.373  1.00 26.80  ? 10  GLU B C   1 
ATOM   5052 O O   . GLU D 2 10  ? -10.384 18.847  63.847  1.00 27.67  ? 10  GLU B O   1 
ATOM   5053 C CB  . GLU D 2 10  ? -10.350 19.768  60.906  1.00 35.61  ? 10  GLU B CB  1 
ATOM   5054 C CG  . GLU D 2 10  ? -9.736  19.909  59.510  1.00 40.62  ? 10  GLU B CG  1 
ATOM   5055 C CD  . GLU D 2 10  ? -9.971  21.279  58.898  1.00 45.43  ? 10  GLU B CD  1 
ATOM   5056 O OE1 . GLU D 2 10  ? -10.741 22.074  59.479  1.00 49.50  ? 10  GLU B OE1 1 
ATOM   5057 O OE2 . GLU D 2 10  ? -9.384  21.564  57.831  1.00 49.26  ? 10  GLU B OE2 1 
ATOM   5058 N N   . LEU D 2 11  ? -10.574 21.090  63.930  1.00 28.07  ? 11  LEU B N   1 
ATOM   5059 C CA  . LEU D 2 11  ? -11.341 21.128  65.164  1.00 30.52  ? 11  LEU B CA  1 
ATOM   5060 C C   . LEU D 2 11  ? -12.691 21.728  64.776  1.00 29.32  ? 11  LEU B C   1 
ATOM   5061 O O   . LEU D 2 11  ? -12.772 22.895  64.385  1.00 31.81  ? 11  LEU B O   1 
ATOM   5062 C CB  . LEU D 2 11  ? -10.633 22.011  66.199  1.00 31.05  ? 11  LEU B CB  1 
ATOM   5063 C CG  . LEU D 2 11  ? -10.898 21.879  67.709  1.00 34.59  ? 11  LEU B CG  1 
ATOM   5064 C CD1 . LEU D 2 11  ? -11.290 23.256  68.251  1.00 31.57  ? 11  LEU B CD1 1 
ATOM   5065 C CD2 . LEU D 2 11  ? -11.980 20.850  68.013  1.00 22.79  ? 11  LEU B CD2 1 
ATOM   5066 N N   . LYS D 2 12  ? -13.743 20.919  64.859  1.00 26.18  ? 12  LYS B N   1 
ATOM   5067 C CA  . LYS D 2 12  ? -15.082 21.383  64.503  1.00 26.15  ? 12  LYS B CA  1 
ATOM   5068 C C   . LYS D 2 12  ? -16.115 21.139  65.611  1.00 21.62  ? 12  LYS B C   1 
ATOM   5069 O O   . LYS D 2 12  ? -15.851 20.410  66.558  1.00 22.82  ? 12  LYS B O   1 
ATOM   5070 C CB  . LYS D 2 12  ? -15.542 20.676  63.233  1.00 24.94  ? 12  LYS B CB  1 
ATOM   5071 C CG  . LYS D 2 12  ? -14.569 20.769  62.067  1.00 17.05  ? 12  LYS B CG  1 
ATOM   5072 C CD  . LYS D 2 12  ? -15.118 21.602  60.957  1.00 25.00  ? 12  LYS B CD  1 
ATOM   5073 C CE  . LYS D 2 12  ? -14.694 23.055  61.090  1.00 28.83  ? 12  LYS B CE  1 
ATOM   5074 N NZ  . LYS D 2 12  ? -13.997 23.560  59.867  1.00 31.99  ? 12  LYS B NZ  1 
ATOM   5075 N N   . LYS D 2 13  ? -17.282 21.768  65.472  1.00 26.37  ? 13  LYS B N   1 
ATOM   5076 C CA  . LYS D 2 13  ? -18.404 21.609  66.411  1.00 23.07  ? 13  LYS B CA  1 
ATOM   5077 C C   . LYS D 2 13  ? -19.517 20.821  65.687  1.00 23.12  ? 13  LYS B C   1 
ATOM   5078 O O   . LYS D 2 13  ? -19.629 20.888  64.465  1.00 23.98  ? 13  LYS B O   1 
ATOM   5079 C CB  . LYS D 2 13  ? -18.933 22.974  66.827  1.00 26.53  ? 13  LYS B CB  1 
ATOM   5080 C CG  . LYS D 2 13  ? -17.924 23.833  67.572  1.00 29.77  ? 13  LYS B CG  1 
ATOM   5081 C CD  . LYS D 2 13  ? -18.501 25.200  67.822  1.00 33.94  ? 13  LYS B CD  1 
ATOM   5082 C CE  . LYS D 2 13  ? -17.415 26.242  67.951  1.00 40.69  ? 13  LYS B CE  1 
ATOM   5083 N NZ  . LYS D 2 13  ? -17.277 27.031  66.687  1.00 50.52  ? 13  LYS B NZ  1 
ATOM   5084 N N   . PRO D 2 14  ? -20.355 20.067  66.424  1.00 23.04  ? 14  PRO B N   1 
ATOM   5085 C CA  . PRO D 2 14  ? -21.413 19.309  65.740  1.00 22.74  ? 14  PRO B CA  1 
ATOM   5086 C C   . PRO D 2 14  ? -22.301 20.103  64.747  1.00 21.58  ? 14  PRO B C   1 
ATOM   5087 O O   . PRO D 2 14  ? -22.638 21.286  64.962  1.00 18.97  ? 14  PRO B O   1 
ATOM   5088 C CB  . PRO D 2 14  ? -22.208 18.702  66.893  1.00 30.52  ? 14  PRO B CB  1 
ATOM   5089 C CG  . PRO D 2 14  ? -21.160 18.587  68.029  1.00 20.39  ? 14  PRO B CG  1 
ATOM   5090 C CD  . PRO D 2 14  ? -20.393 19.860  67.886  1.00 20.03  ? 14  PRO B CD  1 
ATOM   5091 N N   . GLY D 2 15  ? -22.653 19.438  63.647  1.00 21.23  ? 15  GLY B N   1 
ATOM   5092 C CA  . GLY D 2 15  ? -23.481 20.043  62.608  1.00 16.56  ? 15  GLY B CA  1 
ATOM   5093 C C   . GLY D 2 15  ? -22.719 20.829  61.549  1.00 22.27  ? 15  GLY B C   1 
ATOM   5094 O O   . GLY D 2 15  ? -23.261 21.169  60.499  1.00 16.87  ? 15  GLY B O   1 
ATOM   5095 N N   . GLU D 2 16  ? -21.453 21.124  61.816  1.00 20.75  ? 16  GLU B N   1 
ATOM   5096 C CA  . GLU D 2 16  ? -20.637 21.889  60.869  1.00 24.07  ? 16  GLU B CA  1 
ATOM   5097 C C   . GLU D 2 16  ? -20.157 21.056  59.671  1.00 20.96  ? 16  GLU B C   1 
ATOM   5098 O O   . GLU D 2 16  ? -20.432 19.865  59.591  1.00 18.90  ? 16  GLU B O   1 
ATOM   5099 C CB  . GLU D 2 16  ? -19.440 22.474  61.616  1.00 19.65  ? 16  GLU B CB  1 
ATOM   5100 C CG  . GLU D 2 16  ? -19.823 23.636  62.512  1.00 19.75  ? 16  GLU B CG  1 
ATOM   5101 C CD  . GLU D 2 16  ? -18.625 24.327  63.140  1.00 26.49  ? 16  GLU B CD  1 
ATOM   5102 O OE1 . GLU D 2 16  ? -17.536 23.731  63.153  1.00 33.74  ? 16  GLU B OE1 1 
ATOM   5103 O OE2 . GLU D 2 16  ? -18.774 25.467  63.623  1.00 25.48  ? 16  GLU B OE2 1 
ATOM   5104 N N   . THR D 2 17  ? -19.452 21.687  58.736  1.00 24.32  ? 17  THR B N   1 
ATOM   5105 C CA  . THR D 2 17  ? -18.921 20.964  57.575  1.00 27.59  ? 17  THR B CA  1 
ATOM   5106 C C   . THR D 2 17  ? -17.398 21.057  57.553  1.00 22.02  ? 17  THR B C   1 
ATOM   5107 O O   . THR D 2 17  ? -16.837 22.055  58.022  1.00 22.50  ? 17  THR B O   1 
ATOM   5108 C CB  . THR D 2 17  ? -19.441 21.532  56.219  1.00 28.96  ? 17  THR B CB  1 
ATOM   5109 O OG1 . THR D 2 17  ? -20.858 21.373  56.132  1.00 29.32  ? 17  THR B OG1 1 
ATOM   5110 C CG2 . THR D 2 17  ? -18.809 20.772  55.056  1.00 27.90  ? 17  THR B CG2 1 
ATOM   5111 N N   . VAL D 2 18  ? -16.743 19.999  57.066  1.00 28.33  ? 18  VAL B N   1 
ATOM   5112 C CA  . VAL D 2 18  ? -15.275 19.964  56.928  1.00 29.17  ? 18  VAL B CA  1 
ATOM   5113 C C   . VAL D 2 18  ? -14.916 19.493  55.532  1.00 28.45  ? 18  VAL B C   1 
ATOM   5114 O O   . VAL D 2 18  ? -15.601 18.654  54.964  1.00 23.73  ? 18  VAL B O   1 
ATOM   5115 C CB  . VAL D 2 18  ? -14.530 18.903  57.780  1.00 29.42  ? 18  VAL B CB  1 
ATOM   5116 C CG1 . VAL D 2 18  ? -13.516 19.575  58.701  1.00 28.58  ? 18  VAL B CG1 1 
ATOM   5117 C CG2 . VAL D 2 18  ? -15.496 17.984  58.461  1.00 34.88  ? 18  VAL B CG2 1 
ATOM   5118 N N   . LYS D 2 19  ? -13.793 19.989  55.029  1.00 27.68  ? 19  LYS B N   1 
ATOM   5119 C CA  . LYS D 2 19  ? -13.290 19.580  53.722  1.00 30.39  ? 19  LYS B CA  1 
ATOM   5120 C C   . LYS D 2 19  ? -11.790 19.327  53.864  1.00 26.79  ? 19  LYS B C   1 
ATOM   5121 O O   . LYS D 2 19  ? -11.022 20.238  54.141  1.00 22.99  ? 19  LYS B O   1 
ATOM   5122 C CB  . LYS D 2 19  ? -13.536 20.654  52.678  1.00 27.55  ? 19  LYS B CB  1 
ATOM   5123 C CG  . LYS D 2 19  ? -13.189 20.181  51.271  1.00 31.79  ? 19  LYS B CG  1 
ATOM   5124 C CD  . LYS D 2 19  ? -14.286 20.500  50.315  1.00 26.83  ? 19  LYS B CD  1 
ATOM   5125 C CE  . LYS D 2 19  ? -13.870 20.217  48.897  1.00 32.28  ? 19  LYS B CE  1 
ATOM   5126 N NZ  . LYS D 2 19  ? -14.454 21.266  48.019  1.00 28.36  ? 19  LYS B NZ  1 
ATOM   5127 N N   . ILE D 2 20  ? -11.402 18.071  53.730  1.00 28.18  ? 20  ILE B N   1 
ATOM   5128 C CA  . ILE D 2 20  ? -10.007 17.674  53.832  1.00 34.78  ? 20  ILE B CA  1 
ATOM   5129 C C   . ILE D 2 20  ? -9.465  17.500  52.408  1.00 32.91  ? 20  ILE B C   1 
ATOM   5130 O O   . ILE D 2 20  ? -10.190 17.059  51.521  1.00 27.81  ? 20  ILE B O   1 
ATOM   5131 C CB  . ILE D 2 20  ? -9.868  16.325  54.563  1.00 30.77  ? 20  ILE B CB  1 
ATOM   5132 C CG1 . ILE D 2 20  ? -10.329 16.450  56.016  1.00 33.76  ? 20  ILE B CG1 1 
ATOM   5133 C CG2 . ILE D 2 20  ? -8.427  15.854  54.496  1.00 32.57  ? 20  ILE B CG2 1 
ATOM   5134 C CD1 . ILE D 2 20  ? -10.535 15.068  56.691  1.00 31.39  ? 20  ILE B CD1 1 
ATOM   5135 N N   . SER D 2 21  ? -8.197  17.850  52.196  1.00 35.67  ? 21  SER B N   1 
ATOM   5136 C CA  . SER D 2 21  ? -7.586  17.709  50.880  1.00 32.52  ? 21  SER B CA  1 
ATOM   5137 C C   . SER D 2 21  ? -6.390  16.763  50.893  1.00 33.73  ? 21  SER B C   1 
ATOM   5138 O O   . SER D 2 21  ? -5.694  16.627  51.903  1.00 33.30  ? 21  SER B O   1 
ATOM   5139 C CB  . SER D 2 21  ? -7.144  19.071  50.349  1.00 27.47  ? 21  SER B CB  1 
ATOM   5140 O OG  . SER D 2 21  ? -6.028  19.561  51.075  1.00 35.64  ? 21  SER B OG  1 
ATOM   5141 N N   . CYS D 2 22  ? -6.157  16.122  49.751  1.00 32.90  ? 22  CYS B N   1 
ATOM   5142 C CA  . CYS D 2 22  ? -5.051  15.200  49.573  1.00 30.19  ? 22  CYS B CA  1 
ATOM   5143 C C   . CYS D 2 22  ? -4.419  15.424  48.193  1.00 35.73  ? 22  CYS B C   1 
ATOM   5144 O O   . CYS D 2 22  ? -5.007  15.057  47.171  1.00 33.62  ? 22  CYS B O   1 
ATOM   5145 C CB  . CYS D 2 22  ? -5.544  13.769  49.664  1.00 38.88  ? 22  CYS B CB  1 
ATOM   5146 S SG  . CYS D 2 22  ? -4.196  12.559  49.634  1.00 45.36  ? 22  CYS B SG  1 
ATOM   5147 N N   . LYS D 2 23  ? -3.226  16.017  48.171  1.00 30.12  ? 23  LYS B N   1 
ATOM   5148 C CA  . LYS D 2 23  ? -2.516  16.299  46.920  1.00 31.41  ? 23  LYS B CA  1 
ATOM   5149 C C   . LYS D 2 23  ? -1.571  15.157  46.580  1.00 26.99  ? 23  LYS B C   1 
ATOM   5150 O O   . LYS D 2 23  ? -0.753  14.749  47.397  1.00 22.74  ? 23  LYS B O   1 
ATOM   5151 C CB  . LYS D 2 23  ? -1.723  17.600  47.053  1.00 33.03  ? 23  LYS B CB  1 
ATOM   5152 C CG  . LYS D 2 23  ? -1.188  18.144  45.742  1.00 37.22  ? 23  LYS B CG  1 
ATOM   5153 C CD  . LYS D 2 23  ? -1.795  19.500  45.418  1.00 44.09  ? 23  LYS B CD  1 
ATOM   5154 C CE  . LYS D 2 23  ? -0.810  20.394  44.681  1.00 48.90  ? 23  LYS B CE  1 
ATOM   5155 N NZ  . LYS D 2 23  ? 0.040   19.621  43.732  1.00 55.57  ? 23  LYS B NZ  1 
ATOM   5156 N N   . ALA D 2 24  ? -1.697  14.629  45.372  1.00 29.99  ? 24  ALA B N   1 
ATOM   5157 C CA  . ALA D 2 24  ? -0.856  13.519  44.954  1.00 32.20  ? 24  ALA B CA  1 
ATOM   5158 C C   . ALA D 2 24  ? 0.110   13.975  43.872  1.00 40.04  ? 24  ALA B C   1 
ATOM   5159 O O   . ALA D 2 24  ? 0.138   15.155  43.503  1.00 41.86  ? 24  ALA B O   1 
ATOM   5160 C CB  . ALA D 2 24  ? -1.713  12.393  44.431  1.00 20.56  ? 24  ALA B CB  1 
ATOM   5161 N N   . SER D 2 25  ? 0.891   13.030  43.361  1.00 49.36  ? 25  SER B N   1 
ATOM   5162 C CA  . SER D 2 25  ? 1.857   13.313  42.307  1.00 59.33  ? 25  SER B CA  1 
ATOM   5163 C C   . SER D 2 25  ? 1.200   13.162  40.938  1.00 64.47  ? 25  SER B C   1 
ATOM   5164 O O   . SER D 2 25  ? 0.308   12.329  40.755  1.00 66.14  ? 25  SER B O   1 
ATOM   5165 C CB  . SER D 2 25  ? 3.044   12.354  42.415  1.00 61.24  ? 25  SER B CB  1 
ATOM   5166 O OG  . SER D 2 25  ? 4.256   13.060  42.619  1.00 64.86  ? 25  SER B OG  1 
ATOM   5167 N N   . GLY D 2 26  ? 1.641   13.976  39.980  1.00 70.35  ? 26  GLY B N   1 
ATOM   5168 C CA  . GLY D 2 26  ? 1.095   13.901  38.636  1.00 72.59  ? 26  GLY B CA  1 
ATOM   5169 C C   . GLY D 2 26  ? 1.512   12.601  37.972  1.00 73.97  ? 26  GLY B C   1 
ATOM   5170 O O   . GLY D 2 26  ? 2.050   11.709  38.631  1.00 77.79  ? 26  GLY B O   1 
ATOM   5171 N N   . TYR D 2 27  ? 1.279   12.495  36.668  1.00 71.34  ? 27  TYR B N   1 
ATOM   5172 C CA  . TYR D 2 27  ? 1.624   11.295  35.897  1.00 68.00  ? 27  TYR B CA  1 
ATOM   5173 C C   . TYR D 2 27  ? 0.910   10.053  36.412  1.00 63.69  ? 27  TYR B C   1 
ATOM   5174 O O   . TYR D 2 27  ? 0.496   9.200   35.627  1.00 64.79  ? 27  TYR B O   1 
ATOM   5175 C CB  . TYR D 2 27  ? 3.136   11.018  35.914  1.00 68.24  ? 27  TYR B CB  1 
ATOM   5176 C CG  . TYR D 2 27  ? 4.018   12.216  36.167  1.00 68.74  ? 27  TYR B CG  1 
ATOM   5177 C CD1 . TYR D 2 27  ? 4.143   13.229  35.217  1.00 69.90  ? 27  TYR B CD1 1 
ATOM   5178 C CD2 . TYR D 2 27  ? 4.738   12.333  37.354  1.00 64.73  ? 27  TYR B CD2 1 
ATOM   5179 C CE1 . TYR D 2 27  ? 4.963   14.328  35.444  1.00 71.75  ? 27  TYR B CE1 1 
ATOM   5180 C CE2 . TYR D 2 27  ? 5.562   13.429  37.590  1.00 67.45  ? 27  TYR B CE2 1 
ATOM   5181 C CZ  . TYR D 2 27  ? 5.670   14.422  36.632  1.00 68.79  ? 27  TYR B CZ  1 
ATOM   5182 O OH  . TYR D 2 27  ? 6.479   15.509  36.858  1.00 71.00  ? 27  TYR B OH  1 
ATOM   5183 N N   . THR D 2 28  ? 0.773   9.957   37.730  1.00 57.13  ? 28  THR B N   1 
ATOM   5184 C CA  . THR D 2 28  ? 0.127   8.811   38.352  1.00 55.56  ? 28  THR B CA  1 
ATOM   5185 C C   . THR D 2 28  ? -1.238  9.112   38.980  1.00 50.12  ? 28  THR B C   1 
ATOM   5186 O O   . THR D 2 28  ? -1.928  8.188   39.411  1.00 52.89  ? 28  THR B O   1 
ATOM   5187 C CB  . THR D 2 28  ? 1.038   8.204   39.437  1.00 54.88  ? 28  THR B CB  1 
ATOM   5188 O OG1 . THR D 2 28  ? 0.842   8.904   40.671  1.00 57.75  ? 28  THR B OG1 1 
ATOM   5189 C CG2 . THR D 2 28  ? 2.498   8.323   39.029  1.00 59.41  ? 28  THR B CG2 1 
ATOM   5190 N N   . PHE D 2 29  ? -1.627  10.389  39.022  1.00 45.93  ? 29  PHE B N   1 
ATOM   5191 C CA  . PHE D 2 29  ? -2.906  10.790  39.614  1.00 41.05  ? 29  PHE B CA  1 
ATOM   5192 C C   . PHE D 2 29  ? -4.121  10.058  39.068  1.00 38.01  ? 29  PHE B C   1 
ATOM   5193 O O   . PHE D 2 29  ? -4.954  9.593   39.839  1.00 37.31  ? 29  PHE B O   1 
ATOM   5194 C CB  . PHE D 2 29  ? -3.136  12.294  39.467  1.00 40.37  ? 29  PHE B CB  1 
ATOM   5195 C CG  . PHE D 2 29  ? -4.359  12.792  40.203  1.00 44.01  ? 29  PHE B CG  1 
ATOM   5196 C CD1 . PHE D 2 29  ? -4.319  13.021  41.579  1.00 38.18  ? 29  PHE B CD1 1 
ATOM   5197 C CD2 . PHE D 2 29  ? -5.554  13.021  39.521  1.00 42.34  ? 29  PHE B CD2 1 
ATOM   5198 C CE1 . PHE D 2 29  ? -5.453  13.471  42.265  1.00 40.67  ? 29  PHE B CE1 1 
ATOM   5199 C CE2 . PHE D 2 29  ? -6.689  13.472  40.195  1.00 45.73  ? 29  PHE B CE2 1 
ATOM   5200 C CZ  . PHE D 2 29  ? -6.638  13.698  41.574  1.00 41.32  ? 29  PHE B CZ  1 
ATOM   5201 N N   . THR D 2 30  ? -4.254  9.967   37.747  1.00 34.19  ? 30  THR B N   1 
ATOM   5202 C CA  . THR D 2 30  ? -5.403  9.251   37.204  1.00 31.32  ? 30  THR B CA  1 
ATOM   5203 C C   . THR D 2 30  ? -5.085  7.785   36.941  1.00 30.02  ? 30  THR B C   1 
ATOM   5204 O O   . THR D 2 30  ? -5.851  7.092   36.293  1.00 30.94  ? 30  THR B O   1 
ATOM   5205 C CB  . THR D 2 30  ? -5.972  9.886   35.903  1.00 32.68  ? 30  THR B CB  1 
ATOM   5206 O OG1 . THR D 2 30  ? -5.271  9.377   34.774  1.00 34.41  ? 30  THR B OG1 1 
ATOM   5207 C CG2 . THR D 2 30  ? -5.878  11.405  35.936  1.00 36.05  ? 30  THR B CG2 1 
ATOM   5208 N N   . ASN D 2 31  ? -3.962  7.306   37.467  1.00 31.53  ? 31  ASN B N   1 
ATOM   5209 C CA  . ASN D 2 31  ? -3.586  5.904   37.300  1.00 34.63  ? 31  ASN B CA  1 
ATOM   5210 C C   . ASN D 2 31  ? -3.917  5.064   38.539  1.00 37.57  ? 31  ASN B C   1 
ATOM   5211 O O   . ASN D 2 31  ? -3.940  3.830   38.475  1.00 42.71  ? 31  ASN B O   1 
ATOM   5212 C CB  . ASN D 2 31  ? -2.095  5.781   36.988  1.00 36.49  ? 31  ASN B CB  1 
ATOM   5213 C CG  . ASN D 2 31  ? -1.760  6.227   35.582  1.00 41.46  ? 31  ASN B CG  1 
ATOM   5214 O OD1 . ASN D 2 31  ? -1.686  7.428   35.295  1.00 40.08  ? 31  ASN B OD1 1 
ATOM   5215 N ND2 . ASN D 2 31  ? -1.556  5.263   34.692  1.00 45.28  ? 31  ASN B ND2 1 
ATOM   5216 N N   . TYR D 2 32  ? -4.154  5.724   39.671  1.00 34.17  ? 32  TYR B N   1 
ATOM   5217 C CA  . TYR D 2 32  ? -4.499  5.011   40.900  1.00 28.78  ? 32  TYR B CA  1 
ATOM   5218 C C   . TYR D 2 32  ? -5.848  5.493   41.417  1.00 26.29  ? 32  TYR B C   1 
ATOM   5219 O O   . TYR D 2 32  ? -6.178  6.659   41.290  1.00 19.99  ? 32  TYR B O   1 
ATOM   5220 C CB  . TYR D 2 32  ? -3.471  5.275   42.000  1.00 27.50  ? 32  TYR B CB  1 
ATOM   5221 C CG  . TYR D 2 32  ? -2.088  4.746   41.724  1.00 33.43  ? 32  TYR B CG  1 
ATOM   5222 C CD1 . TYR D 2 32  ? -1.141  5.533   41.067  1.00 31.49  ? 32  TYR B CD1 1 
ATOM   5223 C CD2 . TYR D 2 32  ? -1.720  3.466   42.134  1.00 33.30  ? 32  TYR B CD2 1 
ATOM   5224 C CE1 . TYR D 2 32  ? 0.145   5.055   40.828  1.00 42.25  ? 32  TYR B CE1 1 
ATOM   5225 C CE2 . TYR D 2 32  ? -0.439  2.977   41.900  1.00 40.25  ? 32  TYR B CE2 1 
ATOM   5226 C CZ  . TYR D 2 32  ? 0.491   3.777   41.248  1.00 43.96  ? 32  TYR B CZ  1 
ATOM   5227 O OH  . TYR D 2 32  ? 1.762   3.304   41.021  1.00 45.32  ? 32  TYR B OH  1 
ATOM   5228 N N   . GLY D 2 33  ? -6.623  4.598   42.017  1.00 28.52  ? 33  GLY B N   1 
ATOM   5229 C CA  . GLY D 2 33  ? -7.889  5.028   42.580  1.00 26.10  ? 33  GLY B CA  1 
ATOM   5230 C C   . GLY D 2 33  ? -7.632  5.620   43.954  1.00 22.53  ? 33  GLY B C   1 
ATOM   5231 O O   . GLY D 2 33  ? -6.865  5.052   44.739  1.00 26.99  ? 33  GLY B O   1 
ATOM   5232 N N   . MET D 2 34  ? -8.227  6.774   44.240  1.00 17.51  ? 34  MET B N   1 
ATOM   5233 C CA  . MET D 2 34  ? -8.060  7.414   45.537  1.00 19.36  ? 34  MET B CA  1 
ATOM   5234 C C   . MET D 2 34  ? -9.108  6.919   46.539  1.00 22.79  ? 34  MET B C   1 
ATOM   5235 O O   . MET D 2 34  ? -10.325 7.160   46.380  1.00 20.65  ? 34  MET B O   1 
ATOM   5236 C CB  . MET D 2 34  ? -8.175  8.929   45.408  1.00 18.65  ? 34  MET B CB  1 
ATOM   5237 C CG  . MET D 2 34  ? -7.694  9.660   46.651  1.00 29.31  ? 34  MET B CG  1 
ATOM   5238 S SD  . MET D 2 34  ? -5.890  9.472   46.856  1.00 40.94  ? 34  MET B SD  1 
ATOM   5239 C CE  . MET D 2 34  ? -5.332  10.427  45.419  1.00 34.71  ? 34  MET B CE  1 
ATOM   5240 N N   . ASN D 2 35  ? -8.614  6.232   47.562  1.00 20.67  ? 35  ASN B N   1 
ATOM   5241 C CA  . ASN D 2 35  ? -9.432  5.670   48.609  1.00 25.11  ? 35  ASN B CA  1 
ATOM   5242 C C   . ASN D 2 35  ? -9.334  6.506   49.861  1.00 23.47  ? 35  ASN B C   1 
ATOM   5243 O O   . ASN D 2 35  ? -8.389  7.278   50.053  1.00 23.93  ? 35  ASN B O   1 
ATOM   5244 C CB  . ASN D 2 35  ? -8.992  4.241   48.924  1.00 19.97  ? 35  ASN B CB  1 
ATOM   5245 C CG  . ASN D 2 35  ? -9.272  3.283   47.805  1.00 20.83  ? 35  ASN B CG  1 
ATOM   5246 O OD1 . ASN D 2 35  ? -9.991  2.296   47.983  1.00 18.97  ? 35  ASN B OD1 1 
ATOM   5247 N ND2 . ASN D 2 35  ? -8.682  3.544   46.636  1.00 20.82  ? 35  ASN B ND2 1 
ATOM   5248 N N   . TRP D 2 36  ? -10.319 6.356   50.728  1.00 26.15  ? 36  TRP B N   1 
ATOM   5249 C CA  . TRP D 2 36  ? -10.318 7.116   51.965  1.00 21.81  ? 36  TRP B CA  1 
ATOM   5250 C C   . TRP D 2 36  ? -10.649 6.162   53.088  1.00 24.26  ? 36  TRP B C   1 
ATOM   5251 O O   . TRP D 2 36  ? -11.585 5.373   52.959  1.00 15.51  ? 36  TRP B O   1 
ATOM   5252 C CB  . TRP D 2 36  ? -11.359 8.237   51.910  1.00 25.96  ? 36  TRP B CB  1 
ATOM   5253 C CG  . TRP D 2 36  ? -11.025 9.378   50.998  1.00 20.57  ? 36  TRP B CG  1 
ATOM   5254 C CD1 . TRP D 2 36  ? -11.437 9.538   49.713  1.00 16.63  ? 36  TRP B CD1 1 
ATOM   5255 C CD2 . TRP D 2 36  ? -10.257 10.550  51.320  1.00 15.71  ? 36  TRP B CD2 1 
ATOM   5256 N NE1 . TRP D 2 36  ? -10.991 10.735  49.214  1.00 15.81  ? 36  TRP B NE1 1 
ATOM   5257 C CE2 . TRP D 2 36  ? -10.261 11.377  50.180  1.00 22.00  ? 36  TRP B CE2 1 
ATOM   5258 C CE3 . TRP D 2 36  ? -9.570  10.979  52.460  1.00 20.07  ? 36  TRP B CE3 1 
ATOM   5259 C CZ2 . TRP D 2 36  ? -9.600  12.614  50.148  1.00 15.69  ? 36  TRP B CZ2 1 
ATOM   5260 C CZ3 . TRP D 2 36  ? -8.928  12.186  52.435  1.00 11.52  ? 36  TRP B CZ3 1 
ATOM   5261 C CH2 . TRP D 2 36  ? -8.946  13.001  51.288  1.00 14.92  ? 36  TRP B CH2 1 
ATOM   5262 N N   . VAL D 2 37  ? -9.851  6.179   54.161  1.00 24.73  ? 37  VAL B N   1 
ATOM   5263 C CA  . VAL D 2 37  ? -10.138 5.294   55.283  1.00 21.20  ? 37  VAL B CA  1 
ATOM   5264 C C   . VAL D 2 37  ? -10.049 6.069   56.594  1.00 22.44  ? 37  VAL B C   1 
ATOM   5265 O O   . VAL D 2 37  ? -9.203  6.955   56.773  1.00 19.82  ? 37  VAL B O   1 
ATOM   5266 C CB  . VAL D 2 37  ? -9.261  3.959   55.265  1.00 26.02  ? 37  VAL B CB  1 
ATOM   5267 C CG1 . VAL D 2 37  ? -8.547  3.815   53.959  1.00 18.72  ? 37  VAL B CG1 1 
ATOM   5268 C CG2 . VAL D 2 37  ? -8.347  3.888   56.433  1.00 25.01  ? 37  VAL B CG2 1 
ATOM   5269 N N   . LYS D 2 38  ? -11.003 5.779   57.476  1.00 23.34  ? 38  LYS B N   1 
ATOM   5270 C CA  . LYS D 2 38  ? -11.112 6.458   58.764  1.00 20.62  ? 38  LYS B CA  1 
ATOM   5271 C C   . LYS D 2 38  ? -10.506 5.598   59.847  1.00 13.07  ? 38  LYS B C   1 
ATOM   5272 O O   . LYS D 2 38  ? -10.548 4.387   59.762  1.00 15.89  ? 38  LYS B O   1 
ATOM   5273 C CB  . LYS D 2 38  ? -12.601 6.720   59.093  1.00 27.98  ? 38  LYS B CB  1 
ATOM   5274 C CG  . LYS D 2 38  ? -12.900 7.085   60.555  1.00 23.97  ? 38  LYS B CG  1 
ATOM   5275 C CD  . LYS D 2 38  ? -14.431 7.073   60.847  1.00 28.09  ? 38  LYS B CD  1 
ATOM   5276 C CE  . LYS D 2 38  ? -14.777 7.865   62.129  1.00 24.63  ? 38  LYS B CE  1 
ATOM   5277 N NZ  . LYS D 2 38  ? -16.278 7.981   62.348  1.00 25.68  ? 38  LYS B NZ  1 
ATOM   5278 N N   . GLN D 2 39  ? -9.951  6.239   60.866  1.00 17.32  ? 39  GLN B N   1 
ATOM   5279 C CA  . GLN D 2 39  ? -9.364  5.520   61.981  1.00 18.02  ? 39  GLN B CA  1 
ATOM   5280 C C   . GLN D 2 39  ? -9.759  6.262   63.217  1.00 19.77  ? 39  GLN B C   1 
ATOM   5281 O O   . GLN D 2 39  ? -9.177  7.294   63.531  1.00 23.29  ? 39  GLN B O   1 
ATOM   5282 C CB  . GLN D 2 39  ? -7.818  5.462   61.896  1.00 17.35  ? 39  GLN B CB  1 
ATOM   5283 C CG  . GLN D 2 39  ? -7.236  4.488   62.928  1.00 14.69  ? 39  GLN B CG  1 
ATOM   5284 C CD  . GLN D 2 39  ? -5.800  4.093   62.639  1.00 25.43  ? 39  GLN B CD  1 
ATOM   5285 O OE1 . GLN D 2 39  ? -4.993  4.922   62.225  1.00 18.45  ? 39  GLN B OE1 1 
ATOM   5286 N NE2 . GLN D 2 39  ? -5.480  2.824   62.858  1.00 15.49  ? 39  GLN B NE2 1 
ATOM   5287 N N   . ALA D 2 40  ? -10.778 5.758   63.911  1.00 28.30  ? 40  ALA B N   1 
ATOM   5288 C CA  . ALA D 2 40  ? -11.214 6.396   65.144  1.00 27.54  ? 40  ALA B CA  1 
ATOM   5289 C C   . ALA D 2 40  ? -10.132 6.139   66.196  1.00 32.13  ? 40  ALA B C   1 
ATOM   5290 O O   . ALA D 2 40  ? -9.525  5.063   66.228  1.00 32.34  ? 40  ALA B O   1 
ATOM   5291 C CB  . ALA D 2 40  ? -12.554 5.804   65.599  1.00 30.14  ? 40  ALA B CB  1 
ATOM   5292 N N   . PRO D 2 41  ? -9.880  7.115   67.077  1.00 33.13  ? 41  PRO B N   1 
ATOM   5293 C CA  . PRO D 2 41  ? -8.850  6.928   68.106  1.00 35.47  ? 41  PRO B CA  1 
ATOM   5294 C C   . PRO D 2 41  ? -8.874  5.538   68.759  1.00 41.26  ? 41  PRO B C   1 
ATOM   5295 O O   . PRO D 2 41  ? -9.859  5.141   69.392  1.00 38.91  ? 41  PRO B O   1 
ATOM   5296 C CB  . PRO D 2 41  ? -9.137  8.044   69.108  1.00 39.31  ? 41  PRO B CB  1 
ATOM   5297 C CG  . PRO D 2 41  ? -9.765  9.124   68.283  1.00 36.68  ? 41  PRO B CG  1 
ATOM   5298 C CD  . PRO D 2 41  ? -10.552 8.426   67.196  1.00 33.24  ? 41  PRO B CD  1 
ATOM   5299 N N   . GLY D 2 42  ? -7.785  4.797   68.580  1.00 42.52  ? 42  GLY B N   1 
ATOM   5300 C CA  . GLY D 2 42  ? -7.685  3.467   69.155  1.00 47.30  ? 42  GLY B CA  1 
ATOM   5301 C C   . GLY D 2 42  ? -8.638  2.446   68.565  1.00 49.56  ? 42  GLY B C   1 
ATOM   5302 O O   . GLY D 2 42  ? -8.879  1.395   69.158  1.00 50.41  ? 42  GLY B O   1 
ATOM   5303 N N   . LYS D 2 43  ? -9.192  2.749   67.398  1.00 50.57  ? 43  LYS B N   1 
ATOM   5304 C CA  . LYS D 2 43  ? -10.112 1.827   66.752  1.00 50.29  ? 43  LYS B CA  1 
ATOM   5305 C C   . LYS D 2 43  ? -9.432  1.262   65.509  1.00 51.06  ? 43  LYS B C   1 
ATOM   5306 O O   . LYS D 2 43  ? -8.312  1.656   65.184  1.00 55.38  ? 43  LYS B O   1 
ATOM   5307 C CB  . LYS D 2 43  ? -11.414 2.552   66.391  1.00 51.37  ? 43  LYS B CB  1 
ATOM   5308 C CG  . LYS D 2 43  ? -12.179 3.109   67.599  1.00 49.04  ? 43  LYS B CG  1 
ATOM   5309 C CD  . LYS D 2 43  ? -12.169 2.139   68.770  1.00 52.57  ? 43  LYS B CD  1 
ATOM   5310 C CE  . LYS D 2 43  ? -13.444 2.242   69.604  1.00 60.49  ? 43  LYS B CE  1 
ATOM   5311 N NZ  . LYS D 2 43  ? -14.125 0.920   69.784  1.00 66.57  ? 43  LYS B NZ  1 
ATOM   5312 N N   . GLY D 2 44  ? -10.093 0.338   64.820  1.00 47.01  ? 44  GLY B N   1 
ATOM   5313 C CA  . GLY D 2 44  ? -9.489  -0.249  63.637  1.00 43.88  ? 44  GLY B CA  1 
ATOM   5314 C C   . GLY D 2 44  ? -9.460  0.698   62.455  1.00 37.12  ? 44  GLY B C   1 
ATOM   5315 O O   . GLY D 2 44  ? -9.574  1.910   62.624  1.00 34.04  ? 44  GLY B O   1 
ATOM   5316 N N   . LEU D 2 45  ? -9.297  0.147   61.256  1.00 35.62  ? 45  LEU B N   1 
ATOM   5317 C CA  . LEU D 2 45  ? -9.275  0.956   60.039  1.00 33.73  ? 45  LEU B CA  1 
ATOM   5318 C C   . LEU D 2 45  ? -10.566 0.688   59.272  1.00 32.08  ? 45  LEU B C   1 
ATOM   5319 O O   . LEU D 2 45  ? -10.921 -0.463  59.020  1.00 30.50  ? 45  LEU B O   1 
ATOM   5320 C CB  . LEU D 2 45  ? -8.052  0.607   59.168  1.00 30.38  ? 45  LEU B CB  1 
ATOM   5321 C CG  . LEU D 2 45  ? -6.675  0.988   59.733  1.00 29.21  ? 45  LEU B CG  1 
ATOM   5322 C CD1 . LEU D 2 45  ? -5.598  0.106   59.108  1.00 23.95  ? 45  LEU B CD1 1 
ATOM   5323 C CD2 . LEU D 2 45  ? -6.387  2.442   59.454  1.00 25.82  ? 45  LEU B CD2 1 
ATOM   5324 N N   . LYS D 2 46  ? -11.264 1.756   58.894  1.00 31.21  ? 46  LYS B N   1 
ATOM   5325 C CA  . LYS D 2 46  ? -12.518 1.609   58.168  1.00 29.38  ? 46  LYS B CA  1 
ATOM   5326 C C   . LYS D 2 46  ? -12.502 2.223   56.766  1.00 24.52  ? 46  LYS B C   1 
ATOM   5327 O O   . LYS D 2 46  ? -12.322 3.433   56.600  1.00 21.40  ? 46  LYS B O   1 
ATOM   5328 C CB  . LYS D 2 46  ? -13.664 2.225   58.984  1.00 31.92  ? 46  LYS B CB  1 
ATOM   5329 C CG  . LYS D 2 46  ? -14.559 1.209   59.666  1.00 42.60  ? 46  LYS B CG  1 
ATOM   5330 C CD  . LYS D 2 46  ? -13.755 0.175   60.441  1.00 55.78  ? 46  LYS B CD  1 
ATOM   5331 C CE  . LYS D 2 46  ? -14.467 -1.175  60.500  1.00 60.77  ? 46  LYS B CE  1 
ATOM   5332 N NZ  . LYS D 2 46  ? -13.511 -2.316  60.603  1.00 66.28  ? 46  LYS B NZ  1 
ATOM   5333 N N   . TRP D 2 47  ? -12.687 1.380   55.755  1.00 24.00  ? 47  TRP B N   1 
ATOM   5334 C CA  . TRP D 2 47  ? -12.726 1.861   54.381  1.00 25.68  ? 47  TRP B CA  1 
ATOM   5335 C C   . TRP D 2 47  ? -14.035 2.628   54.140  1.00 26.39  ? 47  TRP B C   1 
ATOM   5336 O O   . TRP D 2 47  ? -15.129 2.084   54.294  1.00 29.92  ? 47  TRP B O   1 
ATOM   5337 C CB  . TRP D 2 47  ? -12.622 0.681   53.407  1.00 23.45  ? 47  TRP B CB  1 
ATOM   5338 C CG  . TRP D 2 47  ? -12.608 1.069   51.953  1.00 24.59  ? 47  TRP B CG  1 
ATOM   5339 C CD1 . TRP D 2 47  ? -11.569 1.626   51.260  1.00 30.39  ? 47  TRP B CD1 1 
ATOM   5340 C CD2 . TRP D 2 47  ? -13.657 0.865   51.006  1.00 25.90  ? 47  TRP B CD2 1 
ATOM   5341 N NE1 . TRP D 2 47  ? -11.904 1.772   49.936  1.00 27.93  ? 47  TRP B NE1 1 
ATOM   5342 C CE2 . TRP D 2 47  ? -13.182 1.313   49.751  1.00 28.36  ? 47  TRP B CE2 1 
