data_1AUQ
# 
_entry.id   1AUQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AUQ         
WWPDB D_1000171282 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AUQ 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Emsley, J.'     1 
'Cruz, M.'       2 
'Handin, R.'     3 
'Liddington, R.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the von Willebrand Factor A1 domain and implications for the binding of platelet glycoprotein Ib.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            273 
_citation.page_first                10396 
_citation.page_last                 10401 
_citation.year                      1998 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9553097 
_citation.pdbx_database_id_DOI      10.1074/jbc.273.17.10396 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Emsley, J.'     1 
primary 'Cruz, M.'       2 
primary 'Handin, R.'     3 
primary 'Liddington, R.' 4 
# 
_cell.entry_id           1AUQ 
_cell.length_a           86.395 
_cell.length_b           86.395 
_cell.length_c           68.125 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1AUQ 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'A1 DOMAIN OF VON WILLEBRAND FACTOR' 23760.512 1  ? ? A1 ? 
2 non-polymer syn 'CADMIUM ION'                        112.411   1  ? ? ?  ? 
3 water       nat water                                18.015    91 ? ? ?  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSEL
RRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHA
NLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSEL
RRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHA
NLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   SER n 
1 4   GLU n 
1 5   PRO n 
1 6   PRO n 
1 7   LEU n 
1 8   HIS n 
1 9   ASP n 
1 10  PHE n 
1 11  TYR n 
1 12  CYS n 
1 13  SER n 
1 14  ARG n 
1 15  LEU n 
1 16  LEU n 
1 17  ASP n 
1 18  LEU n 
1 19  VAL n 
1 20  PHE n 
1 21  LEU n 
1 22  LEU n 
1 23  ASP n 
1 24  GLY n 
1 25  SER n 
1 26  SER n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  GLU n 
1 33  PHE n 
1 34  GLU n 
1 35  VAL n 
1 36  LEU n 
1 37  LYS n 
1 38  ALA n 
1 39  PHE n 
1 40  VAL n 
1 41  VAL n 
1 42  ASP n 
1 43  MET n 
1 44  MET n 
1 45  GLU n 
1 46  ARG n 
1 47  LEU n 
1 48  ARG n 
1 49  ILE n 
1 50  SER n 
1 51  GLN n 
1 52  LYS n 
1 53  TRP n 
1 54  VAL n 
1 55  ARG n 
1 56  VAL n 
1 57  ALA n 
1 58  VAL n 
1 59  VAL n 
1 60  GLU n 
1 61  TYR n 
1 62  HIS n 
1 63  ASP n 
1 64  GLY n 
1 65  SER n 
1 66  HIS n 
1 67  ALA n 
1 68  TYR n 
1 69  ILE n 
1 70  GLY n 
1 71  LEU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  LYS n 
1 76  ARG n 
1 77  PRO n 
1 78  SER n 
1 79  GLU n 
1 80  LEU n 
1 81  ARG n 
1 82  ARG n 
1 83  ILE n 
1 84  ALA n 
1 85  SER n 
1 86  GLN n 
1 87  VAL n 
1 88  LYS n 
1 89  TYR n 
1 90  ALA n 
1 91  GLY n 
1 92  SER n 
1 93  GLN n 
1 94  VAL n 
1 95  ALA n 
1 96  SER n 
1 97  THR n 
1 98  SER n 
1 99  GLU n 
1 100 VAL n 
1 101 LEU n 
1 102 LYS n 
1 103 TYR n 
1 104 THR n 
1 105 LEU n 
1 106 PHE n 
1 107 GLN n 
1 108 ILE n 
1 109 PHE n 
1 110 SER n 
1 111 LYS n 
1 112 ILE n 
1 113 ASP n 
1 114 ARG n 
1 115 PRO n 
1 116 GLU n 
1 117 ALA n 
1 118 SER n 
1 119 ARG n 
1 120 ILE n 
1 121 ALA n 
1 122 LEU n 
1 123 LEU n 
1 124 LEU n 
1 125 MET n 
1 126 ALA n 
1 127 SER n 
1 128 GLN n 
1 129 GLU n 
1 130 PRO n 
1 131 GLN n 
1 132 ARG n 
1 133 MET n 
1 134 SER n 
1 135 ARG n 
1 136 ASN n 
1 137 PHE n 
1 138 VAL n 
1 139 ARG n 
1 140 TYR n 
1 141 VAL n 
1 142 GLN n 
1 143 GLY n 
1 144 LEU n 
1 145 LYS n 
1 146 LYS n 
1 147 LYS n 
1 148 LYS n 
1 149 VAL n 
1 150 ILE n 
1 151 VAL n 
1 152 ILE n 
1 153 PRO n 
1 154 VAL n 
1 155 GLY n 
1 156 ILE n 
1 157 GLY n 
1 158 PRO n 
1 159 HIS n 
1 160 ALA n 
1 161 ASN n 
1 162 LEU n 
1 163 LYS n 
1 164 GLN n 
1 165 ILE n 
1 166 ARG n 
1 167 LEU n 
1 168 ILE n 
1 169 GLU n 
1 170 LYS n 
1 171 GLN n 
1 172 ALA n 
1 173 PRO n 
1 174 GLU n 
1 175 ASN n 
1 176 LYS n 
1 177 ALA n 
1 178 PHE n 
1 179 VAL n 
1 180 LEU n 
1 181 SER n 
1 182 SER n 
1 183 VAL n 
1 184 ASP n 
1 185 GLU n 
1 186 LEU n 
1 187 GLU n 
1 188 GLN n 
1 189 GLN n 
1 190 ARG n 
1 191 ASP n 
1 192 GLU n 
1 193 ILE n 
1 194 VAL n 
1 195 SER n 
1 196 TYR n 
1 197 LEU n 
1 198 CYS n 
1 199 ASP n 
1 200 LEU n 
1 201 ALA n 
1 202 PRO n 
1 203 GLU n 
1 204 ALA n 
1 205 PRO n 
1 206 PRO n 
1 207 PRO n 
1 208 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                BLOOD 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VWF_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04275 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGK
RVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCG
LCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTCQSLHINEM
CQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPGTSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFD
NRYFTFSGICQYLLARDCQDHSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQ
DLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRV
AWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECM
SMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDG
LKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLD
SSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTW
RTATLCPQSCEERNLRENGYECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE
VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSRLLDLVF
LLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEV
LKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL
SSVDELEQQRDEIVSYLCDLAPEAPPPTLPPHMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVLEGSDKIGEADFNRSKEF
MEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQA
PNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL
SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLVDV
MQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILA
GPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD
RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQDLEVILHNGACSPGARQG
CMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASK
TYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFY
AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCDGNVSSCGDHPSEGCFCPPD
KVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCC
PEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN
STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAVMGLRVAQCSQKPCEDSCRSG
FTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQWASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSG
FQLSCKTSACCPSCRCERMEACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC
CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCE
EPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLN
AMECKCSPRKCSK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AUQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 208 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04275 
_struct_ref_seq.db_align_beg                  1261 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1468 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       498 
_struct_ref_seq.pdbx_auth_seq_align_end       705 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CD  non-polymer         . 'CADMIUM ION'   ? 'Cd 2'           112.411 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AUQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.09 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M TRIS PH 8.5, 5MM CDCL2, 5% PEG 8K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1997-06 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AUQ 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   11849 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.083 
_reflns.pdbx_netI_over_sigmaI        13.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.4 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   61.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.245 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1AUQ 
_refine.ls_number_reflns_obs                     11021 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    85.4 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.248 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               18.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'ALPHA2 I DOMAIN' 
_refine.pdbx_method_to_determine_struct          'MIR, MR' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1667 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               1759 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.64  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.7  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.61  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.3 
_refine_ls_shell.d_res_low                        2.4 
_refine_ls_shell.number_reflns_R_work             78 
_refine_ls_shell.R_factor_R_work                  0.3786 
_refine_ls_shell.percent_reflns_obs               54.6 
_refine_ls_shell.R_factor_R_free                  0.2475 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO  'X-RAY DIFFRACTION' 
2 PARAMPCA.B72 TOPHPCA.B72  'X-RAY DIFFRACTION' 
3 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
4 PARDNA.PRO   TOPDNA.PRO   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AUQ 
_struct.title                     'A1 DOMAIN OF VON WILLEBRAND FACTOR' 
_struct.pdbx_descriptor           'A1 DOMAIN OF VON WILLEBRAND FACTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AUQ 
_struct_keywords.pdbx_keywords   WILLEBRAND 
_struct_keywords.text            'WILLEBRAND, BLOOD COAGULATION, PLATELET, GLYCOPROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 30  ? ARG A 46  ? GLU A 527 ARG A 543 1 ? 17 
HELX_P HELX_P2 2 PRO A 77  ? SER A 85  ? PRO A 574 SER A 582 1 ? 9  
HELX_P HELX_P3 3 THR A 97  ? PHE A 106 ? THR A 594 PHE A 603 1 ? 10 
HELX_P HELX_P4 4 GLN A 131 ? MET A 133 ? GLN A 628 MET A 630 5 ? 3  
HELX_P HELX_P5 5 PHE A 137 ? LYS A 146 ? PHE A 634 LYS A 643 1 ? 10 
HELX_P HELX_P6 6 LEU A 162 ? GLN A 171 ? LEU A 659 GLN A 668 1 ? 10 
HELX_P HELX_P7 7 VAL A 183 ? LEU A 200 ? VAL A 680 LEU A 697 5 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 12 SG  ? ? ? 1_555 A CYS 198 SG ? ? A CYS 509 A CYS 695 1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc1 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 B CD  .   CD ? ? A HIS 559 A CD  400 1_555 ? ? ? ? ? ? ? 2.639 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 178 ? LEU A 180 ? PHE A 675 LEU A 677 
A 2 VAL A 149 ? ILE A 156 ? VAL A 646 ILE A 653 
A 3 SER A 118 ? MET A 125 ? SER A 615 MET A 622 