ATOM   5343 C CE3 . TRP D 2 47  ? -14.957 0.343   51.092  1.00 27.27  ? 47  TRP B CE3 1 
ATOM   5344 C CZ2 . TRP D 2 47  ? -13.961 1.254   48.590  1.00 29.61  ? 47  TRP B CZ2 1 
ATOM   5345 C CZ3 . TRP D 2 47  ? -15.734 0.287   49.934  1.00 29.40  ? 47  TRP B CZ3 1 
ATOM   5346 C CH2 . TRP D 2 47  ? -15.231 0.741   48.700  1.00 29.20  ? 47  TRP B CH2 1 
ATOM   5347 N N   . MET D 2 48  ? -13.904 3.895   53.769  1.00 24.03  ? 48  MET B N   1 
ATOM   5348 C CA  . MET D 2 48  ? -15.039 4.750   53.492  1.00 27.46  ? 48  MET B CA  1 
ATOM   5349 C C   . MET D 2 48  ? -15.514 4.660   52.051  1.00 28.84  ? 48  MET B C   1 
ATOM   5350 O O   . MET D 2 48  ? -16.667 4.977   51.749  1.00 27.17  ? 48  MET B O   1 
ATOM   5351 C CB  . MET D 2 48  ? -14.676 6.196   53.798  1.00 21.70  ? 48  MET B CB  1 
ATOM   5352 C CG  . MET D 2 48  ? -14.420 6.446   55.281  1.00 21.69  ? 48  MET B CG  1 
ATOM   5353 S SD  . MET D 2 48  ? -13.591 7.991   55.594  1.00 21.99  ? 48  MET B SD  1 
ATOM   5354 C CE  . MET D 2 48  ? -14.991 9.203   55.438  1.00 16.46  ? 48  MET B CE  1 
ATOM   5355 N N   . GLY D 2 49  ? -14.615 4.220   51.172  1.00 27.40  ? 49  GLY B N   1 
ATOM   5356 C CA  . GLY D 2 49  ? -14.912 4.128   49.759  1.00 22.85  ? 49  GLY B CA  1 
ATOM   5357 C C   . GLY D 2 49  ? -13.785 4.786   48.969  1.00 24.00  ? 49  GLY B C   1 
ATOM   5358 O O   . GLY D 2 49  ? -12.714 5.051   49.515  1.00 18.52  ? 49  GLY B O   1 
ATOM   5359 N N   . TRP D 2 50  ? -14.022 5.055   47.689  1.00 25.67  ? 50  TRP B N   1 
ATOM   5360 C CA  . TRP D 2 50  ? -13.020 5.696   46.836  1.00 27.78  ? 50  TRP B CA  1 
ATOM   5361 C C   . TRP D 2 50  ? -13.626 6.506   45.708  1.00 30.53  ? 50  TRP B C   1 
ATOM   5362 O O   . TRP D 2 50  ? -14.848 6.620   45.570  1.00 30.18  ? 50  TRP B O   1 
ATOM   5363 C CB  . TRP D 2 50  ? -12.102 4.662   46.205  1.00 24.46  ? 50  TRP B CB  1 
ATOM   5364 C CG  . TRP D 2 50  ? -12.799 3.826   45.175  1.00 29.41  ? 50  TRP B CG  1 
ATOM   5365 C CD1 . TRP D 2 50  ? -13.827 2.953   45.392  1.00 23.08  ? 50  TRP B CD1 1 
ATOM   5366 C CD2 . TRP D 2 50  ? -12.500 3.752   43.770  1.00 28.32  ? 50  TRP B CD2 1 
ATOM   5367 N NE1 . TRP D 2 50  ? -14.185 2.337   44.213  1.00 27.31  ? 50  TRP B NE1 1 
ATOM   5368 C CE2 . TRP D 2 50  ? -13.386 2.810   43.204  1.00 31.50  ? 50  TRP B CE2 1 
ATOM   5369 C CE3 . TRP D 2 50  ? -11.569 4.388   42.938  1.00 27.11  ? 50  TRP B CE3 1 
ATOM   5370 C CZ2 . TRP D 2 50  ? -13.367 2.487   41.842  1.00 32.67  ? 50  TRP B CZ2 1 
ATOM   5371 C CZ3 . TRP D 2 50  ? -11.549 4.066   41.593  1.00 26.23  ? 50  TRP B CZ3 1 
ATOM   5372 C CH2 . TRP D 2 50  ? -12.441 3.123   41.057  1.00 28.16  ? 50  TRP B CH2 1 
ATOM   5373 N N   . ILE D 2 51  ? -12.751 7.076   44.892  1.00 24.88  ? 51  ILE B N   1 
ATOM   5374 C CA  . ILE D 2 51  ? -13.208 7.834   43.762  1.00 22.80  ? 51  ILE B CA  1 
ATOM   5375 C C   . ILE D 2 51  ? -12.299 7.589   42.549  1.00 28.98  ? 51  ILE B C   1 
ATOM   5376 O O   . ILE D 2 51  ? -11.069 7.602   42.658  1.00 24.20  ? 51  ILE B O   1 
ATOM   5377 C CB  . ILE D 2 51  ? -13.268 9.317   44.079  1.00 16.22  ? 51  ILE B CB  1 
ATOM   5378 C CG1 . ILE D 2 51  ? -13.893 10.044  42.882  1.00 14.12  ? 51  ILE B CG1 1 
ATOM   5379 C CG2 . ILE D 2 51  ? -11.859 9.875   44.370  1.00 19.89  ? 51  ILE B CG2 1 
ATOM   5380 C CD1 . ILE D 2 51  ? -14.158 11.522  43.157  1.00 11.15  ? 51  ILE B CD1 1 
ATOM   5381 N N   . ASN D 2 52  ? -12.931 7.327   41.411  1.00 25.94  ? 52  ASN B N   1 
ATOM   5382 C CA  . ASN D 2 52  ? -12.221 7.079   40.161  1.00 26.52  ? 52  ASN B CA  1 
ATOM   5383 C C   . ASN D 2 52  ? -11.590 8.390   39.755  1.00 27.20  ? 52  ASN B C   1 
ATOM   5384 O O   . ASN D 2 52  ? -12.288 9.363   39.472  1.00 28.14  ? 52  ASN B O   1 
ATOM   5385 C CB  . ASN D 2 52  ? -13.210 6.604   39.089  1.00 23.04  ? 52  ASN B CB  1 
ATOM   5386 C CG  . ASN D 2 52  ? -12.509 6.064   37.868  1.00 17.76  ? 52  ASN B CG  1 
ATOM   5387 O OD1 . ASN D 2 52  ? -12.657 4.892   37.504  1.00 20.18  ? 52  ASN B OD1 1 
ATOM   5388 N ND2 . ASN D 2 52  ? -11.730 6.916   37.232  1.00 17.59  ? 52  ASN B ND2 1 
ATOM   5389 N N   . THR D 2 53  ? -10.264 8.426   39.748  1.00 28.58  ? 53  THR B N   1 
ATOM   5390 C CA  . THR D 2 53  ? -9.548  9.640   39.393  1.00 25.28  ? 53  THR B CA  1 
ATOM   5391 C C   . THR D 2 53  ? -9.638  10.012  37.911  1.00 25.99  ? 53  THR B C   1 
ATOM   5392 O O   . THR D 2 53  ? -9.295  11.131  37.517  1.00 23.64  ? 53  THR B O   1 
ATOM   5393 C CB  . THR D 2 53  ? -8.088  9.543   39.833  1.00 27.07  ? 53  THR B CB  1 
ATOM   5394 O OG1 . THR D 2 53  ? -7.602  8.206   39.605  1.00 29.14  ? 53  THR B OG1 1 
ATOM   5395 C CG2 . THR D 2 53  ? -7.997  9.865   41.325  1.00 27.41  ? 53  THR B CG2 1 
ATOM   5396 N N   . TYR D 2 54  ? -10.133 9.086   37.104  1.00 28.14  ? 54  TYR B N   1 
ATOM   5397 C CA  . TYR D 2 54  ? -10.283 9.342   35.682  1.00 29.96  ? 54  TYR B CA  1 
ATOM   5398 C C   . TYR D 2 54  ? -11.691 9.858   35.344  1.00 30.13  ? 54  TYR B C   1 
ATOM   5399 O O   . TYR D 2 54  ? -11.844 10.921  34.752  1.00 29.83  ? 54  TYR B O   1 
ATOM   5400 C CB  . TYR D 2 54  ? -10.004 8.074   34.887  1.00 29.55  ? 54  TYR B CB  1 
ATOM   5401 C CG  . TYR D 2 54  ? -10.081 8.301   33.390  1.00 36.04  ? 54  TYR B CG  1 
ATOM   5402 C CD1 . TYR D 2 54  ? -9.161  9.129   32.743  1.00 39.19  ? 54  TYR B CD1 1 
ATOM   5403 C CD2 . TYR D 2 54  ? -11.117 7.750   32.635  1.00 39.71  ? 54  TYR B CD2 1 
ATOM   5404 C CE1 . TYR D 2 54  ? -9.278  9.414   31.378  1.00 46.86  ? 54  TYR B CE1 1 
ATOM   5405 C CE2 . TYR D 2 54  ? -11.244 8.024   31.278  1.00 46.84  ? 54  TYR B CE2 1 
ATOM   5406 C CZ  . TYR D 2 54  ? -10.324 8.860   30.652  1.00 51.04  ? 54  TYR B CZ  1 
ATOM   5407 O OH  . TYR D 2 54  ? -10.462 9.147   29.310  1.00 52.17  ? 54  TYR B OH  1 
ATOM   5408 N N   . THR D 2 55  ? -12.716 9.105   35.725  1.00 33.93  ? 55  THR B N   1 
ATOM   5409 C CA  . THR D 2 55  ? -14.100 9.503   35.446  1.00 30.46  ? 55  THR B CA  1 
ATOM   5410 C C   . THR D 2 55  ? -14.676 10.444  36.499  1.00 34.24  ? 55  THR B C   1 
ATOM   5411 O O   . THR D 2 55  ? -15.727 11.054  36.283  1.00 36.45  ? 55  THR B O   1 
ATOM   5412 C CB  . THR D 2 55  ? -15.011 8.289   35.368  1.00 28.28  ? 55  THR B CB  1 
ATOM   5413 O OG1 . THR D 2 55  ? -15.084 7.667   36.664  1.00 31.17  ? 55  THR B OG1 1 
ATOM   5414 C CG2 . THR D 2 55  ? -14.484 7.296   34.342  1.00 13.93  ? 55  THR B CG2 1 
ATOM   5415 N N   . GLY D 2 56  ? -13.991 10.568  37.634  1.00 32.16  ? 56  GLY B N   1 
ATOM   5416 C CA  . GLY D 2 56  ? -14.481 11.441  38.693  1.00 24.75  ? 56  GLY B CA  1 
ATOM   5417 C C   . GLY D 2 56  ? -15.594 10.865  39.553  1.00 29.48  ? 56  GLY B C   1 
ATOM   5418 O O   . GLY D 2 56  ? -15.997 11.510  40.530  1.00 33.93  ? 56  GLY B O   1 
ATOM   5419 N N   . GLU D 2 57  ? -16.074 9.661   39.233  1.00 23.91  ? 57  GLU B N   1 
ATOM   5420 C CA  . GLU D 2 57  ? -17.174 9.031   39.975  1.00 30.88  ? 57  GLU B CA  1 
ATOM   5421 C C   . GLU D 2 57  ? -16.816 8.330   41.284  1.00 30.77  ? 57  GLU B C   1 
ATOM   5422 O O   . GLU D 2 57  ? -15.975 7.419   41.314  1.00 28.03  ? 57  GLU B O   1 
ATOM   5423 C CB  . GLU D 2 57  ? -17.921 8.020   39.088  1.00 35.25  ? 57  GLU B CB  1 
ATOM   5424 C CG  . GLU D 2 57  ? -18.215 8.512   37.674  1.00 54.13  ? 57  GLU B CG  1 
ATOM   5425 C CD  . GLU D 2 57  ? -19.316 9.568   37.612  1.00 59.23  ? 57  GLU B CD  1 
ATOM   5426 O OE1 . GLU D 2 57  ? -19.424 10.398  38.543  1.00 61.62  ? 57  GLU B OE1 1 
ATOM   5427 O OE2 . GLU D 2 57  ? -20.076 9.567   36.619  1.00 64.99  ? 57  GLU B OE2 1 
ATOM   5428 N N   . PRO D 2 58  ? -17.489 8.725   42.380  1.00 29.20  ? 58  PRO B N   1 
ATOM   5429 C CA  . PRO D 2 58  ? -17.266 8.152   43.713  1.00 26.05  ? 58  PRO B CA  1 
ATOM   5430 C C   . PRO D 2 58  ? -18.092 6.909   43.984  1.00 25.61  ? 58  PRO B C   1 
ATOM   5431 O O   . PRO D 2 58  ? -19.147 6.683   43.382  1.00 24.27  ? 58  PRO B O   1 
ATOM   5432 C CB  . PRO D 2 58  ? -17.634 9.289   44.667  1.00 26.71  ? 58  PRO B CB  1 
ATOM   5433 C CG  . PRO D 2 58  ? -18.613 10.150  43.876  1.00 30.07  ? 58  PRO B CG  1 
ATOM   5434 C CD  . PRO D 2 58  ? -18.509 9.787   42.402  1.00 28.05  ? 58  PRO B CD  1 
ATOM   5435 N N   . THR D 2 59  ? -17.590 6.101   44.905  1.00 23.77  ? 59  THR B N   1 
ATOM   5436 C CA  . THR D 2 59  ? -18.254 4.882   45.328  1.00 25.46  ? 59  THR B CA  1 
ATOM   5437 C C   . THR D 2 59  ? -18.113 4.946   46.847  1.00 31.06  ? 59  THR B C   1 
ATOM   5438 O O   . THR D 2 59  ? -16.989 4.998   47.370  1.00 28.63  ? 59  THR B O   1 
ATOM   5439 C CB  . THR D 2 59  ? -17.547 3.632   44.772  1.00 27.97  ? 59  THR B CB  1 
ATOM   5440 O OG1 . THR D 2 59  ? -17.818 3.516   43.367  1.00 28.28  ? 59  THR B OG1 1 
ATOM   5441 C CG2 . THR D 2 59  ? -18.043 2.361   45.482  1.00 28.03  ? 59  THR B CG2 1 
ATOM   5442 N N   . TYR D 2 60  ? -19.251 4.996   47.545  1.00 29.17  ? 60  TYR B N   1 
ATOM   5443 C CA  . TYR D 2 60  ? -19.254 5.086   48.999  1.00 26.20  ? 60  TYR B CA  1 
ATOM   5444 C C   . TYR D 2 60  ? -19.595 3.773   49.671  1.00 25.53  ? 60  TYR B C   1 
ATOM   5445 O O   . TYR D 2 60  ? -20.422 3.022   49.176  1.00 25.71  ? 60  TYR B O   1 
ATOM   5446 C CB  . TYR D 2 60  ? -20.232 6.155   49.466  1.00 19.31  ? 60  TYR B CB  1 
ATOM   5447 C CG  . TYR D 2 60  ? -19.952 7.524   48.899  1.00 20.29  ? 60  TYR B CG  1 
ATOM   5448 C CD1 . TYR D 2 60  ? -19.044 8.376   49.510  1.00 23.58  ? 60  TYR B CD1 1 
ATOM   5449 C CD2 . TYR D 2 60  ? -20.565 7.957   47.732  1.00 21.16  ? 60  TYR B CD2 1 
ATOM   5450 C CE1 . TYR D 2 60  ? -18.754 9.617   48.975  1.00 16.64  ? 60  TYR B CE1 1 
ATOM   5451 C CE2 . TYR D 2 60  ? -20.273 9.211   47.190  1.00 16.82  ? 60  TYR B CE2 1 
ATOM   5452 C CZ  . TYR D 2 60  ? -19.364 10.027  47.819  1.00 20.87  ? 60  TYR B CZ  1 
ATOM   5453 O OH  . TYR D 2 60  ? -19.064 11.270  47.301  1.00 24.75  ? 60  TYR B OH  1 
ATOM   5454 N N   . ALA D 2 61  ? -18.932 3.501   50.794  1.00 25.28  ? 61  ALA B N   1 
ATOM   5455 C CA  . ALA D 2 61  ? -19.171 2.285   51.563  1.00 26.58  ? 61  ALA B CA  1 
ATOM   5456 C C   . ALA D 2 61  ? -20.502 2.456   52.295  1.00 27.47  ? 61  ALA B C   1 
ATOM   5457 O O   . ALA D 2 61  ? -20.868 3.557   52.688  1.00 23.77  ? 61  ALA B O   1 
ATOM   5458 C CB  . ALA D 2 61  ? -18.060 2.069   52.575  1.00 24.40  ? 61  ALA B CB  1 
ATOM   5459 N N   . ASP D 2 62  ? -21.209 1.357   52.497  1.00 32.82  ? 62  ASP B N   1 
ATOM   5460 C CA  . ASP D 2 62  ? -22.508 1.412   53.151  1.00 35.66  ? 62  ASP B CA  1 
ATOM   5461 C C   . ASP D 2 62  ? -22.565 2.315   54.374  1.00 37.51  ? 62  ASP B C   1 
ATOM   5462 O O   . ASP D 2 62  ? -23.522 3.075   54.541  1.00 34.96  ? 62  ASP B O   1 
ATOM   5463 C CB  . ASP D 2 62  ? -22.952 -0.003  53.514  1.00 42.58  ? 62  ASP B CB  1 
ATOM   5464 C CG  . ASP D 2 62  ? -23.487 -0.756  52.316  1.00 43.59  ? 62  ASP B CG  1 
ATOM   5465 O OD1 . ASP D 2 62  ? -23.745 -0.101  51.282  1.00 42.45  ? 62  ASP B OD1 1 
ATOM   5466 O OD2 . ASP D 2 62  ? -23.644 -1.990  52.404  1.00 49.95  ? 62  ASP B OD2 1 
ATOM   5467 N N   . ASP D 2 63  ? -21.523 2.256   55.201  1.00 35.48  ? 63  ASP B N   1 
ATOM   5468 C CA  . ASP D 2 63  ? -21.459 3.042   56.424  1.00 31.01  ? 63  ASP B CA  1 
ATOM   5469 C C   . ASP D 2 63  ? -21.172 4.528   56.237  1.00 29.39  ? 63  ASP B C   1 
ATOM   5470 O O   . ASP D 2 63  ? -21.215 5.289   57.198  1.00 29.07  ? 63  ASP B O   1 
ATOM   5471 C CB  . ASP D 2 63  ? -20.425 2.434   57.372  1.00 37.29  ? 63  ASP B CB  1 
ATOM   5472 C CG  . ASP D 2 63  ? -21.056 1.549   58.438  1.00 46.36  ? 63  ASP B CG  1 
ATOM   5473 O OD1 . ASP D 2 63  ? -21.406 2.067   59.519  1.00 59.18  ? 63  ASP B OD1 1 
ATOM   5474 O OD2 . ASP D 2 63  ? -21.211 0.336   58.198  1.00 52.62  ? 63  ASP B OD2 1 
ATOM   5475 N N   . PHE D 2 64  ? -20.912 4.960   55.009  1.00 20.84  ? 64  PHE B N   1 
ATOM   5476 C CA  . PHE D 2 64  ? -20.626 6.369   54.782  1.00 19.67  ? 64  PHE B CA  1 
ATOM   5477 C C   . PHE D 2 64  ? -21.449 6.981   53.656  1.00 24.00  ? 64  PHE B C   1 
ATOM   5478 O O   . PHE D 2 64  ? -21.006 7.891   52.946  1.00 17.47  ? 64  PHE B O   1 
ATOM   5479 C CB  . PHE D 2 64  ? -19.127 6.539   54.526  1.00 20.78  ? 64  PHE B CB  1 
ATOM   5480 C CG  . PHE D 2 64  ? -18.289 6.131   55.697  1.00 15.68  ? 64  PHE B CG  1 
ATOM   5481 C CD1 . PHE D 2 64  ? -17.986 4.806   55.910  1.00 16.47  ? 64  PHE B CD1 1 
ATOM   5482 C CD2 . PHE D 2 64  ? -17.840 7.067   56.601  1.00 11.22  ? 64  PHE B CD2 1 
ATOM   5483 C CE1 . PHE D 2 64  ? -17.253 4.420   57.001  1.00 15.25  ? 64  PHE B CE1 1 
ATOM   5484 C CE2 . PHE D 2 64  ? -17.095 6.685   57.707  1.00 17.33  ? 64  PHE B CE2 1 
ATOM   5485 C CZ  . PHE D 2 64  ? -16.802 5.368   57.908  1.00 12.68  ? 64  PHE B CZ  1 
ATOM   5486 N N   . LYS D 2 65  ? -22.663 6.469   53.501  1.00 26.77  ? 65  LYS B N   1 
ATOM   5487 C CA  . LYS D 2 65  ? -23.580 6.969   52.486  1.00 23.29  ? 65  LYS B CA  1 
ATOM   5488 C C   . LYS D 2 65  ? -24.539 7.929   53.168  1.00 29.59  ? 65  LYS B C   1 
ATOM   5489 O O   . LYS D 2 65  ? -25.415 7.511   53.944  1.00 25.02  ? 65  LYS B O   1 
ATOM   5490 C CB  . LYS D 2 65  ? -24.374 5.817   51.883  1.00 29.73  ? 65  LYS B CB  1 
ATOM   5491 C CG  . LYS D 2 65  ? -23.665 5.058   50.775  1.00 23.13  ? 65  LYS B CG  1 
ATOM   5492 C CD  . LYS D 2 65  ? -24.445 3.808   50.449  1.00 17.88  ? 65  LYS B CD  1 
ATOM   5493 C CE  . LYS D 2 65  ? -23.905 3.113   49.215  1.00 19.63  ? 65  LYS B CE  1 
ATOM   5494 N NZ  . LYS D 2 65  ? -23.780 1.647   49.480  1.00 30.03  ? 65  LYS B NZ  1 
ATOM   5495 N N   . GLY D 2 66  ? -24.349 9.213   52.914  1.00 26.47  ? 66  GLY B N   1 
ATOM   5496 C CA  . GLY D 2 66  ? -25.240 10.192  53.482  1.00 25.38  ? 66  GLY B CA  1 
ATOM   5497 C C   . GLY D 2 66  ? -24.615 11.547  53.719  1.00 25.99  ? 66  GLY B C   1 
ATOM   5498 O O   . GLY D 2 66  ? -25.020 12.533  53.124  1.00 30.38  ? 66  GLY B O   1 
ATOM   5499 N N   . ARG D 2 67  ? -23.622 11.604  54.595  1.00 20.67  ? 67  ARG B N   1 
ATOM   5500 C CA  . ARG D 2 67  ? -23.013 12.873  54.929  1.00 15.55  ? 67  ARG B CA  1 
ATOM   5501 C C   . ARG D 2 67  ? -21.592 13.009  54.406  1.00 21.57  ? 67  ARG B C   1 
ATOM   5502 O O   . ARG D 2 67  ? -20.876 13.908  54.842  1.00 21.35  ? 67  ARG B O   1 
ATOM   5503 C CB  . ARG D 2 67  ? -22.998 13.048  56.444  1.00 17.27  ? 67  ARG B CB  1 
ATOM   5504 C CG  . ARG D 2 67  ? -24.356 12.818  57.122  1.00 28.27  ? 67  ARG B CG  1 
ATOM   5505 C CD  . ARG D 2 67  ? -24.303 13.107  58.639  1.00 19.44  ? 67  ARG B CD  1 
ATOM   5506 N NE  . ARG D 2 67  ? -23.026 12.728  59.253  1.00 30.65  ? 67  ARG B NE  1 
ATOM   5507 C CZ  . ARG D 2 67  ? -22.709 11.494  59.633  1.00 34.43  ? 67  ARG B CZ  1 
ATOM   5508 N NH1 . ARG D 2 67  ? -23.582 10.513  59.461  1.00 44.46  ? 67  ARG B NH1 1 
ATOM   5509 N NH2 . ARG D 2 67  ? -21.528 11.225  60.188  1.00 18.73  ? 67  ARG B NH2 1 
ATOM   5510 N N   . PHE D 2 68  ? -21.200 12.129  53.478  1.00 21.71  ? 68  PHE B N   1 
ATOM   5511 C CA  . PHE D 2 68  ? -19.841 12.130  52.913  1.00 23.08  ? 68  PHE B CA  1 
ATOM   5512 C C   . PHE D 2 68  ? -19.795 12.325  51.409  1.00 25.09  ? 68  PHE B C   1 
ATOM   5513 O O   . PHE D 2 68  ? -20.544 11.703  50.645  1.00 25.17  ? 68  PHE B O   1 
ATOM   5514 C CB  . PHE D 2 68  ? -19.123 10.839  53.301  1.00 13.97  ? 68  PHE B CB  1 
ATOM   5515 C CG  . PHE D 2 68  ? -19.159 10.561  54.796  1.00 21.33  ? 68  PHE B CG  1 
ATOM   5516 C CD1 . PHE D 2 68  ? -20.313 10.044  55.390  1.00 21.94  ? 68  PHE B CD1 1 
ATOM   5517 C CD2 . PHE D 2 68  ? -18.066 10.856  55.608  1.00 16.21  ? 68  PHE B CD2 1 
ATOM   5518 C CE1 . PHE D 2 68  ? -20.381 9.829   56.765  1.00 14.28  ? 68  PHE B CE1 1 
ATOM   5519 C CE2 . PHE D 2 68  ? -18.118 10.648  56.969  1.00 16.46  ? 68  PHE B CE2 1 
ATOM   5520 C CZ  . PHE D 2 68  ? -19.297 10.130  57.560  1.00 20.16  ? 68  PHE B CZ  1 
ATOM   5521 N N   . ALA D 2 69  ? -18.901 13.210  50.987  1.00 26.77  ? 69  ALA B N   1 
ATOM   5522 C CA  . ALA D 2 69  ? -18.754 13.521  49.579  1.00 25.83  ? 69  ALA B CA  1 
ATOM   5523 C C   . ALA D 2 69  ? -17.302 13.559  49.115  1.00 25.42  ? 69  ALA B C   1 
ATOM   5524 O O   . ALA D 2 69  ? -16.514 14.358  49.612  1.00 26.60  ? 69  ALA B O   1 
ATOM   5525 C CB  . ALA D 2 69  ? -19.400 14.838  49.306  1.00 17.40  ? 69  ALA B CB  1 
ATOM   5526 N N   . PHE D 2 70  ? -16.971 12.693  48.157  1.00 27.75  ? 70  PHE B N   1 
ATOM   5527 C CA  . PHE D 2 70  ? -15.627 12.622  47.568  1.00 26.19  ? 70  PHE B CA  1 
ATOM   5528 C C   . PHE D 2 70  ? -15.605 13.397  46.267  1.00 27.89  ? 70  PHE B C   1 
ATOM   5529 O O   . PHE D 2 70  ? -16.385 13.095  45.366  1.00 26.89  ? 70  PHE B O   1 
ATOM   5530 C CB  . PHE D 2 70  ? -15.247 11.201  47.179  1.00 13.25  ? 70  PHE B CB  1 
ATOM   5531 C CG  . PHE D 2 70  ? -15.270 10.238  48.285  1.00 16.18  ? 70  PHE B CG  1 
ATOM   5532 C CD1 . PHE D 2 70  ? -15.106 10.667  49.615  1.00 19.87  ? 70  PHE B CD1 1 
ATOM   5533 C CD2 . PHE D 2 70  ? -15.486 8.880   48.026  1.00 4.20   ? 70  PHE B CD2 1 
ATOM   5534 C CE1 . PHE D 2 70  ? -15.167 9.754   50.659  1.00 11.48  ? 70  PHE B CE1 1 
ATOM   5535 C CE2 . PHE D 2 70  ? -15.542 7.982   49.063  1.00 10.64  ? 70  PHE B CE2 1 
ATOM   5536 C CZ  . PHE D 2 70  ? -15.383 8.415   50.386  1.00 9.31   ? 70  PHE B CZ  1 
ATOM   5537 N N   . SER D 2 71  ? -14.706 14.368  46.162  1.00 31.69  ? 71  SER B N   1 
ATOM   5538 C CA  . SER D 2 71  ? -14.554 15.146  44.946  1.00 30.24  ? 71  SER B CA  1 
ATOM   5539 C C   . SER D 2 71  ? -13.067 15.244  44.626  1.00 31.99  ? 71  SER B C   1 
ATOM   5540 O O   . SER D 2 71  ? -12.213 14.742  45.365  1.00 28.85  ? 71  SER B O   1 
ATOM   5541 C CB  . SER D 2 71  ? -15.154 16.548  45.102  1.00 29.76  ? 71  SER B CB  1 
ATOM   5542 O OG  . SER D 2 71  ? -14.326 17.394  45.876  1.00 29.21  ? 71  SER B OG  1 
ATOM   5543 N N   . LEU D 2 72  ? -12.759 15.884  43.511  1.00 34.35  ? 72  LEU B N   1 
ATOM   5544 C CA  . LEU D 2 72  ? -11.376 16.026  43.106  1.00 34.62  ? 72  LEU B CA  1 
ATOM   5545 C C   . LEU D 2 72  ? -11.161 17.292  42.307  1.00 33.10  ? 72  LEU B C   1 
ATOM   5546 O O   . LEU D 2 72  ? -12.105 17.907  41.818  1.00 34.22  ? 72  LEU B O   1 
ATOM   5547 C CB  . LEU D 2 72  ? -10.926 14.793  42.309  1.00 34.80  ? 72  LEU B CB  1 
ATOM   5548 C CG  . LEU D 2 72  ? -11.728 14.224  41.134  1.00 40.77  ? 72  LEU B CG  1 
ATOM   5549 C CD1 . LEU D 2 72  ? -11.665 15.153  39.946  1.00 43.02  ? 72  LEU B CD1 1 
ATOM   5550 C CD2 . LEU D 2 72  ? -11.165 12.861  40.760  1.00 40.14  ? 72  LEU B CD2 1 
ATOM   5551 N N   . GLU D 2 73  ? -9.896  17.677  42.200  1.00 41.32  ? 73  GLU B N   1 
ATOM   5552 C CA  . GLU D 2 73  ? -9.464  18.867  41.486  1.00 41.81  ? 73  GLU B CA  1 
ATOM   5553 C C   . GLU D 2 73  ? -8.369  18.393  40.544  1.00 43.06  ? 73  GLU B C   1 
ATOM   5554 O O   . GLU D 2 73  ? -7.195  18.662  40.772  1.00 42.02  ? 73  GLU B O   1 
ATOM   5555 C CB  . GLU D 2 73  ? -8.875  19.872  42.470  1.00 45.38  ? 73  GLU B CB  1 
ATOM   5556 C CG  . GLU D 2 73  ? -9.490  21.244  42.404  1.00 58.59  ? 73  GLU B CG  1 
ATOM   5557 C CD  . GLU D 2 73  ? -9.018  22.025  41.201  1.00 65.91  ? 73  GLU B CD  1 
ATOM   5558 O OE1 . GLU D 2 73  ? -9.347  21.617  40.065  1.00 70.37  ? 73  GLU B OE1 1 
ATOM   5559 O OE2 . GLU D 2 73  ? -8.318  23.042  41.394  1.00 65.71  ? 73  GLU B OE2 1 
ATOM   5560 N N   . THR D 2 74  ? -8.759  17.664  39.505  1.00 44.03  ? 74  THR B N   1 
ATOM   5561 C CA  . THR D 2 74  ? -7.808  17.134  38.534  1.00 44.34  ? 74  THR B CA  1 
ATOM   5562 C C   . THR D 2 74  ? -6.724  18.161  38.162  1.00 43.75  ? 74  THR B C   1 
ATOM   5563 O O   . THR D 2 74  ? -5.535  17.845  38.131  1.00 41.85  ? 74  THR B O   1 
ATOM   5564 C CB  . THR D 2 74  ? -8.545  16.659  37.271  1.00 40.93  ? 74  THR B CB  1 
ATOM   5565 O OG1 . THR D 2 74  ? -9.863  17.218  37.252  1.00 43.59  ? 74  THR B OG1 1 
ATOM   5566 C CG2 . THR D 2 74  ? -8.668  15.141  37.275  1.00 40.67  ? 74  THR B CG2 1 
ATOM   5567 N N   . SER D 2 75  ? -7.138  19.394  37.914  1.00 42.33  ? 75  SER B N   1 
ATOM   5568 C CA  . SER D 2 75  ? -6.201  20.452  37.562  1.00 43.55  ? 75  SER B CA  1 
ATOM   5569 C C   . SER D 2 75  ? -5.074  20.634  38.578  1.00 44.35  ? 75  SER B C   1 
ATOM   5570 O O   . SER D 2 75  ? -3.998  21.120  38.229  1.00 47.20  ? 75  SER B O   1 
ATOM   5571 C CB  . SER D 2 75  ? -6.948  21.777  37.396  1.00 47.01  ? 75  SER B CB  1 
ATOM   5572 O OG  . SER D 2 75  ? -6.758  22.609  38.527  1.00 51.76  ? 75  SER B OG  1 
ATOM   5573 N N   . ALA D 2 76  ? -5.308  20.237  39.828  1.00 39.13  ? 76  ALA B N   1 
ATOM   5574 C CA  . ALA D 2 76  ? -4.304  20.398  40.871  1.00 33.80  ? 76  ALA B CA  1 
ATOM   5575 C C   . ALA D 2 76  ? -3.844  19.088  41.505  1.00 31.91  ? 76  ALA B C   1 
ATOM   5576 O O   . ALA D 2 76  ? -3.170  19.104  42.540  1.00 28.16  ? 76  ALA B O   1 
ATOM   5577 C CB  . ALA D 2 76  ? -4.829  21.341  41.946  1.00 34.99  ? 76  ALA B CB  1 
ATOM   5578 N N   . SER D 2 77  ? -4.200  17.965  40.886  1.00 28.99  ? 77  SER B N   1 
ATOM   5579 C CA  . SER D 2 77  ? -3.816  16.647  41.385  1.00 33.56  ? 77  SER B CA  1 
ATOM   5580 C C   . SER D 2 77  ? -4.258  16.454  42.838  1.00 34.18  ? 77  SER B C   1 
ATOM   5581 O O   . SER D 2 77  ? -3.614  15.727  43.602  1.00 31.02  ? 77  SER B O   1 
ATOM   5582 C CB  . SER D 2 77  ? -2.289  16.476  41.291  1.00 38.20  ? 77  SER B CB  1 
ATOM   5583 O OG  . SER D 2 77  ? -1.953  15.355  40.500  1.00 43.26  ? 77  SER B OG  1 
ATOM   5584 N N   . THR D 2 78  ? -5.360  17.103  43.208  1.00 30.82  ? 78  THR B N   1 
ATOM   5585 C CA  . THR D 2 78  ? -5.885  17.037  44.571  1.00 29.37  ? 78  THR B CA  1 
ATOM   5586 C C   . THR D 2 78  ? -7.240  16.336  44.699  1.00 28.40  ? 78  THR B C   1 
ATOM   5587 O O   . THR D 2 78  ? -8.118  16.473  43.839  1.00 26.10  ? 78  THR B O   1 
ATOM   5588 C CB  . THR D 2 78  ? -6.006  18.449  45.158  1.00 29.84  ? 78  THR B CB  1 
ATOM   5589 O OG1 . THR D 2 78  ? -4.777  19.159  44.940  1.00 30.44  ? 78  THR B OG1 1 
ATOM   5590 C CG2 . THR D 2 78  ? -6.268  18.387  46.662  1.00 32.03  ? 78  THR B CG2 1 
ATOM   5591 N N   . ALA D 2 79  ? -7.380  15.552  45.766  1.00 28.01  ? 79  ALA B N   1 
ATOM   5592 C CA  . ALA D 2 79  ? -8.611  14.830  46.075  1.00 25.58  ? 79  ALA B CA  1 
ATOM   5593 C C   . ALA D 2 79  ? -9.137  15.362  47.419  1.00 28.12  ? 79  ALA B C   1 
ATOM   5594 O O   . ALA D 2 79  ? -8.362  15.567  48.342  1.00 24.58  ? 79  ALA B O   1 
ATOM   5595 C CB  . ALA D 2 79  ? -8.339  13.340  46.174  1.00 14.60  ? 79  ALA B CB  1 
ATOM   5596 N N   . TYR D 2 80  ? -10.442 15.598  47.511  1.00 27.24  ? 80  TYR B N   1 
ATOM   5597 C CA  . TYR D 2 80  ? -11.039 16.116  48.735  1.00 27.79  ? 80  TYR B CA  1 
ATOM   5598 C C   . TYR D 2 80  ? -12.083 15.195  49.322  1.00 28.99  ? 80  TYR B C   1 
ATOM   5599 O O   . TYR D 2 80  ? -12.718 14.409  48.605  1.00 24.98  ? 80  TYR B O   1 
ATOM   5600 C CB  . TYR D 2 80  ? -11.710 17.467  48.495  1.00 27.37  ? 80  TYR B CB  1 
ATOM   5601 C CG  . TYR D 2 80  ? -10.869 18.454  47.734  1.00 28.17  ? 80  TYR B CG  1 
ATOM   5602 C CD1 . TYR D 2 80  ? -10.766 18.382  46.347  1.00 28.11  ? 80  TYR B CD1 1 
ATOM   5603 C CD2 . TYR D 2 80  ? -10.194 19.474  48.400  1.00 24.24  ? 80  TYR B CD2 1 
ATOM   5604 C CE1 . TYR D 2 80  ? -10.007 19.305  45.633  1.00 32.49  ? 80  TYR B CE1 1 
ATOM   5605 C CE2 . TYR D 2 80  ? -9.436  20.403  47.705  1.00 28.68  ? 80  TYR B CE2 1 
ATOM   5606 C CZ  . TYR D 2 80  ? -9.346  20.312  46.315  1.00 34.94  ? 80  TYR B CZ  1 
ATOM   5607 O OH  . TYR D 2 80  ? -8.610  21.231  45.605  1.00 42.03  ? 80  TYR B OH  1 
ATOM   5608 N N   . LEU D 2 81  ? -12.254 15.332  50.639  1.00 33.33  ? 81  LEU B N   1 
ATOM   5609 C CA  . LEU D 2 81  ? -13.230 14.582  51.429  1.00 27.33  ? 81  LEU B CA  1 
ATOM   5610 C C   . LEU D 2 81  ? -14.003 15.643  52.215  1.00 31.54  ? 81  LEU B C   1 
ATOM   5611 O O   . LEU D 2 81  ? -13.396 16.483  52.888  1.00 23.57  ? 81  LEU B O   1 
ATOM   5612 C CB  . LEU D 2 81  ? -12.518 13.651  52.401  1.00 32.84  ? 81  LEU B CB  1 
ATOM   5613 C CG  . LEU D 2 81  ? -13.215 12.417  52.991  1.00 37.80  ? 81  LEU B CG  1 
ATOM   5614 C CD1 . LEU D 2 81  ? -12.739 12.260  54.438  1.00 35.92  ? 81  LEU B CD1 1 
ATOM   5615 C CD2 . LEU D 2 81  ? -14.739 12.527  52.935  1.00 28.77  ? 81  LEU B CD2 1 
ATOM   5616 N N   . GLN D 2 82  ? -15.332 15.637  52.094  1.00 27.24  ? 82  GLN B N   1 
ATOM   5617 C CA  . GLN D 2 82  ? -16.160 16.600  52.816  1.00 27.29  ? 82  GLN B CA  1 
ATOM   5618 C C   . GLN D 2 82  ? -17.166 15.834  53.677  1.00 23.10  ? 82  GLN B C   1 
ATOM   5619 O O   . GLN D 2 82  ? -17.747 14.847  53.228  1.00 22.52  ? 82  GLN B O   1 
ATOM   5620 C CB  . GLN D 2 82  ? -16.891 17.542  51.840  1.00 25.72  ? 82  GLN B CB  1 
ATOM   5621 C CG  . GLN D 2 82  ? -17.441 18.798  52.543  1.00 33.04  ? 82  GLN B CG  1 
ATOM   5622 C CD  . GLN D 2 82  ? -18.540 19.522  51.775  1.00 33.27  ? 82  GLN B CD  1 
ATOM   5623 O OE1 . GLN D 2 82  ? -19.704 19.506  52.172  1.00 42.85  ? 82  GLN B OE1 1 
ATOM   5624 N NE2 . GLN D 2 82  ? -18.174 20.169  50.693  1.00 30.47  ? 82  GLN B NE2 1 
ATOM   5625 N N   . ILE D 2 83  ? -17.323 16.262  54.931  1.00 27.64  ? 83  ILE B N   1 
ATOM   5626 C CA  . ILE D 2 83  ? -18.257 15.624  55.863  1.00 20.96  ? 83  ILE B CA  1 
ATOM   5627 C C   . ILE D 2 83  ? -19.197 16.718  56.339  1.00 23.08  ? 83  ILE B C   1 
ATOM   5628 O O   . ILE D 2 83  ? -18.749 17.738  56.872  1.00 22.48  ? 83  ILE B O   1 
ATOM   5629 C CB  . ILE D 2 83  ? -17.550 15.025  57.082  1.00 20.85  ? 83  ILE B CB  1 
ATOM   5630 C CG1 . ILE D 2 83  ? -16.306 14.233  56.622  1.00 18.98  ? 83  ILE B CG1 1 
ATOM   5631 C CG2 . ILE D 2 83  ? -18.559 14.161  57.906  1.00 12.05  ? 83  ILE B CG2 1 
ATOM   5632 C CD1 . ILE D 2 83  ? -15.668 13.338  57.700  1.00 11.73  ? 83  ILE B CD1 1 
ATOM   5633 N N   . ASN D 2 84  ? -20.498 16.531  56.115  1.00 15.91  ? 84  ASN B N   1 
ATOM   5634 C CA  . ASN D 2 84  ? -21.457 17.544  56.520  1.00 18.89  ? 84  ASN B CA  1 
ATOM   5635 C C   . ASN D 2 84  ? -22.172 17.088  57.765  1.00 15.14  ? 84  ASN B C   1 
ATOM   5636 O O   . ASN D 2 84  ? -22.165 15.905  58.095  1.00 16.44  ? 84  ASN B O   1 
ATOM   5637 C CB  . ASN D 2 84  ? -22.489 17.822  55.414  1.00 31.50  ? 84  ASN B CB  1 
ATOM   5638 C CG  . ASN D 2 84  ? -22.140 17.158  54.113  1.00 47.49  ? 84  ASN B CG  1 
ATOM   5639 O OD1 . ASN D 2 84  ? -22.682 16.101  53.780  1.00 58.68  ? 84  ASN B OD1 1 
ATOM   5640 N ND2 . ASN D 2 84  ? -21.233 17.772  53.358  1.00 48.10  ? 84  ASN B ND2 1 
ATOM   5641 N N   . ASN D 2 85  ? -22.765 18.047  58.459  1.00 20.37  ? 85  ASN B N   1 
ATOM   5642 C CA  . ASN D 2 85  ? -23.514 17.769  59.669  1.00 19.68  ? 85  ASN B CA  1 
ATOM   5643 C C   . ASN D 2 85  ? -22.706 16.837  60.565  1.00 17.80  ? 85  ASN B C   1 
ATOM   5644 O O   . ASN D 2 85  ? -23.130 15.737  60.924  1.00 19.10  ? 85  ASN B O   1 
ATOM   5645 C CB  . ASN D 2 85  ? -24.868 17.168  59.284  1.00 14.14  ? 85  ASN B CB  1 
ATOM   5646 C CG  . ASN D 2 85  ? -25.721 16.887  60.495  1.00 15.13  ? 85  ASN B CG  1 
ATOM   5647 O OD1 . ASN D 2 85  ? -25.767 17.695  61.420  1.00 16.64  ? 85  ASN B OD1 1 
ATOM   5648 N ND2 . ASN D 2 85  ? -26.362 15.731  60.511  1.00 14.25  ? 85  ASN B ND2 1 
ATOM   5649 N N   . LEU D 2 86  ? -21.502 17.310  60.877  1.00 19.28  ? 86  LEU B N   1 
ATOM   5650 C CA  . LEU D 2 86  ? -20.504 16.635  61.702  1.00 19.08  ? 86  LEU B CA  1 
ATOM   5651 C C   . LEU D 2 86  ? -21.059 16.146  63.050  1.00 26.21  ? 86  LEU B C   1 
ATOM   5652 O O   . LEU D 2 86  ? -21.835 16.852  63.685  1.00 21.26  ? 86  LEU B O   1 
ATOM   5653 C CB  . LEU D 2 86  ? -19.352 17.628  61.971  1.00 21.20  ? 86  LEU B CB  1 
ATOM   5654 C CG  . LEU D 2 86  ? -17.940 17.631  61.323  1.00 21.32  ? 86  LEU B CG  1 
ATOM   5655 C CD1 . LEU D 2 86  ? -17.801 16.518  60.374  1.00 12.27  ? 86  LEU B CD1 1 
ATOM   5656 C CD2 . LEU D 2 86  ? -17.646 18.953  60.637  1.00 18.14  ? 86  LEU B CD2 1 
ATOM   5657 N N   . LYS D 2 87  ? -20.637 14.946  63.463  1.00 21.99  ? 87  LYS B N   1 
ATOM   5658 C CA  . LYS D 2 87  ? -21.014 14.338  64.738  1.00 25.16  ? 87  LYS B CA  1 
ATOM   5659 C C   . LYS D 2 87  ? -19.747 14.039  65.572  1.00 26.32  ? 87  LYS B C   1 
ATOM   5660 O O   . LYS D 2 87  ? -18.641 13.981  65.011  1.00 28.55  ? 87  LYS B O   1 
ATOM   5661 C CB  . LYS D 2 87  ? -21.789 13.047  64.480  1.00 25.52  ? 87  LYS B CB  1 
ATOM   5662 C CG  . LYS D 2 87  ? -23.219 13.327  64.014  1.00 22.94  ? 87  LYS B CG  1 
ATOM   5663 C CD  . LYS D 2 87  ? -23.747 12.218  63.155  1.00 29.52  ? 87  LYS B CD  1 
ATOM   5664 C CE  . LYS D 2 87  ? -24.795 12.734  62.155  1.00 37.33  ? 87  LYS B CE  1 
ATOM   5665 N NZ  . LYS D 2 87  ? -25.457 14.004  62.596  1.00 34.00  ? 87  LYS B NZ  1 
ATOM   5666 N N   . ASN D 2 88  ? -19.892 13.871  66.893  1.00 24.25  ? 88  ASN B N   1 
ATOM   5667 C CA  . ASN D 2 88  ? -18.734 13.598  67.752  1.00 18.86  ? 88  ASN B CA  1 
ATOM   5668 C C   . ASN D 2 88  ? -18.051 12.338  67.231  1.00 19.96  ? 88  ASN B C   1 
ATOM   5669 O O   . ASN D 2 88  ? -16.798 12.230  67.250  1.00 19.51  ? 88  ASN B O   1 
ATOM   5670 C CB  . ASN D 2 88  ? -19.116 13.341  69.240  1.00 14.91  ? 88  ASN B CB  1 
ATOM   5671 C CG  . ASN D 2 88  ? -19.825 14.514  69.896  1.00 22.29  ? 88  ASN B CG  1 
ATOM   5672 O OD1 . ASN D 2 88  ? -19.571 15.679  69.604  1.00 16.25  ? 88  ASN B OD1 1 
ATOM   5673 N ND2 . ASN D 2 88  ? -20.728 14.191  70.825  1.00 25.87  ? 88  ASN B ND2 1 
ATOM   5674 N N   . GLU D 2 89  ? -18.882 11.412  66.749  1.00 14.28  ? 89  GLU B N   1 
ATOM   5675 C CA  . GLU D 2 89  ? -18.456 10.117  66.242  1.00 18.42  ? 89  GLU B CA  1 
ATOM   5676 C C   . GLU D 2 89  ? -17.627 10.189  64.971  1.00 15.79  ? 89  GLU B C   1 
ATOM   5677 O O   . GLU D 2 89  ? -17.146 9.160   64.511  1.00 17.79  ? 89  GLU B O   1 
ATOM   5678 C CB  . GLU D 2 89  ? -19.661 9.212   65.983  1.00 14.50  ? 89  GLU B CB  1 
ATOM   5679 C CG  . GLU D 2 89  ? -20.414 8.784   67.239  1.00 31.70  ? 89  GLU B CG  1 
ATOM   5680 C CD  . GLU D 2 89  ? -21.539 9.719   67.519  1.00 16.75  ? 89  GLU B CD  1 
ATOM   5681 O OE1 . GLU D 2 89  ? -21.674 10.665  66.731  1.00 19.62  ? 89  GLU B OE1 1 
ATOM   5682 O OE2 . GLU D 2 89  ? -22.313 9.534   68.484  1.00 34.77  ? 89  GLU B OE2 1 
ATOM   5683 N N   . ASP D 2 90  ? -17.509 11.384  64.397  1.00 15.79  ? 90  ASP B N   1 
ATOM   5684 C CA  . ASP D 2 90  ? -16.688 11.583  63.196  1.00 22.74  ? 90  ASP B CA  1 
ATOM   5685 C C   . ASP D 2 90  ? -15.245 11.867  63.618  1.00 25.06  ? 90  ASP B C   1 
ATOM   5686 O O   . ASP D 2 90  ? -14.346 11.941  62.769  1.00 21.88  ? 90  ASP B O   1 
ATOM   5687 C CB  . ASP D 2 90  ? -17.196 12.775  62.377  1.00 16.24  ? 90  ASP B CB  1 
ATOM   5688 C CG  . ASP D 2 90  ? -18.590 12.539  61.798  1.00 20.39  ? 90  ASP B CG  1 
ATOM   5689 O OD1 . ASP D 2 90  ? -18.916 11.399  61.421  1.00 15.50  ? 90  ASP B OD1 1 
ATOM   5690 O OD2 . ASP D 2 90  ? -19.352 13.509  61.723  1.00 12.91  ? 90  ASP B OD2 1 
ATOM   5691 N N   . THR D 2 91  ? -15.035 12.065  64.921  1.00 20.47  ? 91  THR B N   1 
ATOM   5692 C CA  . THR D 2 91  ? -13.696 12.348  65.436  1.00 25.52  ? 91  THR B CA  1 
ATOM   5693 C C   . THR D 2 91  ? -12.796 11.194  65.059  1.00 24.70  ? 91  THR B C   1 
ATOM   5694 O O   . THR D 2 91  ? -12.995 10.074  65.514  1.00 21.12  ? 91  THR B O   1 
ATOM   5695 C CB  . THR D 2 91  ? -13.666 12.514  66.969  1.00 19.11  ? 91  THR B CB  1 
ATOM   5696 O OG1 . THR D 2 91  ? -14.334 13.730  67.308  1.00 23.91  ? 91  THR B OG1 1 
ATOM   5697 C CG2 . THR D 2 91  ? -12.188 12.622  67.481  1.00 20.70  ? 91  THR B CG2 1 
ATOM   5698 N N   . ALA D 2 92  ? -11.811 11.462  64.204  1.00 22.19  ? 92  ALA B N   1 
ATOM   5699 C CA  . ALA D 2 92  ? -10.913 10.409  63.782  1.00 14.98  ? 92  ALA B CA  1 
ATOM   5700 C C   . ALA D 2 92  ? -9.840  11.017  62.884  1.00 11.82  ? 92  ALA B C   1 
ATOM   5701 O O   . ALA D 2 92  ? -9.792  12.221  62.662  1.00 12.62  ? 92  ALA B O   1 
ATOM   5702 C CB  . ALA D 2 92  ? -11.685 9.320   62.998  1.00 5.98   ? 92  ALA B CB  1 
ATOM   5703 N N   . THR D 2 93  ? -8.989  10.148  62.365  1.00 14.74  ? 93  THR B N   1 
ATOM   5704 C CA  . THR D 2 93  ? -7.919  10.559  61.455  1.00 15.86  ? 93  THR B CA  1 
ATOM   5705 C C   . THR D 2 93  ? -8.302  10.044  60.084  1.00 3.36   ? 93  THR B C   1 
ATOM   5706 O O   . THR D 2 93  ? -8.580  8.876   59.929  1.00 12.93  ? 93  THR B O   1 
ATOM   5707 C CB  . THR D 2 93  ? -6.591  9.939   61.897  1.00 16.74  ? 93  THR B CB  1 
ATOM   5708 O OG1 . THR D 2 93  ? -6.143  10.632  63.068  1.00 20.74  ? 93  THR B OG1 1 
ATOM   5709 C CG2 . THR D 2 93  ? -5.531  10.061  60.774  1.00 14.50  ? 93  THR B CG2 1 
ATOM   5710 N N   . TYR D 2 94  ? -8.358  10.912  59.094  1.00 10.32  ? 94  TYR B N   1 
ATOM   5711 C CA  . TYR D 2 94  ? -8.729  10.431  57.781  1.00 15.35  ? 94  TYR B CA  1 
ATOM   5712 C C   . TYR D 2 94  ? -7.531  10.286  56.837  1.00 15.36  ? 94  TYR B C   1 
ATOM   5713 O O   . TYR D 2 94  ? -6.782  11.221  56.637  1.00 19.96  ? 94  TYR B O   1 
ATOM   5714 C CB  . TYR D 2 94  ? -9.819  11.348  57.209  1.00 16.17  ? 94  TYR B CB  1 
ATOM   5715 C CG  . TYR D 2 94  ? -11.096 11.258  58.042  1.00 21.04  ? 94  TYR B CG  1 
ATOM   5716 C CD1 . TYR D 2 94  ? -11.262 12.054  59.176  1.00 20.66  ? 94  TYR B CD1 1 
ATOM   5717 C CD2 . TYR D 2 94  ? -12.103 10.334  57.716  1.00 19.16  ? 94  TYR B CD2 1 
ATOM   5718 C CE1 . TYR D 2 94  ? -12.427 11.940  59.991  1.00 22.90  ? 94  TYR B CE1 1 
ATOM   5719 C CE2 . TYR D 2 94  ? -13.247 10.211  58.503  1.00 23.48  ? 94  TYR B CE2 1 
ATOM   5720 C CZ  . TYR D 2 94  ? -13.403 11.019  59.635  1.00 16.82  ? 94  TYR B CZ  1 
ATOM   5721 O OH  . TYR D 2 94  ? -14.554 10.908  60.375  1.00 18.72  ? 94  TYR B OH  1 
ATOM   5722 N N   . PHE D 2 95  ? -7.373  9.085   56.288  1.00 18.82  ? 95  PHE B N   1 
ATOM   5723 C CA  . PHE D 2 95  ? -6.296  8.750   55.350  1.00 20.63  ? 95  PHE B CA  1 
ATOM   5724 C C   . PHE D 2 95  ? -6.812  8.718   53.931  1.00 23.13  ? 95  PHE B C   1 
ATOM   5725 O O   . PHE D 2 95  ? -7.912  8.238   53.669  1.00 23.78  ? 95  PHE B O   1 
ATOM   5726 C CB  . PHE D 2 95  ? -5.739  7.361   55.637  1.00 13.72  ? 95  PHE B CB  1 
ATOM   5727 C CG  . PHE D 2 95  ? -5.124  7.225   56.999  1.00 22.07  ? 95  PHE B CG  1 
ATOM   5728 C CD1 . PHE D 2 95  ? -3.848  7.725   57.253  1.00 17.36  ? 95  PHE B CD1 1 
ATOM   5729 C CD2 . PHE D 2 95  ? -5.801  6.561   58.013  1.00 19.52  ? 95  PHE B CD2 1 
ATOM   5730 C CE1 . PHE D 2 95  ? -3.257  7.550   58.506  1.00 26.28  ? 95  PHE B CE1 1 
ATOM   5731 C CE2 . PHE D 2 95  ? -5.229  6.389   59.249  1.00 19.56  ? 95  PHE B CE2 1 
ATOM   5732 C CZ  . PHE D 2 95  ? -3.943  6.885   59.499  1.00 22.99  ? 95  PHE B CZ  1 
ATOM   5733 N N   . CYS D 2 96  ? -5.995  9.238   53.026  1.00 30.01  ? 96  CYS B N   1 
ATOM   5734 C CA  . CYS D 2 96  ? -6.270  9.243   51.607  1.00 28.72  ? 96  CYS B CA  1 
ATOM   5735 C C   . CYS D 2 96  ? -5.225  8.225   51.131  1.00 29.56  ? 96  CYS B C   1 
ATOM   5736 O O   . CYS D 2 96  ? -4.037  8.364   51.418  1.00 35.69  ? 96  CYS B O   1 
ATOM   5737 C CB  . CYS D 2 96  ? -6.038  10.649  51.076  1.00 39.08  ? 96  CYS B CB  1 
ATOM   5738 S SG  . CYS D 2 96  ? -5.135  10.768  49.515  1.00 58.05  ? 96  CYS B SG  1 
ATOM   5739 N N   . VAL D 2 97  ? -5.681  7.192   50.430  1.00 24.89  ? 97  VAL B N   1 
ATOM   5740 C CA  . VAL D 2 97  ? -4.828  6.089   49.986  1.00 22.75  ? 97  VAL B CA  1 
ATOM   5741 C C   . VAL D 2 97  ? -4.959  5.761   48.505  1.00 24.95  ? 97  VAL B C   1 
ATOM   5742 O O   . VAL D 2 97  ? -6.061  5.646   47.999  1.00 23.70  ? 97  VAL B O   1 
ATOM   5743 C CB  . VAL D 2 97  ? -5.209  4.796   50.730  1.00 21.45  ? 97  VAL B CB  1 
ATOM   5744 C CG1 . VAL D 2 97  ? -4.172  3.719   50.475  1.00 23.48  ? 97  VAL B CG1 1 
ATOM   5745 C CG2 . VAL D 2 97  ? -5.413  5.092   52.228  1.00 24.44  ? 97  VAL B CG2 1 
ATOM   5746 N N   . GLN D 2 98  ? -3.837  5.582   47.814  1.00 28.48  ? 98  GLN B N   1 
ATOM   5747 C CA  . GLN D 2 98  ? -3.892  5.230   46.402  1.00 28.52  ? 98  GLN B CA  1 
ATOM   5748 C C   . GLN D 2 98  ? -3.762  3.723   46.297  1.00 28.72  ? 98  GLN B C   1 
ATOM   5749 O O   . GLN D 2 98  ? -2.920  3.108   46.956  1.00 30.52  ? 98  GLN B O   1 
ATOM   5750 C CB  . GLN D 2 98  ? -2.764  5.896   45.625  1.00 28.25  ? 98  GLN B CB  1 
ATOM   5751 C CG  . GLN D 2 98  ? -3.116  7.247   45.054  1.00 33.85  ? 98  GLN B CG  1 
ATOM   5752 C CD  . GLN D 2 98  ? -1.877  7.990   44.592  1.00 37.44  ? 98  GLN B CD  1 
ATOM   5753 O OE1 . GLN D 2 98  ? -0.764  7.680   45.024  1.00 37.31  ? 98  GLN B OE1 1 
ATOM   5754 N NE2 . GLN D 2 98  ? -2.059  8.966   43.707  1.00 34.64  ? 98  GLN B NE2 1 
ATOM   5755 N N   . ALA D 2 99  ? -4.609  3.127   45.474  1.00 27.83  ? 99  ALA B N   1 
ATOM   5756 C CA  . ALA D 2 99  ? -4.596  1.693   45.286  1.00 32.84  ? 99  ALA B CA  1 
ATOM   5757 C C   . ALA D 2 99  ? -4.335  1.378   43.823  1.00 34.83  ? 99  ALA B C   1 
ATOM   5758 O O   . ALA D 2 99  ? -4.827  2.073   42.930  1.00 31.54  ? 99  ALA B O   1 
ATOM   5759 C CB  . ALA D 2 99  ? -5.945  1.087   45.716  1.00 29.57  ? 99  ALA B CB  1 
ATOM   5760 N N   . GLU D 2 100 ? -3.573  0.313   43.603  1.00 38.94  ? 100 GLU B N   1 
ATOM   5761 C CA  . GLU D 2 100 ? -3.227  -0.163  42.275  1.00 44.34  ? 100 GLU B CA  1 
ATOM   5762 C C   . GLU D 2 100 ? -4.296  -1.165  41.827  1.00 45.14  ? 100 GLU B C   1 
ATOM   5763 O O   . GLU D 2 100 ? -4.702  -2.030  42.600  1.00 44.33  ? 100 GLU B O   1 
ATOM   5764 C CB  . GLU D 2 100 ? -1.855  -0.837  42.326  1.00 45.13  ? 100 GLU B CB  1 
ATOM   5765 C CG  . GLU D 2 100 ? -1.071  -0.751  41.044  1.00 51.25  ? 100 GLU B CG  1 
ATOM   5766 C CD  . GLU D 2 100 ? -1.586  -1.714  40.013  1.00 53.55  ? 100 GLU B CD  1 
ATOM   5767 O OE1 . GLU D 2 100 ? -1.864  -2.875  40.379  1.00 56.68  ? 100 GLU B OE1 1 
ATOM   5768 O OE2 . GLU D 2 100 ? -1.721  -1.309  38.842  1.00 59.90  ? 100 GLU B OE2 1 
ATOM   5769 N N   . ARG D 2 101 ? -4.734  -1.051  40.578  1.00 48.51  ? 101 ARG B N   1 
ATOM   5770 C CA  . ARG D 2 101 ? -5.769  -1.928  40.025  1.00 52.10  ? 101 ARG B CA  1 
ATOM   5771 C C   . ARG D 2 101 ? -5.377  -3.403  39.957  1.00 51.05  ? 101 ARG B C   1 
ATOM   5772 O O   . ARG D 2 101 ? -6.140  -4.280  40.369  1.00 51.06  ? 101 ARG B O   1 
ATOM   5773 C CB  . ARG D 2 101 ? -6.169  -1.448  38.623  1.00 54.41  ? 101 ARG B CB  1 
ATOM   5774 C CG  . ARG D 2 101 ? -7.600  -1.786  38.229  1.00 58.70  ? 101 ARG B CG  1 
ATOM   5775 C CD  . ARG D 2 101 ? -8.247  -0.649  37.442  1.00 66.25  ? 101 ARG B CD  1 
ATOM   5776 N NE  . ARG D 2 101 ? -9.065  -1.138  36.332  1.00 77.45  ? 101 ARG B NE  1 
ATOM   5777 C CZ  . ARG D 2 101 ? -10.396 -1.154  36.325  1.00 82.02  ? 101 ARG B CZ  1 
ATOM   5778 N NH1 . ARG D 2 101 ? -11.076 -0.708  37.374  1.00 82.68  ? 101 ARG B NH1 1 
ATOM   5779 N NH2 . ARG D 2 101 ? -11.049 -1.613  35.265  1.00 83.34  ? 101 ARG B NH2 1 
ATOM   5780 N N   . LEU D 2 102 ? -4.189  -3.675  39.433  1.00 51.00  ? 102 LEU B N   1 
ATOM   5781 C CA  . LEU D 2 102 ? -3.727  -5.049  39.312  1.00 49.06  ? 102 LEU B CA  1 
ATOM   5782 C C   . LEU D 2 102 ? -3.607  -5.741  40.664  1.00 44.07  ? 102 LEU B C   1 
ATOM   5783 O O   . LEU D 2 102 ? -4.316  -6.716  40.932  1.00 43.82  ? 102 LEU B O   1 
ATOM   5784 C CB  . LEU D 2 102 ? -2.382  -5.094  38.584  1.00 53.41  ? 102 LEU B CB  1 
ATOM   5785 C CG  . LEU D 2 102 ? -2.207  -6.234  37.574  1.00 55.66  ? 102 LEU B CG  1 
ATOM   5786 C CD1 . LEU D 2 102 ? -2.148  -7.569  38.306  1.00 51.67  ? 102 LEU B CD1 1 
ATOM   5787 C CD2 . LEU D 2 102 ? -3.355  -6.213  36.572  1.00 55.94  ? 102 LEU B CD2 1 
ATOM   5788 N N   . ARG D 2 103 ? -2.708  -5.245  41.511  1.00 39.83  ? 103 ARG B N   1 
ATOM   5789 C CA  . ARG D 2 103 ? -2.510  -5.841  42.831  1.00 34.42  ? 103 ARG B CA  1 
ATOM   5790 C C   . ARG D 2 103 ? -3.682  -5.613  43.787  1.00 34.92  ? 103 ARG B C   1 
ATOM   5791 O O   . ARG D 2 103 ? -3.898  -6.406  44.706  1.00 33.56  ? 103 ARG B O   1 
ATOM   5792 C CB  . ARG D 2 103 ? -1.220  -5.311  43.453  1.00 35.44  ? 103 ARG B CB  1 
ATOM   5793 C CG  . ARG D 2 103 ? 0.016   -5.617  42.621  1.00 38.77  ? 103 ARG B CG  1 
ATOM   5794 C CD  . ARG D 2 103 ? 1.286   -5.255  43.366  1.00 41.54  ? 103 ARG B CD  1 
ATOM   5795 N NE  . ARG D 2 103 ? 1.267   -3.867  43.816  1.00 43.29  ? 103 ARG B NE  1 
ATOM   5796 C CZ  . ARG D 2 103 ? 1.262   -2.824  42.993  1.00 49.18  ? 103 ARG B CZ  1 
ATOM   5797 N NH1 . ARG D 2 103 ? 1.278   -3.018  41.684  1.00 54.96  ? 103 ARG B NH1 1 
ATOM   5798 N NH2 . ARG D 2 103 ? 1.238   -1.589  43.472  1.00 54.55  ? 103 ARG B NH2 1 
ATOM   5799 N N   . ARG D 2 104 ? -4.438  -4.536  43.574  1.00 36.07  ? 104 ARG B N   1 
ATOM   5800 C CA  . ARG D 2 104 ? -5.591  -4.234  44.428  1.00 38.36  ? 104 ARG B CA  1 
ATOM   5801 C C   . ARG D 2 104 ? -5.127  -3.900  45.841  1.00 38.36  ? 104 ARG B C   1 
ATOM   5802 O O   . ARG D 2 104 ? -5.802  -4.226  46.831  1.00 36.94  ? 104 ARG B O   1 
ATOM   5803 C CB  . ARG D 2 104 ? -6.541  -5.435  44.488  1.00 35.29  ? 104 ARG B CB  1 
ATOM   5804 C CG  . ARG D 2 104 ? -7.319  -5.689  43.210  1.00 44.42  ? 104 ARG B CG  1 
ATOM   5805 C CD  . ARG D 2 104 ? -8.735  -6.172  43.519  1.00 51.36  ? 104 ARG B CD  1 
ATOM   5806 N NE  . ARG D 2 104 ? -9.318  -6.934  42.411  1.00 58.12  ? 104 ARG B NE  1 
ATOM   5807 C CZ  . ARG D 2 104 ? -10.515 -7.521  42.444  1.00 59.49  ? 104 ARG B CZ  1 
ATOM   5808 N NH1 . ARG D 2 104 ? -11.277 -7.444  43.531  1.00 51.53  ? 104 ARG B NH1 1 
ATOM   5809 N NH2 . ARG D 2 104 ? -10.951 -8.190  41.384  1.00 58.90  ? 104 ARG B NH2 1 
ATOM   5810 N N   . THR D 2 105 ? -3.983  -3.226  45.922  1.00 36.07  ? 105 THR B N   1 
ATOM   5811 C CA  . THR D 2 105 ? -3.378  -2.869  47.201  1.00 34.27  ? 105 THR B CA  1 
ATOM   5812 C C   . THR D 2 105 ? -3.519  -1.400  47.561  1.00 31.89  ? 105 THR B C   1 
ATOM   5813 O O   . THR D 2 105 ? -3.699  -0.561  46.687  1.00 33.33  ? 105 THR B O   1 
ATOM   5814 C CB  . THR D 2 105 ? -1.851  -3.204  47.198  1.00 37.45  ? 105 THR B CB  1 
ATOM   5815 O OG1 . THR D 2 105 ? -1.205  -2.535  46.098  1.00 36.05  ? 105 THR B OG1 1 
ATOM   5816 C CG2 . THR D 2 105 ? -1.629  -4.695  47.059  1.00 31.39  ? 105 THR B CG2 1 
ATOM   5817 N N   . PHE D 2 106 ? -3.473  -1.102  48.856  1.00 28.28  ? 106 PHE B N   1 
ATOM   5818 C CA  . PHE D 2 106 ? -3.498  0.286   49.314  1.00 31.63  ? 106 PHE B CA  1 
ATOM   5819 C C   . PHE D 2 106 ? -2.000  0.605   49.396  1.00 29.59  ? 106 PHE B C   1 
ATOM   5820 O O   . PHE D 2 106 ? -1.374  0.520   50.458  1.00 25.97  ? 106 PHE B O   1 
ATOM   5821 C CB  . PHE D 2 106 ? -4.169  0.406   50.687  1.00 22.49  ? 106 PHE B CB  1 
ATOM   5822 C CG  . PHE D 2 106 ? -5.658  0.150   50.651  1.00 31.69  ? 106 PHE B CG  1 
ATOM   5823 C CD1 . PHE D 2 106 ? -6.469  0.806   49.728  1.00 28.26  ? 106 PHE B CD1 1 
ATOM   5824 C CD2 . PHE D 2 106 ? -6.241  -0.765  51.515  1.00 31.09  ? 106 PHE B CD2 1 
ATOM   5825 C CE1 . PHE D 2 106 ? -7.846  0.545   49.675  1.00 34.00  ? 106 PHE B CE1 1 
ATOM   5826 C CE2 . PHE D 2 106 ? -7.607  -1.032  51.471  1.00 33.80  ? 106 PHE B CE2 1 
ATOM   5827 C CZ  . PHE D 2 106 ? -8.410  -0.377  50.552  1.00 33.55  ? 106 PHE B CZ  1 
ATOM   5828 N N   . ASP D 2 107 ? -1.445  0.952   48.244  1.00 33.52  ? 107 ASP B N   1 
ATOM   5829 C CA  . ASP D 2 107 ? -0.023  1.230   48.091  1.00 34.06  ? 107 ASP B CA  1 
ATOM   5830 C C   . ASP D 2 107 ? 0.539   2.398   48.876  1.00 35.75  ? 107 ASP B C   1 
ATOM   5831 O O   . ASP D 2 107 ? 1.396   2.194   49.738  1.00 39.45  ? 107 ASP B O   1 
ATOM   5832 C CB  . ASP D 2 107 ? 0.297   1.391   46.606  1.00 41.09  ? 107 ASP B CB  1 
ATOM   5833 C CG  . ASP D 2 107 ? -0.002  0.128   45.806  1.00 46.79  ? 107 ASP B CG  1 
ATOM   5834 O OD1 . ASP D 2 107 ? 0.644   -0.910  46.047  1.00 52.34  ? 107 ASP B OD1 1 
ATOM   5835 O OD2 . ASP D 2 107 ? -0.891  0.170   44.934  1.00 56.58  ? 107 ASP B OD2 1 
ATOM   5836 N N   . TYR D 2 108 ? 0.077   3.615   48.594  1.00 32.82  ? 108 TYR B N   1 
ATOM   5837 C CA  . TYR D 2 108 ? 0.585   4.783   49.305  1.00 37.33  ? 108 TYR B CA  1 
ATOM   5838 C C   . TYR D 2 108 ? -0.499  5.455   50.134  1.00 36.57  ? 108 TYR B C   1 
ATOM   5839 O O   . TYR D 2 108 ? -1.616  5.661   49.660  1.00 34.92  ? 108 TYR B O   1 
ATOM   5840 C CB  . TYR D 2 108 ? 1.185   5.790   48.317  1.00 51.26  ? 108 TYR B CB  1 
ATOM   5841 C CG  . TYR D 2 108 ? 2.061   6.857   48.958  1.00 65.73  ? 108 TYR B CG  1 
ATOM   5842 C CD1 . TYR D 2 108 ? 1.506   8.039   49.447  1.00 71.27  ? 108 TYR B CD1 1 
ATOM   5843 C CD2 . TYR D 2 108 ? 3.450   6.705   49.036  1.00 68.32  ? 108 TYR B CD2 1 
ATOM   5844 C CE1 . TYR D 2 108 ? 2.302   9.045   49.991  1.00 72.10  ? 108 TYR B CE1 1 
ATOM   5845 C CE2 . TYR D 2 108 ? 4.259   7.711   49.580  1.00 69.56  ? 108 TYR B CE2 1 
ATOM   5846 C CZ  . TYR D 2 108 ? 3.675   8.878   50.052  1.00 72.03  ? 108 TYR B CZ  1 
ATOM   5847 O OH  . TYR D 2 108 ? 4.452   9.890   50.570  1.00 69.41  ? 108 TYR B OH  1 
ATOM   5848 N N   . TRP D 2 109 ? -0.160  5.786   51.378  1.00 27.98  ? 109 TRP B N   1 
ATOM   5849 C CA  . TRP D 2 109 ? -1.092  6.429   52.284  1.00 26.33  ? 109 TRP B CA  1 
ATOM   5850 C C   . TRP D 2 109 ? -0.609  7.838   52.605  1.00 27.43  ? 109 TRP B C   1 
ATOM   5851 O O   . TRP D 2 109 ? 0.593   8.075   52.707  1.00 34.58  ? 109 TRP B O   1 
ATOM   5852 C CB  . TRP D 2 109 ? -1.209  5.626   53.597  1.00 22.31  ? 109 TRP B CB  1 
ATOM   5853 C CG  . TRP D 2 109 ? -1.727  4.197   53.447  1.00 24.91  ? 109 TRP B CG  1 
ATOM   5854 C CD1 . TRP D 2 109 ? -1.195  3.203   52.672  1.00 21.21  ? 109 TRP B CD1 1 
ATOM   5855 C CD2 . TRP D 2 109 ? -2.848  3.607   54.132  1.00 26.02  ? 109 TRP B CD2 1 
ATOM   5856 N NE1 . TRP D 2 109 ? -1.905  2.032   52.832  1.00 22.83  ? 109 TRP B NE1 1 
ATOM   5857 C CE2 . TRP D 2 109 ? -2.925  2.253   53.723  1.00 21.94  ? 109 TRP B CE2 1 
ATOM   5858 C CE3 . TRP D 2 109 ? -3.789  4.093   55.050  1.00 25.95  ? 109 TRP B CE3 1 
ATOM   5859 C CZ2 . TRP D 2 109 ? -3.902  1.381   54.201  1.00 27.45  ? 109 TRP B CZ2 1 
ATOM   5860 C CZ3 . TRP D 2 109 ? -4.770  3.213   55.531  1.00 20.10  ? 109 TRP B CZ3 1 
ATOM   5861 C CH2 . TRP D 2 109 ? -4.814  1.875   55.103  1.00 29.70  ? 109 TRP B CH2 1 
ATOM   5862 N N   . GLY D 2 110 ? -1.539  8.773   52.764  1.00 19.37  ? 110 GLY B N   1 
ATOM   5863 C CA  . GLY D 2 110 ? -1.152  10.124  53.123  1.00 21.81  ? 110 GLY B CA  1 
ATOM   5864 C C   . GLY D 2 110 ? -0.813  10.060  54.604  1.00 17.20  ? 110 GLY B C   1 
ATOM   5865 O O   . GLY D 2 110 ? -0.848  8.984   55.187  1.00 20.57  ? 110 GLY B O   1 
ATOM   5866 N N   . ALA D 2 111 ? -0.474  11.184  55.218  1.00 22.41  ? 111 ALA B N   1 
ATOM   5867 C CA  . ALA D 2 111 ? -0.156  11.174  56.643  1.00 25.84  ? 111 ALA B CA  1 
ATOM   5868 C C   . ALA D 2 111 ? -1.415  11.042  57.504  1.00 29.07  ? 111 ALA B C   1 
ATOM   5869 O O   . ALA D 2 111 ? -1.345  10.594  58.655  1.00 25.68  ? 111 ALA B O   1 
ATOM   5870 C CB  . ALA D 2 111 ? 0.583   12.447  57.031  1.00 28.67  ? 111 ALA B CB  1 
ATOM   5871 N N   . GLY D 2 112 ? -2.557  11.448  56.957  1.00 27.95  ? 112 GLY B N   1 
ATOM   5872 C CA  . GLY D 2 112 ? -3.801  11.386  57.710  1.00 27.96  ? 112 GLY B CA  1 
ATOM   5873 C C   . GLY D 2 112 ? -4.127  12.753  58.279  1.00 29.87  ? 112 GLY B C   1 
ATOM   5874 O O   . GLY D 2 112 ? -3.241  13.467  58.750  1.00 33.20  ? 112 GLY B O   1 
ATOM   5875 N N   . THR D 2 113 ? -5.395  13.141  58.209  1.00 25.12  ? 113 THR B N   1 
ATOM   5876 C CA  . THR D 2 113 ? -5.823  14.421  58.739  1.00 19.74  ? 113 THR B CA  1 
ATOM   5877 C C   . THR D 2 113 ? -6.754  14.093  59.919  1.00 28.09  ? 113 THR B C   1 
ATOM   5878 O O   . THR D 2 113 ? -7.730  13.340  59.794  1.00 18.88  ? 113 THR B O   1 
ATOM   5879 C CB  . THR D 2 113 ? -6.554  15.264  57.669  1.00 29.66  ? 113 THR B CB  1 
ATOM   5880 O OG1 . THR D 2 113 ? -5.628  15.641  56.637  1.00 29.27  ? 113 THR B OG1 1 
ATOM   5881 C CG2 . THR D 2 113 ? -7.140  16.534  58.291  1.00 33.13  ? 113 THR B CG2 1 
ATOM   5882 N N   . THR D 2 114 ? -6.402  14.646  61.070  1.00 21.97  ? 114 THR B N   1 
ATOM   5883 C CA  . THR D 2 114 ? -7.129  14.443  62.299  1.00 25.41  ? 114 THR B CA  1 
ATOM   5884 C C   . THR D 2 114 ? -8.273  15.437  62.424  1.00 22.29  ? 114 THR B C   1 
ATOM   5885 O O   . THR D 2 114 ? -8.071  16.647  62.339  1.00 25.19  ? 114 THR B O   1 
ATOM   5886 C CB  . THR D 2 114 ? -6.157  14.585  63.491  1.00 27.61  ? 114 THR B CB  1 
ATOM   5887 O OG1 . THR D 2 114 ? -5.917  13.292  64.051  1.00 41.20  ? 114 THR B OG1 1 
ATOM   5888 C CG2 . THR D 2 114 ? -6.710  15.495  64.556  1.00 37.53  ? 114 THR B CG2 1 
ATOM   5889 N N   . VAL D 2 115 ? -9.488  14.925  62.580  1.00 24.41  ? 115 VAL B N   1 
ATOM   5890 C CA  . VAL D 2 115 ? -10.634 15.815  62.752  1.00 22.74  ? 115 VAL B CA  1 
ATOM   5891 C C   . VAL D 2 115 ? -11.218 15.632  64.162  1.00 21.88  ? 115 VAL B C   1 
ATOM   5892 O O   . VAL D 2 115 ? -11.445 14.517  64.611  1.00 20.09  ? 115 VAL B O   1 
ATOM   5893 C CB  . VAL D 2 115 ? -11.734 15.534  61.714  1.00 21.81  ? 115 VAL B CB  1 
ATOM   5894 C CG1 . VAL D 2 115 ? -12.932 16.462  61.978  1.00 22.53  ? 115 VAL B CG1 1 
ATOM   5895 C CG2 . VAL D 2 115 ? -11.181 15.767  60.290  1.00 19.06  ? 115 VAL B CG2 1 
ATOM   5896 N N   . THR D 2 116 ? -11.434 16.727  64.872  1.00 22.81  ? 116 THR B N   1 
ATOM   5897 C CA  . THR D 2 116 ? -12.001 16.626  66.204  1.00 23.61  ? 116 THR B CA  1 
ATOM   5898 C C   . THR D 2 116 ? -13.321 17.395  66.262  1.00 20.82  ? 116 THR B C   1 
ATOM   5899 O O   . THR D 2 116 ? -13.352 18.604  66.055  1.00 25.43  ? 116 THR B O   1 
ATOM   5900 C CB  . THR D 2 116 ? -11.056 17.188  67.257  1.00 24.74  ? 116 THR B CB  1 
ATOM   5901 O OG1 . THR D 2 116 ? -9.875  16.375  67.325  1.00 26.58  ? 116 THR B OG1 1 
ATOM   5902 C CG2 . THR D 2 116 ? -11.750 17.192  68.630  1.00 25.17  ? 116 THR B CG2 1 
ATOM   5903 N N   . VAL D 2 117 ? -14.410 16.685  66.515  1.00 27.30  ? 117 VAL B N   1 
ATOM   5904 C CA  . VAL D 2 117 ? -15.731 17.315  66.602  1.00 19.90  ? 117 VAL B CA  1 
ATOM   5905 C C   . VAL D 2 117 ? -16.152 17.341  68.055  1.00 16.86  ? 117 VAL B C   1 
ATOM   5906 O O   . VAL D 2 117 ? -16.288 16.293  68.675  1.00 18.35  ? 117 VAL B O   1 
ATOM   5907 C CB  . VAL D 2 117 ? -16.783 16.517  65.833  1.00 24.19  ? 117 VAL B CB  1 
ATOM   5908 C CG1 . VAL D 2 117 ? -18.079 17.310  65.775  1.00 13.74  ? 117 VAL B CG1 1 
ATOM   5909 C CG2 . VAL D 2 117 ? -16.279 16.194  64.423  1.00 27.32  ? 117 VAL B CG2 1 
ATOM   5910 N N   . SER D 2 118 ? -16.352 18.535  68.594  1.00 22.37  ? 118 SER B N   1 
ATOM   5911 C CA  . SER D 2 118 ? -16.757 18.691  69.997  1.00 26.18  ? 118 SER B CA  1 
ATOM   5912 C C   . SER D 2 118 ? -17.378 20.076  70.148  1.00 25.16  ? 118 SER B C   1 
ATOM   5913 O O   . SER D 2 118 ? -17.055 20.973  69.375  1.00 24.72  ? 118 SER B O   1 
ATOM   5914 C CB  . SER D 2 118 ? -15.527 18.542  70.914  1.00 20.02  ? 118 SER B CB  1 
ATOM   5915 O OG  . SER D 2 118 ? -15.647 19.313  72.101  1.00 20.76  ? 118 SER B OG  1 
ATOM   5916 N N   . SER D 2 119 ? -18.278 20.256  71.116  1.00 26.36  ? 119 SER B N   1 
ATOM   5917 C CA  . SER D 2 119 ? -18.896 21.572  71.305  1.00 24.91  ? 119 SER B CA  1 
ATOM   5918 C C   . SER D 2 119 ? -18.158 22.353  72.408  1.00 29.38  ? 119 SER B C   1 
ATOM   5919 O O   . SER D 2 119 ? -18.481 23.506  72.706  1.00 23.36  ? 119 SER B O   1 
ATOM   5920 C CB  . SER D 2 119 ? -20.380 21.418  71.656  1.00 27.29  ? 119 SER B CB  1 
ATOM   5921 O OG  . SER D 2 119 ? -20.622 20.172  72.279  1.00 33.56  ? 119 SER B OG  1 
ATOM   5922 N N   . ALA D 2 120 ? -17.142 21.722  72.988  1.00 26.93  ? 120 ALA B N   1 
ATOM   5923 C CA  . ALA D 2 120 ? -16.366 22.348  74.041  1.00 27.09  ? 120 ALA B CA  1 
ATOM   5924 C C   . ALA D 2 120 ? -15.665 23.621  73.592  1.00 25.62  ? 120 ALA B C   1 
ATOM   5925 O O   . ALA D 2 120 ? -15.345 23.811  72.412  1.00 31.24  ? 120 ALA B O   1 
ATOM   5926 C CB  . ALA D 2 120 ? -15.368 21.366  74.588  1.00 23.74  ? 120 ALA B CB  1 