A 4 LEU A 16  ? ASP A 23  ? LEU A 513 ASP A 520 
A 5 VAL A 54  ? TYR A 61  ? VAL A 551 TYR A 558 
A 6 SER A 65  ? ILE A 69  ? SER A 562 ILE A 566 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 178 ? O PHE A 675 N GLY A 155 ? N GLY A 652 
A 2 3 O ILE A 150 ? O ILE A 647 N ARG A 119 ? N ARG A 616 
A 3 4 O SER A 118 ? O SER A 615 N ASP A 17  ? N ASP A 514 
A 4 5 O LEU A 16  ? O LEU A 513 N ARG A 55  ? N ARG A 552 
A 5 6 O VAL A 58  ? O VAL A 555 N ILE A 69  ? N ILE A 566 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE CD A 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 HIS A 62 ? HIS A 559 . ? 1_555 ? 
2 AC1 2 HIS A 66 ? HIS A 563 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AUQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AUQ 
_atom_sites.fract_transf_matrix[1][1]   0.011575 
_atom_sites.fract_transf_matrix[1][2]   0.006683 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013365 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014679 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 1   ? 22.142 52.453 -14.520 1.00 83.59 ? 498 ASP A N   1 
ATOM   2    C  CA  . ASP A 1 1   ? 20.770 52.768 -14.026 1.00 83.86 ? 498 ASP A CA  1 
ATOM   3    C  C   . ASP A 1 1   ? 20.803 53.068 -12.522 1.00 81.16 ? 498 ASP A C   1 
ATOM   4    O  O   . ASP A 1 1   ? 20.978 52.165 -11.696 1.00 81.93 ? 498 ASP A O   1 
ATOM   5    C  CB  . ASP A 1 1   ? 19.821 51.597 -14.327 1.00 87.23 ? 498 ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 1   ? 18.352 51.961 -14.133 1.00 88.94 ? 498 ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 1   ? 18.022 53.171 -14.084 1.00 88.91 ? 498 ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 1   ? 17.521 51.027 -14.033 1.00 90.11 ? 498 ASP A OD2 1 
ATOM   9    N  N   . ILE A 1 2   ? 20.620 54.343 -12.190 1.00 76.43 ? 499 ILE A N   1 
ATOM   10   C  CA  . ILE A 1 2   ? 20.649 54.829 -10.809 1.00 70.82 ? 499 ILE A CA  1 
ATOM   11   C  C   . ILE A 1 2   ? 19.237 55.126 -10.255 1.00 64.40 ? 499 ILE A C   1 
ATOM   12   O  O   . ILE A 1 2   ? 18.888 56.265 -9.941  1.00 62.53 ? 499 ILE A O   1 
ATOM   13   C  CB  . ILE A 1 2   ? 21.596 56.076 -10.724 1.00 75.17 ? 499 ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 2   ? 21.872 56.476 -9.278  1.00 77.18 ? 499 ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 2   ? 21.030 57.256 -11.527 1.00 77.54 ? 499 ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 2   ? 23.010 57.485 -9.141  1.00 79.34 ? 499 ILE A CD1 1 
ATOM   17   N  N   . SER A 1 3   ? 18.445 54.071 -10.111 1.00 58.81 ? 500 SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? 17.073 54.170 -9.616  1.00 52.67 ? 500 SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? 16.771 52.914 -8.797  1.00 46.03 ? 500 SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? 17.477 51.915 -8.928  1.00 46.10 ? 500 SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? 16.085 54.306 -10.779 1.00 55.03 ? 500 SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? 14.814 54.747 -10.320 1.00 55.43 ? 500 SER A OG  1 
ATOM   23   N  N   . GLU A 1 4   ? 15.690 52.946 -8.017  1.00 39.21 ? 501 GLU A N   1 
ATOM   24   C  CA  . GLU A 1 4   ? 15.341 51.839 -7.124  1.00 33.62 ? 501 GLU A CA  1 
ATOM   25   C  C   . GLU A 1 4   ? 13.826 51.632 -6.967  1.00 33.73 ? 501 GLU A C   1 
ATOM   26   O  O   . GLU A 1 4   ? 13.055 52.575 -7.148  1.00 35.42 ? 501 GLU A O   1 
ATOM   27   C  CB  . GLU A 1 4   ? 16.025 52.088 -5.772  1.00 27.09 ? 501 GLU A CB  1 
ATOM   28   C  CG  . GLU A 1 4   ? 15.928 53.517 -5.328  1.00 23.81 ? 501 GLU A CG  1 
ATOM   29   C  CD  . GLU A 1 4   ? 17.036 53.971 -4.394  1.00 22.26 ? 501 GLU A CD  1 
ATOM   30   O  OE1 . GLU A 1 4   ? 18.150 53.442 -4.407  1.00 23.46 ? 501 GLU A OE1 1 
ATOM   31   O  OE2 . GLU A 1 4   ? 16.790 54.912 -3.645  1.00 19.78 ? 501 GLU A OE2 1 
ATOM   32   N  N   . PRO A 1 5   ? 13.390 50.408 -6.585  1.00 32.77 ? 502 PRO A N   1 
ATOM   33   C  CA  . PRO A 1 5   ? 11.980 50.038 -6.406  1.00 33.37 ? 502 PRO A CA  1 
ATOM   34   C  C   . PRO A 1 5   ? 11.257 50.886 -5.377  1.00 36.76 ? 502 PRO A C   1 
ATOM   35   O  O   . PRO A 1 5   ? 11.881 51.657 -4.655  1.00 40.35 ? 502 PRO A O   1 
ATOM   36   C  CB  . PRO A 1 5   ? 12.056 48.588 -5.911  1.00 32.84 ? 502 PRO A CB  1 
ATOM   37   C  CG  . PRO A 1 5   ? 13.426 48.154 -6.188  1.00 30.80 ? 502 PRO A CG  1 
ATOM   38   C  CD  . PRO A 1 5   ? 14.248 49.372 -5.994  1.00 33.53 ? 502 PRO A CD  1 
ATOM   39   N  N   . PRO A 1 6   ? 9.921  50.743 -5.283  1.00 38.50 ? 503 PRO A N   1 
ATOM   40   C  CA  . PRO A 1 6   ? 9.095  51.495 -4.332  1.00 36.00 ? 503 PRO A CA  1 
ATOM   41   C  C   . PRO A 1 6   ? 9.217  50.861 -2.962  1.00 33.78 ? 503 PRO A C   1 
ATOM   42   O  O   . PRO A 1 6   ? 9.351  49.642 -2.870  1.00 33.98 ? 503 PRO A O   1 
ATOM   43   C  CB  . PRO A 1 6   ? 7.670  51.270 -4.844  1.00 35.94 ? 503 PRO A CB  1 
ATOM   44   C  CG  . PRO A 1 6   ? 7.844  50.708 -6.240  1.00 36.76 ? 503 PRO A CG  1 
ATOM   45   C  CD  . PRO A 1 6   ? 9.074  49.889 -6.137  1.00 37.21 ? 503 PRO A CD  1 
ATOM   46   N  N   . LEU A 1 7   ? 9.225  51.670 -1.910  1.00 32.48 ? 504 LEU A N   1 
ATOM   47   C  CA  . LEU A 1 7   ? 9.284  51.120 -0.562  1.00 31.29 ? 504 LEU A CA  1 