ATOM   5927 N N   . SER D 2 121 ? -15.450 24.511  74.545  1.00 28.76  ? 121 SER B N   1 
ATOM   5928 C CA  . SER D 2 121 ? -14.775 25.769  74.277  1.00 32.79  ? 121 SER B CA  1 
ATOM   5929 C C   . SER D 2 121 ? -13.334 25.664  74.777  1.00 29.17  ? 121 SER B C   1 
ATOM   5930 O O   . SER D 2 121 ? -13.060 24.975  75.758  1.00 24.76  ? 121 SER B O   1 
ATOM   5931 C CB  . SER D 2 121 ? -15.490 26.904  75.004  1.00 31.34  ? 121 SER B CB  1 
ATOM   5932 O OG  . SER D 2 121 ? -16.691 27.245  74.339  1.00 43.71  ? 121 SER B OG  1 
ATOM   5933 N N   . THR D 2 122 ? -12.421 26.341  74.090  1.00 31.28  ? 122 THR B N   1 
ATOM   5934 C CA  . THR D 2 122 ? -11.019 26.341  74.476  1.00 33.01  ? 122 THR B CA  1 
ATOM   5935 C C   . THR D 2 122 ? -10.958 26.617  75.978  1.00 34.95  ? 122 THR B C   1 
ATOM   5936 O O   . THR D 2 122 ? -11.598 27.556  76.465  1.00 31.28  ? 122 THR B O   1 
ATOM   5937 C CB  . THR D 2 122 ? -10.243 27.449  73.731  1.00 32.71  ? 122 THR B CB  1 
ATOM   5938 O OG1 . THR D 2 122 ? -10.319 27.216  72.319  1.00 33.55  ? 122 THR B OG1 1 
ATOM   5939 C CG2 . THR D 2 122 ? -8.789  27.452  74.150  1.00 32.74  ? 122 THR B CG2 1 
ATOM   5940 N N   . LYS D 2 123 ? -10.207 25.799  76.710  1.00 32.44  ? 123 LYS B N   1 
ATOM   5941 C CA  . LYS D 2 123 ? -10.096 25.988  78.154  1.00 32.53  ? 123 LYS B CA  1 
ATOM   5942 C C   . LYS D 2 123 ? -8.757  25.522  78.690  1.00 33.88  ? 123 LYS B C   1 
ATOM   5943 O O   . LYS D 2 123 ? -8.302  24.417  78.386  1.00 34.14  ? 123 LYS B O   1 
ATOM   5944 C CB  . LYS D 2 123 ? -11.204 25.231  78.886  1.00 32.18  ? 123 LYS B CB  1 
ATOM   5945 C CG  . LYS D 2 123 ? -11.374 25.651  80.338  1.00 33.12  ? 123 LYS B CG  1 
ATOM   5946 C CD  . LYS D 2 123 ? -11.999 24.553  81.179  1.00 31.51  ? 123 LYS B CD  1 
ATOM   5947 C CE  . LYS D 2 123 ? -11.876 24.886  82.665  1.00 30.93  ? 123 LYS B CE  1 
ATOM   5948 N NZ  . LYS D 2 123 ? -10.558 24.445  83.243  1.00 37.06  ? 123 LYS B NZ  1 
ATOM   5949 N N   . GLY D 2 124 ? -8.135  26.376  79.497  1.00 34.48  ? 124 GLY B N   1 
ATOM   5950 C CA  . GLY D 2 124 ? -6.857  26.033  80.091  1.00 30.95  ? 124 GLY B CA  1 
ATOM   5951 C C   . GLY D 2 124 ? -7.094  25.039  81.205  1.00 29.63  ? 124 GLY B C   1 
ATOM   5952 O O   . GLY D 2 124 ? -8.163  25.054  81.819  1.00 31.55  ? 124 GLY B O   1 
ATOM   5953 N N   . PRO D 2 125 ? -6.118  24.161  81.501  1.00 29.77  ? 125 PRO B N   1 
ATOM   5954 C CA  . PRO D 2 125 ? -6.313  23.179  82.566  1.00 26.61  ? 125 PRO B CA  1 
ATOM   5955 C C   . PRO D 2 125 ? -6.125  23.729  83.963  1.00 29.04  ? 125 PRO B C   1 
ATOM   5956 O O   . PRO D 2 125 ? -5.718  24.871  84.157  1.00 26.69  ? 125 PRO B O   1 
ATOM   5957 C CB  . PRO D 2 125 ? -5.274  22.102  82.260  1.00 27.58  ? 125 PRO B CB  1 
ATOM   5958 C CG  . PRO D 2 125 ? -4.166  22.853  81.580  1.00 28.02  ? 125 PRO B CG  1 
ATOM   5959 C CD  . PRO D 2 125 ? -4.790  24.032  80.863  1.00 28.59  ? 125 PRO B CD  1 
ATOM   5960 N N   . SER D 2 126 ? -6.445  22.884  84.929  1.00 31.52  ? 126 SER B N   1 
ATOM   5961 C CA  . SER D 2 126 ? -6.284  23.204  86.333  1.00 33.18  ? 126 SER B CA  1 
ATOM   5962 C C   . SER D 2 126 ? -5.225  22.200  86.776  1.00 31.09  ? 126 SER B C   1 
ATOM   5963 O O   . SER D 2 126 ? -5.381  21.002  86.559  1.00 30.74  ? 126 SER B O   1 
ATOM   5964 C CB  . SER D 2 126 ? -7.597  22.962  87.088  1.00 32.31  ? 126 SER B CB  1 
ATOM   5965 O OG  . SER D 2 126 ? -8.602  23.886  86.684  1.00 38.27  ? 126 SER B OG  1 
ATOM   5966 N N   . VAL D 2 127 ? -4.155  22.678  87.395  1.00 31.46  ? 127 VAL B N   1 
ATOM   5967 C CA  . VAL D 2 127 ? -3.098  21.774  87.828  1.00 29.77  ? 127 VAL B CA  1 
ATOM   5968 C C   . VAL D 2 127 ? -3.088  21.554  89.327  1.00 29.23  ? 127 VAL B C   1 
ATOM   5969 O O   . VAL D 2 127 ? -2.888  22.478  90.120  1.00 28.47  ? 127 VAL B O   1 
ATOM   5970 C CB  . VAL D 2 127 ? -1.724  22.279  87.361  1.00 29.02  ? 127 VAL B CB  1 
ATOM   5971 C CG1 . VAL D 2 127 ? -0.676  21.203  87.603  1.00 22.02  ? 127 VAL B CG1 1 
ATOM   5972 C CG2 . VAL D 2 127 ? -1.801  22.649  85.878  1.00 29.23  ? 127 VAL B CG2 1 
ATOM   5973 N N   . PHE D 2 128 ? -3.328  20.309  89.711  1.00 28.58  ? 128 PHE B N   1 
ATOM   5974 C CA  . PHE D 2 128 ? -3.369  19.943  91.109  1.00 25.83  ? 128 PHE B CA  1 
ATOM   5975 C C   . PHE D 2 128 ? -2.207  19.010  91.412  1.00 29.80  ? 128 PHE B C   1 
ATOM   5976 O O   . PHE D 2 128 ? -1.780  18.248  90.549  1.00 24.39  ? 128 PHE B O   1 
ATOM   5977 C CB  . PHE D 2 128 ? -4.698  19.230  91.414  1.00 24.68  ? 128 PHE B CB  1 
ATOM   5978 C CG  . PHE D 2 128 ? -5.918  20.062  91.093  1.00 23.45  ? 128 PHE B CG  1 
ATOM   5979 C CD1 . PHE D 2 128 ? -6.226  21.191  91.843  1.00 25.58  ? 128 PHE B CD1 1 
ATOM   5980 C CD2 . PHE D 2 128 ? -6.747  19.713  90.047  1.00 24.92  ? 128 PHE B CD2 1 
ATOM   5981 C CE1 . PHE D 2 128 ? -7.350  21.968  91.553  1.00 28.87  ? 128 PHE B CE1 1 
ATOM   5982 C CE2 . PHE D 2 128 ? -7.887  20.484  89.741  1.00 29.05  ? 128 PHE B CE2 1 
ATOM   5983 C CZ  . PHE D 2 128 ? -8.187  21.608  90.496  1.00 20.71  ? 128 PHE B CZ  1 
ATOM   5984 N N   . PRO D 2 129 ? -1.661  19.078  92.637  1.00 33.98  ? 129 PRO B N   1 
ATOM   5985 C CA  . PRO D 2 129 ? -0.543  18.219  93.049  1.00 32.91  ? 129 PRO B CA  1 
ATOM   5986 C C   . PRO D 2 129 ? -0.965  16.804  93.429  1.00 35.69  ? 129 PRO B C   1 
ATOM   5987 O O   . PRO D 2 129 ? -2.064  16.584  93.937  1.00 41.90  ? 129 PRO B O   1 
ATOM   5988 C CB  . PRO D 2 129 ? 0.035   18.941  94.251  1.00 34.64  ? 129 PRO B CB  1 
ATOM   5989 C CG  . PRO D 2 129 ? -1.159  19.611  94.853  1.00 33.18  ? 129 PRO B CG  1 
ATOM   5990 C CD  . PRO D 2 129 ? -2.008  20.051  93.688  1.00 30.48  ? 129 PRO B CD  1 
ATOM   5991 N N   . LEU D 2 130 ? -0.078  15.853  93.159  1.00 31.89  ? 130 LEU B N   1 
ATOM   5992 C CA  . LEU D 2 130 ? -0.268  14.455  93.504  1.00 30.61  ? 130 LEU B CA  1 
ATOM   5993 C C   . LEU D 2 130 ? 0.852   14.261  94.539  1.00 33.18  ? 130 LEU B C   1 
ATOM   5994 O O   . LEU D 2 130 ? 1.935   13.759  94.226  1.00 30.24  ? 130 LEU B O   1 
ATOM   5995 C CB  . LEU D 2 130 ? -0.024  13.570  92.289  1.00 30.34  ? 130 LEU B CB  1 
ATOM   5996 C CG  . LEU D 2 130 ? -1.206  13.094  91.438  1.00 31.80  ? 130 LEU B CG  1 
ATOM   5997 C CD1 . LEU D 2 130 ? -2.149  14.240  91.156  1.00 34.56  ? 130 LEU B CD1 1 
ATOM   5998 C CD2 . LEU D 2 130 ? -0.664  12.515  90.114  1.00 30.64  ? 130 LEU B CD2 1 
ATOM   5999 N N   . ALA D 2 131 ? 0.581   14.685  95.766  1.00 27.30  ? 131 ALA B N   1 
ATOM   6000 C CA  . ALA D 2 131 ? 1.566   14.631  96.838  1.00 27.83  ? 131 ALA B CA  1 
ATOM   6001 C C   . ALA D 2 131 ? 2.145   13.282  97.203  1.00 31.92  ? 131 ALA B C   1 
ATOM   6002 O O   . ALA D 2 131 ? 1.441   12.267  97.242  1.00 29.13  ? 131 ALA B O   1 
ATOM   6003 C CB  . ALA D 2 131 ? 0.994   15.301  98.084  1.00 28.25  ? 131 ALA B CB  1 
ATOM   6004 N N   . PRO D 2 132 ? 3.470   13.242  97.460  1.00 35.23  ? 132 PRO B N   1 
ATOM   6005 C CA  . PRO D 2 132 ? 4.114   11.981  97.832  1.00 38.30  ? 132 PRO B CA  1 
ATOM   6006 C C   . PRO D 2 132 ? 3.614   11.588  99.214  1.00 43.65  ? 132 PRO B C   1 
ATOM   6007 O O   . PRO D 2 132 ? 3.407   12.457  100.064 1.00 41.56  ? 132 PRO B O   1 
ATOM   6008 C CB  . PRO D 2 132 ? 5.606   12.315  97.845  1.00 30.59  ? 132 PRO B CB  1 
ATOM   6009 C CG  . PRO D 2 132 ? 5.648   13.798  98.095  1.00 33.86  ? 132 PRO B CG  1 
ATOM   6010 C CD  . PRO D 2 132 ? 4.430   14.361  97.405  1.00 31.48  ? 132 PRO B CD  1 
ATOM   6011 N N   . SER D 2 133 ? 3.417   10.290  99.426  1.00 53.23  ? 133 SER B N   1 
ATOM   6012 C CA  . SER D 2 133 ? 2.936   9.775   100.701 1.00 62.82  ? 133 SER B CA  1 
ATOM   6013 C C   . SER D 2 133 ? 3.656   10.460  101.854 1.00 71.10  ? 133 SER B C   1 
ATOM   6014 O O   . SER D 2 133 ? 4.875   10.346  101.997 1.00 67.79  ? 133 SER B O   1 
ATOM   6015 C CB  . SER D 2 133 ? 3.153   8.259   100.775 1.00 62.31  ? 133 SER B CB  1 
ATOM   6016 O OG  . SER D 2 133 ? 2.146   7.627   101.550 1.00 57.77  ? 133 SER B OG  1 
ATOM   6017 N N   . SER D 2 134 ? 2.890   11.184  102.665 1.00 80.94  ? 134 SER B N   1 
ATOM   6018 C CA  . SER D 2 134 ? 3.432   11.891  103.820 1.00 90.12  ? 134 SER B CA  1 
ATOM   6019 C C   . SER D 2 134 ? 3.502   10.952  105.021 1.00 94.46  ? 134 SER B C   1 
ATOM   6020 O O   . SER D 2 134 ? 4.537   10.850  105.682 1.00 97.24  ? 134 SER B O   1 
ATOM   6021 C CB  . SER D 2 134 ? 2.557   13.105  104.160 1.00 91.55  ? 134 SER B CB  1 
ATOM   6022 O OG  . SER D 2 134 ? 1.188   12.747  104.236 1.00 90.52  ? 134 SER B OG  1 
ATOM   6023 N N   . LYS D 2 135 ? 2.396   10.265  105.297 1.00 96.62  ? 135 LYS B N   1 
ATOM   6024 C CA  . LYS D 2 135 ? 2.330   9.329   106.416 1.00 97.30  ? 135 LYS B CA  1 
ATOM   6025 C C   . LYS D 2 135 ? 3.218   8.122   106.137 1.00 98.75  ? 135 LYS B C   1 
ATOM   6026 O O   . LYS D 2 135 ? 3.117   7.090   106.801 1.00 99.63  ? 135 LYS B O   1 
ATOM   6027 C CB  . LYS D 2 135 ? 0.885   8.872   106.644 1.00 94.27  ? 135 LYS B CB  1 
ATOM   6028 C CG  . LYS D 2 135 ? 0.150   9.655   107.723 1.00 87.90  ? 135 LYS B CG  1 
ATOM   6029 C CD  . LYS D 2 135 ? -0.797  10.679  107.117 1.00 79.79  ? 135 LYS B CD  1 
ATOM   6030 C CE  . LYS D 2 135 ? -1.748  11.236  108.164 1.00 75.10  ? 135 LYS B CE  1 
ATOM   6031 N NZ  . LYS D 2 135 ? -2.363  12.519  107.728 1.00 67.82  ? 135 LYS B NZ  1 
ATOM   6032 N N   . SER D 2 136 ? 4.083   8.269   105.141 1.00 98.75  ? 136 SER B N   1 
ATOM   6033 C CA  . SER D 2 136 ? 5.011   7.221   104.754 1.00 98.60  ? 136 SER B CA  1 
ATOM   6034 C C   . SER D 2 136 ? 6.144   7.874   103.979 1.00 98.32  ? 136 SER B C   1 
ATOM   6035 O O   . SER D 2 136 ? 6.446   7.483   102.852 1.00 98.49  ? 136 SER B O   1 
ATOM   6036 C CB  . SER D 2 136 ? 4.307   6.185   103.877 1.00 98.97  ? 136 SER B CB  1 
ATOM   6037 O OG  . SER D 2 136 ? 5.038   4.971   103.847 1.00 98.73  ? 136 SER B OG  1 
ATOM   6038 N N   . THR D 2 137 ? 6.759   8.881   104.593 1.00 98.37  ? 137 THR B N   1 
ATOM   6039 C CA  . THR D 2 137 ? 7.859   9.610   103.972 1.00 98.93  ? 137 THR B CA  1 
ATOM   6040 C C   . THR D 2 137 ? 8.924   8.649   103.450 1.00 99.88  ? 137 THR B C   1 
ATOM   6041 O O   . THR D 2 137 ? 9.600   8.942   102.462 1.00 100.00 ? 137 THR B O   1 
ATOM   6042 C CB  . THR D 2 137 ? 8.505   10.605  104.969 1.00 99.34  ? 137 THR B CB  1 
ATOM   6043 O OG1 . THR D 2 137 ? 7.500   11.497  105.471 1.00 99.58  ? 137 THR B OG1 1 
ATOM   6044 C CG2 . THR D 2 137 ? 9.597   11.420  104.287 1.00 97.35  ? 137 THR B CG2 1 
ATOM   6045 N N   . SER D 2 138 ? 9.055   7.496   104.102 1.00 98.89  ? 138 SER B N   1 
ATOM   6046 C CA  . SER D 2 138 ? 10.036  6.493   103.692 1.00 96.16  ? 138 SER B CA  1 
ATOM   6047 C C   . SER D 2 138 ? 9.437   5.510   102.685 1.00 95.37  ? 138 SER B C   1 
ATOM   6048 O O   . SER D 2 138 ? 8.278   5.635   102.288 1.00 95.63  ? 138 SER B O   1 
ATOM   6049 C CB  . SER D 2 138 ? 10.565  5.734   104.916 1.00 96.39  ? 138 SER B CB  1 
ATOM   6050 O OG  . SER D 2 138 ? 11.954  5.963   105.102 1.00 88.81  ? 138 SER B OG  1 
ATOM   6051 N N   . GLY D 2 139 ? 10.239  4.532   102.276 1.00 92.91  ? 139 GLY B N   1 
ATOM   6052 C CA  . GLY D 2 139 ? 9.786   3.545   101.312 1.00 87.33  ? 139 GLY B CA  1 
ATOM   6053 C C   . GLY D 2 139 ? 10.791  3.455   100.180 1.00 81.36  ? 139 GLY B C   1 
ATOM   6054 O O   . GLY D 2 139 ? 10.549  2.807   99.155  1.00 82.07  ? 139 GLY B O   1 
ATOM   6055 N N   . GLY D 2 140 ? 11.933  4.108   100.382 1.00 73.42  ? 140 GLY B N   1 
ATOM   6056 C CA  . GLY D 2 140 ? 12.980  4.116   99.382  1.00 63.09  ? 140 GLY B CA  1 
ATOM   6057 C C   . GLY D 2 140 ? 12.609  5.074   98.270  1.00 56.58  ? 140 GLY B C   1 
ATOM   6058 O O   . GLY D 2 140 ? 13.202  6.144   98.122  1.00 52.94  ? 140 GLY B O   1 
ATOM   6059 N N   . THR D 2 141 ? 11.609  4.682   97.491  1.00 52.68  ? 141 THR B N   1 
ATOM   6060 C CA  . THR D 2 141 ? 11.126  5.493   96.383  1.00 45.35  ? 141 THR B CA  1 
ATOM   6061 C C   . THR D 2 141 ? 9.788   6.122   96.731  1.00 41.68  ? 141 THR B C   1 
ATOM   6062 O O   . THR D 2 141 ? 8.910   5.457   97.282  1.00 39.92  ? 141 THR B O   1 
ATOM   6063 C CB  . THR D 2 141 ? 10.939  4.648   95.132  1.00 45.53  ? 141 THR B CB  1 
ATOM   6064 O OG1 . THR D 2 141 ? 12.115  3.860   94.915  1.00 43.86  ? 141 THR B OG1 1 
ATOM   6065 C CG2 . THR D 2 141 ? 10.688  5.534   93.929  1.00 45.05  ? 141 THR B CG2 1 
ATOM   6066 N N   . ALA D 2 142 ? 9.647   7.404   96.407  1.00 37.51  ? 142 ALA B N   1 
ATOM   6067 C CA  . ALA D 2 142 ? 8.430   8.157   96.659  1.00 33.58  ? 142 ALA B CA  1 
ATOM   6068 C C   . ALA D 2 142 ? 7.608   8.308   95.367  1.00 38.70  ? 142 ALA B C   1 
ATOM   6069 O O   . ALA D 2 142 ? 8.114   8.079   94.264  1.00 28.31  ? 142 ALA B O   1 
ATOM   6070 C CB  . ALA D 2 142 ? 8.780   9.517   97.211  1.00 32.25  ? 142 ALA B CB  1 
ATOM   6071 N N   . ALA D 2 143 ? 6.352   8.723   95.546  1.00 39.35  ? 143 ALA B N   1 
ATOM   6072 C CA  . ALA D 2 143 ? 5.351   8.924   94.493  1.00 44.05  ? 143 ALA B CA  1 
ATOM   6073 C C   . ALA D 2 143 ? 5.558   10.194  93.679  1.00 43.07  ? 143 ALA B C   1 
ATOM   6074 O O   . ALA D 2 143 ? 6.396   10.216  92.798  1.00 51.27  ? 143 ALA B O   1 
ATOM   6075 C CB  . ALA D 2 143 ? 3.972   8.942   95.124  1.00 48.45  ? 143 ALA B CB  1 
ATOM   6076 N N   . LEU D 2 144 ? 4.765   11.232  93.944  1.00 38.81  ? 144 LEU B N   1 
ATOM   6077 C CA  . LEU D 2 144 ? 4.904   12.524  93.251  1.00 28.81  ? 144 LEU B CA  1 
ATOM   6078 C C   . LEU D 2 144 ? 4.314   12.659  91.835  1.00 30.58  ? 144 LEU B C   1 
ATOM   6079 O O   . LEU D 2 144 ? 4.544   11.826  90.953  1.00 25.77  ? 144 LEU B O   1 
ATOM   6080 C CB  . LEU D 2 144 ? 6.396   12.904  93.202  1.00 36.80  ? 144 LEU B CB  1 
ATOM   6081 C CG  . LEU D 2 144 ? 6.843   14.349  93.401  1.00 30.30  ? 144 LEU B CG  1 
ATOM   6082 C CD1 . LEU D 2 144 ? 7.939   14.406  94.446  1.00 31.86  ? 144 LEU B CD1 1 
ATOM   6083 C CD2 . LEU D 2 144 ? 7.298   14.917  92.093  1.00 29.38  ? 144 LEU B CD2 1 
ATOM   6084 N N   . GLY D 2 145 ? 3.572   13.738  91.608  1.00 28.56  ? 145 GLY B N   1 
ATOM   6085 C CA  . GLY D 2 145 ? 3.004   13.953  90.290  1.00 23.78  ? 145 GLY B CA  1 
ATOM   6086 C C   . GLY D 2 145 ? 2.112   15.168  90.244  1.00 25.44  ? 145 GLY B C   1 
ATOM   6087 O O   . GLY D 2 145 ? 1.985   15.876  91.236  1.00 24.31  ? 145 GLY B O   1 
ATOM   6088 N N   . CYS D 2 146 ? 1.511   15.409  89.075  1.00 25.93  ? 146 CYS B N   1 
ATOM   6089 C CA  . CYS D 2 146 ? 0.588   16.519  88.869  1.00 29.87  ? 146 CYS B CA  1 
ATOM   6090 C C   . CYS D 2 146 ? -0.621  16.056  88.044  1.00 29.46  ? 146 CYS B C   1 
ATOM   6091 O O   . CYS D 2 146 ? -0.476  15.249  87.127  1.00 24.17  ? 146 CYS B O   1 
ATOM   6092 C CB  . CYS D 2 146 ? 1.282   17.656  88.134  1.00 35.25  ? 146 CYS B CB  1 
ATOM   6093 S SG  . CYS D 2 146 ? 2.232   18.773  89.206  1.00 39.59  ? 146 CYS B SG  1 
ATOM   6094 N N   . LEU D 2 147 ? -1.807  16.559  88.390  1.00 29.44  ? 147 LEU B N   1 
ATOM   6095 C CA  . LEU D 2 147 ? -3.044  16.226  87.673  1.00 29.57  ? 147 LEU B CA  1 
ATOM   6096 C C   . LEU D 2 147 ? -3.457  17.451  86.864  1.00 27.74  ? 147 LEU B C   1 
ATOM   6097 O O   . LEU D 2 147 ? -3.806  18.481  87.429  1.00 27.25  ? 147 LEU B O   1 
ATOM   6098 C CB  . LEU D 2 147 ? -4.160  15.863  88.665  1.00 30.98  ? 147 LEU B CB  1 
ATOM   6099 C CG  . LEU D 2 147 ? -5.602  15.708  88.151  1.00 27.66  ? 147 LEU B CG  1 
ATOM   6100 C CD1 . LEU D 2 147 ? -5.680  14.647  87.051  1.00 17.92  ? 147 LEU B CD1 1 
ATOM   6101 C CD2 . LEU D 2 147 ? -6.499  15.294  89.318  1.00 26.76  ? 147 LEU B CD2 1 
ATOM   6102 N N   . VAL D 2 148 ? -3.407  17.347  85.541  1.00 27.54  ? 148 VAL B N   1 
ATOM   6103 C CA  . VAL D 2 148 ? -3.782  18.471  84.688  1.00 28.23  ? 148 VAL B CA  1 
ATOM   6104 C C   . VAL D 2 148 ? -5.155  18.115  84.126  1.00 29.46  ? 148 VAL B C   1 
ATOM   6105 O O   . VAL D 2 148 ? -5.307  17.314  83.206  1.00 28.75  ? 148 VAL B O   1 
ATOM   6106 C CB  . VAL D 2 148 ? -2.682  18.731  83.590  1.00 27.51  ? 148 VAL B CB  1 
ATOM   6107 C CG1 . VAL D 2 148 ? -1.705  17.568  83.558  1.00 34.18  ? 148 VAL B CG1 1 
ATOM   6108 C CG2 . VAL D 2 148 ? -3.284  18.991  82.244  1.00 25.10  ? 148 VAL B CG2 1 
ATOM   6109 N N   . LYS D 2 149 ? -6.175  18.700  84.728  1.00 31.06  ? 149 LYS B N   1 
ATOM   6110 C CA  . LYS D 2 149 ? -7.512  18.360  84.318  1.00 29.09  ? 149 LYS B CA  1 
ATOM   6111 C C   . LYS D 2 149 ? -8.367  19.483  83.794  1.00 29.26  ? 149 LYS B C   1 
ATOM   6112 O O   . LYS D 2 149 ? -8.126  20.674  84.040  1.00 28.24  ? 149 LYS B O   1 
ATOM   6113 C CB  . LYS D 2 149 ? -8.206  17.610  85.470  1.00 37.96  ? 149 LYS B CB  1 
ATOM   6114 C CG  . LYS D 2 149 ? -9.478  18.211  86.043  1.00 37.91  ? 149 LYS B CG  1 
ATOM   6115 C CD  . LYS D 2 149 ? -10.020 17.318  87.149  1.00 33.23  ? 149 LYS B CD  1 
ATOM   6116 C CE  . LYS D 2 149 ? -11.550 17.311  87.194  1.00 36.87  ? 149 LYS B CE  1 
ATOM   6117 N NZ  . LYS D 2 149 ? -12.077 15.912  87.111  1.00 34.50  ? 149 LYS B NZ  1 
ATOM   6118 N N   . ASP D 2 150 ? -9.357  19.058  83.020  1.00 23.58  ? 150 ASP B N   1 
ATOM   6119 C CA  . ASP D 2 150 ? -10.335 19.924  82.415  1.00 20.71  ? 150 ASP B CA  1 
ATOM   6120 C C   . ASP D 2 150 ? -9.801  20.961  81.495  1.00 16.98  ? 150 ASP B C   1 
ATOM   6121 O O   . ASP D 2 150 ? -9.953  22.135  81.741  1.00 21.89  ? 150 ASP B O   1 
ATOM   6122 C CB  . ASP D 2 150 ? -11.202 20.584  83.486  1.00 19.84  ? 150 ASP B CB  1 
ATOM   6123 C CG  . ASP D 2 150 ? -11.917 19.574  84.328  1.00 18.86  ? 150 ASP B CG  1 
ATOM   6124 O OD1 . ASP D 2 150 ? -12.110 18.426  83.836  1.00 21.13  ? 150 ASP B OD1 1 
ATOM   6125 O OD2 . ASP D 2 150 ? -12.271 19.922  85.472  1.00 29.88  ? 150 ASP B OD2 1 
ATOM   6126 N N   . TYR D 2 151 ? -9.177  20.518  80.409  1.00 22.84  ? 151 TYR B N   1 
ATOM   6127 C CA  . TYR D 2 151 ? -8.677  21.454  79.414  1.00 25.41  ? 151 TYR B CA  1 
ATOM   6128 C C   . TYR D 2 151 ? -9.211  21.035  78.058  1.00 21.35  ? 151 TYR B C   1 
ATOM   6129 O O   . TYR D 2 151 ? -9.698  19.921  77.897  1.00 22.97  ? 151 TYR B O   1 
ATOM   6130 C CB  . TYR D 2 151 ? -7.141  21.476  79.381  1.00 23.41  ? 151 TYR B CB  1 
ATOM   6131 C CG  . TYR D 2 151 ? -6.483  20.149  79.052  1.00 25.25  ? 151 TYR B CG  1 
ATOM   6132 C CD1 . TYR D 2 151 ? -6.242  19.770  77.730  1.00 23.34  ? 151 TYR B CD1 1 
ATOM   6133 C CD2 . TYR D 2 151 ? -6.087  19.280  80.065  1.00 24.37  ? 151 TYR B CD2 1 
ATOM   6134 C CE1 . TYR D 2 151 ? -5.621  18.560  77.428  1.00 20.51  ? 151 TYR B CE1 1 
ATOM   6135 C CE2 . TYR D 2 151 ? -5.462  18.059  79.774  1.00 22.21  ? 151 TYR B CE2 1 
ATOM   6136 C CZ  . TYR D 2 151 ? -5.236  17.713  78.451  1.00 20.11  ? 151 TYR B CZ  1 
ATOM   6137 O OH  . TYR D 2 151 ? -4.637  16.516  78.161  1.00 18.04  ? 151 TYR B OH  1 
ATOM   6138 N N   . PHE D 2 152 ? -9.141  21.943  77.094  1.00 23.10  ? 152 PHE B N   1 
ATOM   6139 C CA  . PHE D 2 152 ? -9.582  21.658  75.732  1.00 23.72  ? 152 PHE B CA  1 
ATOM   6140 C C   . PHE D 2 152 ? -9.137  22.802  74.840  1.00 23.90  ? 152 PHE B C   1 
ATOM   6141 O O   . PHE D 2 152 ? -9.128  23.960  75.270  1.00 26.22  ? 152 PHE B O   1 
ATOM   6142 C CB  . PHE D 2 152 ? -11.126 21.527  75.635  1.00 24.03  ? 152 PHE B CB  1 
ATOM   6143 C CG  . PHE D 2 152 ? -11.617 21.204  74.242  1.00 22.42  ? 152 PHE B CG  1 
ATOM   6144 C CD1 . PHE D 2 152 ? -11.861 22.224  73.316  1.00 24.43  ? 152 PHE B CD1 1 
ATOM   6145 C CD2 . PHE D 2 152 ? -11.761 19.874  73.831  1.00 20.00  ? 152 PHE B CD2 1 
ATOM   6146 C CE1 . PHE D 2 152 ? -12.228 21.932  72.007  1.00 23.35  ? 152 PHE B CE1 1 
ATOM   6147 C CE2 . PHE D 2 152 ? -12.129 19.571  72.520  1.00 25.49  ? 152 PHE B CE2 1 
ATOM   6148 C CZ  . PHE D 2 152 ? -12.362 20.603  71.602  1.00 23.48  ? 152 PHE B CZ  1 
ATOM   6149 N N   . PRO D 2 153 ? -8.659  22.481  73.622  1.00 22.74  ? 153 PRO B N   1 
ATOM   6150 C CA  . PRO D 2 153 ? -8.505  21.128  73.063  1.00 20.80  ? 153 PRO B CA  1 
ATOM   6151 C C   . PRO D 2 153 ? -7.115  20.613  73.444  1.00 23.13  ? 153 PRO B C   1 
ATOM   6152 O O   . PRO D 2 153 ? -6.394  21.255  74.232  1.00 24.76  ? 153 PRO B O   1 
ATOM   6153 C CB  . PRO D 2 153 ? -8.628  21.354  71.551  1.00 16.97  ? 153 PRO B CB  1 
ATOM   6154 C CG  . PRO D 2 153 ? -8.044  22.742  71.355  1.00 16.60  ? 153 PRO B CG  1 
ATOM   6155 C CD  . PRO D 2 153 ? -8.288  23.522  72.646  1.00 16.99  ? 153 PRO B CD  1 
ATOM   6156 N N   . GLU D 2 154 ? -6.763  19.445  72.923  1.00 24.86  ? 154 GLU B N   1 
ATOM   6157 C CA  . GLU D 2 154 ? -5.438  18.871  73.120  1.00 23.24  ? 154 GLU B CA  1 
ATOM   6158 C C   . GLU D 2 154 ? -4.512  19.707  72.220  1.00 27.14  ? 154 GLU B C   1 
ATOM   6159 O O   . GLU D 2 154 ? -4.981  20.370  71.301  1.00 30.65  ? 154 GLU B O   1 
ATOM   6160 C CB  . GLU D 2 154 ? -5.410  17.442  72.612  1.00 22.76  ? 154 GLU B CB  1 
ATOM   6161 C CG  . GLU D 2 154 ? -6.002  16.420  73.541  1.00 30.01  ? 154 GLU B CG  1 
ATOM   6162 C CD  . GLU D 2 154 ? -4.982  15.442  74.048  1.00 36.03  ? 154 GLU B CD  1 
ATOM   6163 O OE1 . GLU D 2 154 ? -4.091  15.852  74.830  1.00 40.44  ? 154 GLU B OE1 1 
ATOM   6164 O OE2 . GLU D 2 154 ? -5.081  14.258  73.667  1.00 43.42  ? 154 GLU B OE2 1 
ATOM   6165 N N   . PRO D 2 155 ? -3.191  19.691  72.471  1.00 26.30  ? 155 PRO B N   1 
ATOM   6166 C CA  . PRO D 2 155 ? -2.493  18.967  73.520  1.00 26.72  ? 155 PRO B CA  1 
ATOM   6167 C C   . PRO D 2 155 ? -2.065  19.861  74.666  1.00 22.06  ? 155 PRO B C   1 
ATOM   6168 O O   . PRO D 2 155 ? -2.306  21.058  74.683  1.00 26.66  ? 155 PRO B O   1 
ATOM   6169 C CB  . PRO D 2 155 ? -1.274  18.402  72.793  1.00 26.05  ? 155 PRO B CB  1 
ATOM   6170 C CG  . PRO D 2 155 ? -0.989  19.449  71.710  1.00 27.08  ? 155 PRO B CG  1 
ATOM   6171 C CD  . PRO D 2 155 ? -2.212  20.348  71.578  1.00 25.02  ? 155 PRO B CD  1 
ATOM   6172 N N   . VAL D 2 156 ? -1.390  19.234  75.613  1.00 26.73  ? 156 VAL B N   1 
ATOM   6173 C CA  . VAL D 2 156 ? -0.833  19.886  76.782  1.00 30.90  ? 156 VAL B CA  1 
ATOM   6174 C C   . VAL D 2 156 ? 0.597   19.312  76.858  1.00 30.38  ? 156 VAL B C   1 
ATOM   6175 O O   . VAL D 2 156 ? 0.823   18.169  76.462  1.00 26.03  ? 156 VAL B O   1 
ATOM   6176 C CB  . VAL D 2 156 ? -1.631  19.489  78.062  1.00 29.85  ? 156 VAL B CB  1 
ATOM   6177 C CG1 . VAL D 2 156 ? -0.729  18.786  79.063  1.00 30.94  ? 156 VAL B CG1 1 
ATOM   6178 C CG2 . VAL D 2 156 ? -2.278  20.709  78.682  1.00 22.85  ? 156 VAL B CG2 1 
ATOM   6179 N N   . THR D 2 157 ? 1.563   20.101  77.321  1.00 30.66  ? 157 THR B N   1 
ATOM   6180 C CA  . THR D 2 157 ? 2.923   19.574  77.470  1.00 30.05  ? 157 THR B CA  1 
ATOM   6181 C C   . THR D 2 157 ? 3.281   19.712  78.942  1.00 27.11  ? 157 THR B C   1 
ATOM   6182 O O   . THR D 2 157 ? 2.931   20.710  79.577  1.00 26.13  ? 157 THR B O   1 
ATOM   6183 C CB  . THR D 2 157 ? 3.954   20.328  76.609  1.00 27.07  ? 157 THR B CB  1 
ATOM   6184 O OG1 . THR D 2 157 ? 3.701   21.732  76.671  1.00 38.38  ? 157 THR B OG1 1 
ATOM   6185 C CG2 . THR D 2 157 ? 3.855   19.873  75.161  1.00 25.63  ? 157 THR B CG2 1 
ATOM   6186 N N   . VAL D 2 158 ? 3.948   18.699  79.486  1.00 23.79  ? 158 VAL B N   1 
ATOM   6187 C CA  . VAL D 2 158 ? 4.319   18.713  80.888  1.00 24.05  ? 158 VAL B CA  1 
ATOM   6188 C C   . VAL D 2 158 ? 5.791   18.348  81.102  1.00 26.31  ? 158 VAL B C   1 
ATOM   6189 O O   . VAL D 2 158 ? 6.263   17.315  80.623  1.00 25.29  ? 158 VAL B O   1 
ATOM   6190 C CB  . VAL D 2 158 ? 3.473   17.705  81.712  1.00 24.85  ? 158 VAL B CB  1 
ATOM   6191 C CG1 . VAL D 2 158 ? 3.966   17.666  83.153  1.00 27.73  ? 158 VAL B CG1 1 
ATOM   6192 C CG2 . VAL D 2 158 ? 1.996   18.102  81.696  1.00 28.68  ? 158 VAL B CG2 1 
ATOM   6193 N N   . SER D 2 159 ? 6.509   19.204  81.818  1.00 26.50  ? 159 SER B N   1 
ATOM   6194 C CA  . SER D 2 159 ? 7.907   18.924  82.126  1.00 30.02  ? 159 SER B CA  1 
ATOM   6195 C C   . SER D 2 159 ? 8.062   19.041  83.633  1.00 32.43  ? 159 SER B C   1 
ATOM   6196 O O   . SER D 2 159 ? 7.159   19.529  84.320  1.00 36.67  ? 159 SER B O   1 
ATOM   6197 C CB  . SER D 2 159 ? 8.836   19.907  81.398  1.00 28.72  ? 159 SER B CB  1 
ATOM   6198 O OG  . SER D 2 159 ? 8.877   21.181  82.024  1.00 35.76  ? 159 SER B OG  1 
ATOM   6199 N N   . TRP D 2 160 ? 9.197   18.586  84.147  1.00 32.69  ? 160 TRP B N   1 
ATOM   6200 C CA  . TRP D 2 160 ? 9.467   18.649  85.573  1.00 34.45  ? 160 TRP B CA  1 
ATOM   6201 C C   . TRP D 2 160 ? 10.774  19.390  85.816  1.00 36.89  ? 160 TRP B C   1 
ATOM   6202 O O   . TRP D 2 160 ? 11.800  19.104  85.184  1.00 34.60  ? 160 TRP B O   1 
ATOM   6203 C CB  . TRP D 2 160 ? 9.531   17.237  86.161  1.00 30.18  ? 160 TRP B CB  1 
ATOM   6204 C CG  . TRP D 2 160 ? 8.171   16.619  86.321  1.00 33.87  ? 160 TRP B CG  1 
ATOM   6205 C CD1 . TRP D 2 160 ? 7.481   15.877  85.395  1.00 31.08  ? 160 TRP B CD1 1 
ATOM   6206 C CD2 . TRP D 2 160 ? 7.340   16.684  87.483  1.00 32.30  ? 160 TRP B CD2 1 
ATOM   6207 N NE1 . TRP D 2 160 ? 6.270   15.478  85.915  1.00 34.48  ? 160 TRP B NE1 1 
ATOM   6208 C CE2 . TRP D 2 160 ? 6.159   15.961  87.195  1.00 36.64  ? 160 TRP B CE2 1 
ATOM   6209 C CE3 . TRP D 2 160 ? 7.477   17.284  88.742  1.00 29.42  ? 160 TRP B CE3 1 
ATOM   6210 C CZ2 . TRP D 2 160 ? 5.123   15.823  88.124  1.00 34.13  ? 160 TRP B CZ2 1 
ATOM   6211 C CZ3 . TRP D 2 160 ? 6.448   17.147  89.665  1.00 27.78  ? 160 TRP B CZ3 1 
ATOM   6212 C CH2 . TRP D 2 160 ? 5.289   16.423  89.351  1.00 35.86  ? 160 TRP B CH2 1 
ATOM   6213 N N   . ASN D 2 161 ? 10.715  20.367  86.711  1.00 38.14  ? 161 ASN B N   1 
ATOM   6214 C CA  . ASN D 2 161 ? 11.885  21.157  87.045  1.00 39.29  ? 161 ASN B CA  1 
ATOM   6215 C C   . ASN D 2 161 ? 12.466  21.788  85.786  1.00 40.96  ? 161 ASN B C   1 
ATOM   6216 O O   . ASN D 2 161 ? 13.669  21.700  85.523  1.00 39.44  ? 161 ASN B O   1 
ATOM   6217 C CB  . ASN D 2 161 ? 12.918  20.263  87.727  1.00 36.34  ? 161 ASN B CB  1 
ATOM   6218 C CG  . ASN D 2 161 ? 12.496  19.863  89.127  1.00 35.62  ? 161 ASN B CG  1 
ATOM   6219 O OD1 . ASN D 2 161 ? 13.151  19.051  89.788  1.00 29.57  ? 161 ASN B OD1 1 
ATOM   6220 N ND2 . ASN D 2 161 ? 11.387  20.445  89.592  1.00 30.81  ? 161 ASN B ND2 1 
ATOM   6221 N N   . SER D 2 162 ? 11.591  22.427  85.013  1.00 34.00  ? 162 SER B N   1 
ATOM   6222 C CA  . SER D 2 162 ? 11.974  23.089  83.775  1.00 30.84  ? 162 SER B CA  1 
ATOM   6223 C C   . SER D 2 162 ? 12.743  22.174  82.830  1.00 30.63  ? 162 SER B C   1 
ATOM   6224 O O   . SER D 2 162 ? 13.487  22.644  81.975  1.00 36.21  ? 162 SER B O   1 
ATOM   6225 C CB  . SER D 2 162 ? 12.804  24.342  84.072  1.00 32.36  ? 162 SER B CB  1 
ATOM   6226 O OG  . SER D 2 162 ? 12.019  25.358  84.695  1.00 36.97  ? 162 SER B OG  1 
ATOM   6227 N N   . GLY D 2 163 ? 12.576  20.872  82.990  1.00 22.93  ? 163 GLY B N   1 
ATOM   6228 C CA  . GLY D 2 163 ? 13.246  19.937  82.113  1.00 25.66  ? 163 GLY B CA  1 
ATOM   6229 C C   . GLY D 2 163 ? 14.438  19.179  82.667  1.00 24.90  ? 163 GLY B C   1 
ATOM   6230 O O   . GLY D 2 163 ? 14.901  18.227  82.041  1.00 25.22  ? 163 GLY B O   1 
ATOM   6231 N N   . ALA D 2 164 ? 14.925  19.579  83.836  1.00 28.84  ? 164 ALA B N   1 
ATOM   6232 C CA  . ALA D 2 164 ? 16.098  18.927  84.444  1.00 33.76  ? 164 ALA B CA  1 
ATOM   6233 C C   . ALA D 2 164 ? 15.781  17.533  84.935  1.00 33.43  ? 164 ALA B C   1 
ATOM   6234 O O   . ALA D 2 164 ? 16.675  16.692  85.096  1.00 33.23  ? 164 ALA B O   1 
ATOM   6235 C CB  . ALA D 2 164 ? 16.610  19.762  85.614  1.00 34.17  ? 164 ALA B CB  1 
ATOM   6236 N N   . LEU D 2 165 ? 14.495  17.297  85.185  1.00 33.96  ? 165 LEU B N   1 
ATOM   6237 C CA  . LEU D 2 165 ? 14.027  16.016  85.680  1.00 29.44  ? 165 LEU B CA  1 
ATOM   6238 C C   . LEU D 2 165 ? 13.271  15.249  84.599  1.00 30.81  ? 165 LEU B C   1 
ATOM   6239 O O   . LEU D 2 165 ? 12.193  15.673  84.180  1.00 22.84  ? 165 LEU B O   1 
ATOM   6240 C CB  . LEU D 2 165 ? 13.119  16.244  86.897  1.00 30.12  ? 165 LEU B CB  1 
ATOM   6241 C CG  . LEU D 2 165 ? 13.119  15.202  88.014  1.00 32.23  ? 165 LEU B CG  1 
ATOM   6242 C CD1 . LEU D 2 165 ? 11.695  15.093  88.620  1.00 29.41  ? 165 LEU B CD1 1 
ATOM   6243 C CD2 . LEU D 2 165 ? 13.582  13.869  87.466  1.00 20.11  ? 165 LEU B CD2 1 
ATOM   6244 N N   . THR D 2 166 ? 13.838  14.127  84.154  1.00 25.67  ? 166 THR B N   1 
ATOM   6245 C CA  . THR D 2 166 ? 13.213  13.307  83.121  1.00 22.72  ? 166 THR B CA  1 
ATOM   6246 C C   . THR D 2 166 ? 13.225  11.830  83.488  1.00 20.46  ? 166 THR B C   1 
ATOM   6247 O O   . THR D 2 166 ? 12.434  11.059  82.973  1.00 22.69  ? 166 THR B O   1 
ATOM   6248 C CB  . THR D 2 166 ? 13.935  13.442  81.774  1.00 28.40  ? 166 THR B CB  1 
ATOM   6249 O OG1 . THR D 2 166 ? 15.282  12.970  81.905  1.00 30.30  ? 166 THR B OG1 1 
ATOM   6250 C CG2 . THR D 2 166 ? 13.951  14.867  81.315  1.00 28.48  ? 166 THR B CG2 1 
ATOM   6251 N N   . SER D 2 167 ? 14.122  11.409  84.372  1.00 23.49  ? 167 SER B N   1 
ATOM   6252 C CA  . SER D 2 167 ? 14.147  9.996   84.721  1.00 28.34  ? 167 SER B CA  1 
ATOM   6253 C C   . SER D 2 167 ? 13.021  9.691   85.698  1.00 32.91  ? 167 SER B C   1 
ATOM   6254 O O   . SER D 2 167 ? 12.787  10.450  86.637  1.00 32.20  ? 167 SER B O   1 
ATOM   6255 C CB  . SER D 2 167 ? 15.485  9.605   85.344  1.00 32.98  ? 167 SER B CB  1 
ATOM   6256 O OG  . SER D 2 167 ? 16.259  10.752  85.610  1.00 43.02  ? 167 SER B OG  1 
ATOM   6257 N N   . GLY D 2 168 ? 12.337  8.575   85.458  1.00 31.93  ? 168 GLY B N   1 
ATOM   6258 C CA  . GLY D 2 168 ? 11.234  8.171   86.299  1.00 34.92  ? 168 GLY B CA  1 
ATOM   6259 C C   . GLY D 2 168 ? 9.915   8.842   85.951  1.00 34.44  ? 168 GLY B C   1 
ATOM   6260 O O   . GLY D 2 168 ? 8.860   8.388   86.402  1.00 38.12  ? 168 GLY B O   1 
ATOM   6261 N N   . VAL D 2 169 ? 9.969   9.908   85.153  1.00 28.90  ? 169 VAL B N   1 
ATOM   6262 C CA  . VAL D 2 169 ? 8.774   10.660  84.763  1.00 28.35  ? 169 VAL B CA  1 
ATOM   6263 C C   . VAL D 2 169 ? 7.852   9.873   83.822  1.00 30.80  ? 169 VAL B C   1 
ATOM   6264 O O   . VAL D 2 169 ? 8.304   9.257   82.864  1.00 26.81  ? 169 VAL B O   1 
ATOM   6265 C CB  . VAL D 2 169 ? 9.153   11.996  84.057  1.00 26.21  ? 169 VAL B CB  1 
ATOM   6266 C CG1 . VAL D 2 169 ? 7.889   12.696  83.526  1.00 23.57  ? 169 VAL B CG1 1 
ATOM   6267 C CG2 . VAL D 2 169 ? 9.868   12.918  85.020  1.00 22.36  ? 169 VAL B CG2 1 
ATOM   6268 N N   . HIS D 2 170 ? 6.552   9.880   84.104  1.00 29.75  ? 170 HIS B N   1 
ATOM   6269 C CA  . HIS D 2 170 ? 5.587   9.183   83.239  1.00 24.63  ? 170 HIS B CA  1 
ATOM   6270 C C   . HIS D 2 170 ? 4.407   10.088  83.035  1.00 23.60  ? 170 HIS B C   1 
ATOM   6271 O O   . HIS D 2 170 ? 3.645   10.323  83.971  1.00 24.55  ? 170 HIS B O   1 
ATOM   6272 C CB  . HIS D 2 170 ? 5.104   7.885   83.877  1.00 29.87  ? 170 HIS B CB  1 
ATOM   6273 C CG  . HIS D 2 170 ? 6.068   6.746   83.750  1.00 35.69  ? 170 HIS B CG  1 
ATOM   6274 N ND1 . HIS D 2 170 ? 7.426   6.924   83.669  1.00 47.00  ? 170 HIS B ND1 1 
ATOM   6275 C CD2 . HIS D 2 170 ? 5.860   5.413   83.717  1.00 41.28  ? 170 HIS B CD2 1 
ATOM   6276 C CE1 . HIS D 2 170 ? 8.018   5.743   83.590  1.00 43.67  ? 170 HIS B CE1 1 
ATOM   6277 N NE2 . HIS D 2 170 ? 7.089   4.812   83.618  1.00 34.75  ? 170 HIS B NE2 1 
ATOM   6278 N N   . THR D 2 171 ? 4.271   10.632  81.825  1.00 24.82  ? 171 THR B N   1 
ATOM   6279 C CA  . THR D 2 171 ? 3.167   11.522  81.521  1.00 21.57  ? 171 THR B CA  1 
ATOM   6280 C C   . THR D 2 171 ? 2.193   10.690  80.696  1.00 27.19  ? 171 THR B C   1 
ATOM   6281 O O   . THR D 2 171 ? 2.501   10.266  79.587  1.00 24.24  ? 171 THR B O   1 
ATOM   6282 C CB  . THR D 2 171 ? 3.656   12.739  80.756  1.00 18.02  ? 171 THR B CB  1 
ATOM   6283 O OG1 . THR D 2 171 ? 4.523   13.467  81.603  1.00 18.30  ? 171 THR B OG1 1 
ATOM   6284 C CG2 . THR D 2 171 ? 2.503   13.666  80.369  1.00 15.82  ? 171 THR B CG2 1 
ATOM   6285 N N   . PHE D 2 172 ? 1.028   10.416  81.272  1.00 22.70  ? 172 PHE B N   1 
ATOM   6286 C CA  . PHE D 2 172 ? 0.044   9.576   80.597  1.00 19.21  ? 172 PHE B CA  1 
ATOM   6287 C C   . PHE D 2 172 ? -0.768  10.228  79.506  1.00 17.71  ? 172 PHE B C   1 
ATOM   6288 O O   . PHE D 2 172 ? -0.951  11.437  79.484  1.00 19.82  ? 172 PHE B O   1 
ATOM   6289 C CB  . PHE D 2 172 ? -0.916  8.984   81.623  1.00 20.17  ? 172 PHE B CB  1 
ATOM   6290 C CG  . PHE D 2 172 ? -0.252  8.135   82.637  1.00 19.72  ? 172 PHE B CG  1 
ATOM   6291 C CD1 . PHE D 2 172 ? 0.285   8.697   83.793  1.00 23.71  ? 172 PHE B CD1 1 
ATOM   6292 C CD2 . PHE D 2 172 ? -0.169  6.771   82.449  1.00 16.01  ? 172 PHE B CD2 1 
ATOM   6293 C CE1 . PHE D 2 172 ? 0.893   7.901   84.749  1.00 16.88  ? 172 PHE B CE1 1 
ATOM   6294 C CE2 . PHE D 2 172 ? 0.427   5.970   83.384  1.00 12.94  ? 172 PHE B CE2 1 
ATOM   6295 C CZ  . PHE D 2 172 ? 0.964   6.527   84.546  1.00 15.87  ? 172 PHE B CZ  1 
ATOM   6296 N N   . PRO D 2 173 ? -1.227  9.421   78.538  1.00 19.66  ? 173 PRO B N   1 
ATOM   6297 C CA  . PRO D 2 173 ? -2.038  9.999   77.470  1.00 17.41  ? 173 PRO B CA  1 
ATOM   6298 C C   . PRO D 2 173 ? -3.346  10.517  78.087  1.00 20.74  ? 173 PRO B C   1 
ATOM   6299 O O   . PRO D 2 173 ? -3.921  9.879   78.988  1.00 19.46  ? 173 PRO B O   1 
ATOM   6300 C CB  . PRO D 2 173 ? -2.286  8.833   76.505  1.00 21.91  ? 173 PRO B CB  1 
ATOM   6301 C CG  . PRO D 2 173 ? -1.848  7.580   77.224  1.00 17.42  ? 173 PRO B CG  1 
ATOM   6302 C CD  . PRO D 2 173 ? -0.953  7.982   78.360  1.00 17.57  ? 173 PRO B CD  1 
ATOM   6303 N N   . ALA D 2 174 ? -3.799  11.669  77.607  1.00 18.03  ? 174 ALA B N   1 
ATOM   6304 C CA  . ALA D 2 174 ? -5.018  12.279  78.097  1.00 25.20  ? 174 ALA B CA  1 
ATOM   6305 C C   . ALA D 2 174 ? -6.225  11.357  77.921  1.00 27.83  ? 174 ALA B C   1 
ATOM   6306 O O   . ALA D 2 174 ? -6.205  10.401  77.139  1.00 29.10  ? 174 ALA B O   1 
ATOM   6307 C CB  . ALA D 2 174 ? -5.276  13.592  77.367  1.00 23.03  ? 174 ALA B CB  1 
ATOM   6308 N N   . VAL D 2 175 ? -7.282  11.673  78.654  1.00 27.69  ? 175 VAL B N   1 
ATOM   6309 C CA  . VAL D 2 175 ? -8.513  10.905  78.605  1.00 27.47  ? 175 VAL B CA  1 
ATOM   6310 C C   . VAL D 2 175 ? -9.639  11.927  78.449  1.00 25.33  ? 175 VAL B C   1 
ATOM   6311 O O   . VAL D 2 175 ? -9.649  12.960  79.110  1.00 20.48  ? 175 VAL B O   1 
ATOM   6312 C CB  . VAL D 2 175 ? -8.712  10.100  79.914  1.00 27.09  ? 175 VAL B CB  1 
ATOM   6313 C CG1 . VAL D 2 175 ? -10.154 10.059  80.276  1.00 32.10  ? 175 VAL B CG1 1 
ATOM   6314 C CG2 . VAL D 2 175 ? -8.187  8.683   79.758  1.00 30.18  ? 175 VAL B CG2 1 
ATOM   6315 N N   . LEU D 2 176 ? -10.586 11.636  77.571  1.00 23.88  ? 176 LEU B N   1 
ATOM   6316 C CA  . LEU D 2 176 ? -11.695 12.543  77.351  1.00 25.33  ? 176 LEU B CA  1 
ATOM   6317 C C   . LEU D 2 176 ? -12.732 12.232  78.429  1.00 23.94  ? 176 LEU B C   1 
ATOM   6318 O O   . LEU D 2 176 ? -13.162 11.094  78.588  1.00 22.73  ? 176 LEU B O   1 
ATOM   6319 C CB  . LEU D 2 176 ? -12.269 12.353  75.940  1.00 24.36  ? 176 LEU B CB  1 
ATOM   6320 C CG  . LEU D 2 176 ? -13.429 13.290  75.563  1.00 23.51  ? 176 LEU B CG  1 
ATOM   6321 C CD1 . LEU D 2 176 ? -13.010 14.724  75.750  1.00 21.79  ? 176 LEU B CD1 1 
ATOM   6322 C CD2 . LEU D 2 176 ? -13.864 13.037  74.115  1.00 25.41  ? 176 LEU B CD2 1 
ATOM   6323 N N   . GLN D 2 177 ? -13.096 13.252  79.194  1.00 24.12  ? 177 GLN B N   1 
ATOM   6324 C CA  . GLN D 2 177 ? -14.052 13.080  80.271  1.00 25.19  ? 177 GLN B CA  1 
ATOM   6325 C C   . GLN D 2 177 ? -15.478 13.226  79.723  1.00 24.39  ? 177 GLN B C   1 
ATOM   6326 O O   . GLN D 2 177 ? -15.667 13.660  78.588  1.00 21.27  ? 177 GLN B O   1 
ATOM   6327 C CB  . GLN D 2 177 ? -13.752 14.105  81.385  1.00 23.42  ? 177 GLN B CB  1 
ATOM   6328 C CG  . GLN D 2 177 ? -12.354 13.930  82.038  1.00 20.80  ? 177 GLN B CG  1 
ATOM   6329 C CD  . GLN D 2 177 ? -11.983 15.056  82.973  1.00 20.52  ? 177 GLN B CD  1 
ATOM   6330 O OE1 . GLN D 2 177 ? -11.925 16.235  82.588  1.00 21.83  ? 177 GLN B OE1 1 
ATOM   6331 N NE2 . GLN D 2 177 ? -11.723 14.702  84.224  1.00 32.94  ? 177 GLN B NE2 1 
ATOM   6332 N N   . SER D 2 178 ? -16.471 12.863  80.538  1.00 25.12  ? 178 SER B N   1 
ATOM   6333 C CA  . SER D 2 178 ? -17.896 12.925  80.173  1.00 21.15  ? 178 SER B CA  1 
ATOM   6334 C C   . SER D 2 178 ? -18.322 14.337  79.856  1.00 20.05  ? 178 SER B C   1 
ATOM   6335 O O   . SER D 2 178 ? -19.279 14.562  79.118  1.00 18.95  ? 178 SER B O   1 
ATOM   6336 C CB  . SER D 2 178 ? -18.756 12.399  81.330  1.00 25.18  ? 178 SER B CB  1 
ATOM   6337 O OG  . SER D 2 178 ? -18.705 10.983  81.403  1.00 27.29  ? 178 SER B OG  1 
ATOM   6338 N N   . SER D 2 179 ? -17.613 15.289  80.446  1.00 18.68  ? 179 SER B N   1 
ATOM   6339 C CA  . SER D 2 179 ? -17.884 16.702  80.248  1.00 21.12  ? 179 SER B CA  1 
ATOM   6340 C C   . SER D 2 179 ? -17.410 17.150  78.878  1.00 18.64  ? 179 SER B C   1 
ATOM   6341 O O   . SER D 2 179 ? -17.732 18.257  78.435  1.00 21.02  ? 179 SER B O   1 
ATOM   6342 C CB  . SER D 2 179 ? -17.115 17.497  81.286  1.00 27.70  ? 179 SER B CB  1 
ATOM   6343 O OG  . SER D 2 179 ? -15.847 16.894  81.471  1.00 31.02  ? 179 SER B OG  1 
ATOM   6344 N N   . GLY D 2 180 ? -16.617 16.301  78.225  1.00 17.70  ? 180 GLY B N   1 
ATOM   6345 C CA  . GLY D 2 180 ? -16.070 16.663  76.932  1.00 18.20  ? 180 GLY B CA  1 
ATOM   6346 C C   . GLY D 2 180 ? -14.748 17.401  77.119  1.00 26.32  ? 180 GLY B C   1 
ATOM   6347 O O   . GLY D 2 180 ? -14.184 17.939  76.165  1.00 28.06  ? 180 GLY B O   1 
ATOM   6348 N N   . LEU D 2 181 ? -14.258 17.434  78.358  1.00 24.58  ? 181 LEU B N   1 
ATOM   6349 C CA  . LEU D 2 181 ? -12.989 18.085  78.674  1.00 23.99  ? 181 LEU B CA  1 
ATOM   6350 C C   . LEU D 2 181 ? -11.919 17.004  78.858  1.00 20.97  ? 181 LEU B C   1 
ATOM   6351 O O   . LEU D 2 181 ? -12.238 15.866  79.202  1.00 18.96  ? 181 LEU B O   1 
ATOM   6352 C CB  . LEU D 2 181 ? -13.130 18.928  79.940  1.00 23.15  ? 181 LEU B CB  1 
ATOM   6353 C CG  . LEU D 2 181 ? -13.280 20.446  79.819  1.00 27.83  ? 181 LEU B CG  1 
ATOM   6354 C CD1 . LEU D 2 181 ? -14.011 20.857  78.553  1.00 19.48  ? 181 LEU B CD1 1 
ATOM   6355 C CD2 . LEU D 2 181 ? -13.999 20.957  81.061  1.00 22.03  ? 181 LEU B CD2 1 
ATOM   6356 N N   . TYR D 2 182 ? -10.651 17.340  78.613  1.00 21.83  ? 182 TYR B N   1 
ATOM   6357 C CA  . TYR D 2 182 ? -9.595  16.340  78.756  1.00 21.61  ? 182 TYR B CA  1 
ATOM   6358 C C   . TYR D 2 182 ? -8.941  16.466  80.113  1.00 18.54  ? 182 TYR B C   1 
ATOM   6359 O O   . TYR D 2 182 ? -8.973  17.521  80.732  1.00 20.29  ? 182 TYR B O   1 
ATOM   6360 C CB  . TYR D 2 182 ? -8.502  16.498  77.680  1.00 20.19  ? 182 TYR B CB  1 
ATOM   6361 C CG  . TYR D 2 182 ? -8.942  16.237  76.248  1.00 17.52  ? 182 TYR B CG  1 
ATOM   6362 C CD1 . TYR D 2 182 ? -8.947  14.949  75.729  1.00 16.85  ? 182 TYR B CD1 1 
ATOM   6363 C CD2 . TYR D 2 182 ? -9.315  17.287  75.408  1.00 20.81  ? 182 TYR B CD2 1 
ATOM   6364 C CE1 . TYR D 2 182 ? -9.320  14.700  74.379  1.00 18.84  ? 182 TYR B CE1 1 
ATOM   6365 C CE2 . TYR D 2 182 ? -9.688  17.048  74.071  1.00 22.56  ? 182 TYR B CE2 1 
ATOM   6366 C CZ  . TYR D 2 182 ? -9.688  15.757  73.571  1.00 17.78  ? 182 TYR B CZ  1 
ATOM   6367 O OH  . TYR D 2 182 ? -10.094 15.506  72.270  1.00 23.96  ? 182 TYR B OH  1 
ATOM   6368 N N   . SER D 2 183 ? -8.350  15.366  80.563  1.00 22.80  ? 183 SER B N   1 
ATOM   6369 C CA  . SER D 2 183 ? -7.625  15.325  81.822  1.00 24.94  ? 183 SER B CA  1 
ATOM   6370 C C   . SER D 2 183 ? -6.507  14.276  81.719  1.00 27.93  ? 183 SER B C   1 
ATOM   6371 O O   . SER D 2 183 ? -6.615  13.318  80.952  1.00 24.60  ? 183 SER B O   1 
ATOM   6372 C CB  . SER D 2 183 ? -8.563  14.956  82.969  1.00 25.92  ? 183 SER B CB  1 
ATOM   6373 O OG  . SER D 2 183 ? -7.833  14.484  84.083  1.00 24.52  ? 183 SER B OG  1 
ATOM   6374 N N   . LEU D 2 184 ? -5.428  14.476  82.472  1.00 26.17  ? 184 LEU B N   1 
ATOM   6375 C CA  . LEU D 2 184 ? -4.319  13.532  82.487  1.00 26.05  ? 184 LEU B CA  1 
ATOM   6376 C C   . LEU D 2 184 ? -3.424  13.796  83.680  1.00 24.81  ? 184 LEU B C   1 
ATOM   6377 O O   . LEU D 2 184 ? -3.484  14.857  84.304  1.00 22.28  ? 184 LEU B O   1 
ATOM   6378 C CB  . LEU D 2 184 ? -3.469  13.635  81.210  1.00 27.12  ? 184 LEU B CB  1 
ATOM   6379 C CG  . LEU D 2 184 ? -2.519  14.819  80.979  1.00 31.62  ? 184 LEU B CG  1 
ATOM   6380 C CD1 . LEU D 2 184 ? -1.190  14.723  81.799  1.00 27.25  ? 184 LEU B CD1 1 
ATOM   6381 C CD2 . LEU D 2 184 ? -2.206  14.822  79.503  1.00 29.40  ? 184 LEU B CD2 1 
ATOM   6382 N N   . SER D 2 185 ? -2.594  12.814  83.995  1.00 28.34  ? 185 SER B N   1 
ATOM   6383 C CA  . SER D 2 185 ? -1.643  12.949  85.086  1.00 32.12  ? 185 SER B CA  1 
ATOM   6384 C C   . SER D 2 185 ? -0.220  12.695  84.577  1.00 29.59  ? 185 SER B C   1 
ATOM   6385 O O   . SER D 2 185 ? -0.015  12.010  83.574  1.00 18.86  ? 185 SER B O   1 
ATOM   6386 C CB  . SER D 2 185 ? -1.971  11.968  86.214  1.00 33.82  ? 185 SER B CB  1 
ATOM   6387 O OG  . SER D 2 185 ? -2.531  10.779  85.694  1.00 49.70  ? 185 SER B OG  1 
ATOM   6388 N N   . SER D 2 186 ? 0.740   13.296  85.275  1.00 29.21  ? 186 SER B N   1 
ATOM   6389 C CA  . SER D 2 186 ? 2.159   13.171  84.992  1.00 26.17  ? 186 SER B CA  1 
ATOM   6390 C C   . SER D 2 186 ? 2.760   12.806  86.332  1.00 23.33  ? 186 SER B C   1 
ATOM   6391 O O   . SER D 2 186 ? 2.635   13.559  87.298  1.00 22.78  ? 186 SER B O   1 
ATOM   6392 C CB  . SER D 2 186 ? 2.762   14.500  84.534  1.00 28.44  ? 186 SER B CB  1 
ATOM   6393 O OG  . SER D 2 186 ? 4.137   14.344  84.232  1.00 25.45  ? 186 SER B OG  1 
ATOM   6394 N N   . VAL D 2 187 ? 3.378   11.638  86.402  1.00 18.11  ? 187 VAL B N   1 
ATOM   6395 C CA  . VAL D 2 187 ? 3.991   11.194  87.643  1.00 24.04  ? 187 VAL B CA  1 
ATOM   6396 C C   . VAL D 2 187 ? 5.520   11.049  87.525  1.00 27.00  ? 187 VAL B C   1 
ATOM   6397 O O   . VAL D 2 187 ? 6.058   11.005  86.423  1.00 22.09  ? 187 VAL B O   1 
ATOM   6398 C CB  . VAL D 2 187 ? 3.372   9.851   88.081  1.00 20.50  ? 187 VAL B CB  1 
ATOM   6399 C CG1 . VAL D 2 187 ? 1.848   9.978   88.094  1.00 23.48  ? 187 VAL B CG1 1 
ATOM   6400 C CG2 . VAL D 2 187 ? 3.768   8.749   87.127  1.00 19.03  ? 187 VAL B CG2 1 
ATOM   6401 N N   . VAL D 2 188 ? 6.201   10.984  88.671  1.00 29.32  ? 188 VAL B N   1 
ATOM   6402 C CA  . VAL D 2 188 ? 7.662   10.842  88.736  1.00 28.44  ? 188 VAL B CA  1 
ATOM   6403 C C   . VAL D 2 188 ? 8.035   10.069  89.973  1.00 30.73  ? 188 VAL B C   1 
ATOM   6404 O O   . VAL D 2 188 ? 7.516   10.362  91.043  1.00 27.49  ? 188 VAL B O   1 
ATOM   6405 C CB  . VAL D 2 188 ? 8.383   12.194  88.892  1.00 29.45  ? 188 VAL B CB  1 
ATOM   6406 C CG1 . VAL D 2 188 ? 9.691   12.168  88.137  1.00 29.96  ? 188 VAL B CG1 1 
ATOM   6407 C CG2 . VAL D 2 188 ? 7.504   13.308  88.407  1.00 37.35  ? 188 VAL B CG2 1 
ATOM   6408 N N   . THR D 2 189 ? 8.933   9.095   89.843  1.00 30.48  ? 189 THR B N   1 
ATOM   6409 C CA  . THR D 2 189 ? 9.371   8.333   91.007  1.00 34.89  ? 189 THR B CA  1 
ATOM   6410 C C   . THR D 2 189 ? 10.730  8.869   91.455  1.00 40.75  ? 189 THR B C   1 
ATOM   6411 O O   . THR D 2 189 ? 11.701  8.834   90.695  1.00 38.27  ? 189 THR B O   1 
ATOM   6412 C CB  . THR D 2 189 ? 9.480   6.829   90.694  1.00 35.58  ? 189 THR B CB  1 
ATOM   6413 O OG1 . THR D 2 189 ? 9.473   6.626   89.279  1.00 47.40  ? 189 THR B OG1 1 
ATOM   6414 C CG2 . THR D 2 189 ? 8.305   6.100   91.277  1.00 39.61  ? 189 THR B CG2 1 
ATOM   6415 N N   . VAL D 2 190 ? 10.783  9.378   92.686  1.00 41.09  ? 190 VAL B N   1 
ATOM   6416 C CA  . VAL D 2 190 ? 12.008  9.946   93.251  1.00 41.97  ? 190 VAL B CA  1 
ATOM   6417 C C   . VAL D 2 190 ? 12.443  9.262   94.560  1.00 41.89  ? 190 VAL B C   1 
ATOM   6418 O O   . VAL D 2 190 ? 11.695  8.482   95.146  1.00 36.84  ? 190 VAL B O   1 
ATOM   6419 C CB  . VAL D 2 190 ? 11.824  11.456  93.525  1.00 45.63  ? 190 VAL B CB  1 
ATOM   6420 C CG1 . VAL D 2 190 ? 11.431  12.184  92.236  1.00 43.92  ? 190 VAL B CG1 1 
ATOM   6421 C CG2 . VAL D 2 190 ? 10.762  11.656  94.597  1.00 42.45  ? 190 VAL B CG2 1 
ATOM   6422 N N   . PRO D 2 191 ? 13.666  9.558   95.043  1.00 42.00  ? 191 PRO B N   1 
ATOM   6423 C CA  . PRO D 2 191 ? 14.070  8.901   96.286  1.00 39.84  ? 191 PRO B CA  1 
ATOM   6424 C C   . PRO D 2 191 ? 13.434  9.604   97.473  1.00 37.24  ? 191 PRO B C   1 
ATOM   6425 O O   . PRO D 2 191 ? 13.524  10.821  97.607  1.00 38.07  ? 191 PRO B O   1 
ATOM   6426 C CB  . PRO D 2 191 ? 15.586  9.029   96.286  1.00 36.71  ? 191 PRO B CB  1 
ATOM   6427 C CG  . PRO D 2 191 ? 15.851  10.287  95.524  1.00 43.79  ? 191 PRO B CG  1 
ATOM   6428 C CD  . PRO D 2 191 ? 14.698  10.486  94.551  1.00 40.37  ? 191 PRO B CD  1 
ATOM   6429 N N   . SER D 2 192 ? 12.780  8.833   98.328  1.00 37.79  ? 192 SER B N   1 
ATOM   6430 C CA  . SER D 2 192 ? 12.125  9.391   99.500  1.00 41.03  ? 192 SER B CA  1 
ATOM   6431 C C   . SER D 2 192 ? 13.092  10.298  100.251 1.00 43.05  ? 192 SER B C   1 
ATOM   6432 O O   . SER D 2 192 ? 12.687  11.298  100.843 1.00 45.03  ? 192 SER B O   1 
ATOM   6433 C CB  . SER D 2 192 ? 11.654  8.267   100.420 1.00 44.39  ? 192 SER B CB  1 
ATOM   6434 O OG  . SER D 2 192 ? 11.358  7.092   99.687  1.00 50.56  ? 192 SER B OG  1 
ATOM   6435 N N   . SER D 2 193 ? 14.374  9.952   100.210 1.00 40.56  ? 193 SER B N   1 
ATOM   6436 C CA  . SER D 2 193 ? 15.398  10.727  100.905 1.00 40.72  ? 193 SER B CA  1 
ATOM   6437 C C   . SER D 2 193 ? 15.545  12.145  100.358 1.00 40.31  ? 193 SER B C   1 
ATOM   6438 O O   . SER D 2 193 ? 16.050  13.028  101.053 1.00 41.77  ? 193 SER B O   1 
ATOM   6439 C CB  . SER D 2 193 ? 16.749  10.015  100.822 1.00 40.77  ? 193 SER B CB  1 
ATOM   6440 O OG  . SER D 2 193 ? 17.537  10.586  99.798  1.00 42.44  ? 193 SER B OG  1 
ATOM   6441 N N   . SER D 2 194 ? 15.103  12.363  99.121  1.00 36.54  ? 194 SER B N   1 
ATOM   6442 C CA  . SER D 2 194 ? 15.193  13.687  98.511  1.00 38.18  ? 194 SER B CA  1 
ATOM   6443 C C   . SER D 2 194 ? 14.029  14.585  98.920  1.00 39.98  ? 194 SER B C   1 
ATOM   6444 O O   . SER D 2 194 ? 14.100  15.808  98.777  1.00 37.26  ? 194 SER B O   1 
ATOM   6445 C CB  . SER D 2 194 ? 15.245  13.580  96.980  1.00 37.26  ? 194 SER B CB  1 
ATOM   6446 O OG  . SER D 2 194 ? 14.135  12.878  96.449  1.00 41.10  ? 194 SER B OG  1 
ATOM   6447 N N   . LEU D 2 195 ? 12.961  13.972  99.426  1.00 38.82  ? 195 LEU B N   1 
ATOM   6448 C CA  . LEU D 2 195 ? 11.781  14.721  99.854  1.00 41.72  ? 195 LEU B CA  1 
ATOM   6449 C C   . LEU D 2 195 ? 12.100  15.715  100.961 1.00 43.36  ? 195 LEU B C   1 
ATOM   6450 O O   . LEU D 2 195 ? 12.469  15.334  102.080 1.00 45.80  ? 195 LEU B O   1 
ATOM   6451 C CB  . LEU D 2 195 ? 10.684  13.760  100.321 1.00 33.88  ? 195 LEU B CB  1 
ATOM   6452 C CG  . LEU D 2 195 ? 10.277  12.763  99.242  1.00 30.43  ? 195 LEU B CG  1 
ATOM   6453 C CD1 . LEU D 2 195 ? 9.190   11.864  99.776  1.00 28.61  ? 195 LEU B CD1 1 
ATOM   6454 C CD2 . LEU D 2 195 ? 9.817   13.529  97.980  1.00 30.83  ? 195 LEU B CD2 1 
ATOM   6455 N N   . GLY D 2 196 ? 11.951  16.995  100.647 1.00 44.23  ? 196 GLY B N   1 
ATOM   6456 C CA  . GLY D 2 196 ? 12.234  18.015  101.637 1.00 47.24  ? 196 GLY B CA  1 
ATOM   6457 C C   . GLY D 2 196 ? 13.490  18.786  101.295 1.00 49.94  ? 196 GLY B C   1 
ATOM   6458 O O   . GLY D 2 196 ? 13.677  19.912  101.745 1.00 48.79  ? 196 GLY B O   1 
ATOM   6459 N N   . THR D 2 197 ? 14.357  18.173  100.499 1.00 52.10  ? 197 THR B N   1 
ATOM   6460 C CA  . THR D 2 197 ? 15.591  18.821  100.086 1.00 57.05  ? 197 THR B CA  1 
ATOM   6461 C C   . THR D 2 197 ? 15.463  19.209  98.623  1.00 54.66  ? 197 THR B C   1 
ATOM   6462 O O   . THR D 2 197 ? 15.743  20.347  98.248  1.00 57.05  ? 197 THR B O   1 
ATOM   6463 C CB  . THR D 2 197 ? 16.809  17.886  100.240 1.00 61.69  ? 197 THR B CB  1 
ATOM   6464 O OG1 . THR D 2 197 ? 16.375  16.597  100.696 1.00 68.54  ? 197 THR B OG1 1 
ATOM   6465 C CG2 . THR D 2 197 ? 17.799  18.467  101.234 1.00 63.13  ? 197 THR B CG2 1 
ATOM   6466 N N   . GLN D 2 198 ? 15.028  18.258  97.801  1.00 50.75  ? 198 GLN B N   1 
ATOM   6467 C CA  . GLN D 2 198 ? 14.865  18.504  96.378  1.00 45.72  ? 198 GLN B CA  1 
ATOM   6468 C C   . GLN D 2 198 ? 13.451  18.972  96.059  1.00 43.38  ? 198 GLN B C   1 
ATOM   6469 O O   . GLN D 2 198 ? 12.481  18.246  96.278  1.00 45.90  ? 198 GLN B O   1 
ATOM   6470 C CB  . GLN D 2 198 ? 15.184  17.242  95.585  1.00 46.02  ? 198 GLN B CB  1 
ATOM   6471 C CG  . GLN D 2 198 ? 14.961  17.398  94.098  1.00 50.40  ? 198 GLN B CG  1 
ATOM   6472 C CD  . GLN D 2 198 ? 15.868  18.447  93.479  1.00 50.95  ? 198 GLN B CD  1 
ATOM   6473 O OE1 . GLN D 2 198 ? 15.412  19.502  93.036  1.00 49.12  ? 198 GLN B OE1 1 
ATOM   6474 N NE2 . GLN D 2 198 ? 17.161  18.157  93.443  1.00 53.56  ? 198 GLN B NE2 1 
ATOM   6475 N N   . THR D 2 199 ? 13.332  20.191  95.550  1.00 38.36  ? 199 THR B N   1 
ATOM   6476 C CA  . THR D 2 199 ? 12.025  20.726  95.211  1.00 41.22  ? 199 THR B CA  1 
ATOM   6477 C C   . THR D 2 199 ? 11.594  20.195  93.838  1.00 39.71  ? 199 THR B C   1 
ATOM   6478 O O   . THR D 2 199 ? 12.424  19.972  92.948  1.00 34.95  ? 199 THR B O   1 
ATOM   6479 C CB  . THR D 2 199 ? 12.030  22.279  95.234  1.00 45.69  ? 199 THR B CB  1 
ATOM   6480 O OG1 . THR D 2 199 ? 11.250  22.788  94.144  1.00 50.40  ? 199 THR B OG1 1 
ATOM   6481 C CG2 . THR D 2 199 ? 13.460  22.813  95.147  1.00 54.19  ? 199 THR B CG2 1 
ATOM   6482 N N   . TYR D 2 200 ? 10.290  19.967  93.690  1.00 39.24  ? 200 TYR B N   1 
ATOM   6483 C CA  . TYR D 2 200 ? 9.713   19.432  92.458  1.00 34.74  ? 200 TYR B CA  1 
ATOM   6484 C C   . TYR D 2 200 ? 8.561   20.279  91.956  1.00 34.11  ? 200 TYR B C   1 
ATOM   6485 O O   . TYR D 2 200 ? 7.565   20.478  92.656  1.00 37.10  ? 200 TYR B O   1 
ATOM   6486 C CB  . TYR D 2 200 ? 9.226   18.005  92.694  1.00 31.54  ? 200 TYR B CB  1 
ATOM   6487 C CG  . TYR D 2 200 ? 10.315  17.061  93.125  1.00 31.80  ? 200 TYR B CG  1 
ATOM   6488 C CD1 . TYR D 2 200 ? 11.207  16.528  92.193  1.00 34.92  ? 200 TYR B CD1 1 
ATOM   6489 C CD2 . TYR D 2 200 ? 10.448  16.675  94.460  1.00 34.94  ? 200 TYR B CD2 1 
ATOM   6490 C CE1 . TYR D 2 200 ? 12.200  15.631  92.575  1.00 28.89  ? 200 TYR B CE1 1 
ATOM   6491 C CE2 . TYR D 2 200 ? 11.441  15.776  94.858  1.00 29.86  ? 200 TYR B CE2 1 
ATOM   6492 C CZ  . TYR D 2 200 ? 12.314  15.254  93.901  1.00 31.68  ? 200 TYR B CZ  1 
ATOM   6493 O OH  . TYR D 2 200 ? 13.280  14.336  94.260  1.00 27.15  ? 200 TYR B OH  1 
ATOM   6494 N N   . ILE D 2 201 ? 8.705   20.768  90.732  1.00 32.52  ? 201 ILE B N   1 
ATOM   6495 C CA  . ILE D 2 201 ? 7.710   21.622  90.102  1.00 32.54  ? 201 ILE B CA  1 
ATOM   6496 C C   . ILE D 2 201 ? 7.323   21.064  88.743  1.00 32.35  ? 201 ILE B C   1 
ATOM   6497 O O   . ILE D 2 201 ? 8.200   20.717  87.943  1.00 35.93  ? 201 ILE B O   1 
ATOM   6498 C CB  . ILE D 2 201 ? 8.280   23.029  89.882  1.00 32.48  ? 201 ILE B CB  1 
ATOM   6499 C CG1 . ILE D 2 201 ? 8.590   23.672  91.234  1.00 36.50  ? 201 ILE B CG1 1 
ATOM   6500 C CG2 . ILE D 2 201 ? 7.309   23.872  89.056  1.00 33.34  ? 201 ILE B CG2 1 
ATOM   6501 C CD1 . ILE D 2 201 ? 9.174   25.066  91.125  1.00 41.13  ? 201 ILE B CD1 1 
ATOM   6502 N N   . CYS D 2 202 ? 6.023   20.953  88.481  1.00 29.59  ? 202 CYS B N   1 
ATOM   6503 C CA  . CYS D 2 202 ? 5.591   20.480  87.177  1.00 24.57  ? 202 CYS B CA  1 
ATOM   6504 C C   . CYS D 2 202 ? 5.324   21.698  86.323  1.00 27.20  ? 202 CYS B C   1 
ATOM   6505 O O   . CYS D 2 202 ? 4.720   22.686  86.769  1.00 22.53  ? 202 CYS B O   1 
ATOM   6506 C CB  . CYS D 2 202 ? 4.365   19.574  87.244  1.00 26.46  ? 202 CYS B CB  1 
ATOM   6507 S SG  . CYS D 2 202 ? 2.820   20.249  87.945  1.00 37.39  ? 202 CYS B SG  1 
ATOM   6508 N N   . ASN D 2 203 ? 5.815   21.641  85.092  1.00 23.25  ? 203 ASN B N   1 
ATOM   6509 C CA  . ASN D 2 203 ? 5.643   22.739  84.171  1.00 28.20  ? 203 ASN B CA  1 
ATOM   6510 C C   . ASN D 2 203 ? 4.602   22.298  83.147  1.00 26.05  ? 203 ASN B C   1 