ATOM   48   C  C   . LEU A 1 7   ? 7.869  50.821 -0.120  1.00 31.74 ? 504 LEU A C   1 
ATOM   49   O  O   . LEU A 1 7   ? 7.663  50.104 0.847   1.00 34.42 ? 504 LEU A O   1 
ATOM   50   C  CB  . LEU A 1 7   ? 9.857  52.133 0.427   1.00 27.31 ? 504 LEU A CB  1 
ATOM   51   C  CG  . LEU A 1 7   ? 11.346 52.216 0.633   1.00 20.47 ? 504 LEU A CG  1 
ATOM   52   C  CD1 . LEU A 1 7   ? 11.608 53.354 1.577   1.00 16.31 ? 504 LEU A CD1 1 
ATOM   53   C  CD2 . LEU A 1 7   ? 11.865 50.886 1.213   1.00 22.70 ? 504 LEU A CD2 1 
ATOM   54   N  N   . HIS A 1 8   ? 6.892  51.433 -0.779  1.00 32.33 ? 505 HIS A N   1 
ATOM   55   C  CA  . HIS A 1 8   ? 5.508  51.234 -0.382  1.00 33.59 ? 505 HIS A CA  1 
ATOM   56   C  C   . HIS A 1 8   ? 4.574  50.872 -1.506  1.00 37.41 ? 505 HIS A C   1 
ATOM   57   O  O   . HIS A 1 8   ? 4.980  50.817 -2.669  1.00 38.66 ? 505 HIS A O   1 
ATOM   58   C  CB  . HIS A 1 8   ? 4.977  52.504 0.277   1.00 30.39 ? 505 HIS A CB  1 
ATOM   59   C  CG  . HIS A 1 8   ? 5.799  52.956 1.432   1.00 24.50 ? 505 HIS A CG  1 
ATOM   60   N  ND1 . HIS A 1 8   ? 6.533  54.118 1.413   1.00 26.88 ? 505 HIS A ND1 1 
ATOM   61   C  CD2 . HIS A 1 8   ? 6.041  52.377 2.628   1.00 22.75 ? 505 HIS A CD2 1 
ATOM   62   C  CE1 . HIS A 1 8   ? 7.195  54.235 2.543   1.00 22.86 ? 505 HIS A CE1 1 
ATOM   63   N  NE2 . HIS A 1 8   ? 6.915  53.193 3.297   1.00 23.78 ? 505 HIS A NE2 1 
ATOM   64   N  N   . ASP A 1 9   ? 3.323  50.612 -1.125  1.00 39.57 ? 506 ASP A N   1 
ATOM   65   C  CA  . ASP A 1 9   ? 2.254  50.291 -2.072  1.00 41.22 ? 506 ASP A CA  1 
ATOM   66   C  C   . ASP A 1 9   ? 1.600  51.614 -2.482  1.00 39.47 ? 506 ASP A C   1 
ATOM   67   O  O   . ASP A 1 9   ? 1.306  51.826 -3.651  1.00 42.48 ? 506 ASP A O   1 
ATOM   68   C  CB  . ASP A 1 9   ? 1.231  49.325 -1.443  1.00 44.20 ? 506 ASP A CB  1 
ATOM   69   C  CG  . ASP A 1 9   ? 1.831  47.941 -1.106  1.00 47.68 ? 506 ASP A CG  1 
ATOM   70   O  OD1 . ASP A 1 9   ? 2.837  47.508 -1.730  1.00 48.34 ? 506 ASP A OD1 1 
ATOM   71   O  OD2 . ASP A 1 9   ? 1.276  47.272 -0.209  1.00 49.92 ? 506 ASP A OD2 1 
ATOM   72   N  N   . PHE A 1 10  ? 1.367  52.497 -1.507  1.00 38.50 ? 507 PHE A N   1 
ATOM   73   C  CA  . PHE A 1 10  ? 0.800  53.830 -1.756  1.00 35.03 ? 507 PHE A CA  1 
ATOM   74   C  C   . PHE A 1 10  ? 2.016  54.527 -2.406  1.00 36.00 ? 507 PHE A C   1 
ATOM   75   O  O   . PHE A 1 10  ? 3.086  54.637 -1.780  1.00 35.29 ? 507 PHE A O   1 
ATOM   76   C  CB  . PHE A 1 10  ? 0.408  54.471 -0.418  1.00 32.75 ? 507 PHE A CB  1 
ATOM   77   C  CG  . PHE A 1 10  ? -0.252 55.810 -0.552  1.00 32.71 ? 507 PHE A CG  1 
ATOM   78   C  CD1 . PHE A 1 10  ? -1.605 55.915 -0.866  1.00 33.60 ? 507 PHE A CD1 1 
ATOM   79   C  CD2 . PHE A 1 10  ? 0.471  56.969 -0.343  1.00 29.61 ? 507 PHE A CD2 1 
ATOM   80   C  CE1 . PHE A 1 10  ? -2.216 57.157 -0.962  1.00 31.49 ? 507 PHE A CE1 1 
ATOM   81   C  CE2 . PHE A 1 10  ? -0.132 58.205 -0.437  1.00 29.32 ? 507 PHE A CE2 1 
ATOM   82   C  CZ  . PHE A 1 10  ? -1.477 58.298 -0.750  1.00 33.05 ? 507 PHE A CZ  1 
ATOM   83   N  N   . TYR A 1 11  ? 1.839  55.032 -3.624  1.00 35.32 ? 508 TYR A N   1 
ATOM   84   C  CA  . TYR A 1 11  ? 2.955  55.578 -4.396  1.00 32.82 ? 508 TYR A CA  1 
ATOM   85   C  C   . TYR A 1 11  ? 2.445  56.499 -5.515  1.00 33.01 ? 508 TYR A C   1 
ATOM   86   O  O   . TYR A 1 11  ? 1.484  56.154 -6.200  1.00 39.06 ? 508 TYR A O   1 
ATOM   87   C  CB  . TYR A 1 11  ? 3.612  54.364 -5.053  1.00 27.12 ? 508 TYR A CB  1 
ATOM   88   C  CG  . TYR A 1 11  ? 5.027  54.464 -5.529  1.00 31.57 ? 508 TYR A CG  1 
ATOM   89   C  CD1 . TYR A 1 11  ? 6.041  54.922 -4.680  1.00 35.35 ? 508 TYR A CD1 1 
ATOM   90   C  CD2 . TYR A 1 11  ? 5.389  53.946 -6.771  1.00 28.70 ? 508 TYR A CD2 1 
ATOM   91   C  CE1 . TYR A 1 11  ? 7.397  54.848 -5.054  1.00 36.51 ? 508 TYR A CE1 1 
ATOM   92   C  CE2 . TYR A 1 11  ? 6.730  53.862 -7.154  1.00 33.58 ? 508 TYR A CE2 1 
ATOM   93   C  CZ  . TYR A 1 11  ? 7.735  54.309 -6.294  1.00 36.83 ? 508 TYR A CZ  1 
ATOM   94   O  OH  . TYR A 1 11  ? 9.075  54.176 -6.649  1.00 40.00 ? 508 TYR A OH  1 
ATOM   95   N  N   . CYS A 1 12  ? 3.046  57.662 -5.717  1.00 28.11 ? 509 CYS A N   1 
ATOM   96   C  CA  . CYS A 1 12  ? 2.593  58.516 -6.822  1.00 27.15 ? 509 CYS A CA  1 
ATOM   97   C  C   . CYS A 1 12  ? 3.509  58.310 -8.009  1.00 25.32 ? 509 CYS A C   1 
ATOM   98   O  O   . CYS A 1 12  ? 4.717  58.512 -7.909  1.00 30.67 ? 509 CYS A O   1 
ATOM   99   C  CB  . CYS A 1 12  ? 2.572  59.997 -6.464  1.00 25.77 ? 509 CYS A CB  1 
ATOM   100  S  SG  . CYS A 1 12  ? 1.888  61.004 -7.834  1.00 21.50 ? 509 CYS A SG  1 
ATOM   101  N  N   . SER A 1 13  ? 2.939  57.837 -9.102  1.00 23.50 ? 510 SER A N   1 
ATOM   102  C  CA  . SER A 1 13  ? 3.686  57.590 -10.321 1.00 25.91 ? 510 SER A CA  1 
ATOM   103  C  C   . SER A 1 13  ? 3.052  58.414 -11.475 1.00 25.38 ? 510 SER A C   1 
ATOM   104  O  O   . SER A 1 13  ? 2.384  57.882 -12.364 1.00 32.01 ? 510 SER A O   1 
ATOM   105  C  CB  . SER A 1 13  ? 3.687  56.087 -10.612 1.00 24.85 ? 510 SER A CB  1 
ATOM   106  O  OG  . SER A 1 13  ? 4.275  55.783 -11.867 1.00 29.60 ? 510 SER A OG  1 
ATOM   107  N  N   . ARG A 1 14  ? 3.236  59.726 -11.434 1.00 19.35 ? 511 ARG A N   1 
ATOM   108  C  CA  . ARG A 1 14  ? 2.689  60.596 -12.451 1.00 16.16 ? 511 ARG A CA  1 
ATOM   109  C  C   . ARG A 1 14  ? 3.757  61.589 -12.810 1.00 20.03 ? 511 ARG A C   1 
ATOM   110  O  O   . ARG A 1 14  ? 4.825  61.584 -12.191 1.00 24.48 ? 511 ARG A O   1 
ATOM   111  C  CB  . ARG A 1 14  ? 1.439  61.310 -11.952 1.00 13.51 ? 511 ARG A CB  1 
ATOM   112  C  CG  . ARG A 1 14  ? 0.300  60.358 -11.708 1.00 13.74 ? 511 ARG A CG  1 
ATOM   113  C  CD  . ARG A 1 14  ? -0.994 61.084 -11.674 1.00 12.03 ? 511 ARG A CD  1 
ATOM   114  N  NE  . ARG A 1 14  ? -2.111 60.169 -11.505 1.00 12.96 ? 511 ARG A NE  1 
ATOM   115  C  CZ  . ARG A 1 14  ? -3.388 60.547 -11.582 1.00 16.84 ? 511 ARG A CZ  1 
ATOM   116  N  NH1 . ARG A 1 14  ? -3.700 61.814 -11.841 1.00 18.71 ? 511 ARG A NH1 1 
ATOM   117  N  NH2 . ARG A 1 14  ? -4.361 59.680 -11.342 1.00 18.41 ? 511 ARG A NH2 1 
ATOM   118  N  N   . LEU A 1 15  ? 3.482  62.427 -13.810 1.00 16.95 ? 512 LEU A N   1 
ATOM   119  C  CA  . LEU A 1 15  ? 4.457  63.400 -14.279 1.00 17.28 ? 512 LEU A CA  1 
ATOM   120  C  C   . LEU A 1 15  ? 4.337  64.645 -13.434 1.00 16.82 ? 512 LEU A C   1 
ATOM   121  O  O   . LEU A 1 15  ? 3.544  65.534 -13.715 1.00 18.14 ? 512 LEU A O   1 
ATOM   122  C  CB  . LEU A 1 15  ? 4.220  63.668 -15.756 1.00 18.43 ? 512 LEU A CB  1 
ATOM   123  C  CG  . LEU A 1 15  ? 4.357  62.372 -16.556 1.00 17.02 ? 512 LEU A CG  1 
ATOM   124  C  CD1 . LEU A 1 15  ? 3.947  62.602 -17.993 1.00 15.13 ? 512 LEU A CD1 1 
ATOM   125  C  CD2 . LEU A 1 15  ? 5.796  61.865 -16.461 1.00 16.19 ? 512 LEU A CD2 1 
ATOM   126  N  N   . LEU A 1 16  ? 5.226  64.748 -12.458 1.00 19.32 ? 513 LEU A N   1 
ATOM   127  C  CA  . LEU A 1 16  ? 5.162  65.827 -11.501 1.00 18.08 ? 513 LEU A CA  1 
ATOM   128  C  C   . LEU A 1 16  ? 6.506  66.390 -11.089 1.00 15.12 ? 513 LEU A C   1 
ATOM   129  O  O   . LEU A 1 16  ? 7.477  65.655 -10.948 1.00 14.11 ? 513 LEU A O   1 
ATOM   130  C  CB  . LEU A 1 16  ? 4.454  65.273 -10.257 1.00 19.36 ? 513 LEU A CB  1 
ATOM   131  C  CG  . LEU A 1 16  ? 4.260  66.123 -9.012  1.00 20.52 ? 513 LEU A CG  1 
ATOM   132  C  CD1 . LEU A 1 16  ? 3.338  67.259 -9.353  1.00 18.37 ? 513 LEU A CD1 1 
ATOM   133  C  CD2 . LEU A 1 16  ? 3.698  65.270 -7.902  1.00 12.16 ? 513 LEU A CD2 1 
ATOM   134  N  N   . ASP A 1 17  ? 6.534  67.699 -10.853 1.00 16.07 ? 514 ASP A N   1 
ATOM   135  C  CA  . ASP A 1 17  ? 7.735  68.384 -10.383 1.00 16.17 ? 514 ASP A CA  1 
ATOM   136  C  C   . ASP A 1 17  ? 7.257  68.946 -9.041  1.00 15.61 ? 514 ASP A C   1 
ATOM   137  O  O   . ASP A 1 17  ? 6.480  69.890 -9.014  1.00 16.76 ? 514 ASP A O   1 
ATOM   138  C  CB  . ASP A 1 17  ? 8.136  69.530 -11.327 1.00 15.99 ? 514 ASP A CB  1 
ATOM   139  C  CG  . ASP A 1 17  ? 9.016  69.076 -12.511 1.00 18.33 ? 514 ASP A CG  1 
ATOM   140  O  OD1 . ASP A 1 17  ? 9.255  67.874 -12.736 1.00 17.22 ? 514 ASP A OD1 1 
ATOM   141  O  OD2 . ASP A 1 17  ? 9.492  69.961 -13.240 1.00 25.18 ? 514 ASP A OD2 1 
ATOM   142  N  N   . LEU A 1 18  ? 7.660  68.338 -7.929  1.00 15.44 ? 515 LEU A N   1 
ATOM   143  C  CA  . LEU A 1 18  ? 7.205  68.808 -6.623  1.00 14.64 ? 515 LEU A CA  1 
ATOM   144  C  C   . LEU A 1 18  ? 8.282  69.524 -5.802  1.00 14.01 ? 515 LEU A C   1 
ATOM   145  O  O   . LEU A 1 18  ? 9.382  68.995 -5.603  1.00 8.40  ? 515 LEU A O   1 
ATOM   146  C  CB  . LEU A 1 18  ? 6.613  67.625 -5.853  1.00 14.99 ? 515 LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 18  ? 6.168  67.788 -4.396  1.00 9.59  ? 515 LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 18  ? 5.054  68.775 -4.249  1.00 5.58  ? 515 LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 18  ? 5.714  66.455 -3.924  1.00 8.85  ? 515 LEU A CD2 1 
ATOM   150  N  N   . VAL A 1 19  ? 7.975  70.743 -5.355  1.00 10.50 ? 516 VAL A N   1 
ATOM   151  C  CA  . VAL A 1 19  ? 8.927  71.514 -4.566  1.00 13.88 ? 516 VAL A CA  1 
ATOM   152  C  C   . VAL A 1 19  ? 8.504  71.601 -3.100  1.00 14.19 ? 516 VAL A C   1 
ATOM   153  O  O   . VAL A 1 19  ? 7.400  72.059 -2.796  1.00 14.17 ? 516 VAL A O   1 
ATOM   154  C  CB  . VAL A 1 19  ? 9.103  72.966 -5.111  1.00 15.97 ? 516 VAL A CB  1 
ATOM   155  C  CG1 . VAL A 1 19  ? 10.134 73.711 -4.278  1.00 14.88 ? 516 VAL A CG1 1 
ATOM   156  C  CG2 . VAL A 1 19  ? 9.580  72.947 -6.570  1.00 14.16 ? 516 VAL A CG2 1 
ATOM   157  N  N   . PHE A 1 20  ? 9.359  71.127 -2.191  1.00 17.00 ? 517 PHE A N   1 
ATOM   158  C  CA  . PHE A 1 20  ? 9.072  71.205 -0.747  1.00 13.51 ? 517 PHE A CA  1 
ATOM   159  C  C   . PHE A 1 20  ? 9.776  72.469 -0.179  1.00 12.08 ? 517 PHE A C   1 
ATOM   160  O  O   . PHE A 1 20  ? 11.009 72.587 -0.233  1.00 10.17 ? 517 PHE A O   1 
ATOM   161  C  CB  . PHE A 1 20  ? 9.602  69.968 -0.024  1.00 15.54 ? 517 PHE A CB  1 
ATOM   162  C  CG  . PHE A 1 20  ? 8.940  68.662 -0.426  1.00 11.63 ? 517 PHE A CG  1 
ATOM   163  C  CD1 . PHE A 1 20  ? 7.805  68.200 0.230   1.00 13.47 ? 517 PHE A CD1 1 
ATOM   164  C  CD2 . PHE A 1 20  ? 9.517  67.852 -1.400  1.00 9.53  ? 517 PHE A CD2 1 
ATOM   165  C  CE1 . PHE A 1 20  ? 7.256  66.952 -0.075  1.00 10.36 ? 517 PHE A CE1 1 
ATOM   166  C  CE2 . PHE A 1 20  ? 8.989  66.625 -1.703  1.00 8.49  ? 517 PHE A CE2 1 
ATOM   167  C  CZ  . PHE A 1 20  ? 7.847  66.164 -1.036  1.00 10.76 ? 517 PHE A CZ  1 