ATOM   6511 O O   . ASN D 2 203 ? 4.871   21.434  82.317  1.00 24.90  ? 203 ASN B O   1 
ATOM   6512 C CB  . ASN D 2 203 ? 6.973   23.054  83.478  1.00 27.98  ? 203 ASN B CB  1 
ATOM   6513 C CG  . ASN D 2 203 ? 8.135   23.123  84.452  1.00 29.70  ? 203 ASN B CG  1 
ATOM   6514 O OD1 . ASN D 2 203 ? 8.255   24.064  85.237  1.00 29.29  ? 203 ASN B OD1 1 
ATOM   6515 N ND2 . ASN D 2 203 ? 9.005   22.126  84.398  1.00 39.21  ? 203 ASN B ND2 1 
ATOM   6516 N N   . VAL D 2 204 ? 3.411   22.885  83.224  1.00 31.67  ? 204 VAL B N   1 
ATOM   6517 C CA  . VAL D 2 204 ? 2.331   22.513  82.315  1.00 25.49  ? 204 VAL B CA  1 
ATOM   6518 C C   . VAL D 2 204 ? 1.991   23.654  81.390  1.00 25.12  ? 204 VAL B C   1 
ATOM   6519 O O   . VAL D 2 204 ? 1.772   24.784  81.819  1.00 25.43  ? 204 VAL B O   1 
ATOM   6520 C CB  . VAL D 2 204 ? 1.055   22.098  83.091  1.00 28.27  ? 204 VAL B CB  1 
ATOM   6521 C CG1 . VAL D 2 204 ? 0.062   21.428  82.142  1.00 25.52  ? 204 VAL B CG1 1 
ATOM   6522 C CG2 . VAL D 2 204 ? 1.413   21.135  84.214  1.00 23.35  ? 204 VAL B CG2 1 
ATOM   6523 N N   . ASN D 2 205 ? 1.977   23.367  80.098  1.00 26.15  ? 205 ASN B N   1 
ATOM   6524 C CA  . ASN D 2 205 ? 1.644   24.405  79.154  1.00 31.12  ? 205 ASN B CA  1 
ATOM   6525 C C   . ASN D 2 205 ? 0.540   23.954  78.198  1.00 27.53  ? 205 ASN B C   1 
ATOM   6526 O O   . ASN D 2 205 ? 0.584   22.857  77.650  1.00 27.42  ? 205 ASN B O   1 
ATOM   6527 C CB  . ASN D 2 205 ? 2.886   24.821  78.364  1.00 34.51  ? 205 ASN B CB  1 
ATOM   6528 C CG  . ASN D 2 205 ? 2.589   25.885  77.342  1.00 44.09  ? 205 ASN B CG  1 
ATOM   6529 O OD1 . ASN D 2 205 ? 1.957   26.896  77.649  1.00 50.60  ? 205 ASN B OD1 1 
ATOM   6530 N ND2 . ASN D 2 205 ? 3.037   25.667  76.114  1.00 50.76  ? 205 ASN B ND2 1 
ATOM   6531 N N   . HIS D 2 206 ? -0.457  24.813  78.025  1.00 27.12  ? 206 HIS B N   1 
ATOM   6532 C CA  . HIS D 2 206 ? -1.556  24.541  77.107  1.00 29.74  ? 206 HIS B CA  1 
ATOM   6533 C C   . HIS D 2 206 ? -1.549  25.710  76.148  1.00 28.67  ? 206 HIS B C   1 
ATOM   6534 O O   . HIS D 2 206 ? -2.025  26.791  76.485  1.00 26.57  ? 206 HIS B O   1 
ATOM   6535 C CB  . HIS D 2 206 ? -2.899  24.490  77.841  1.00 28.86  ? 206 HIS B CB  1 
ATOM   6536 C CG  . HIS D 2 206 ? -4.042  24.055  76.972  1.00 27.67  ? 206 HIS B CG  1 
ATOM   6537 N ND1 . HIS D 2 206 ? -5.163  24.831  76.772  1.00 27.40  ? 206 HIS B ND1 1 
ATOM   6538 C CD2 . HIS D 2 206 ? -4.226  22.929  76.244  1.00 23.66  ? 206 HIS B CD2 1 
ATOM   6539 C CE1 . HIS D 2 206 ? -5.991  24.203  75.957  1.00 25.97  ? 206 HIS B CE1 1 
ATOM   6540 N NE2 . HIS D 2 206 ? -5.445  23.045  75.620  1.00 27.24  ? 206 HIS B NE2 1 
ATOM   6541 N N   . LYS D 2 207 ? -0.992  25.496  74.961  1.00 32.06  ? 207 LYS B N   1 
ATOM   6542 C CA  . LYS D 2 207 ? -0.899  26.568  73.971  1.00 39.42  ? 207 LYS B CA  1 
ATOM   6543 C C   . LYS D 2 207 ? -2.249  27.054  73.449  1.00 39.15  ? 207 LYS B C   1 
ATOM   6544 O O   . LYS D 2 207 ? -2.451  28.257  73.284  1.00 39.65  ? 207 LYS B O   1 
ATOM   6545 C CB  . LYS D 2 207 ? -0.029  26.140  72.793  1.00 46.49  ? 207 LYS B CB  1 
ATOM   6546 C CG  . LYS D 2 207 ? 0.167   27.239  71.758  1.00 60.22  ? 207 LYS B CG  1 
ATOM   6547 C CD  . LYS D 2 207 ? 0.218   26.664  70.351  1.00 67.52  ? 207 LYS B CD  1 
ATOM   6548 C CE  . LYS D 2 207 ? 1.152   27.421  69.430  1.00 68.88  ? 207 LYS B CE  1 
ATOM   6549 N NZ  . LYS D 2 207 ? 2.073   26.497  68.707  1.00 72.38  ? 207 LYS B NZ  1 
ATOM   6550 N N   . PRO D 2 208 ? -3.181  26.132  73.163  1.00 31.26  ? 208 PRO B N   1 
ATOM   6551 C CA  . PRO D 2 208 ? -4.466  26.634  72.666  1.00 31.90  ? 208 PRO B CA  1 
ATOM   6552 C C   . PRO D 2 208 ? -5.043  27.688  73.573  1.00 30.77  ? 208 PRO B C   1 
ATOM   6553 O O   . PRO D 2 208 ? -5.561  28.689  73.099  1.00 35.09  ? 208 PRO B O   1 
ATOM   6554 C CB  . PRO D 2 208 ? -5.333  25.389  72.582  1.00 29.16  ? 208 PRO B CB  1 
ATOM   6555 C CG  . PRO D 2 208 ? -4.325  24.286  72.344  1.00 31.80  ? 208 PRO B CG  1 
ATOM   6556 C CD  . PRO D 2 208 ? -3.161  24.662  73.222  1.00 25.02  ? 208 PRO B CD  1 
ATOM   6557 N N   . SER D 2 209 ? -4.943  27.487  74.880  1.00 36.80  ? 209 SER B N   1 
ATOM   6558 C CA  . SER D 2 209 ? -5.491  28.465  75.817  1.00 37.91  ? 209 SER B CA  1 
ATOM   6559 C C   . SER D 2 209 ? -4.421  29.470  76.236  1.00 44.25  ? 209 SER B C   1 
ATOM   6560 O O   . SER D 2 209 ? -4.707  30.446  76.942  1.00 45.32  ? 209 SER B O   1 
ATOM   6561 C CB  . SER D 2 209 ? -6.065  27.760  77.055  1.00 36.89  ? 209 SER B CB  1 
ATOM   6562 O OG  . SER D 2 209 ? -5.040  27.234  77.884  1.00 32.20  ? 209 SER B OG  1 
ATOM   6563 N N   . ASN D 2 210 ? -3.193  29.226  75.788  1.00 45.21  ? 210 ASN B N   1 
ATOM   6564 C CA  . ASN D 2 210 ? -2.066  30.092  76.115  1.00 47.57  ? 210 ASN B CA  1 
ATOM   6565 C C   . ASN D 2 210 ? -1.874  30.092  77.622  1.00 44.89  ? 210 ASN B C   1 
ATOM   6566 O O   . ASN D 2 210 ? -1.685  31.141  78.238  1.00 43.58  ? 210 ASN B O   1 
ATOM   6567 C CB  . ASN D 2 210 ? -2.321  31.519  75.621  1.00 56.11  ? 210 ASN B CB  1 
ATOM   6568 C CG  . ASN D 2 210 ? -1.309  31.967  74.583  1.00 63.71  ? 210 ASN B CG  1 
ATOM   6569 O OD1 . ASN D 2 210 ? -0.118  32.106  74.876  1.00 65.68  ? 210 ASN B OD1 1 
ATOM   6570 N ND2 . ASN D 2 210 ? -1.778  32.196  73.362  1.00 66.78  ? 210 ASN B ND2 1 
ATOM   6571 N N   . THR D 2 211 ? -1.933  28.897  78.200  1.00 42.93  ? 211 THR B N   1 
ATOM   6572 C CA  . THR D 2 211 ? -1.782  28.704  79.635  1.00 39.71  ? 211 THR B CA  1 
ATOM   6573 C C   . THR D 2 211 ? -0.424  28.070  79.941  1.00 41.21  ? 211 THR B C   1 
ATOM   6574 O O   . THR D 2 211 ? 0.001   27.125  79.268  1.00 39.59  ? 211 THR B O   1 
ATOM   6575 C CB  . THR D 2 211 ? -2.887  27.771  80.189  1.00 41.26  ? 211 THR B CB  1 
ATOM   6576 O OG1 . THR D 2 211 ? -4.159  28.414  80.068  1.00 42.35  ? 211 THR B OG1 1 
ATOM   6577 C CG2 . THR D 2 211 ? -2.630  27.423  81.660  1.00 37.13  ? 211 THR B CG2 1 
ATOM   6578 N N   . LYS D 2 212 ? 0.240   28.601  80.962  1.00 38.05  ? 212 LYS B N   1 
ATOM   6579 C CA  . LYS D 2 212 ? 1.540   28.110  81.411  1.00 41.60  ? 212 LYS B CA  1 
ATOM   6580 C C   . LYS D 2 212 ? 1.501   28.150  82.929  1.00 39.21  ? 212 LYS B C   1 
ATOM   6581 O O   . LYS D 2 212 ? 1.389   29.224  83.508  1.00 41.40  ? 212 LYS B O   1 
ATOM   6582 C CB  . LYS D 2 212 ? 2.668   29.027  80.919  1.00 45.56  ? 212 LYS B CB  1 
ATOM   6583 C CG  . LYS D 2 212 ? 3.742   28.332  80.103  1.00 50.63  ? 212 LYS B CG  1 
ATOM   6584 C CD  . LYS D 2 212 ? 4.023   29.105  78.814  1.00 59.13  ? 212 LYS B CD  1 
ATOM   6585 C CE  . LYS D 2 212 ? 5.350   29.855  78.873  1.00 59.85  ? 212 LYS B CE  1 
ATOM   6586 N NZ  . LYS D 2 212 ? 6.234   29.509  77.721  1.00 60.94  ? 212 LYS B NZ  1 
ATOM   6587 N N   . VAL D 2 213 ? 1.572   26.992  83.575  1.00 35.41  ? 213 VAL B N   1 
ATOM   6588 C CA  . VAL D 2 213 ? 1.548   26.962  85.034  1.00 34.77  ? 213 VAL B CA  1 
ATOM   6589 C C   . VAL D 2 213 ? 2.614   26.046  85.630  1.00 34.22  ? 213 VAL B C   1 
ATOM   6590 O O   . VAL D 2 213 ? 2.817   24.924  85.168  1.00 34.05  ? 213 VAL B O   1 
ATOM   6591 C CB  . VAL D 2 213 ? 0.148   26.526  85.576  1.00 38.46  ? 213 VAL B CB  1 
ATOM   6592 C CG1 . VAL D 2 213 ? -0.608  25.754  84.515  1.00 40.04  ? 213 VAL B CG1 1 
ATOM   6593 C CG2 . VAL D 2 213 ? 0.304   25.687  86.855  1.00 38.98  ? 213 VAL B CG2 1 
ATOM   6594 N N   . ASP D 2 214 ? 3.294   26.539  86.659  1.00 31.93  ? 214 ASP B N   1 
ATOM   6595 C CA  . ASP D 2 214 ? 4.319   25.764  87.347  1.00 30.85  ? 214 ASP B CA  1 
ATOM   6596 C C   . ASP D 2 214 ? 3.776   25.444  88.730  1.00 30.73  ? 214 ASP B C   1 
ATOM   6597 O O   . ASP D 2 214 ? 3.405   26.336  89.483  1.00 34.70  ? 214 ASP B O   1 
ATOM   6598 C CB  . ASP D 2 214 ? 5.605   26.572  87.463  1.00 30.64  ? 214 ASP B CB  1 
ATOM   6599 C CG  . ASP D 2 214 ? 6.118   27.022  86.124  1.00 31.13  ? 214 ASP B CG  1 
ATOM   6600 O OD1 . ASP D 2 214 ? 6.599   26.161  85.362  1.00 36.06  ? 214 ASP B OD1 1 
ATOM   6601 O OD2 . ASP D 2 214 ? 6.034   28.233  85.835  1.00 36.39  ? 214 ASP B OD2 1 
ATOM   6602 N N   . LYS D 2 215 ? 3.726   24.162  89.059  1.00 32.97  ? 215 LYS B N   1 
ATOM   6603 C CA  . LYS D 2 215 ? 3.187   23.740  90.334  1.00 34.14  ? 215 LYS B CA  1 
ATOM   6604 C C   . LYS D 2 215 ? 4.209   23.003  91.178  1.00 32.26  ? 215 LYS B C   1 
ATOM   6605 O O   . LYS D 2 215 ? 4.742   21.974  90.763  1.00 25.39  ? 215 LYS B O   1 
ATOM   6606 C CB  . LYS D 2 215 ? 1.982   22.829  90.105  1.00 33.50  ? 215 LYS B CB  1 
ATOM   6607 C CG  . LYS D 2 215 ? 0.690   23.338  90.727  1.00 42.22  ? 215 LYS B CG  1 
ATOM   6608 C CD  . LYS D 2 215 ? 0.378   22.618  92.018  1.00 40.48  ? 215 LYS B CD  1 
ATOM   6609 C CE  . LYS D 2 215 ? -1.049  22.899  92.462  1.00 50.55  ? 215 LYS B CE  1 
ATOM   6610 N NZ  . LYS D 2 215 ? -1.591  24.192  91.938  1.00 56.19  ? 215 LYS B NZ  1 
ATOM   6611 N N   . LYS D 2 216 ? 4.460   23.539  92.366  1.00 29.29  ? 216 LYS B N   1 
ATOM   6612 C CA  . LYS D 2 216 ? 5.383   22.943  93.305  1.00 32.06  ? 216 LYS B CA  1 
ATOM   6613 C C   . LYS D 2 216 ? 4.618   21.847  94.037  1.00 35.24  ? 216 LYS B C   1 
ATOM   6614 O O   . LYS D 2 216 ? 3.485   22.067  94.479  1.00 32.06  ? 216 LYS B O   1 
ATOM   6615 C CB  . LYS D 2 216 ? 5.875   23.997  94.298  1.00 32.12  ? 216 LYS B CB  1 
ATOM   6616 C CG  . LYS D 2 216 ? 7.267   23.729  94.855  1.00 35.54  ? 216 LYS B CG  1 
ATOM   6617 C CD  . LYS D 2 216 ? 7.228   23.440  96.345  1.00 39.66  ? 216 LYS B CD  1 
ATOM   6618 C CE  . LYS D 2 216 ? 8.415   24.053  97.064  1.00 40.57  ? 216 LYS B CE  1 
ATOM   6619 N NZ  . LYS D 2 216 ? 7.982   25.041  98.087  1.00 44.79  ? 216 LYS B NZ  1 
ATOM   6620 N N   . VAL D 2 217 ? 5.240   20.675  94.162  1.00 33.67  ? 217 VAL B N   1 
ATOM   6621 C CA  . VAL D 2 217 ? 4.617   19.525  94.817  1.00 35.74  ? 217 VAL B CA  1 
ATOM   6622 C C   . VAL D 2 217 ? 5.374   19.108  96.070  1.00 41.57  ? 217 VAL B C   1 
ATOM   6623 O O   . VAL D 2 217 ? 4.985   19.526  97.194  1.00 44.10  ? 217 VAL B O   1 
ATOM   6624 C CB  . VAL D 2 217 ? 4.572   18.325  93.850  1.00 35.14  ? 217 VAL B CB  1 
ATOM   6625 C CG1 . VAL D 2 217 ? 3.579   17.288  94.333  1.00 30.30  ? 217 VAL B CG1 1 
ATOM   6626 C CG2 . VAL D 2 217 ? 4.208   18.814  92.445  1.00 37.13  ? 217 VAL B CG2 1 
HETATM 6627 O O   . HOH E 3 .   ? 22.967  -19.114 -14.306 1.00 23.93  ? 218 HOH L O   1 
HETATM 6628 O O   . HOH E 3 .   ? 37.732  -13.372 5.155   1.00 26.60  ? 219 HOH L O   1 
HETATM 6629 O O   . HOH E 3 .   ? 8.551   -2.267  20.956  1.00 29.38  ? 220 HOH L O   1 
HETATM 6630 O O   . HOH E 3 .   ? 16.327  -13.402 -2.350  1.00 39.82  ? 221 HOH L O   1 
HETATM 6631 O O   . HOH E 3 .   ? 29.259  -1.889  11.423  1.00 26.76  ? 222 HOH L O   1 
HETATM 6632 O O   . HOH E 3 .   ? 11.088  -8.354  -10.455 1.00 31.28  ? 223 HOH L O   1 
HETATM 6633 O O   . HOH E 3 .   ? 27.133  -1.819  -8.583  1.00 29.25  ? 224 HOH L O   1 
HETATM 6634 O O   . HOH E 3 .   ? 22.140  -3.987  1.573   1.00 44.77  ? 225 HOH L O   1 
HETATM 6635 O O   . HOH E 3 .   ? 30.095  -3.040  14.306  1.00 24.54  ? 226 HOH L O   1 
HETATM 6636 O O   . HOH E 3 .   ? 19.276  -3.319  5.926   1.00 36.75  ? 227 HOH L O   1 
HETATM 6637 O O   . HOH E 3 .   ? 4.725   -16.733 -19.814 1.00 22.02  ? 228 HOH L O   1 
HETATM 6638 O O   . HOH E 3 .   ? 16.911  3.028   16.477  1.00 19.88  ? 229 HOH L O   1 
HETATM 6639 O O   . HOH E 3 .   ? 23.520  -4.654  7.373   1.00 36.47  ? 230 HOH L O   1 
HETATM 6640 O O   . HOH E 3 .   ? 39.338  -13.515 -12.591 1.00 23.88  ? 231 HOH L O   1 
HETATM 6641 O O   . HOH E 3 .   ? 23.943  0.273   30.137  1.00 27.80  ? 232 HOH L O   1 
HETATM 6642 O O   . HOH E 3 .   ? 24.337  -3.376  -2.614  1.00 38.41  ? 233 HOH L O   1 
HETATM 6643 O O   . HOH E 3 .   ? 29.682  -19.524 -16.764 1.00 28.14  ? 234 HOH L O   1 
HETATM 6644 O O   . HOH E 3 .   ? 17.077  12.603  24.982  1.00 23.04  ? 235 HOH L O   1 
HETATM 6645 O O   . HOH E 3 .   ? 33.201  -7.402  -9.435  1.00 28.25  ? 236 HOH L O   1 
HETATM 6646 O O   . HOH E 3 .   ? 26.754  -5.283  5.393   1.00 38.60  ? 237 HOH L O   1 
HETATM 6647 O O   . HOH E 3 .   ? 35.017  -6.684  6.809   1.00 44.27  ? 238 HOH L O   1 
HETATM 6648 O O   . HOH E 3 .   ? 16.946  -9.247  -17.877 1.00 44.40  ? 239 HOH L O   1 
HETATM 6649 O O   . HOH E 3 .   ? 24.688  -19.376 -24.841 1.00 41.17  ? 240 HOH L O   1 
HETATM 6650 O O   . HOH E 3 .   ? 14.530  -14.203 -4.384  1.00 38.15  ? 241 HOH L O   1 
HETATM 6651 O O   . HOH E 3 .   ? 25.387  5.672   -8.488  1.00 34.06  ? 242 HOH L O   1 
HETATM 6652 O O   . HOH E 3 .   ? 2.832   -4.303  17.121  1.00 44.16  ? 243 HOH L O   1 
HETATM 6653 O O   . HOH E 3 .   ? 17.671  7.867   24.848  1.00 35.25  ? 244 HOH L O   1 
HETATM 6654 O O   . HOH E 3 .   ? 31.385  -6.865  21.249  1.00 37.98  ? 245 HOH L O   1 
HETATM 6655 O O   . HOH E 3 .   ? 26.600  -6.048  27.712  1.00 37.27  ? 246 HOH L O   1 
HETATM 6656 O O   . HOH E 3 .   ? 14.888  -6.739  17.503  1.00 33.56  ? 247 HOH L O   1 
HETATM 6657 O O   . HOH E 3 .   ? 38.840  -6.689  -4.629  1.00 39.36  ? 248 HOH L O   1 
HETATM 6658 O O   . HOH E 3 .   ? 11.001  -8.300  37.761  1.00 30.29  ? 249 HOH L O   1 
HETATM 6659 O O   . HOH E 3 .   ? 31.787  -17.412 -20.831 1.00 39.17  ? 250 HOH L O   1 
HETATM 6660 O O   . HOH E 3 .   ? 14.547  -27.629 -13.798 1.00 57.82  ? 251 HOH L O   1 
HETATM 6661 O O   . HOH E 3 .   ? 6.651   -12.690 -15.383 1.00 37.53  ? 252 HOH L O   1 
HETATM 6662 O O   . HOH E 3 .   ? 33.119  -5.502  -17.312 1.00 48.33  ? 253 HOH L O   1 
HETATM 6663 O O   . HOH E 3 .   ? 21.654  -3.848  4.385   1.00 80.89  ? 254 HOH L O   1 
HETATM 6664 O O   . HOH E 3 .   ? 14.803  -8.009  -7.169  1.00 58.63  ? 255 HOH L O   1 
HETATM 6665 O O   . HOH E 3 .   ? 8.547   -19.269 -25.282 1.00 66.81  ? 256 HOH L O   1 
HETATM 6666 O O   . HOH E 3 .   ? 10.446  -12.923 -5.592  1.00 31.74  ? 257 HOH L O   1 
HETATM 6667 O O   . HOH E 3 .   ? 19.428  -7.976  12.722  1.00 34.75  ? 258 HOH L O   1 
HETATM 6668 O O   . HOH E 3 .   ? 31.448  0.872   11.002  1.00 40.22  ? 259 HOH L O   1 
HETATM 6669 O O   . HOH E 3 .   ? 17.889  6.269   17.506  1.00 32.82  ? 260 HOH L O   1 
HETATM 6670 O O   . HOH E 3 .   ? 14.228  -8.073  30.571  1.00 35.12  ? 261 HOH L O   1 
HETATM 6671 O O   . HOH E 3 .   ? 10.830  -4.152  32.959  1.00 41.29  ? 262 HOH L O   1 
HETATM 6672 O O   . HOH E 3 .   ? 25.482  -4.781  0.085   1.00 31.89  ? 263 HOH L O   1 
HETATM 6673 O O   . HOH E 3 .   ? 10.389  -10.818 -21.019 1.00 29.93  ? 264 HOH L O   1 
HETATM 6674 O O   . HOH E 3 .   ? 32.919  -4.523  -2.953  1.00 41.40  ? 265 HOH L O   1 
HETATM 6675 O O   . HOH E 3 .   ? 17.445  -10.068 14.228  1.00 40.88  ? 266 HOH L O   1 
HETATM 6676 O O   . HOH F 3 .   ? 14.701  12.566  2.684   1.00 23.71  ? 220 HOH H O   1 
HETATM 6677 O O   . HOH F 3 .   ? 8.508   12.039  5.161   1.00 26.54  ? 221 HOH H O   1 
HETATM 6678 O O   . HOH F 3 .   ? 6.302   4.194   -8.325  1.00 17.48  ? 222 HOH H O   1 
HETATM 6679 O O   . HOH F 3 .   ? 20.161  13.424  -17.830 1.00 27.59  ? 223 HOH H O   1 
HETATM 6680 O O   . HOH F 3 .   ? 10.409  10.894  3.445   1.00 23.85  ? 224 HOH H O   1 
HETATM 6681 O O   . HOH F 3 .   ? 8.439   12.697  14.923  1.00 22.64  ? 225 HOH H O   1 
HETATM 6682 O O   . HOH F 3 .   ? 39.116  13.570  20.027  1.00 24.04  ? 226 HOH H O   1 
HETATM 6683 O O   . HOH F 3 .   ? 29.471  5.214   11.217  1.00 27.68  ? 227 HOH H O   1 
HETATM 6684 O O   . HOH F 3 .   ? 11.857  7.049   -21.443 1.00 21.38  ? 228 HOH H O   1 
HETATM 6685 O O   . HOH F 3 .   ? 27.267  11.276  9.089   1.00 31.85  ? 229 HOH H O   1 
HETATM 6686 O O   . HOH F 3 .   ? 9.315   9.002   1.503   1.00 31.42  ? 230 HOH H O   1 
HETATM 6687 O O   . HOH F 3 .   ? 38.509  8.795   23.137  1.00 25.85  ? 231 HOH H O   1 
HETATM 6688 O O   . HOH F 3 .   ? 19.513  10.493  -6.962  1.00 18.52  ? 232 HOH H O   1 
HETATM 6689 O O   . HOH F 3 .   ? 6.940   9.843   2.360   1.00 29.65  ? 233 HOH H O   1 
HETATM 6690 O O   . HOH F 3 .   ? 15.024  12.133  -3.147  1.00 31.45  ? 234 HOH H O   1 
HETATM 6691 O O   . HOH F 3 .   ? 9.873   -6.806  -12.370 1.00 31.21  ? 235 HOH H O   1 
HETATM 6692 O O   . HOH F 3 .   ? 32.724  14.695  27.197  1.00 33.09  ? 236 HOH H O   1 
HETATM 6693 O O   . HOH F 3 .   ? 5.971   7.732   7.845   1.00 30.25  ? 237 HOH H O   1 
HETATM 6694 O O   . HOH F 3 .   ? 6.208   10.674  4.649   1.00 26.35  ? 238 HOH H O   1 
HETATM 6695 O O   . HOH F 3 .   ? 2.610   10.371  14.161  1.00 28.04  ? 239 HOH H O   1 
HETATM 6696 O O   . HOH F 3 .   ? -5.015  9.416   -6.342  1.00 22.52  ? 240 HOH H O   1 
HETATM 6697 O O   . HOH F 3 .   ? -2.641  16.612  -8.190  1.00 35.54  ? 241 HOH H O   1 
HETATM 6698 O O   . HOH F 3 .   ? 18.268  5.802   5.832   1.00 34.49  ? 242 HOH H O   1 
HETATM 6699 O O   . HOH F 3 .   ? 12.961  8.515   18.248  1.00 40.02  ? 243 HOH H O   1 
HETATM 6700 O O   . HOH F 3 .   ? 0.330   15.118  -11.223 1.00 49.04  ? 244 HOH H O   1 
HETATM 6701 O O   . HOH F 3 .   ? 18.773  3.328   -25.736 1.00 24.14  ? 245 HOH H O   1 
HETATM 6702 O O   . HOH F 3 .   ? -4.078  13.432  -6.036  1.00 27.19  ? 246 HOH H O   1 
HETATM 6703 O O   . HOH F 3 .   ? 8.241   11.787  -20.168 1.00 23.67  ? 247 HOH H O   1 
HETATM 6704 O O   . HOH F 3 .   ? 1.117   11.013  4.326   1.00 27.40  ? 248 HOH H O   1 
HETATM 6705 O O   . HOH F 3 .   ? 11.778  12.721  -30.479 1.00 29.59  ? 249 HOH H O   1 
HETATM 6706 O O   . HOH F 3 .   ? 8.296   3.539   -1.560  1.00 32.14  ? 250 HOH H O   1 
HETATM 6707 O O   . HOH F 3 .   ? 25.470  -0.859  -15.770 1.00 29.26  ? 251 HOH H O   1 
HETATM 6708 O O   . HOH F 3 .   ? 36.726  5.529   20.736  1.00 40.79  ? 252 HOH H O   1 
HETATM 6709 O O   . HOH F 3 .   ? -1.822  5.953   -2.003  1.00 18.57  ? 253 HOH H O   1 
HETATM 6710 O O   . HOH F 3 .   ? 29.547  9.633   11.195  1.00 24.30  ? 254 HOH H O   1 
HETATM 6711 O O   . HOH F 3 .   ? 1.572   -0.430  -22.429 1.00 18.31  ? 255 HOH H O   1 
HETATM 6712 O O   . HOH F 3 .   ? 13.129  16.921  -17.204 1.00 47.01  ? 256 HOH H O   1 
HETATM 6713 O O   . HOH F 3 .   ? 12.569  -5.027  -22.055 1.00 31.09  ? 257 HOH H O   1 
HETATM 6714 O O   . HOH F 3 .   ? 6.748   -5.043  -12.954 1.00 30.28  ? 258 HOH H O   1 
HETATM 6715 O O   . HOH F 3 .   ? 12.539  3.778   8.414   1.00 28.53  ? 259 HOH H O   1 
HETATM 6716 O O   . HOH F 3 .   ? 7.963   19.840  -4.932  1.00 26.02  ? 260 HOH H O   1 
HETATM 6717 O O   . HOH F 3 .   ? 20.459  7.872   7.166   1.00 32.04  ? 261 HOH H O   1 
HETATM 6718 O O   . HOH F 3 .   ? 17.158  26.063  4.907   1.00 63.52  ? 262 HOH H O   1 
HETATM 6719 O O   . HOH F 3 .   ? 2.879   7.014   -22.592 1.00 36.12  ? 263 HOH H O   1 
HETATM 6720 O O   . HOH F 3 .   ? 7.044   8.334   -27.777 1.00 22.65  ? 264 HOH H O   1 
HETATM 6721 O O   . HOH F 3 .   ? 12.661  16.270  18.733  1.00 24.93  ? 265 HOH H O   1 
HETATM 6722 O O   . HOH F 3 .   ? 7.798   -0.250  -26.584 1.00 20.10  ? 266 HOH H O   1 
HETATM 6723 O O   . HOH F 3 .   ? 15.850  14.469  -11.750 1.00 26.04  ? 267 HOH H O   1 
HETATM 6724 O O   . HOH F 3 .   ? 10.516  17.476  -12.212 1.00 29.13  ? 268 HOH H O   1 
HETATM 6725 O O   . HOH F 3 .   ? 8.673   10.464  -27.317 1.00 27.49  ? 269 HOH H O   1 
HETATM 6726 O O   . HOH F 3 .   ? 15.470  3.141   -3.095  1.00 46.41  ? 270 HOH H O   1 
HETATM 6727 O O   . HOH F 3 .   ? 13.974  -3.806  -24.223 1.00 25.85  ? 271 HOH H O   1 
HETATM 6728 O O   . HOH F 3 .   ? 7.247   4.954   0.868   1.00 30.57  ? 272 HOH H O   1 
HETATM 6729 O O   . HOH F 3 .   ? 8.635   19.064  8.860   1.00 44.81  ? 273 HOH H O   1 
HETATM 6730 O O   . HOH F 3 .   ? 28.680  16.934  10.632  1.00 41.63  ? 274 HOH H O   1 
HETATM 6731 O O   . HOH F 3 .   ? 23.232  4.918   -26.249 1.00 36.26  ? 275 HOH H O   1 
HETATM 6732 O O   . HOH F 3 .   ? 24.550  11.074  5.371   1.00 31.71  ? 276 HOH H O   1 
HETATM 6733 O O   . HOH F 3 .   ? 33.918  11.964  13.594  1.00 21.88  ? 277 HOH H O   1 
HETATM 6734 O O   . HOH F 3 .   ? 1.369   4.728   -17.551 1.00 24.31  ? 278 HOH H O   1 
HETATM 6735 O O   . HOH F 3 .   ? 14.469  22.389  14.939  1.00 36.87  ? 279 HOH H O   1 
HETATM 6736 O O   . HOH F 3 .   ? 2.407   12.349  2.198   1.00 24.89  ? 280 HOH H O   1 
HETATM 6737 O O   . HOH F 3 .   ? 39.462  11.418  21.049  1.00 45.36  ? 281 HOH H O   1 
HETATM 6738 O O   . HOH F 3 .   ? 8.694   -13.445 -27.429 1.00 52.55  ? 282 HOH H O   1 
HETATM 6739 O O   . HOH F 3 .   ? 22.025  10.441  7.041   1.00 43.46  ? 283 HOH H O   1 
HETATM 6740 O O   . HOH F 3 .   ? 10.991  -1.869  -5.722  1.00 29.51  ? 284 HOH H O   1 
HETATM 6741 O O   . HOH F 3 .   ? 9.504   14.645  -23.276 1.00 62.77  ? 285 HOH H O   1 
HETATM 6742 O O   . HOH F 3 .   ? 26.051  -3.235  -16.417 1.00 57.51  ? 286 HOH H O   1 
HETATM 6743 O O   . HOH F 3 .   ? 2.284   -7.146  -9.089  1.00 48.71  ? 287 HOH H O   1 
HETATM 6744 O O   . HOH F 3 .   ? 31.952  0.953   18.558  1.00 39.96  ? 288 HOH H O   1 
HETATM 6745 O O   . HOH F 3 .   ? 38.780  6.772   21.699  1.00 39.81  ? 289 HOH H O   1 
HETATM 6746 O O   . HOH F 3 .   ? 18.564  1.932   -5.077  1.00 57.21  ? 290 HOH H O   1 
HETATM 6747 O O   . HOH F 3 .   ? 22.262  12.988  -29.110 1.00 46.24  ? 291 HOH H O   1 
HETATM 6748 O O   . HOH F 3 .   ? 8.474   17.556  0.765   1.00 40.83  ? 292 HOH H O   1 
HETATM 6749 O O   . HOH F 3 .   ? 5.425   14.817  7.917   1.00 46.91  ? 293 HOH H O   1 
HETATM 6750 O O   . HOH F 3 .   ? 19.093  20.458  19.362  1.00 49.61  ? 294 HOH H O   1 
HETATM 6751 O O   . HOH F 3 .   ? 25.518  -1.109  -21.951 1.00 37.84  ? 295 HOH H O   1 
HETATM 6752 O O   . HOH F 3 .   ? 3.720   -4.616  -13.101 1.00 26.81  ? 296 HOH H O   1 
HETATM 6753 O O   . HOH F 3 .   ? 20.867  5.793   -32.781 1.00 33.10  ? 297 HOH H O   1 
HETATM 6754 O O   . HOH F 3 .   ? 28.830  8.118   8.656   1.00 37.37  ? 298 HOH H O   1 
HETATM 6755 O O   . HOH F 3 .   ? 23.677  9.284   39.019  1.00 36.48  ? 299 HOH H O   1 
HETATM 6756 O O   . HOH F 3 .   ? 27.224  1.120   -15.842 1.00 40.82  ? 300 HOH H O   1 
HETATM 6757 O O   . HOH F 3 .   ? 8.451   11.041  18.020  1.00 30.08  ? 301 HOH H O   1 
HETATM 6758 O O   . HOH F 3 .   ? 21.248  10.476  27.821  1.00 41.32  ? 302 HOH H O   1 
HETATM 6759 O O   . HOH F 3 .   ? 23.693  14.270  -24.757 1.00 39.15  ? 303 HOH H O   1 
HETATM 6760 O O   . HOH F 3 .   ? 3.646   -6.261  -16.553 1.00 33.71  ? 304 HOH H O   1 
HETATM 6761 O O   . HOH F 3 .   ? 12.645  20.691  -12.063 1.00 41.26  ? 305 HOH H O   1 
HETATM 6762 O O   . HOH G 3 .   ? 6.885   2.120   82.545  1.00 14.72  ? 218 HOH A O   1 
HETATM 6763 O O   . HOH G 3 .   ? -13.360 -1.727  55.851  1.00 17.72  ? 219 HOH A O   1 
HETATM 6764 O O   . HOH G 3 .   ? -5.893  13.541  93.426  1.00 20.97  ? 220 HOH A O   1 
HETATM 6765 O O   . HOH G 3 .   ? 0.517   4.787   98.321  1.00 30.95  ? 221 HOH A O   1 
HETATM 6766 O O   . HOH G 3 .   ? -6.476  8.618   84.293  1.00 29.38  ? 222 HOH A O   1 
HETATM 6767 O O   . HOH G 3 .   ? -12.014 -3.291  57.911  1.00 31.00  ? 223 HOH A O   1 
HETATM 6768 O O   . HOH G 3 .   ? -4.894  -5.070  81.180  1.00 42.42  ? 224 HOH A O   1 
HETATM 6769 O O   . HOH G 3 .   ? 6.245   3.417   80.011  1.00 23.45  ? 225 HOH A O   1 
HETATM 6770 O O   . HOH G 3 .   ? 0.624   1.054   75.671  1.00 27.90  ? 226 HOH A O   1 
HETATM 6771 O O   . HOH G 3 .   ? -20.739 -7.175  52.454  1.00 35.36  ? 227 HOH A O   1 
HETATM 6772 O O   . HOH G 3 .   ? 3.581   -0.096  73.771  1.00 35.88  ? 228 HOH A O   1 
HETATM 6773 O O   . HOH G 3 .   ? -6.932  -8.278  66.261  1.00 19.06  ? 229 HOH A O   1 
HETATM 6774 O O   . HOH G 3 .   ? 6.489   -13.949 51.186  1.00 24.40  ? 230 HOH A O   1 
HETATM 6775 O O   . HOH G 3 .   ? -5.832  -3.759  51.022  1.00 35.05  ? 231 HOH A O   1 
HETATM 6776 O O   . HOH G 3 .   ? -6.336  16.258  93.155  1.00 27.43  ? 232 HOH A O   1 
HETATM 6777 O O   . HOH G 3 .   ? 14.446  -8.040  72.962  1.00 28.81  ? 233 HOH A O   1 
HETATM 6778 O O   . HOH G 3 .   ? 8.590   5.543   79.574  1.00 27.79  ? 234 HOH A O   1 
HETATM 6779 O O   . HOH G 3 .   ? -8.517  -2.978  85.750  1.00 43.69  ? 235 HOH A O   1 
HETATM 6780 O O   . HOH G 3 .   ? 2.320   -0.102  68.401  1.00 40.19  ? 236 HOH A O   1 
HETATM 6781 O O   . HOH G 3 .   ? -13.169 0.231   90.244  1.00 38.44  ? 237 HOH A O   1 
HETATM 6782 O O   . HOH G 3 .   ? -14.649 2.689   88.905  1.00 26.82  ? 238 HOH A O   1 
HETATM 6783 O O   . HOH G 3 .   ? -0.088  -14.365 53.947  1.00 27.44  ? 239 HOH A O   1 
HETATM 6784 O O   . HOH G 3 .   ? 16.054  -8.369  55.661  1.00 28.53  ? 240 HOH A O   1 
HETATM 6785 O O   . HOH G 3 .   ? 9.337   -13.777 84.188  1.00 29.01  ? 241 HOH A O   1 
HETATM 6786 O O   . HOH G 3 .   ? 0.801   1.588   66.255  1.00 44.55  ? 242 HOH A O   1 
HETATM 6787 O O   . HOH G 3 .   ? 14.199  2.003   83.951  1.00 31.41  ? 243 HOH A O   1 
HETATM 6788 O O   . HOH G 3 .   ? 8.052   -2.508  89.200  1.00 33.91  ? 244 HOH A O   1 
HETATM 6789 O O   . HOH G 3 .   ? 9.034   -0.290  50.919  1.00 34.26  ? 245 HOH A O   1 
HETATM 6790 O O   . HOH G 3 .   ? 11.403  -1.519  74.955  1.00 37.85  ? 246 HOH A O   1 
HETATM 6791 O O   . HOH G 3 .   ? 8.976   5.249   86.679  1.00 46.56  ? 247 HOH A O   1 
HETATM 6792 O O   . HOH G 3 .   ? -0.546  -15.957 92.778  1.00 39.30  ? 248 HOH A O   1 
HETATM 6793 O O   . HOH G 3 .   ? 10.851  2.809   63.699  1.00 41.91  ? 249 HOH A O   1 
HETATM 6794 O O   . HOH G 3 .   ? -19.795 3.220   99.346  1.00 39.01  ? 250 HOH A O   1 
HETATM 6795 O O   . HOH G 3 .   ? -8.851  -9.068  64.443  1.00 40.30  ? 251 HOH A O   1 
HETATM 6796 O O   . HOH G 3 .   ? 1.509   -14.539 44.194  1.00 43.25  ? 252 HOH A O   1 
HETATM 6797 O O   . HOH G 3 .   ? -3.392  -2.374  80.411  1.00 42.70  ? 253 HOH A O   1 
HETATM 6798 O O   . HOH G 3 .   ? -3.887  0.254   74.959  1.00 41.44  ? 254 HOH A O   1 
HETATM 6799 O O   . HOH G 3 .   ? 8.378   -11.711 47.613  1.00 32.06  ? 255 HOH A O   1 
HETATM 6800 O O   . HOH G 3 .   ? 15.862  -11.845 49.196  1.00 22.63  ? 256 HOH A O   1 
HETATM 6801 O O   . HOH G 3 .   ? -4.958  10.505  86.371  1.00 43.44  ? 257 HOH A O   1 
HETATM 6802 O O   . HOH G 3 .   ? -20.045 3.350   96.682  1.00 36.39  ? 258 HOH A O   1 