ATOM   168  N  N   . LEU A 1 21  ? 9.005  73.405 0.378   1.00 12.33 ? 518 LEU A N   1 
ATOM   169  C  CA  . LEU A 1 21  ? 9.574  74.643 0.926   1.00 12.65 ? 518 LEU A CA  1 
ATOM   170  C  C   . LEU A 1 21  ? 9.420  74.659 2.453   1.00 11.22 ? 518 LEU A C   1 
ATOM   171  O  O   . LEU A 1 21  ? 8.333  74.940 2.959   1.00 15.25 ? 518 LEU A O   1 
ATOM   172  C  CB  . LEU A 1 21  ? 8.884  75.865 0.287   1.00 9.93  ? 518 LEU A CB  1 
ATOM   173  C  CG  . LEU A 1 21  ? 8.791  75.956 -1.244  1.00 8.05  ? 518 LEU A CG  1 
ATOM   174  C  CD1 . LEU A 1 21  ? 7.840  77.076 -1.640  1.00 3.79  ? 518 LEU A CD1 1 
ATOM   175  C  CD2 . LEU A 1 21  ? 10.166 76.182 -1.857  1.00 10.27 ? 518 LEU A CD2 1 
ATOM   176  N  N   . LEU A 1 22  ? 10.514 74.399 3.168   1.00 7.04  ? 519 LEU A N   1 
ATOM   177  C  CA  . LEU A 1 22  ? 10.518 74.319 4.635   1.00 7.57  ? 519 LEU A CA  1 
ATOM   178  C  C   . LEU A 1 22  ? 10.795 75.567 5.440   1.00 4.28  ? 519 LEU A C   1 
ATOM   179  O  O   . LEU A 1 22  ? 11.867 76.131 5.339   1.00 10.10 ? 519 LEU A O   1 
ATOM   180  C  CB  . LEU A 1 22  ? 11.544 73.283 5.090   1.00 6.92  ? 519 LEU A CB  1 
ATOM   181  C  CG  . LEU A 1 22  ? 11.188 71.821 4.925   1.00 10.92 ? 519 LEU A CG  1 
ATOM   182  C  CD1 . LEU A 1 22  ? 11.011 71.550 3.470   1.00 8.66  ? 519 LEU A CD1 1 
ATOM   183  C  CD2 . LEU A 1 22  ? 12.295 70.951 5.489   1.00 7.00  ? 519 LEU A CD2 1 
ATOM   184  N  N   . ASP A 1 23  ? 9.891  75.908 6.352   1.00 11.69 ? 520 ASP A N   1 
ATOM   185  C  CA  . ASP A 1 23  ? 10.051 77.081 7.217   1.00 13.58 ? 520 ASP A CA  1 
ATOM   186  C  C   . ASP A 1 23  ? 11.330 76.914 8.057   1.00 14.38 ? 520 ASP A C   1 
ATOM   187  O  O   . ASP A 1 23  ? 11.469 75.933 8.775   1.00 18.86 ? 520 ASP A O   1 
ATOM   188  C  CB  . ASP A 1 23  ? 8.813  77.201 8.116   1.00 15.76 ? 520 ASP A CB  1 
ATOM   189  C  CG  . ASP A 1 23  ? 8.737  78.528 8.839   1.00 14.91 ? 520 ASP A CG  1 
ATOM   190  O  OD1 . ASP A 1 23  ? 9.744  78.970 9.394   1.00 15.53 ? 520 ASP A OD1 1 
ATOM   191  O  OD2 . ASP A 1 23  ? 7.671  79.143 8.870   1.00 15.00 ? 520 ASP A OD2 1 
ATOM   192  N  N   . GLY A 1 24  ? 12.272 77.847 7.958   1.00 12.62 ? 521 GLY A N   1 
ATOM   193  C  CA  . GLY A 1 24  ? 13.514 77.720 8.713   1.00 12.88 ? 521 GLY A CA  1 
ATOM   194  C  C   . GLY A 1 24  ? 13.617 78.637 9.919   1.00 17.26 ? 521 GLY A C   1 
ATOM   195  O  O   . GLY A 1 24  ? 14.690 78.785 10.508  1.00 16.89 ? 521 GLY A O   1 
ATOM   196  N  N   . SER A 1 25  ? 12.500 79.256 10.291  1.00 16.08 ? 522 SER A N   1 
ATOM   197  C  CA  . SER A 1 25  ? 12.452 80.168 11.420  1.00 17.98 ? 522 SER A CA  1 
ATOM   198  C  C   . SER A 1 25  ? 12.484 79.424 12.750  1.00 18.91 ? 522 SER A C   1 
ATOM   199  O  O   . SER A 1 25  ? 12.359 78.197 12.792  1.00 17.50 ? 522 SER A O   1 
ATOM   200  C  CB  . SER A 1 25  ? 11.158 80.967 11.371  1.00 12.88 ? 522 SER A CB  1 
ATOM   201  O  OG  . SER A 1 25  ? 10.069 80.128 11.708  1.00 12.60 ? 522 SER A OG  1 
ATOM   202  N  N   . SER A 1 26  ? 12.547 80.206 13.828  1.00 17.68 ? 523 SER A N   1 
ATOM   203  C  CA  . SER A 1 26  ? 12.558 79.701 15.187  1.00 20.71 ? 523 SER A CA  1 
ATOM   204  C  C   . SER A 1 26  ? 11.141 79.389 15.694  1.00 20.97 ? 523 SER A C   1 
ATOM   205  O  O   . SER A 1 26  ? 10.971 78.999 16.833  1.00 27.46 ? 523 SER A O   1 
ATOM   206  C  CB  . SER A 1 26  ? 13.253 80.693 16.111  1.00 21.32 ? 523 SER A CB  1 
ATOM   207  O  OG  . SER A 1 26  ? 12.701 81.986 15.933  1.00 26.32 ? 523 SER A OG  1 
ATOM   208  N  N   . ARG A 1 27  ? 10.117 79.590 14.872  1.00 18.19 ? 524 ARG A N   1 
ATOM   209  C  CA  . ARG A 1 27  ? 8.765  79.240 15.278  1.00 19.04 ? 524 ARG A CA  1 
ATOM   210  C  C   . ARG A 1 27  ? 8.655  77.734 15.460  1.00 20.87 ? 524 ARG A C   1 
ATOM   211  O  O   . ARG A 1 27  ? 7.724  77.235 16.106  1.00 22.79 ? 524 ARG A O   1 
ATOM   212  C  CB  . ARG A 1 27  ? 7.758  79.709 14.246  1.00 20.78 ? 524 ARG A CB  1 
ATOM   213  C  CG  . ARG A 1 27  ? 7.654  81.183 14.225  1.00 22.74 ? 524 ARG A CG  1 
ATOM   214  C  CD  . ARG A 1 27  ? 7.449  81.671 15.627  1.00 23.78 ? 524 ARG A CD  1 
ATOM   215  N  NE  . ARG A 1 27  ? 7.265  83.107 15.661  1.00 29.27 ? 524 ARG A NE  1 
ATOM   216  C  CZ  . ARG A 1 27  ? 7.116  83.815 16.774  1.00 29.96 ? 524 ARG A CZ  1 
ATOM   217  N  NH1 . ARG A 1 27  ? 7.140  83.218 17.959  1.00 25.48 ? 524 ARG A NH1 1 
ATOM   218  N  NH2 . ARG A 1 27  ? 6.899  85.118 16.686  1.00 26.64 ? 524 ARG A NH2 1 
ATOM   219  N  N   . LEU A 1 28  ? 9.561  77.014 14.804  1.00 19.12 ? 525 LEU A N   1 
ATOM   220  C  CA  . LEU A 1 28  ? 9.645  75.571 14.915  1.00 17.29 ? 525 LEU A CA  1 
ATOM   221  C  C   . LEU A 1 28  ? 10.942 75.381 15.674  1.00 22.24 ? 525 LEU A C   1 
ATOM   222  O  O   . LEU A 1 28  ? 11.950 76.041 15.374  1.00 21.49 ? 525 LEU A O   1 
ATOM   223  C  CB  . LEU A 1 28  ? 9.817  74.913 13.546  1.00 19.88 ? 525 LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 28  ? 8.695  74.845 12.523  1.00 15.92 ? 525 LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 28  ? 9.236  74.241 11.253  1.00 11.38 ? 525 LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 28  ? 7.556  73.989 13.080  1.00 16.42 ? 525 LEU A CD2 1 
ATOM   227  N  N   . SER A 1 29  ? 10.912 74.519 16.682  1.00 23.55 ? 526 SER A N   1 
ATOM   228  C  CA  . SER A 1 29  ? 12.113 74.240 17.460  1.00 24.19 ? 526 SER A CA  1 
ATOM   229  C  C   . SER A 1 29  ? 12.873 73.147 16.725  1.00 25.31 ? 526 SER A C   1 
ATOM   230  O  O   . SER A 1 29  ? 12.342 72.534 15.797  1.00 26.87 ? 526 SER A O   1 
ATOM   231  C  CB  . SER A 1 29  ? 11.737 73.746 18.855  1.00 22.27 ? 526 SER A CB  1 
ATOM   232  O  OG  . SER A 1 29  ? 10.926 72.579 18.785  1.00 18.28 ? 526 SER A OG  1 
ATOM   233  N  N   . GLU A 1 30  ? 14.093 72.868 17.160  1.00 26.48 ? 527 GLU A N   1 
ATOM   234  C  CA  . GLU A 1 30  ? 14.900 71.829 16.539  1.00 26.18 ? 527 GLU A CA  1 
ATOM   235  C  C   . GLU A 1 30  ? 14.144 70.514 16.449  1.00 25.55 ? 527 GLU A C   1 
ATOM   236  O  O   . GLU A 1 30  ? 14.134 69.859 15.406  1.00 30.55 ? 527 GLU A O   1 
ATOM   237  C  CB  . GLU A 1 30  ? 16.172 71.620 17.349  1.00 28.26 ? 527 GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 30  ? 17.025 70.471 16.880  1.00 37.14 ? 527 GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 30  ? 18.417 70.909 16.459  1.00 44.14 ? 527 GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 30  ? 19.082 71.637 17.238  1.00 44.73 ? 527 GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 30  ? 18.853 70.506 15.351  1.00 47.92 ? 527 GLU A OE2 1 
ATOM   242  N  N   . ALA A 1 31  ? 13.458 70.159 17.526  1.00 23.12 ? 528 ALA A N   1 
ATOM   243  C  CA  . ALA A 1 31  ? 12.733 68.901 17.580  1.00 19.11 ? 528 ALA A CA  1 
ATOM   244  C  C   . ALA A 1 31  ? 11.547 68.875 16.650  1.00 19.81 ? 528 ALA A C   1 
ATOM   245  O  O   . ALA A 1 31  ? 11.237 67.834 16.078  1.00 24.34 ? 528 ALA A O   1 
ATOM   246  C  CB  . ALA A 1 31  ? 12.301 68.609 18.992  1.00 11.67 ? 528 ALA A CB  1 
ATOM   247  N  N   . GLU A 1 32  ? 10.873 70.015 16.518  1.00 19.26 ? 529 GLU A N   1 
ATOM   248  C  CA  . GLU A 1 32  ? 9.697  70.126 15.659  1.00 19.04 ? 529 GLU A CA  1 
ATOM   249  C  C   . GLU A 1 32  ? 10.146 70.132 14.212  1.00 21.14 ? 529 GLU A C   1 
ATOM   250  O  O   . GLU A 1 32  ? 9.491  69.543 13.358  1.00 26.65 ? 529 GLU A O   1 
ATOM   251  C  CB  . GLU A 1 32  ? 8.908  71.403 15.974  1.00 17.25 ? 529 GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 32  ? 8.144  71.355 17.292  1.00 12.54 ? 529 GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 32  ? 7.447  72.663 17.624  1.00 18.73 ? 529 GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 32  ? 8.120  73.725 17.576  1.00 16.59 ? 529 GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 32  ? 6.236  72.623 17.966  1.00 18.64 ? 529 GLU A OE2 1 
ATOM   256  N  N   . PHE A 1 33  ? 11.292 70.750 13.945  1.00 17.88 ? 530 PHE A N   1 
ATOM   257  C  CA  . PHE A 1 33  ? 11.828 70.807 12.600  1.00 18.23 ? 530 PHE A CA  1 
ATOM   258  C  C   . PHE A 1 33  ? 12.139 69.383 12.147  1.00 21.70 ? 530 PHE A C   1 
ATOM   259  O  O   . PHE A 1 33  ? 11.848 69.007 11.003  1.00 28.22 ? 530 PHE A O   1 
ATOM   260  C  CB  . PHE A 1 33  ? 13.083 71.658 12.571  1.00 17.84 ? 530 PHE A CB  1 
ATOM   261  C  CG  . PHE A 1 33  ? 13.534 72.028 11.196  1.00 19.34 ? 530 PHE A CG  1 
ATOM   262  C  CD1 . PHE A 1 33  ? 12.696 72.758 10.342  1.00 17.07 ? 530 PHE A CD1 1 
ATOM   263  C  CD2 . PHE A 1 33  ? 14.806 71.685 10.759  1.00 16.08 ? 530 PHE A CD2 1 
ATOM   264  C  CE1 . PHE A 1 33  ? 13.127 73.139 9.089   1.00 12.46 ? 530 PHE A CE1 1 
ATOM   265  C  CE2 . PHE A 1 33  ? 15.248 72.066 9.492   1.00 13.83 ? 530 PHE A CE2 1 
ATOM   266  C  CZ  . PHE A 1 33  ? 14.413 72.789 8.664   1.00 11.80 ? 530 PHE A CZ  1 
ATOM   267  N  N   . GLU A 1 34  ? 12.650 68.563 13.052  1.00 18.89 ? 531 GLU A N   1 
ATOM   268  C  CA  . GLU A 1 34  ? 12.932 67.182 12.695  1.00 21.46 ? 531 GLU A CA  1 
ATOM   269  C  C   . GLU A 1 34  ? 11.660 66.478 12.263  1.00 17.63 ? 531 GLU A C   1 
ATOM   270  O  O   . GLU A 1 34  ? 11.711 65.606 11.397  1.00 22.80 ? 531 GLU A O   1 
ATOM   271  C  CB  . GLU A 1 34  ? 13.556 66.414 13.862  1.00 19.16 ? 531 GLU A CB  1 
ATOM   272  C  CG  . GLU A 1 34  ? 14.885 66.955 14.274  1.00 24.82 ? 531 GLU A CG  1 
ATOM   273  C  CD  . GLU A 1 34  ? 15.827 67.120 13.105  1.00 28.99 ? 531 GLU A CD  1 
ATOM   274  O  OE1 . GLU A 1 34  ? 16.177 66.101 12.469  1.00 24.87 ? 531 GLU A OE1 1 
ATOM   275  O  OE2 . GLU A 1 34  ? 16.211 68.282 12.831  1.00 35.27 ? 531 GLU A OE2 1 
ATOM   276  N  N   . VAL A 1 35  ? 10.529 66.840 12.864  1.00 15.71 ? 532 VAL A N   1 
ATOM   277  C  CA  . VAL A 1 35  ? 9.257  66.211 12.509  1.00 15.96 ? 532 VAL A CA  1 
ATOM   278  C  C   . VAL A 1 35  ? 8.820  66.691 11.133  1.00 18.38 ? 532 VAL A C   1 
ATOM   279  O  O   . VAL A 1 35  ? 8.234  65.921 10.357  1.00 22.15 ? 532 VAL A O   1 
ATOM   280  C  CB  . VAL A 1 35  ? 8.149  66.493 13.551  1.00 15.96 ? 532 VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 35  ? 6.825  65.847 13.117  1.00 6.01  ? 532 VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 35  ? 8.575  65.950 14.908  1.00 13.74 ? 532 VAL A CG2 1 
ATOM   283  N  N   . LEU A 1 36  ? 9.150  67.943 10.821  1.00 14.73 ? 533 LEU A N   1 
ATOM   284  C  CA  . LEU A 1 36  ? 8.826  68.530 9.536   1.00 14.97 ? 533 LEU A CA  1 
ATOM   285  C  C   . LEU A 1 36  ? 9.602  67.771 8.476   1.00 16.19 ? 533 LEU A C   1 