HETATM 6803 O O   . HOH G 3 .   ? -13.876 -1.162  88.378  1.00 53.34  ? 259 HOH A O   1 
HETATM 6804 O O   . HOH G 3 .   ? 10.502  -2.869  59.349  1.00 42.62  ? 260 HOH A O   1 
HETATM 6805 O O   . HOH G 3 .   ? 3.648   -0.910  96.055  1.00 64.76  ? 261 HOH A O   1 
HETATM 6806 O O   . HOH G 3 .   ? 0.827   -12.821 74.956  1.00 45.51  ? 262 HOH A O   1 
HETATM 6807 O O   . HOH G 3 .   ? 4.950   -2.049  70.072  1.00 53.51  ? 263 HOH A O   1 
HETATM 6808 O O   . HOH G 3 .   ? -1.122  -9.584  84.646  1.00 37.71  ? 264 HOH A O   1 
HETATM 6809 O O   . HOH G 3 .   ? -19.564 7.148   92.013  1.00 74.96  ? 265 HOH A O   1 
HETATM 6810 O O   . HOH G 3 .   ? -12.595 -13.754 60.817  1.00 31.11  ? 266 HOH A O   1 
HETATM 6811 O O   . HOH G 3 .   ? 3.863   3.046   59.804  1.00 23.56  ? 267 HOH A O   1 
HETATM 6812 O O   . HOH G 3 .   ? 15.564  -1.402  63.957  1.00 39.13  ? 268 HOH A O   1 
HETATM 6813 O O   . HOH G 3 .   ? -6.825  12.180  103.031 1.00 41.47  ? 269 HOH A O   1 
HETATM 6814 O O   . HOH G 3 .   ? -1.054  8.847   99.859  1.00 35.33  ? 270 HOH A O   1 
HETATM 6815 O O   . HOH G 3 .   ? -0.813  6.586   63.648  1.00 34.89  ? 271 HOH A O   1 
HETATM 6816 O O   . HOH H 3 .   ? -17.010 9.972   60.201  1.00 22.95  ? 220 HOH B O   1 
HETATM 6817 O O   . HOH H 3 .   ? 15.799  17.657  89.065  1.00 30.30  ? 221 HOH B O   1 
HETATM 6818 O O   . HOH H 3 .   ? -9.219  2.011   44.298  1.00 19.26  ? 222 HOH B O   1 
HETATM 6819 O O   . HOH H 3 .   ? -22.797 20.626  57.679  1.00 34.50  ? 223 HOH B O   1 
HETATM 6820 O O   . HOH H 3 .   ? -11.800 12.272  46.805  1.00 28.90  ? 224 HOH B O   1 
HETATM 6821 O O   . HOH H 3 .   ? -13.002 16.068  71.890  1.00 28.81  ? 225 HOH B O   1 
HETATM 6822 O O   . HOH H 3 .   ? -7.239  10.286  65.530  1.00 27.82  ? 226 HOH B O   1 
HETATM 6823 O O   . HOH H 3 .   ? -14.711 17.652  83.718  1.00 31.87  ? 227 HOH B O   1 
HETATM 6824 O O   . HOH H 3 .   ? -15.165 15.251  41.336  1.00 31.24  ? 228 HOH B O   1 
HETATM 6825 O O   . HOH H 3 .   ? -8.589  18.255  71.229  1.00 28.98  ? 229 HOH B O   1 
HETATM 6826 O O   . HOH H 3 .   ? -25.843 21.308  59.865  1.00 35.98  ? 230 HOH B O   1 
HETATM 6827 O O   . HOH H 3 .   ? -13.672 14.066  70.340  1.00 37.08  ? 231 HOH B O   1 
HETATM 6828 O O   . HOH H 3 .   ? -15.581 16.423  48.443  1.00 19.55  ? 232 HOH B O   1 
HETATM 6829 O O   . HOH H 3 .   ? 4.138   17.935  99.234  1.00 39.39  ? 233 HOH B O   1 
HETATM 6830 O O   . HOH H 3 .   ? -28.296 14.610  62.400  1.00 29.48  ? 234 HOH B O   1 
HETATM 6831 O O   . HOH H 3 .   ? 18.722  17.720  96.156  1.00 71.98  ? 235 HOH B O   1 
HETATM 6832 O O   . HOH H 3 .   ? -5.256  10.757  74.555  1.00 30.40  ? 236 HOH B O   1 
HETATM 6833 O O   . HOH H 3 .   ? -22.847 13.474  49.461  1.00 49.79  ? 237 HOH B O   1 
HETATM 6834 O O   . HOH H 3 .   ? -17.406 12.851  76.363  1.00 45.92  ? 238 HOH B O   1 
HETATM 6835 O O   . HOH H 3 .   ? -8.834  5.539   39.166  1.00 25.44  ? 239 HOH B O   1 
HETATM 6836 O O   . HOH H 3 .   ? 6.392   7.662   80.013  1.00 21.42  ? 240 HOH B O   1 
HETATM 6837 O O   . HOH H 3 .   ? 9.108   20.189  95.878  1.00 31.44  ? 241 HOH B O   1 
HETATM 6838 O O   . HOH H 3 .   ? -3.884  16.109  61.006  1.00 20.58  ? 242 HOH B O   1 
HETATM 6839 O O   . HOH H 3 .   ? -7.059  7.695   65.341  1.00 25.65  ? 243 HOH B O   1 
HETATM 6840 O O   . HOH H 3 .   ? -9.304  21.206  52.038  1.00 36.77  ? 244 HOH B O   1 
HETATM 6841 O O   . HOH H 3 .   ? -21.838 11.731  70.698  1.00 17.75  ? 245 HOH B O   1 
HETATM 6842 O O   . HOH H 3 .   ? -16.960 16.121  73.224  1.00 24.98  ? 246 HOH B O   1 
HETATM 6843 O O   . HOH H 3 .   ? -14.523 8.876   66.977  1.00 26.29  ? 247 HOH B O   1 
HETATM 6844 O O   . HOH H 3 .   ? -16.157 14.735  70.927  1.00 42.24  ? 248 HOH B O   1 
HETATM 6845 O O   . HOH H 3 .   ? -9.024  29.025  79.995  1.00 22.83  ? 249 HOH B O   1 
HETATM 6846 O O   . HOH H 3 .   ? 13.888  10.246  89.432  1.00 32.00  ? 250 HOH B O   1 
HETATM 6847 O O   . HOH H 3 .   ? -14.066 -7.822  41.709  1.00 45.03  ? 251 HOH B O   1 
HETATM 6848 O O   . HOH H 3 .   ? -8.716  -2.516  61.571  1.00 41.29  ? 252 HOH B O   1 
HETATM 6849 O O   . HOH H 3 .   ? -21.725 4.670   46.230  1.00 27.88  ? 253 HOH B O   1 
HETATM 6850 O O   . HOH H 3 .   ? 15.580  13.583  92.521  1.00 56.85  ? 254 HOH B O   1 
HETATM 6851 O O   . HOH H 3 .   ? -11.025 24.241  58.060  1.00 48.54  ? 255 HOH B O   1 
HETATM 6852 O O   . HOH H 3 .   ? -25.577 16.184  55.077  1.00 28.58  ? 256 HOH B O   1 
HETATM 6853 O O   . HOH H 3 .   ? 6.701   17.417  50.579  1.00 45.15  ? 257 HOH B O   1 
HETATM 6854 O O   . HOH H 3 .   ? 10.317  25.999  82.860  1.00 37.49  ? 258 HOH B O   1 
HETATM 6855 O O   . HOH H 3 .   ? -19.587 24.437  58.351  1.00 24.60  ? 259 HOH B O   1 
HETATM 6856 O O   . HOH H 3 .   ? -14.554 17.454  73.565  1.00 22.98  ? 260 HOH B O   1 
HETATM 6857 O O   . HOH H 3 .   ? 6.382   14.770  80.206  1.00 23.51  ? 261 HOH B O   1 
HETATM 6858 O O   . HOH H 3 .   ? 10.896  17.383  82.608  1.00 33.09  ? 262 HOH B O   1 
HETATM 6859 O O   . HOH H 3 .   ? -24.568 16.583  64.214  1.00 36.20  ? 263 HOH B O   1 
HETATM 6860 O O   . HOH H 3 .   ? -8.309  17.536  65.559  1.00 37.94  ? 264 HOH B O   1 
HETATM 6861 O O   . HOH H 3 .   ? -12.248 3.401   63.138  1.00 35.59  ? 265 HOH B O   1 
HETATM 6862 O O   . HOH H 3 .   ? -10.491 20.730  87.453  1.00 40.96  ? 266 HOH B O   1 
HETATM 6863 O O   . HOH H 3 .   ? -4.585  9.065   42.858  1.00 30.17  ? 267 HOH B O   1 
HETATM 6864 O O   . HOH H 3 .   ? -14.119 20.220  45.745  1.00 32.81  ? 268 HOH B O   1 
HETATM 6865 O O   . HOH H 3 .   ? -1.506  15.654  75.841  1.00 30.76  ? 269 HOH B O   1 
HETATM 6866 O O   . HOH H 3 .   ? -7.637  19.599  56.635  1.00 31.04  ? 270 HOH B O   1 
HETATM 6867 O O   . HOH H 3 .   ? -4.579  7.491   63.051  1.00 52.96  ? 271 HOH B O   1 
HETATM 6868 O O   . HOH H 3 .   ? -21.915 9.749   51.335  1.00 30.39  ? 272 HOH B O   1 
HETATM 6869 O O   . HOH H 3 .   ? 0.404   12.912  76.709  1.00 43.13  ? 273 HOH B O   1 
HETATM 6870 O O   . HOH H 3 .   ? 9.102   27.896  84.308  1.00 52.78  ? 274 HOH B O   1 
HETATM 6871 O O   . HOH H 3 .   ? 0.197   23.003  74.355  1.00 33.42  ? 275 HOH B O   1 
HETATM 6872 O O   . HOH H 3 .   ? -20.864 12.289  46.188  1.00 43.45  ? 276 HOH B O   1 
HETATM 6873 O O   . HOH H 3 .   ? -4.166  25.712  88.004  1.00 31.95  ? 277 HOH B O   1 
HETATM 6874 O O   . HOH H 3 .   ? -12.851 22.900  56.615  1.00 37.89  ? 278 HOH B O   1 
HETATM 6875 O O   . HOH H 3 .   ? -3.172  18.996  50.777  1.00 30.23  ? 279 HOH B O   1 
HETATM 6876 O O   . HOH H 3 .   ? -25.805 17.941  66.300  1.00 51.52  ? 280 HOH B O   1 
HETATM 6877 O O   . HOH H 3 .   ? 6.614   10.165  79.755  1.00 23.57  ? 281 HOH B O   1 
HETATM 6878 O O   . HOH H 3 .   ? 4.662   16.292  78.023  1.00 63.01  ? 282 HOH B O   1 
HETATM 6879 O O   . HOH H 3 .   ? -26.777 14.396  54.110  1.00 50.64  ? 283 HOH B O   1 
HETATM 6880 O O   . HOH H 3 .   ? -15.834 6.239   65.699  1.00 62.07  ? 284 HOH B O   1 
HETATM 6881 O O   . HOH H 3 .   ? -2.706  12.814  75.027  1.00 59.16  ? 285 HOH B O   1 
HETATM 6882 O O   . HOH H 3 .   ? -27.151 19.006  63.152  1.00 35.08  ? 286 HOH B O   1 
HETATM 6883 O O   . HOH H 3 .   ? -15.087 22.772  69.967  1.00 27.90  ? 287 HOH B O   1 
HETATM 6884 O O   . HOH H 3 .   ? 10.630  17.928  98.424  1.00 34.80  ? 288 HOH B O   1 
HETATM 6885 O O   . HOH H 3 .   ? -15.725 26.311  63.435  1.00 39.18  ? 289 HOH B O   1 
HETATM 6886 O O   . HOH H 3 .   ? -21.659 -2.231  58.875  1.00 38.07  ? 290 HOH B O   1 
HETATM 6887 O O   . HOH H 3 .   ? -9.219  14.253  68.522  1.00 30.81  ? 291 HOH B O   1 
HETATM 6888 O O   . HOH H 3 .   ? -9.863  26.741  83.896  1.00 38.54  ? 292 HOH B O   1 
HETATM 6889 O O   . HOH H 3 .   ? 1.508   17.165  74.203  1.00 33.30  ? 293 HOH B O   1 
HETATM 6890 O O   . HOH H 3 .   ? 18.808  15.354  100.256 1.00 35.30  ? 294 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU L . n 
A 1 2   LEU 2   2   2   LEU LEU L . n 
A 1 3   VAL 3   3   3   VAL VAL L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   THR 7   7   7   THR THR L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   LEU 9   9   9   LEU LEU L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  PRO 12  12  12  PRO PRO L . n 
A 1 13  VAL 13  13  13  VAL VAL L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  LEU 15  15  15  LEU LEU L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  ASP 17  17  17  ASP ASP L . n 
A 1 18  GLN 18  18  18  GLN GLN L . n 
A 1 19  ALA 19  19  19  ALA ALA L . n 
A 1 20  SER 20  20  20  SER SER L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  ARG 24  24  24  ARG ARG L . n 
A 1 25  SER 25  25  25  SER SER L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  SER 28  28  28  SER SER L . n 
A 1 29  LEU 29  29  29  LEU LEU L . n 
A 1 30  VAL 30  30  30  VAL VAL L . n 
A 1 31  HIS 31  31  31  HIS HIS L . n 
A 1 32  SER 32  32  32  SER SER L . n 
A 1 33  ASN 33  33  33  ASN ASN L . n 
A 1 34  GLY 34  34  34  GLY GLY L . n 
A 1 35  ASN 35  35  35  ASN ASN L . n 
A 1 36  THR 36  36  36  THR THR L . n 
A 1 37  TYR 37  37  37  TYR TYR L . n 
A 1 38  LEU 38  38  38  LEU LEU L . n 
A 1 39  HIS 39  39  39  HIS HIS L . n 
A 1 40  TRP 40  40  40  TRP TRP L . n 
A 1 41  TYR 41  41  41  TYR TYR L . n 
A 1 42  LEU 42  42  42  LEU LEU L . n 
A 1 43  GLN 43  43  43  GLN GLN L . n 
A 1 44  LYS 44  44  44  LYS LYS L . n 
A 1 45  PRO 45  45  45  PRO PRO L . n 
A 1 46  GLY 46  46  46  GLY GLY L . n 
A 1 47  GLN 47  47  47  GLN GLN L . n 
A 1 48  SER 48  48  48  SER SER L . n 
A 1 49  PRO 49  49  49  PRO PRO L . n 
A 1 50  LYS 50  50  50  LYS LYS L . n 
A 1 51  LEU 51  51  51  LEU LEU L . n 
A 1 52  LEU 52  52  52  LEU LEU L . n 
A 1 53  ILE 53  53  53  ILE ILE L . n 
A 1 54  TYR 54  54  54  TYR TYR L . n 
A 1 55  LYS 55  55  55  LYS LYS L . n 
A 1 56  VAL 56  56  56  VAL VAL L . n 
A 1 57  SER 57  57  57  SER SER L . n 
A 1 58  ASN 58  58  58  ASN ASN L . n 
A 1 59  ARG 59  59  59  ARG ARG L . n 
A 1 60  PHE 60  60  60  PHE PHE L . n 
A 1 61  SER 61  61  61  SER SER L . n 
A 1 62  GLY 62  62  62  GLY GLY L . n 
A 1 63  VAL 63  63  63  VAL VAL L . n 
A 1 64  PRO 64  64  64  PRO PRO L . n 
A 1 65  ASP 65  65  65  ASP ASP L . n 
A 1 66  ARG 66  66  66  ARG ARG L . n 
A 1 67  PHE 67  67  67  PHE PHE L . n 
A 1 68  SER 68  68  68  SER SER L . n 
A 1 69  GLY 69  69  69  GLY GLY L . n 
A 1 70  SER 70  70  70  SER SER L . n 
A 1 71  GLY 71  71  71  GLY GLY L . n 
A 1 72  SER 72  72  72  SER SER L . n 
A 1 73  GLY 73  73  73  GLY GLY L . n 
A 1 74  THR 74  74  74  THR THR L . n 
A 1 75  ASP 75  75  75  ASP ASP L . n 
A 1 76  PHE 76  76  76  PHE PHE L . n 
A 1 77  THR 77  77  77  THR THR L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  LYS 79  79  79  LYS LYS L . n 
A 1 80  ILE 80  80  80  ILE ILE L . n 
A 1 81  SER 81  81  81  SER SER L . n 
A 1 82  ARG 82  82  82  ARG ARG L . n 
A 1 83  VAL 83  83  83  VAL VAL L . n 
A 1 84  GLU 84  84  84  GLU GLU L . n 
A 1 85  ALA 85  85  85  ALA ALA L . n 
A 1 86  GLU 86  86  86  GLU GLU L . n 
A 1 87  ASP 87  87  87  ASP ASP L . n 
A 1 88  LEU 88  88  88  LEU LEU L . n 
A 1 89  GLY 89  89  89  GLY GLY L . n 
A 1 90  VAL 90  90  90  VAL VAL L . n 
A 1 91  TYR 91  91  91  TYR TYR L . n 
A 1 92  PHE 92  92  92  PHE PHE L . n 
A 1 93  CYS 93  93  93  CYS CYS L . n 
A 1 94  SER 94  94  94  SER SER L . n 
A 1 95  GLN 95  95  95  GLN GLN L . n 
A 1 96  SER 96  96  96  SER SER L . n 
A 1 97  THR 97  97  97  THR THR L . n 
A 1 98  HIS 98  98  98  HIS HIS L . n 
A 1 99  VAL 99  99  99  VAL VAL L . n 
A 1 100 PRO 100 100 100 PRO PRO L . n 
A 1 101 PRO 101 101 101 PRO PRO L . n 
A 1 102 THR 102 102 102 THR THR L . n 
A 1 103 PHE 103 103 103 PHE PHE L . n 
A 1 104 GLY 104 104 104 GLY GLY L . n 
A 1 105 GLY 105 105 105 GLY GLY L . n 
A 1 106 GLY 106 106 106 GLY GLY L . n 
A 1 107 THR 107 107 107 THR THR L . n 
A 1 108 LYS 108 108 108 LYS LYS L . n 
A 1 109 LEU 109 109 109 LEU LEU L . n 
A 1 110 GLU 110 110 110 GLU GLU L . n 
A 1 111 ILE 111 111 111 ILE ILE L . n 
A 1 112 LYS 112 112 112 LYS LYS L . n 
A 1 113 ARG 113 113 113 ARG ARG L . n 
A 1 114 THR 114 114 114 THR THR L . n 
A 1 115 VAL 115 115 115 VAL VAL L . n 
A 1 116 ALA 116 116 116 ALA ALA L . n 
A 1 117 ALA 117 117 117 ALA ALA L . n 
A 1 118 PRO 118 118 118 PRO PRO L . n 
A 1 119 SER 119 119 119 SER SER L . n 
A 1 120 VAL 120 120 120 VAL VAL L . n 
A 1 121 PHE 121 121 121 PHE PHE L . n 
A 1 122 ILE 122 122 122 ILE ILE L . n 
A 1 123 PHE 123 123 123 PHE PHE L . n 
A 1 124 PRO 124 124 124 PRO PRO L . n 
A 1 125 PRO 125 125 125 PRO PRO L . n 
A 1 126 SER 126 126 126 SER SER L . n 
A 1 127 ASP 127 127 127 ASP ASP L . n 
A 1 128 GLU 128 128 128 GLU GLU L . n 
A 1 129 GLN 129 129 129 GLN GLN L . n 
A 1 130 LEU 130 130 130 LEU LEU L . n 
A 1 131 LYS 131 131 131 LYS LYS L . n 
A 1 132 SER 132 132 132 SER SER L . n 
A 1 133 GLY 133 133 133 GLY GLY L . n 
A 1 134 THR 134 134 134 THR THR L . n 
A 1 135 ALA 135 135 135 ALA ALA L . n 
A 1 136 SER 136 136 136 SER SER L . n 
A 1 137 VAL 137 137 137 VAL VAL L . n 
A 1 138 VAL 138 138 138 VAL VAL L . n 
A 1 139 CYS 139 139 139 CYS CYS L . n 
A 1 140 LEU 140 140 140 LEU LEU L . n 
A 1 141 LEU 141 141 141 LEU LEU L . n 
A 1 142 ASN 142 142 142 ASN ASN L . n 
A 1 143 ASN 143 143 143 ASN ASN L . n 
A 1 144 PHE 144 144 144 PHE PHE L . n 
A 1 145 TYR 145 145 145 TYR TYR L . n 
A 1 146 PRO 146 146 146 PRO PRO L . n 
A 1 147 ARG 147 147 147 ARG ARG L . n 
A 1 148 GLU 148 148 148 GLU GLU L . n 
A 1 149 ALA 149 149 149 ALA ALA L . n 
A 1 150 LYS 150 150 150 LYS LYS L . n 
A 1 151 VAL 151 151 151 VAL VAL L . n 
A 1 152 GLN 152 152 152 GLN GLN L . n 
A 1 153 TRP 153 153 153 TRP TRP L . n 
A 1 154 LYS 154 154 154 LYS LYS L . n 
A 1 155 VAL 155 155 155 VAL VAL L . n 
A 1 156 ASP 156 156 156 ASP ASP L . n 
A 1 157 ASN 157 157 157 ASN ASN L . n 
A 1 158 ALA 158 158 158 ALA ALA L . n 
A 1 159 LEU 159 159 159 LEU LEU L . n 
A 1 160 GLN 160 160 160 GLN GLN L . n 
A 1 161 SER 161 161 161 SER SER L . n 
A 1 162 GLY 162 162 162 GLY GLY L . n 
A 1 163 ASN 163 163 163 ASN ASN L . n 
A 1 164 SER 164 164 164 SER SER L . n 
A 1 165 GLN 165 165 165 GLN GLN L . n 
A 1 166 GLU 166 166 166 GLU GLU L . n 
A 1 167 SER 167 167 167 SER SER L . n 
A 1 168 VAL 168 168 168 VAL VAL L . n 
A 1 169 THR 169 169 169 THR THR L . n 
A 1 170 GLU 170 170 170 GLU GLU L . n 
A 1 171 GLN 171 171 171 GLN GLN L . n 
A 1 172 ASP 172 172 172 ASP ASP L . n 
A 1 173 SER 173 173 173 SER SER L . n 
A 1 174 LYS 174 174 174 LYS LYS L . n 
A 1 175 ASP 175 175 175 ASP ASP L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 THR 177 177 177 THR THR L . n 
A 1 178 TYR 178 178 178 TYR TYR L . n 
A 1 179 SER 179 179 179 SER SER L . n 
A 1 180 LEU 180 180 180 LEU LEU L . n 
A 1 181 SER 181 181 181 SER SER L . n 
A 1 182 SER 182 182 182 SER SER L . n 
A 1 183 THR 183 183 183 THR THR L . n 
A 1 184 LEU 184 184 184 LEU LEU L . n 
A 1 185 THR 185 185 185 THR THR L . n 
A 1 186 LEU 186 186 186 LEU LEU L . n 
A 1 187 SER 187 187 187 SER SER L . n 
A 1 188 LYS 188 188 188 LYS LYS L . n 
A 1 189 ALA 189 189 189 ALA ALA L . n 
A 1 190 ASP 190 190 190 ASP ASP L . n 
A 1 191 TYR 191 191 191 TYR TYR L . n 
A 1 192 GLU 192 192 192 GLU GLU L . n 
A 1 193 LYS 193 193 193 LYS LYS L . n 
A 1 194 HIS 194 194 194 HIS HIS L . n 
A 1 195 LYS 195 195 195 LYS LYS L . n 
A 1 196 VAL 196 196 196 VAL VAL L . n 
A 1 197 TYR 197 197 197 TYR TYR L . n 
A 1 198 ALA 198 198 198 ALA ALA L . n 
A 1 199 CYS 199 199 199 CYS CYS L . n 
A 1 200 GLU 200 200 200 GLU GLU L . n 
A 1 201 VAL 201 201 201 VAL VAL L . n 
A 1 202 THR 202 202 202 THR THR L . n 
A 1 203 HIS 203 203 203 HIS HIS L . n 
A 1 204 GLN 204 204 204 GLN GLN L . n 
A 1 205 GLY 205 205 205 GLY GLY L . n 
A 1 206 LEU 206 206 206 LEU LEU L . n 
A 1 207 SER 207 207 207 SER SER L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PRO 209 209 209 PRO PRO L . n 
A 1 210 VAL 210 210 210 VAL VAL L . n 
A 1 211 THR 211 211 211 THR THR L . n 
A 1 212 LYS 212 212 212 LYS LYS L . n 
A 1 213 SER 213 213 213 SER SER L . n 
A 1 214 PHE 214 214 214 PHE PHE L . n 
A 1 215 ASN 215 215 215 ASN ASN L . n 
A 1 216 ARG 216 216 216 ARG ARG L . n 
A 1 217 GLY 217 217 217 GLY GLY L . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   LEU 5   5   5   LEU LEU H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   PRO 9   9   9   PRO PRO H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  LYS 12  12  12  LYS LYS H . n 
B 2 13  LYS 13  13  13  LYS LYS H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  GLU 16  16  16  GLU GLU H . n 
B 2 17  THR 17  17  17  THR THR H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  ILE 20  20  20  ILE ILE H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  ASN 31  31  31  ASN ASN H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  GLY 33  33  33  GLY GLY H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  ASN 35  35  35  ASN ASN H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  LYS 38  38  38  LYS LYS H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ALA 40  40  40  ALA ALA H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  LYS 46  46  46  LYS LYS H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  MET 48  48  48  MET MET H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  TRP 50  50  50  TRP TRP H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  ASN 52  52  52  ASN ASN H . n 
B 2 53  THR 53  53  53  THR THR H . n 
B 2 54  TYR 54  54  54  TYR TYR H . n 
B 2 55  THR 55  55  55  THR THR H . n 
B 2 56  GLY 56  56  56  GLY GLY H . n 
B 2 57  GLU 57  57  57  GLU GLU H . n 
B 2 58  PRO 58  58  58  PRO PRO H . n 
B 2 59  THR 59  59  59  THR THR H . n 
B 2 60  TYR 60  60  60  TYR TYR H . n 
B 2 61  ALA 61  61  61  ALA ALA H . n 
B 2 62  ASP 62  62  62  ASP ASP H . n 
B 2 63  ASP 63  63  63  ASP ASP H . n 
B 2 64  PHE 64  64  64  PHE PHE H . n 
B 2 65  LYS 65  65  65  LYS LYS H . n 
B 2 66  GLY 66  66  66  GLY GLY H . n 
B 2 67  ARG 67  67  67  ARG ARG H . n 
B 2 68  PHE 68  68  68  PHE PHE H . n 
B 2 69  ALA 69  69  69  ALA ALA H . n 
B 2 70  PHE 70  70  70  PHE PHE H . n 
B 2 71  SER 71  71  71  SER SER H . n 
B 2 72  LEU 72  72  72  LEU LEU H . n 
B 2 73  GLU 73  73  73  GLU GLU H . n 
B 2 74  THR 74  74  74  THR THR H . n 
B 2 75  SER 75  75  75  SER SER H . n 
B 2 76  ALA 76  76  76  ALA ALA H . n 
B 2 77  SER 77  77  77  SER SER H . n 
B 2 78  THR 78  78  78  THR THR H . n 
B 2 79  ALA 79  79  79  ALA ALA H . n 
B 2 80  TYR 80  80  80  TYR TYR H . n 
B 2 81  LEU 81  81  81  LEU LEU H . n 
B 2 82  GLN 82  82  82  GLN GLN H . n 
B 2 83  ILE 83  83  83  ILE ILE H . n 
B 2 84  ASN 84  84  84  ASN ASN H . n 
B 2 85  ASN 85  85  85  ASN ASN H . n 
B 2 86  LEU 86  86  86  LEU LEU H . n 
B 2 87  LYS 87  87  87  LYS LYS H . n 
B 2 88  ASN 88  88  88  ASN ASN H . n 
B 2 89  GLU 89  89  89  GLU GLU H . n 
B 2 90  ASP 90  90  90  ASP ASP H . n 
B 2 91  THR 91  91  91  THR THR H . n 
B 2 92  ALA 92  92  92  ALA ALA H . n 
B 2 93  THR 93  93  93  THR THR H . n 
B 2 94  TYR 94  94  94  TYR TYR H . n 
B 2 95  PHE 95  95  95  PHE PHE H . n 
B 2 96  CYS 96  96  96  CYS CYS H . n 
B 2 97  VAL 97  97  97  VAL VAL H . n 
B 2 98  GLN 98  98  98  GLN GLN H . n 
B 2 99  ALA 99  99  99  ALA ALA H . n 
B 2 100 GLU 100 100 100 GLU GLU H . n 
B 2 101 ARG 101 101 101 ARG ARG H . n 
B 2 102 LEU 102 102 102 LEU LEU H . n 
B 2 103 ARG 103 103 103 ARG ARG H . n 
B 2 104 ARG 104 104 104 ARG ARG H . n 
B 2 105 THR 105 105 105 THR THR H . n 
B 2 106 PHE 106 106 106 PHE PHE H . n 
B 2 107 ASP 107 107 107 ASP ASP H . n 
B 2 108 TYR 108 108 108 TYR TYR H . n 
B 2 109 TRP 109 109 109 TRP TRP H . n 
B 2 110 GLY 110 110 110 GLY GLY H . n 
B 2 111 ALA 111 111 111 ALA ALA H . n 
B 2 112 GLY 112 112 112 GLY GLY H . n 
B 2 113 THR 113 113 113 THR THR H . n 
B 2 114 THR 114 114 114 THR THR H . n 
B 2 115 VAL 115 115 115 VAL VAL H . n 
B 2 116 THR 116 116 116 THR THR H . n 
B 2 117 VAL 117 117 117 VAL VAL H . n 
B 2 118 SER 118 118 118 SER SER H . n 
B 2 119 SER 119 119 119 SER SER H . n 
B 2 120 ALA 120 120 120 ALA ALA H . n 
B 2 121 SER 121 121 121 SER SER H . n 
B 2 122 THR 122 122 122 THR THR H . n 
B 2 123 LYS 123 123 123 LYS LYS H . n 
B 2 124 GLY 124 124 124 GLY GLY H . n 
B 2 125 PRO 125 125 125 PRO PRO H . n 
B 2 126 SER 126 126 126 SER SER H . n 
B 2 127 VAL 127 127 127 VAL VAL H . n 
B 2 128 PHE 128 128 128 PHE PHE H . n 
B 2 129 PRO 129 129 129 PRO PRO H . n 
B 2 130 LEU 130 130 130 LEU LEU H . n 
B 2 131 ALA 131 131 131 ALA ALA H . n 
B 2 132 PRO 132 132 132 PRO PRO H . n 
B 2 133 SER 133 133 133 SER SER H . n 
B 2 134 SER 134 134 134 SER SER H . n 
B 2 135 LYS 135 135 135 LYS LYS H . n 
B 2 136 SER 136 136 136 SER SER H . n 
B 2 137 THR 137 137 137 THR THR H . n 
B 2 138 SER 138 138 138 SER SER H . n 
B 2 139 GLY 139 139 139 GLY GLY H . n 
B 2 140 GLY 140 140 140 GLY GLY H . n 
B 2 141 THR 141 141 141 THR THR H . n 
B 2 142 ALA 142 142 142 ALA ALA H . n 
B 2 143 ALA 143 143 143 ALA ALA H . n 
B 2 144 LEU 144 144 144 LEU LEU H . n 
B 2 145 GLY 145 145 145 GLY GLY H . n 
B 2 146 CYS 146 146 146 CYS CYS H . n 
B 2 147 LEU 147 147 147 LEU LEU H . n 
B 2 148 VAL 148 148 148 VAL VAL H . n 
B 2 149 LYS 149 149 149 LYS LYS H . n 
B 2 150 ASP 150 150 150 ASP ASP H . n 
B 2 151 TYR 151 151 151 TYR TYR H . n 
B 2 152 PHE 152 152 152 PHE PHE H . n 
B 2 153 PRO 153 153 153 PRO PRO H . n 
B 2 154 GLU 154 154 154 GLU GLU H . n 
B 2 155 PRO 155 155 155 PRO PRO H . n 
B 2 156 VAL 156 156 156 VAL VAL H . n 
B 2 157 THR 157 157 157 THR THR H . n 
B 2 158 VAL 158 158 158 VAL VAL H . n 
B 2 159 SER 159 159 159 SER SER H . n 
B 2 160 TRP 160 160 160 TRP TRP H . n 
B 2 161 ASN 161 161 161 ASN ASN H . n 
B 2 162 SER 162 162 162 SER SER H . n 
B 2 163 GLY 163 163 163 GLY GLY H . n 
B 2 164 ALA 164 164 164 ALA ALA H . n 
B 2 165 LEU 165 165 165 LEU LEU H . n 
B 2 166 THR 166 166 166 THR THR H . n 
B 2 167 SER 167 167 167 SER SER H . n 
B 2 168 GLY 168 168 168 GLY GLY H . n 
B 2 169 VAL 169 169 169 VAL VAL H . n 
B 2 170 HIS 170 170 170 HIS HIS H . n 
B 2 171 THR 171 171 171 THR THR H . n 
B 2 172 PHE 172 172 172 PHE PHE H . n 
B 2 173 PRO 173 173 173 PRO PRO H . n 
B 2 174 ALA 174 174 174 ALA ALA H . n 
B 2 175 VAL 175 175 175 VAL VAL H . n 
B 2 176 LEU 176 176 176 LEU LEU H . n 
B 2 177 GLN 177 177 177 GLN GLN H . n 
B 2 178 SER 178 178 178 SER SER H . n 
B 2 179 SER 179 179 179 SER SER H . n 
B 2 180 GLY 180 180 180 GLY GLY H . n 
B 2 181 LEU 181 181 181 LEU LEU H . n 
B 2 182 TYR 182 182 182 TYR TYR H . n 
B 2 183 SER 183 183 183 SER SER H . n 
B 2 184 LEU 184 184 184 LEU LEU H . n 
B 2 185 SER 185 185 185 SER SER H . n 
B 2 186 SER 186 186 186 SER SER H . n 
B 2 187 VAL 187 187 187 VAL VAL H . n 
B 2 188 VAL 188 188 188 VAL VAL H . n 
B 2 189 THR 189 189 189 THR THR H . n 
B 2 190 VAL 190 190 190 VAL VAL H . n 
B 2 191 PRO 191 191 191 PRO PRO H . n 
B 2 192 SER 192 192 192 SER SER H . n 
B 2 193 SER 193 193 193 SER SER H . n 
B 2 194 SER 194 194 194 SER SER H . n 
B 2 195 LEU 195 195 195 LEU LEU H . n 
B 2 196 GLY 196 196 196 GLY GLY H . n 
B 2 197 THR 197 197 197 THR THR H . n 
B 2 198 GLN 198 198 198 GLN GLN H . n 
B 2 199 THR 199 199 199 THR THR H . n 
B 2 200 TYR 200 200 200 TYR TYR H . n 
B 2 201 ILE 201 201 201 ILE ILE H . n 
B 2 202 CYS 202 202 202 CYS CYS H . n 
B 2 203 ASN 203 203 203 ASN ASN H . n 
B 2 204 VAL 204 204 204 VAL VAL H . n 
B 2 205 ASN 205 205 205 ASN ASN H . n 
B 2 206 HIS 206 206 206 HIS HIS H . n 
B 2 207 LYS 207 207 207 LYS LYS H . n 
B 2 208 PRO 208 208 208 PRO PRO H . n 
B 2 209 SER 209 209 209 SER SER H . n 
B 2 210 ASN 210 210 210 ASN ASN H . n 
B 2 211 THR 211 211 211 THR THR H . n 
B 2 212 LYS 212 212 212 LYS LYS H . n 
B 2 213 VAL 213 213 213 VAL VAL H . n 
B 2 214 ASP 214 214 214 ASP ASP H . n 
B 2 215 LYS 215 215 215 LYS LYS H . n 
B 2 216 LYS 216 216 216 LYS LYS H . n 
B 2 217 VAL 217 217 217 VAL VAL H . n 
B 2 218 GLU 218 218 ?   ?   ?   H . n 
B 2 219 PRO 219 219 ?   ?   ?   H . n 
C 1 1   GLU 1   1   1   GLU GLU A . n 
C 1 2   LEU 2   2   2   LEU LEU A . n 
C 1 3   VAL 3   3   3   VAL VAL A . n 
C 1 4   MET 4   4   4   MET MET A . n 
C 1 5   THR 5   5   5   THR THR A . n 
C 1 6   GLN 6   6   6   GLN GLN A . n 
C 1 7   THR 7   7   7   THR THR A . n 
C 1 8   PRO 8   8   8   PRO PRO A . n 
C 1 9   LEU 9   9   9   LEU LEU A . n 
C 1 10  SER 10  10  10  SER SER A . n 
C 1 11  LEU 11  11  11  LEU LEU A . n 
C 1 12  PRO 12  12  12  PRO PRO A . n 
C 1 13  VAL 13  13  13  VAL VAL A . n 
C 1 14  SER 14  14  14  SER SER A . n 
C 1 15  LEU 15  15  15  LEU LEU A . n 
C 1 16  GLY 16  16  16  GLY GLY A . n 
C 1 17  ASP 17  17  17  ASP ASP A . n 
C 1 18  GLN 18  18  18  GLN GLN A . n 
C 1 19  ALA 19  19  19  ALA ALA A . n 
C 1 20  SER 20  20  20  SER SER A . n 
C 1 21  ILE 21  21  21  ILE ILE A . n 
C 1 22  SER 22  22  22  SER SER A . n 
C 1 23  CYS 23  23  23  CYS CYS A . n 
C 1 24  ARG 24  24  24  ARG ARG A . n 
C 1 25  SER 25  25  25  SER SER A . n 
C 1 26  SER 26  26  26  SER SER A . n 
C 1 27  GLN 27  27  27  GLN GLN A . n 
C 1 28  SER 28  28  28  SER SER A . n 
C 1 29  LEU 29  29  29  LEU LEU A . n 
C 1 30  VAL 30  30  30  VAL VAL A . n 
C 1 31  HIS 31  31  31  HIS HIS A . n 
C 1 32  SER 32  32  32  SER SER A . n 
C 1 33  ASN 33  33  33  ASN ASN A . n 
C 1 34  GLY 34  34  34  GLY GLY A . n 
C 1 35  ASN 35  35  35  ASN ASN A . n 
C 1 36  THR 36  36  36  THR THR A . n 
C 1 37  TYR 37  37  37  TYR TYR A . n 
C 1 38  LEU 38  38  38  LEU LEU A . n 
C 1 39  HIS 39  39  39  HIS HIS A . n 
C 1 40  TRP 40  40  40  TRP TRP A . n 
C 1 41  TYR 41  41  41  TYR TYR A . n 
C 1 42  LEU 42  42  42  LEU LEU A . n 
C 1 43  GLN 43  43  43  GLN GLN A . n 
C 1 44  LYS 44  44  44  LYS LYS A . n 
C 1 45  PRO 45  45  45  PRO PRO A . n 
C 1 46  GLY 46  46  46  GLY GLY A . n 
C 1 47  GLN 47  47  47  GLN GLN A . n 
C 1 48  SER 48  48  48  SER SER A . n 
C 1 49  PRO 49  49  49  PRO PRO A . n 
C 1 50  LYS 50  50  50  LYS LYS A . n 
C 1 51  LEU 51  51  51  LEU LEU A . n 
C 1 52  LEU 52  52  52  LEU LEU A . n 
C 1 53  ILE 53  53  53  ILE ILE A . n 
C 1 54  TYR 54  54  54  TYR TYR A . n 
C 1 55  LYS 55  55  55  LYS LYS A . n 
C 1 56  VAL 56  56  56  VAL VAL A . n 
C 1 57  SER 57  57  57  SER SER A . n 
C 1 58  ASN 58  58  58  ASN ASN A . n 
C 1 59  ARG 59  59  59  ARG ARG A . n 
C 1 60  PHE 60  60  60  PHE PHE A . n 
C 1 61  SER 61  61  61  SER SER A . n 
C 1 62  GLY 62  62  62  GLY GLY A . n 
C 1 63  VAL 63  63  63  VAL VAL A . n 
C 1 64  PRO 64  64  64  PRO PRO A . n 
C 1 65  ASP 65  65  65  ASP ASP A . n 
C 1 66  ARG 66  66  66  ARG ARG A . n 
C 1 67  PHE 67  67  67  PHE PHE A . n 
C 1 68  SER 68  68  68  SER SER A . n 
C 1 69  GLY 69  69  69  GLY GLY A . n 
C 1 70  SER 70  70  70  SER SER A . n 
C 1 71  GLY 71  71  71  GLY GLY A . n 
C 1 72  SER 72  72  72  SER SER A . n 
C 1 73  GLY 73  73  73  GLY GLY A . n 
C 1 74  THR 74  74  74  THR THR A . n 
C 1 75  ASP 75  75  75  ASP ASP A . n 
C 1 76  PHE 76  76  76  PHE PHE A . n 
C 1 77  THR 77  77  77  THR THR A . n 
C 1 78  LEU 78  78  78  LEU LEU A . n 
C 1 79  LYS 79  79  79  LYS LYS A . n 
C 1 80  ILE 80  80  80  ILE ILE A . n 
C 1 81  SER 81  81  81  SER SER A . n 
C 1 82  ARG 82  82  82  ARG ARG A . n 
C 1 83  VAL 83  83  83  VAL VAL A . n 
C 1 84  GLU 84  84  84  GLU GLU A . n 
C 1 85  ALA 85  85  85  ALA ALA A . n 
C 1 86  GLU 86  86  86  GLU GLU A . n 
C 1 87  ASP 87  87  87  ASP ASP A . n 
C 1 88  LEU 88  88  88  LEU LEU A . n 
C 1 89  GLY 89  89  89  GLY GLY A . n 
C 1 90  VAL 90  90  90  VAL VAL A . n 
C 1 91  TYR 91  91  91  TYR TYR A . n 
C 1 92  PHE 92  92  92  PHE PHE A . n 
C 1 93  CYS 93  93  93  CYS CYS A . n 
C 1 94  SER 94  94  94  SER SER A . n 
C 1 95  GLN 95  95  95  GLN GLN A . n 
C 1 96  SER 96  96  96  SER SER A . n 
C 1 97  THR 97  97  97  THR THR A . n 
C 1 98  HIS 98  98  98  HIS HIS A . n 
C 1 99  VAL 99  99  99  VAL VAL A . n 
C 1 100 PRO 100 100 100 PRO PRO A . n 
C 1 101 PRO 101 101 101 PRO PRO A . n 
C 1 102 THR 102 102 102 THR THR A . n 
C 1 103 PHE 103 103 103 PHE PHE A . n 
C 1 104 GLY 104 104 104 GLY GLY A . n 
C 1 105 GLY 105 105 105 GLY GLY A . n 
C 1 106 GLY 106 106 106 GLY GLY A . n 
C 1 107 THR 107 107 107 THR THR A . n 
C 1 108 LYS 108 108 108 LYS LYS A . n 
C 1 109 LEU 109 109 109 LEU LEU A . n 
C 1 110 GLU 110 110 110 GLU GLU A . n 
C 1 111 ILE 111 111 111 ILE ILE A . n 
C 1 112 LYS 112 112 112 LYS LYS A . n 
C 1 113 ARG 113 113 113 ARG ARG A . n 
C 1 114 THR 114 114 114 THR THR A . n 
C 1 115 VAL 115 115 115 VAL VAL A . n 
C 1 116 ALA 116 116 116 ALA ALA A . n 
C 1 117 ALA 117 117 117 ALA ALA A . n 
C 1 118 PRO 118 118 118 PRO PRO A . n 
C 1 119 SER 119 119 119 SER SER A . n 
C 1 120 VAL 120 120 120 VAL VAL A . n 
C 1 121 PHE 121 121 121 PHE PHE A . n 
C 1 122 ILE 122 122 122 ILE ILE A . n 
C 1 123 PHE 123 123 123 PHE PHE A . n 
C 1 124 PRO 124 124 124 PRO PRO A . n 
C 1 125 PRO 125 125 125 PRO PRO A . n 
C 1 126 SER 126 126 126 SER SER A . n 
C 1 127 ASP 127 127 127 ASP ASP A . n 
C 1 128 GLU 128 128 128 GLU GLU A . n 
C 1 129 GLN 129 129 129 GLN GLN A . n 
C 1 130 LEU 130 130 130 LEU LEU A . n 
C 1 131 LYS 131 131 131 LYS LYS A . n 
C 1 132 SER 132 132 132 SER SER A . n 
C 1 133 GLY 133 133 133 GLY GLY A . n 
C 1 134 THR 134 134 134 THR THR A . n 
C 1 135 ALA 135 135 135 ALA ALA A . n 
C 1 136 SER 136 136 136 SER SER A . n 
C 1 137 VAL 137 137 137 VAL VAL A . n 
C 1 138 VAL 138 138 138 VAL VAL A . n 
C 1 139 CYS 139 139 139 CYS CYS A . n 
C 1 140 LEU 140 140 140 LEU LEU A . n 
C 1 141 LEU 141 141 141 LEU LEU A . n 
C 1 142 ASN 142 142 142 ASN ASN A . n 
C 1 143 ASN 143 143 143 ASN ASN A . n 
C 1 144 PHE 144 144 144 PHE PHE A . n 
C 1 145 TYR 145 145 145 TYR TYR A . n 
C 1 146 PRO 146 146 146 PRO PRO A . n 
C 1 147 ARG 147 147 147 ARG ARG A . n 
C 1 148 GLU 148 148 148 GLU GLU A . n 
C 1 149 ALA 149 149 149 ALA ALA A . n 
C 1 150 LYS 150 150 150 LYS LYS A . n 
C 1 151 VAL 151 151 151 VAL VAL A . n 
C 1 152 GLN 152 152 152 GLN GLN A . n 
C 1 153 TRP 153 153 153 TRP TRP A . n 
C 1 154 LYS 154 154 154 LYS LYS A . n 
C 1 155 VAL 155 155 155 VAL VAL A . n 
C 1 156 ASP 156 156 156 ASP ASP A . n 
C 1 157 ASN 157 157 157 ASN ASN A . n 
C 1 158 ALA 158 158 158 ALA ALA A . n 
C 1 159 LEU 159 159 159 LEU LEU A . n 
C 1 160 GLN 160 160 160 GLN GLN A . n 
C 1 161 SER 161 161 161 SER SER A . n 
C 1 162 GLY 162 162 162 GLY GLY A . n 
C 1 163 ASN 163 163 163 ASN ASN A . n 
C 1 164 SER 164 164 164 SER SER A . n 
C 1 165 GLN 165 165 165 GLN GLN A . n 
C 1 166 GLU 166 166 166 GLU GLU A . n 
C 1 167 SER 167 167 167 SER SER A . n 
C 1 168 VAL 168 168 168 VAL VAL A . n 
C 1 169 THR 169 169 169 THR THR A . n 
C 1 170 GLU 170 170 170 GLU GLU A . n 
C 1 171 GLN 171 171 171 GLN GLN A . n 
C 1 172 ASP 172 172 172 ASP ASP A . n 
C 1 173 SER 173 173 173 SER SER A . n 
C 1 174 LYS 174 174 174 LYS LYS A . n 
C 1 175 ASP 175 175 175 ASP ASP A . n 
C 1 176 SER 176 176 176 SER SER A . n 
C 1 177 THR 177 177 177 THR THR A . n 
C 1 178 TYR 178 178 178 TYR TYR A . n 
C 1 179 SER 179 179 179 SER SER A . n 
C 1 180 LEU 180 180 180 LEU LEU A . n 
C 1 181 SER 181 181 181 SER SER A . n 
C 1 182 SER 182 182 182 SER SER A . n 
C 1 183 THR 183 183 183 THR THR A . n 
C 1 184 LEU 184 184 184 LEU LEU A . n 
C 1 185 THR 185 185 185 THR THR A . n 
C 1 186 LEU 186 186 186 LEU LEU A . n 
C 1 187 SER 187 187 187 SER SER A . n 
C 1 188 LYS 188 188 188 LYS LYS A . n 
C 1 189 ALA 189 189 189 ALA ALA A . n 
C 1 190 ASP 190 190 190 ASP ASP A . n 
C 1 191 TYR 191 191 191 TYR TYR A . n 
C 1 192 GLU 192 192 192 GLU GLU A . n 
C 1 193 LYS 193 193 193 LYS LYS A . n 
C 1 194 HIS 194 194 194 HIS HIS A . n 
C 1 195 LYS 195 195 195 LYS LYS A . n 
C 1 196 VAL 196 196 196 VAL VAL A . n 
C 1 197 TYR 197 197 197 TYR TYR A . n 
C 1 198 ALA 198 198 198 ALA ALA A . n 
C 1 199 CYS 199 199 199 CYS CYS A . n 
C 1 200 GLU 200 200 200 GLU GLU A . n 
C 1 201 VAL 201 201 201 VAL VAL A . n 
C 1 202 THR 202 202 202 THR THR A . n 
C 1 203 HIS 203 203 203 HIS HIS A . n 
C 1 204 GLN 204 204 204 GLN GLN A . n 
C 1 205 GLY 205 205 205 GLY GLY A . n 
C 1 206 LEU 206 206 206 LEU LEU A . n 
C 1 207 SER 207 207 207 SER SER A . n 
C 1 208 SER 208 208 208 SER SER A . n 
C 1 209 PRO 209 209 209 PRO PRO A . n 
C 1 210 VAL 210 210 210 VAL VAL A . n 
C 1 211 THR 211 211 211 THR THR A . n 
C 1 212 LYS 212 212 212 LYS LYS A . n 
C 1 213 SER 213 213 213 SER SER A . n 
C 1 214 PHE 214 214 214 PHE PHE A . n 
C 1 215 ASN 215 215 215 ASN ASN A . n 
C 1 216 ARG 216 216 216 ARG ARG A . n 
C 1 217 GLY 217 217 217 GLY GLY A . n 
D 2 1   GLN 1   1   1   GLN GLN B . n 
D 2 2   VAL 2   2   2   VAL VAL B . n 
D 2 3   GLN 3   3   3   GLN GLN B . n 
D 2 4   LEU 4   4   4   LEU LEU B . n 
D 2 5   LEU 5   5   5   LEU LEU B . n 
D 2 6   GLU 6   6   6   GLU GLU B . n 
D 2 7   SER 7   7   7   SER SER B . n 
D 2 8   GLY 8   8   8   GLY GLY B . n 
D 2 9   PRO 9   9   9   PRO PRO B . n 
D 2 10  GLU 10  10  10  GLU GLU B . n 
D 2 11  LEU 11  11  11  LEU LEU B . n 
D 2 12  LYS 12  12  12  LYS LYS B . n 
D 2 13  LYS 13  13  13  LYS LYS B . n 
D 2 14  PRO 14  14  14  PRO PRO B . n 
D 2 15  GLY 15  15  15  GLY GLY B . n 
D 2 16  GLU 16  16  16  GLU GLU B . n 
D 2 17  THR 17  17  17  THR THR B . n 
D 2 18  VAL 18  18  18  VAL VAL B . n 
D 2 19  LYS 19  19  19  LYS LYS B . n 
D 2 20  ILE 20  20  20  ILE ILE B . n 
D 2 21  SER 21  21  21  SER SER B . n 
D 2 22  CYS 22  22  22  CYS CYS B . n 
D 2 23  LYS 23  23  23  LYS LYS B . n 
D 2 24  ALA 24  24  24  ALA ALA B . n 
D 2 25  SER 25  25  25  SER SER B . n 
D 2 26  GLY 26  26  26  GLY GLY B . n 
D 2 27  TYR 27  27  27  TYR TYR B . n 
D 2 28  THR 28  28  28  THR THR B . n 
D 2 29  PHE 29  29  29  PHE PHE B . n 
D 2 30  THR 30  30  30  THR THR B . n 
D 2 31  ASN 31  31  31  ASN ASN B . n 
D 2 32  TYR 32  32  32  TYR TYR B . n 
D 2 33  GLY 33  33  33  GLY GLY B . n 
D 2 34  MET 34  34  34  MET MET B . n 
D 2 35  ASN 35  35  35  ASN ASN B . n 
D 2 36  TRP 36  36  36  TRP TRP B . n 
D 2 37  VAL 37  37  37  VAL VAL B . n 
D 2 38  LYS 38  38  38  LYS LYS B . n 
D 2 39  GLN 39  39  39  GLN GLN B . n 
D 2 40  ALA 40  40  40  ALA ALA B . n 
D 2 41  PRO 41  41  41  PRO PRO B . n 
D 2 42  GLY 42  42  42  GLY GLY B . n 
D 2 43  LYS 43  43  43  LYS LYS B . n 
D 2 44  GLY 44  44  44  GLY GLY B . n 
D 2 45  LEU 45  45  45  LEU LEU B . n 
D 2 46  LYS 46  46  46  LYS LYS B . n 
D 2 47  TRP 47  47  47  TRP TRP B . n 
D 2 48  MET 48  48  48  MET MET B . n 
D 2 49  GLY 49  49  49  GLY GLY B . n 
D 2 50  TRP 50  50  50  TRP TRP B . n 
D 2 51  ILE 51  51  51  ILE ILE B . n 
D 2 52  ASN 52  52  52  ASN ASN B . n 
D 2 53  THR 53  53  53  THR THR B . n 
D 2 54  TYR 54  54  54  TYR TYR B . n 
D 2 55  THR 55  55  55  THR THR B . n 
D 2 56  GLY 56  56  56  GLY GLY B . n 
D 2 57  GLU 57  57  57  GLU GLU B . n 
D 2 58  PRO 58  58  58  PRO PRO B . n 
D 2 59  THR 59  59  59  THR THR B . n 
D 2 60  TYR 60  60  60  TYR TYR B . n 
D 2 61  ALA 61  61  61  ALA ALA B . n 
D 2 62  ASP 62  62  62  ASP ASP B . n 
D 2 63  ASP 63  63  63  ASP ASP B . n 
D 2 64  PHE 64  64  64  PHE PHE B . n 
D 2 65  LYS 65  65  65  LYS LYS B . n 
D 2 66  GLY 66  66  66  GLY GLY B . n 
D 2 67  ARG 67  67  67  ARG ARG B . n 
D 2 68  PHE 68  68  68  PHE PHE B . n 
D 2 69  ALA 69  69  69  ALA ALA B . n 
D 2 70  PHE 70  70  70  PHE PHE B . n 
D 2 71  SER 71  71  71  SER SER B . n 
D 2 72  LEU 72  72  72  LEU LEU B . n 
D 2 73  GLU 73  73  73  GLU GLU B . n 
D 2 74  THR 74  74  74  THR THR B . n 
D 2 75  SER 75  75  75  SER SER B . n 
D 2 76  ALA 76  76  76  ALA ALA B . n 
D 2 77  SER 77  77  77  SER SER B . n 
D 2 78  THR 78  78  78  THR THR B . n 
D 2 79  ALA 79  79  79  ALA ALA B . n 
D 2 80  TYR 80  80  80  TYR TYR B . n 
D 2 81  LEU 81  81  81  LEU LEU B . n 
D 2 82  GLN 82  82  82  GLN GLN B . n 
D 2 83  ILE 83  83  83  ILE ILE B . n 
D 2 84  ASN 84  84  84  ASN ASN B . n 
D 2 85  ASN 85  85  85  ASN ASN B . n 
D 2 86  LEU 86  86  86  LEU LEU B . n 
D 2 87  LYS 87  87  87  LYS LYS B . n 
D 2 88  ASN 88  88  88  ASN ASN B . n 
D 2 89  GLU 89  89  89  GLU GLU B . n 
D 2 90  ASP 90  90  90  ASP ASP B . n 
D 2 91  THR 91  91  91  THR THR B . n 
D 2 92  ALA 92  92  92  ALA ALA B . n 
D 2 93  THR 93  93  93  THR THR B . n 
D 2 94  TYR 94  94  94  TYR TYR B . n 
D 2 95  PHE 95  95  95  PHE PHE B . n 
D 2 96  CYS 96  96  96  CYS CYS B . n 
D 2 97  VAL 97  97  97  VAL VAL B . n 
D 2 98  GLN 98  98  98  GLN GLN B . n 
D 2 99  ALA 99  99  99  ALA ALA B . n 
D 2 100 GLU 100 100 100 GLU GLU B . n 
D 2 101 ARG 101 101 101 ARG ARG B . n 
D 2 102 LEU 102 102 102 LEU LEU B . n 
D 2 103 ARG 103 103 103 ARG ARG B . n 
D 2 104 ARG 104 104 104 ARG ARG B . n 
D 2 105 THR 105 105 105 THR THR B . n 
D 2 106 PHE 106 106 106 PHE PHE B . n 
D 2 107 ASP 107 107 107 ASP ASP B . n 
D 2 108 TYR 108 108 108 TYR TYR B . n 
D 2 109 TRP 109 109 109 TRP TRP B . n 
D 2 110 GLY 110 110 110 GLY GLY B . n 
D 2 111 ALA 111 111 111 ALA ALA B . n 
D 2 112 GLY 112 112 112 GLY GLY B . n 
D 2 113 THR 113 113 113 THR THR B . n 
D 2 114 THR 114 114 114 THR THR B . n 
D 2 115 VAL 115 115 115 VAL VAL B . n 
D 2 116 THR 116 116 116 THR THR B . n 
D 2 117 VAL 117 117 117 VAL VAL B . n 
D 2 118 SER 118 118 118 SER SER B . n 
D 2 119 SER 119 119 119 SER SER B . n 
D 2 120 ALA 120 120 120 ALA ALA B . n 
D 2 121 SER 121 121 121 SER SER B . n 
D 2 122 THR 122 122 122 THR THR B . n 
D 2 123 LYS 123 123 123 LYS LYS B . n 
D 2 124 GLY 124 124 124 GLY GLY B . n 
D 2 125 PRO 125 125 125 PRO PRO B . n 
D 2 126 SER 126 126 126 SER SER B . n 
D 2 127 VAL 127 127 127 VAL VAL B . n 
D 2 128 PHE 128 128 128 PHE PHE B . n 
D 2 129 PRO 129 129 129 PRO PRO B . n 
D 2 130 LEU 130 130 130 LEU LEU B . n 
D 2 131 ALA 131 131 131 ALA ALA B . n 
D 2 132 PRO 132 132 132 PRO PRO B . n 
D 2 133 SER 133 133 133 SER SER B . n 
D 2 134 SER 134 134 134 SER SER B . n 
D 2 135 LYS 135 135 135 LYS LYS B . n 
D 2 136 SER 136 136 136 SER SER B . n 
D 2 137 THR 137 137 137 THR THR B . n 
D 2 138 SER 138 138 138 SER SER B . n 
D 2 139 GLY 139 139 139 GLY GLY B . n 
D 2 140 GLY 140 140 140 GLY GLY B . n 
D 2 141 THR 141 141 141 THR THR B . n 
D 2 142 ALA 142 142 142 ALA ALA B . n 
D 2 143 ALA 143 143 143 ALA ALA B . n 
D 2 144 LEU 144 144 144 LEU LEU B . n 
D 2 145 GLY 145 145 145 GLY GLY B . n 
D 2 146 CYS 146 146 146 CYS CYS B . n 
D 2 147 LEU 147 147 147 LEU LEU B . n 
D 2 148 VAL 148 148 148 VAL VAL B . n 
D 2 149 LYS 149 149 149 LYS LYS B . n 
D 2 150 ASP 150 150 150 ASP ASP B . n 
D 2 151 TYR 151 151 151 TYR TYR B . n 
D 2 152 PHE 152 152 152 PHE PHE B . n 
D 2 153 PRO 153 153 153 PRO PRO B . n 
D 2 154 GLU 154 154 154 GLU GLU B . n 
D 2 155 PRO 155 155 155 PRO PRO B . n 
D 2 156 VAL 156 156 156 VAL VAL B . n 
D 2 157 THR 157 157 157 THR THR B . n 
D 2 158 VAL 158 158 158 VAL VAL B . n 
D 2 159 SER 159 159 159 SER SER B . n 
D 2 160 TRP 160 160 160 TRP TRP B . n 
D 2 161 ASN 161 161 161 ASN ASN B . n 
D 2 162 SER 162 162 162 SER SER B . n 
D 2 163 GLY 163 163 163 GLY GLY B . n 
D 2 164 ALA 164 164 164 ALA ALA B . n 
D 2 165 LEU 165 165 165 LEU LEU B . n 
D 2 166 THR 166 166 166 THR THR B . n 
D 2 167 SER 167 167 167 SER SER B . n 
D 2 168 GLY 168 168 168 GLY GLY B . n 
D 2 169 VAL 169 169 169 VAL VAL B . n 
D 2 170 HIS 170 170 170 HIS HIS B . n 
D 2 171 THR 171 171 171 THR THR B . n 
D 2 172 PHE 172 172 172 PHE PHE B . n 
D 2 173 PRO 173 173 173 PRO PRO B . n 
D 2 174 ALA 174 174 174 ALA ALA B . n 
D 2 175 VAL 175 175 175 VAL VAL B . n 
D 2 176 LEU 176 176 176 LEU LEU B . n 
D 2 177 GLN 177 177 177 GLN GLN B . n 
D 2 178 SER 178 178 178 SER SER B . n 
D 2 179 SER 179 179 179 SER SER B . n 
D 2 180 GLY 180 180 180 GLY GLY B . n 
D 2 181 LEU 181 181 181 LEU LEU B . n 
D 2 182 TYR 182 182 182 TYR TYR B . n 
D 2 183 SER 183 183 183 SER SER B . n 
D 2 184 LEU 184 184 184 LEU LEU B . n 
D 2 185 SER 185 185 185 SER SER B . n 
D 2 186 SER 186 186 186 SER SER B . n 
D 2 187 VAL 187 187 187 VAL VAL B . n 
D 2 188 VAL 188 188 188 VAL VAL B . n 
D 2 189 THR 189 189 189 THR THR B . n 
D 2 190 VAL 190 190 190 VAL VAL B . n 
D 2 191 PRO 191 191 191 PRO PRO B . n 
D 2 192 SER 192 192 192 SER SER B . n 
D 2 193 SER 193 193 193 SER SER B . n 
D 2 194 SER 194 194 194 SER SER B . n 
D 2 195 LEU 195 195 195 LEU LEU B . n 
D 2 196 GLY 196 196 196 GLY GLY B . n 
D 2 197 THR 197 197 197 THR THR B . n 
D 2 198 GLN 198 198 198 GLN GLN B . n 
D 2 199 THR 199 199 199 THR THR B . n 
D 2 200 TYR 200 200 200 TYR TYR B . n 
D 2 201 ILE 201 201 201 ILE ILE B . n 
D 2 202 CYS 202 202 202 CYS CYS B . n 
D 2 203 ASN 203 203 203 ASN ASN B . n 
D 2 204 VAL 204 204 204 VAL VAL B . n 
D 2 205 ASN 205 205 205 ASN ASN B . n 
D 2 206 HIS 206 206 206 HIS HIS B . n 
D 2 207 LYS 207 207 207 LYS LYS B . n 
D 2 208 PRO 208 208 208 PRO PRO B . n 
D 2 209 SER 209 209 209 SER SER B . n 
D 2 210 ASN 210 210 210 ASN ASN B . n 
D 2 211 THR 211 211 211 THR THR B . n 
D 2 212 LYS 212 212 212 LYS LYS B . n 
D 2 213 VAL 213 213 213 VAL VAL B . n 
D 2 214 ASP 214 214 214 ASP ASP B . n 
D 2 215 LYS 215 215 215 LYS LYS B . n 
D 2 216 LYS 216 216 216 LYS LYS B . n 
D 2 217 VAL 217 217 217 VAL VAL B . n 
D 2 218 GLU 218 218 ?   ?   ?   B . n 
D 2 219 PRO 219 219 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3260  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  20290 ? 
2 'ABSA (A^2)' 3230  ? 
2 MORE         -20   ? 
2 'SSA (A^2)'  20460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-05-13 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
X-PLOR    'model building' 3.851 ? 3 
X-PLOR    refinement       3.851 ? 4 
X-PLOR    phasing          3.851 ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG B CYS 22  ? ? SG B CYS 96  ? ? 2.03 
2 1 SG B CYS 146 ? ? SG B CYS 202 ? ? 2.03 
3 1 SG A CYS 139 ? ? SG A CYS 199 ? ? 2.04 
4 1 SG A CYS 23  ? ? SG A CYS 93  ? ? 2.04 
5 1 O  B ALA 143 ? ? O  B VAL 188 ? ? 2.09 
6 1 O  H ALA 143 ? ? O  H VAL 188 ? ? 2.14 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE2 B GLU 89 ? ? 1_555 OE2 B GLU 89 ? ? 2_556 1.99 
2 1 OE2 H GLU 89 ? ? 1_555 OE2 H GLU 89 ? ? 2_555 2.10 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL L 56  ? ? 76.23   -50.76  
2  1 ASP L 65  ? ? -66.86  2.78    
3  1 SER L 72  ? ? -135.26 -50.58  
4  1 ARG L 82  ? ? 50.15   94.13   
5  1 VAL L 99  ? ? -3.20   -83.45  
6  1 ASN L 143 ? ? 39.27   72.72   
7  1 PRO L 146 ? ? -67.51  -178.08 
8  1 ASN L 157 ? ? 69.00   -6.68   
9  1 LYS L 195 ? ? -97.65  -80.45  
10 1 ASN L 215 ? ? -153.54 -6.26   
11 1 ARG L 216 ? ? -61.51  -167.78 
12 1 VAL H 2   ? ? 50.30   11.57   
13 1 GLN H 3   ? ? -32.82  135.91  
14 1 TYR H 27  ? ? 28.46   43.29   
15 1 THR H 28  ? ? 165.33  -4.83   
16 1 PRO H 41  ? ? -36.74  113.24  
17 1 ALA H 92  ? ? -177.67 -175.40 
18 1 SER H 133 ? ? -38.15  114.75  
19 1 LYS H 135 ? ? -69.21  11.81   
20 1 SER H 136 ? ? -154.95 55.98   
21 1 ALA H 143 ? ? -73.26  -98.02  
22 1 LEU H 144 ? ? 77.72   128.56  
23 1 ASP H 150 ? ? 60.13   65.97   
24 1 ASN A 35  ? ? -49.94  155.07  
25 1 VAL A 56  ? ? 70.62   -53.65  
26 1 ASP A 65  ? ? -69.51  0.24    
27 1 SER A 72  ? ? -100.79 -71.98  
28 1 ARG A 82  ? ? 48.03   96.62   
29 1 VAL A 99  ? ? -5.94   -79.48  
30 1 ASN A 143 ? ? 37.21   74.61   
31 1 PRO A 146 ? ? -67.90  -175.97 
32 1 ASN A 157 ? ? 71.99   -4.84   
33 1 LYS A 195 ? ? -96.31  -77.32  
34 1 ASN A 215 ? ? -101.68 -89.24  
35 1 ARG A 216 ? ? -7.14   61.36   
36 1 VAL B 2   ? ? 56.77   155.81  
37 1 GLN B 3   ? ? 174.59  127.46  
38 1 TYR B 27  ? ? 60.03   -37.94  
39 1 ALA B 92  ? ? -176.34 -176.48 
40 1 LYS B 135 ? ? -68.47  14.55   
41 1 SER B 136 ? ? -159.55 53.96   
42 1 ALA B 143 ? ? -76.00  -103.02 
43 1 LEU B 144 ? ? 79.23   132.19  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H GLU 218 ? B GLU 218 
2 1 Y 1 H PRO 219 ? B PRO 219 
3 1 Y 1 B GLU 218 ? D GLU 218 
4 1 Y 1 B PRO 219 ? D PRO 219 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  218 16  HOH HOH L . 
E 3 HOH 2  219 25  HOH HOH L . 
E 3 HOH 3  220 28  HOH HOH L . 
E 3 HOH 4  221 29  HOH HOH L . 
E 3 HOH 5  222 31  HOH HOH L . 
E 3 HOH 6  223 36  HOH HOH L . 
E 3 HOH 7  224 48  HOH HOH L . 
E 3 HOH 8  225 53  HOH HOH L . 
E 3 HOH 9  226 58  HOH HOH L . 
E 3 HOH 10 227 66  HOH HOH L . 
E 3 HOH 11 228 73  HOH HOH L . 
E 3 HOH 12 229 79  HOH HOH L . 
E 3 HOH 13 230 80  HOH HOH L . 
E 3 HOH 14 231 82  HOH HOH L . 
E 3 HOH 15 232 84  HOH HOH L . 
E 3 HOH 16 233 85  HOH HOH L . 
E 3 HOH 17 234 89  HOH HOH L . 
E 3 HOH 18 235 92  HOH HOH L . 
E 3 HOH 19 236 98  HOH HOH L . 
E 3 HOH 20 237 104 HOH HOH L . 
E 3 HOH 21 238 128 HOH HOH L . 
E 3 HOH 22 239 129 HOH HOH L . 
E 3 HOH 23 240 131 HOH HOH L . 
E 3 HOH 24 241 133 HOH HOH L . 
E 3 HOH 25 242 142 HOH HOH L . 
E 3 HOH 26 243 147 HOH HOH L . 
E 3 HOH 27 244 157 HOH HOH L . 
E 3 HOH 28 245 167 HOH HOH L . 
E 3 HOH 29 246 180 HOH HOH L . 
E 3 HOH 30 247 181 HOH HOH L . 
E 3 HOH 31 248 183 HOH HOH L . 
E 3 HOH 32 249 184 HOH HOH L . 
E 3 HOH 33 250 204 HOH HOH L . 
E 3 HOH 34 251 209 HOH HOH L . 
E 3 HOH 35 252 212 HOH HOH L . 
E 3 HOH 36 253 214 HOH HOH L . 
E 3 HOH 37 254 220 HOH HOH L . 
E 3 HOH 38 255 222 HOH HOH L . 
E 3 HOH 39 256 233 HOH HOH L . 
E 3 HOH 40 257 238 HOH HOH L . 
E 3 HOH 41 258 239 HOH HOH L . 
E 3 HOH 42 259 243 HOH HOH L . 
E 3 HOH 43 260 248 HOH HOH L . 
E 3 HOH 44 261 253 HOH HOH L . 
E 3 HOH 45 262 255 HOH HOH L . 
E 3 HOH 46 263 257 HOH HOH L . 
E 3 HOH 47 264 264 HOH HOH L . 
E 3 HOH 48 265 265 HOH HOH L . 
E 3 HOH 49 266 266 HOH HOH L . 
F 3 HOH 1  220 4   HOH HOH H . 
F 3 HOH 2  221 5   HOH HOH H . 
F 3 HOH 3  222 7   HOH HOH H . 
F 3 HOH 4  223 9   HOH HOH H . 
F 3 HOH 5  224 10  HOH HOH H . 
F 3 HOH 6  225 12  HOH HOH H . 
F 3 HOH 7  226 13  HOH HOH H . 
F 3 HOH 8  227 30  HOH HOH H . 
F 3 HOH 9  228 34  HOH HOH H . 
F 3 HOH 10 229 35  HOH HOH H . 
F 3 HOH 11 230 38  HOH HOH H . 
F 3 HOH 12 231 39  HOH HOH H . 
F 3 HOH 13 232 46  HOH HOH H . 
F 3 HOH 14 233 50  HOH HOH H . 
F 3 HOH 15 234 55  HOH HOH H . 
F 3 HOH 16 235 56  HOH HOH H . 
F 3 HOH 17 236 60  HOH HOH H . 
F 3 HOH 18 237 63  HOH HOH H . 
F 3 HOH 19 238 67  HOH HOH H . 
F 3 HOH 20 239 70  HOH HOH H . 
F 3 HOH 21 240 72  HOH HOH H . 
F 3 HOH 22 241 74  HOH HOH H . 
F 3 HOH 23 242 86  HOH HOH H . 
F 3 HOH 24 243 88  HOH HOH H . 
F 3 HOH 25 244 90  HOH HOH H . 
F 3 HOH 26 245 91  HOH HOH H . 
F 3 HOH 27 246 93  HOH HOH H . 
F 3 HOH 28 247 95  HOH HOH H . 
F 3 HOH 29 248 97  HOH HOH H . 
F 3 HOH 30 249 100 HOH HOH H . 
F 3 HOH 31 250 101 HOH HOH H . 
F 3 HOH 32 251 103 HOH HOH H . 
F 3 HOH 33 252 105 HOH HOH H . 
F 3 HOH 34 253 109 HOH HOH H . 
F 3 HOH 35 254 113 HOH HOH H . 
F 3 HOH 36 255 115 HOH HOH H . 
F 3 HOH 37 256 118 HOH HOH H . 
F 3 HOH 38 257 121 HOH HOH H . 
F 3 HOH 39 258 123 HOH HOH H . 
F 3 HOH 40 259 125 HOH HOH H . 
F 3 HOH 41 260 130 HOH HOH H . 
F 3 HOH 42 261 132 HOH HOH H . 
F 3 HOH 43 262 135 HOH HOH H . 
F 3 HOH 44 263 137 HOH HOH H . 
F 3 HOH 45 264 141 HOH HOH H . 
F 3 HOH 46 265 143 HOH HOH H . 
F 3 HOH 47 266 144 HOH HOH H . 
F 3 HOH 48 267 154 HOH HOH H . 
F 3 HOH 49 268 163 HOH HOH H . 
F 3 HOH 50 269 164 HOH HOH H . 
F 3 HOH 51 270 166 HOH HOH H . 
F 3 HOH 52 271 168 HOH HOH H . 
F 3 HOH 53 272 170 HOH HOH H . 
F 3 HOH 54 273 173 HOH HOH H . 
F 3 HOH 55 274 179 HOH HOH H . 
F 3 HOH 56 275 182 HOH HOH H . 
F 3 HOH 57 276 186 HOH HOH H . 
F 3 HOH 58 277 188 HOH HOH H . 
F 3 HOH 59 278 189 HOH HOH H . 
F 3 HOH 60 279 193 HOH HOH H . 
F 3 HOH 61 280 197 HOH HOH H . 
F 3 HOH 62 281 199 HOH HOH H . 
F 3 HOH 63 282 205 HOH HOH H . 
F 3 HOH 64 283 206 HOH HOH H . 
F 3 HOH 65 284 207 HOH HOH H . 
F 3 HOH 66 285 210 HOH HOH H . 
F 3 HOH 67 286 211 HOH HOH H . 
F 3 HOH 68 287 213 HOH HOH H . 
F 3 HOH 69 288 223 HOH HOH H . 
F 3 HOH 70 289 225 HOH HOH H . 
F 3 HOH 71 290 227 HOH HOH H . 
F 3 HOH 72 291 228 HOH HOH H . 
F 3 HOH 73 292 230 HOH HOH H . 
F 3 HOH 74 293 232 HOH HOH H . 
F 3 HOH 75 294 234 HOH HOH H . 
F 3 HOH 76 295 240 HOH HOH H . 
F 3 HOH 77 296 242 HOH HOH H . 
F 3 HOH 78 297 245 HOH HOH H . 
F 3 HOH 79 298 250 HOH HOH H . 
F 3 HOH 80 299 252 HOH HOH H . 
F 3 HOH 81 300 256 HOH HOH H . 
F 3 HOH 82 301 258 HOH HOH H . 
F 3 HOH 83 302 269 HOH HOH H . 
F 3 HOH 84 303 270 HOH HOH H . 
F 3 HOH 85 304 273 HOH HOH H . 
F 3 HOH 86 305 274 HOH HOH H . 
G 3 HOH 1  218 2   HOH HOH A . 
G 3 HOH 2  219 6   HOH HOH A . 
G 3 HOH 3  220 11  HOH HOH A . 
G 3 HOH 4  221 17  HOH HOH A . 
G 3 HOH 5  222 18  HOH HOH A . 
G 3 HOH 6  223 20  HOH HOH A . 
G 3 HOH 7  224 21  HOH HOH A . 
G 3 HOH 8  225 23  HOH HOH A . 
G 3 HOH 9  226 33  HOH HOH A . 
G 3 HOH 10 227 42  HOH HOH A . 
G 3 HOH 11 228 43  HOH HOH A . 
G 3 HOH 12 229 44  HOH HOH A . 
G 3 HOH 13 230 45  HOH HOH A . 
G 3 HOH 14 231 49  HOH HOH A . 
G 3 HOH 15 232 52  HOH HOH A . 
G 3 HOH 16 233 54  HOH HOH A . 
G 3 HOH 17 234 59  HOH HOH A . 
G 3 HOH 18 235 64  HOH HOH A . 
G 3 HOH 19 236 65  HOH HOH A . 
G 3 HOH 20 237 69  HOH HOH A . 
G 3 HOH 21 238 71  HOH HOH A . 
G 3 HOH 22 239 78  HOH HOH A . 
G 3 HOH 23 240 94  HOH HOH A . 
G 3 HOH 24 241 96  HOH HOH A . 
G 3 HOH 25 242 102 HOH HOH A . 
G 3 HOH 26 243 117 HOH HOH A . 
G 3 HOH 27 244 119 HOH HOH A . 
G 3 HOH 28 245 126 HOH HOH A . 
G 3 HOH 29 246 134 HOH HOH A . 
G 3 HOH 30 247 136 HOH HOH A . 
G 3 HOH 31 248 140 HOH HOH A . 
G 3 HOH 32 249 146 HOH HOH A . 
G 3 HOH 33 250 149 HOH HOH A . 
G 3 HOH 34 251 151 HOH HOH A . 
G 3 HOH 35 252 156 HOH HOH A . 
G 3 HOH 36 253 158 HOH HOH A . 
G 3 HOH 37 254 159 HOH HOH A . 
G 3 HOH 38 255 162 HOH HOH A . 
G 3 HOH 39 256 175 HOH HOH A . 
G 3 HOH 40 257 190 HOH HOH A . 
G 3 HOH 41 258 191 HOH HOH A . 
G 3 HOH 42 259 198 HOH HOH A . 
G 3 HOH 43 260 208 HOH HOH A . 
G 3 HOH 44 261 215 HOH HOH A . 
G 3 HOH 45 262 219 HOH HOH A . 
G 3 HOH 46 263 224 HOH HOH A . 
G 3 HOH 47 264 226 HOH HOH A . 
G 3 HOH 48 265 229 HOH HOH A . 
G 3 HOH 49 266 246 HOH HOH A . 
G 3 HOH 50 267 247 HOH HOH A . 
G 3 HOH 51 268 254 HOH HOH A . 
G 3 HOH 52 269 263 HOH HOH A . 
G 3 HOH 53 270 267 HOH HOH A . 
G 3 HOH 54 271 271 HOH HOH A . 
H 3 HOH 1  220 1   HOH HOH B . 
H 3 HOH 2  221 8   HOH HOH B . 
H 3 HOH 3  222 15  HOH HOH B . 
H 3 HOH 4  223 19  HOH HOH B . 
H 3 HOH 5  224 22  HOH HOH B . 
H 3 HOH 6  225 24  HOH HOH B . 
H 3 HOH 7  226 26  HOH HOH B . 
H 3 HOH 8  227 27  HOH HOH B . 
H 3 HOH 9  228 32  HOH HOH B . 
H 3 HOH 10 229 37  HOH HOH B . 
H 3 HOH 11 230 40  HOH HOH B . 
H 3 HOH 12 231 41  HOH HOH B . 
H 3 HOH 13 232 47  HOH HOH B . 
H 3 HOH 14 233 51  HOH HOH B . 
H 3 HOH 15 234 57  HOH HOH B . 
H 3 HOH 16 235 61  HOH HOH B . 
H 3 HOH 17 236 62  HOH HOH B . 
H 3 HOH 18 237 68  HOH HOH B . 
H 3 HOH 19 238 75  HOH HOH B . 
H 3 HOH 20 239 76  HOH HOH B . 
H 3 HOH 21 240 77  HOH HOH B . 
H 3 HOH 22 241 81  HOH HOH B . 
H 3 HOH 23 242 83  HOH HOH B . 
H 3 HOH 24 243 87  HOH HOH B . 
H 3 HOH 25 244 99  HOH HOH B . 
H 3 HOH 26 245 106 HOH HOH B . 
H 3 HOH 27 246 110 HOH HOH B . 
H 3 HOH 28 247 111 HOH HOH B . 
H 3 HOH 29 248 112 HOH HOH B . 
H 3 HOH 30 249 114 HOH HOH B . 
H 3 HOH 31 250 116 HOH HOH B . 
H 3 HOH 32 251 120 HOH HOH B . 
H 3 HOH 33 252 122 HOH HOH B . 
H 3 HOH 34 253 124 HOH HOH B . 
H 3 HOH 35 254 127 HOH HOH B . 
H 3 HOH 36 255 138 HOH HOH B . 
H 3 HOH 37 256 139 HOH HOH B . 
H 3 HOH 38 257 145 HOH HOH B . 
H 3 HOH 39 258 148 HOH HOH B . 
H 3 HOH 40 259 150 HOH HOH B . 
H 3 HOH 41 260 153 HOH HOH B . 
H 3 HOH 42 261 155 HOH HOH B . 
H 3 HOH 43 262 161 HOH HOH B . 
H 3 HOH 44 263 165 HOH HOH B . 
H 3 HOH 45 264 169 HOH HOH B . 
H 3 HOH 46 265 171 HOH HOH B . 
H 3 HOH 47 266 172 HOH HOH B . 
H 3 HOH 48 267 174 HOH HOH B . 
H 3 HOH 49 268 176 HOH HOH B . 
H 3 HOH 50 269 177 HOH HOH B . 
H 3 HOH 51 270 178 HOH HOH B . 
H 3 HOH 52 271 185 HOH HOH B . 
H 3 HOH 53 272 187 HOH HOH B . 
H 3 HOH 54 273 192 HOH HOH B . 
H 3 HOH 55 274 194 HOH HOH B . 
H 3 HOH 56 275 195 HOH HOH B . 
H 3 HOH 57 276 196 HOH HOH B . 
H 3 HOH 58 277 200 HOH HOH B . 
H 3 HOH 59 278 201 HOH HOH B . 
H 3 HOH 60 279 202 HOH HOH B . 
H 3 HOH 61 280 203 HOH HOH B . 
H 3 HOH 62 281 216 HOH HOH B . 
H 3 HOH 63 282 217 HOH HOH B . 
H 3 HOH 64 283 218 HOH HOH B . 
H 3 HOH 65 284 221 HOH HOH B . 
H 3 HOH 66 285 231 HOH HOH B . 
H 3 HOH 67 286 244 HOH HOH B . 
H 3 HOH 68 287 249 HOH HOH B . 
H 3 HOH 69 288 251 HOH HOH B . 
H 3 HOH 70 289 259 HOH HOH B . 
H 3 HOH 71 290 260 HOH HOH B . 
H 3 HOH 72 291 261 HOH HOH B . 
H 3 HOH 73 292 262 HOH HOH B . 
H 3 HOH 74 293 268 HOH HOH B . 
H 3 HOH 75 294 272 HOH HOH B . 
#