ATOM   286  O  O   . LEU A 1 36  ? 9.044  67.348 7.458   1.00 18.03 ? 533 LEU A O   1 
ATOM   287  C  CB  . LEU A 1 36  ? 9.243  70.008 9.496   1.00 14.45 ? 533 LEU A CB  1 
ATOM   288  C  CG  . LEU A 1 36  ? 8.780  70.717 8.220   1.00 12.15 ? 533 LEU A CG  1 
ATOM   289  C  CD1 . LEU A 1 36  ? 7.283  70.472 8.038   1.00 14.73 ? 533 LEU A CD1 1 
ATOM   290  C  CD2 . LEU A 1 36  ? 9.060  72.183 8.282   1.00 8.85  ? 533 LEU A CD2 1 
ATOM   291  N  N   . LYS A 1 37  ? 10.899 67.640 8.704   1.00 12.22 ? 534 LYS A N   1 
ATOM   292  C  CA  . LYS A 1 37  ? 11.766 66.936 7.785   1.00 13.88 ? 534 LYS A CA  1 
ATOM   293  C  C   . LYS A 1 37  ? 11.337 65.492 7.592   1.00 13.67 ? 534 LYS A C   1 
ATOM   294  O  O   . LYS A 1 37  ? 11.356 64.974 6.478   1.00 19.68 ? 534 LYS A O   1 
ATOM   295  C  CB  . LYS A 1 37  ? 13.210 67.016 8.282   1.00 17.43 ? 534 LYS A CB  1 
ATOM   296  C  CG  . LYS A 1 37  ? 13.819 68.393 8.100   1.00 13.24 ? 534 LYS A CG  1 
ATOM   297  C  CD  . LYS A 1 37  ? 15.002 68.635 9.036   1.00 18.41 ? 534 LYS A CD  1 
ATOM   298  C  CE  . LYS A 1 37  ? 15.936 67.455 9.114   1.00 20.81 ? 534 LYS A CE  1 
ATOM   299  N  NZ  . LYS A 1 37  ? 17.017 67.696 10.101  1.00 18.52 ? 534 LYS A NZ  1 
ATOM   300  N  N   . ALA A 1 38  ? 10.871 64.858 8.656   1.00 13.06 ? 535 ALA A N   1 
ATOM   301  C  CA  . ALA A 1 38  ? 10.442 63.472 8.563   1.00 9.85  ? 535 ALA A CA  1 
ATOM   302  C  C   . ALA A 1 38  ? 9.164  63.382 7.745   1.00 13.30 ? 535 ALA A C   1 
ATOM   303  O  O   . ALA A 1 38  ? 8.911  62.361 7.082   1.00 15.28 ? 535 ALA A O   1 
ATOM   304  C  CB  . ALA A 1 38  ? 10.254 62.901 9.923   1.00 8.53  ? 535 ALA A CB  1 
ATOM   305  N  N   . PHE A 1 39  ? 8.348  64.428 7.797   1.00 13.50 ? 536 PHE A N   1 
ATOM   306  C  CA  . PHE A 1 39  ? 7.117  64.490 6.996   1.00 11.73 ? 536 PHE A CA  1 
ATOM   307  C  C   . PHE A 1 39  ? 7.537  64.558 5.521   1.00 14.75 ? 536 PHE A C   1 
ATOM   308  O  O   . PHE A 1 39  ? 6.962  63.887 4.654   1.00 17.83 ? 536 PHE A O   1 
ATOM   309  C  CB  . PHE A 1 39  ? 6.369  65.756 7.350   1.00 6.75  ? 536 PHE A CB  1 
ATOM   310  C  CG  . PHE A 1 39  ? 5.252  66.076 6.419   1.00 12.43 ? 536 PHE A CG  1 
ATOM   311  C  CD1 . PHE A 1 39  ? 4.113  65.288 6.388   1.00 13.94 ? 536 PHE A CD1 1 
ATOM   312  C  CD2 . PHE A 1 39  ? 5.314  67.191 5.585   1.00 10.83 ? 536 PHE A CD2 1 
ATOM   313  C  CE1 . PHE A 1 39  ? 3.040  65.604 5.534   1.00 15.05 ? 536 PHE A CE1 1 
ATOM   314  C  CE2 . PHE A 1 39  ? 4.260  67.511 4.736   1.00 11.68 ? 536 PHE A CE2 1 
ATOM   315  C  CZ  . PHE A 1 39  ? 3.114  66.720 4.711   1.00 9.74  ? 536 PHE A CZ  1 
ATOM   316  N  N   . VAL A 1 40  ? 8.550  65.375 5.250   1.00 13.66 ? 537 VAL A N   1 
ATOM   317  C  CA  . VAL A 1 40  ? 9.068  65.549 3.903   1.00 14.58 ? 537 VAL A CA  1 
ATOM   318  C  C   . VAL A 1 40  ? 9.593  64.209 3.418   1.00 16.40 ? 537 VAL A C   1 
ATOM   319  O  O   . VAL A 1 40  ? 9.176  63.735 2.376   1.00 21.04 ? 537 VAL A O   1 
ATOM   320  C  CB  . VAL A 1 40  ? 10.143 66.684 3.858   1.00 12.13 ? 537 VAL A CB  1 
ATOM   321  C  CG1 . VAL A 1 40  ? 10.864 66.706 2.527   1.00 7.80  ? 537 VAL A CG1 1 
ATOM   322  C  CG2 . VAL A 1 40  ? 9.459  68.040 4.070   1.00 2.11  ? 537 VAL A CG2 1 
ATOM   323  N  N   . VAL A 1 41  ? 10.397 63.541 4.231   1.00 17.90 ? 538 VAL A N   1 
ATOM   324  C  CA  . VAL A 1 41  ? 10.929 62.228 3.867   1.00 15.91 ? 538 VAL A CA  1 
ATOM   325  C  C   . VAL A 1 41  ? 9.842  61.187 3.559   1.00 17.55 ? 538 VAL A C   1 
ATOM   326  O  O   . VAL A 1 41  ? 9.946  60.491 2.538   1.00 15.35 ? 538 VAL A O   1 
ATOM   327  C  CB  . VAL A 1 41  ? 11.893 61.693 4.948   1.00 17.65 ? 538 VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 41  ? 12.129 60.169 4.791   1.00 9.43  ? 538 VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 41  ? 13.200 62.447 4.849   1.00 9.34  ? 538 VAL A CG2 1 
ATOM   330  N  N   . ASP A 1 42  ? 8.818  61.040 4.410   1.00 17.17 ? 539 ASP A N   1 
ATOM   331  C  CA  . ASP A 1 42  ? 7.798  60.050 4.068   1.00 21.22 ? 539 ASP A CA  1 
ATOM   332  C  C   . ASP A 1 42  ? 6.892  60.418 2.919   1.00 17.63 ? 539 ASP A C   1 
ATOM   333  O  O   . ASP A 1 42  ? 6.313  59.526 2.305   1.00 20.04 ? 539 ASP A O   1 
ATOM   334  C  CB  . ASP A 1 42  ? 7.048  59.412 5.257   1.00 29.14 ? 539 ASP A CB  1 
ATOM   335  C  CG  . ASP A 1 42  ? 6.836  60.345 6.384   1.00 35.47 ? 539 ASP A CG  1 
ATOM   336  O  OD1 . ASP A 1 42  ? 6.283  61.428 6.128   1.00 44.75 ? 539 ASP A OD1 1 
ATOM   337  O  OD2 . ASP A 1 42  ? 7.219  59.993 7.523   1.00 36.63 ? 539 ASP A OD2 1 
ATOM   338  N  N   . MET A 1 43  ? 6.810  61.709 2.601   1.00 16.39 ? 540 MET A N   1 
ATOM   339  C  CA  . MET A 1 43  ? 6.063  62.172 1.428   1.00 13.96 ? 540 MET A CA  1 
ATOM   340  C  C   . MET A 1 43  ? 6.857  61.593 0.269   1.00 10.86 ? 540 MET A C   1 
ATOM   341  O  O   . MET A 1 43  ? 6.333  60.862 -0.539  1.00 14.71 ? 540 MET A O   1 
ATOM   342  C  CB  . MET A 1 43  ? 6.159  63.688 1.294   1.00 22.58 ? 540 MET A CB  1 
ATOM   343  C  CG  . MET A 1 43  ? 5.149  64.497 2.065   1.00 31.44 ? 540 MET A CG  1 
ATOM   344  S  SD  . MET A 1 43  ? 3.503  64.541 1.326   1.00 45.37 ? 540 MET A SD  1 
ATOM   345  C  CE  . MET A 1 43  ? 3.679  65.729 0.060   1.00 31.22 ? 540 MET A CE  1 
ATOM   346  N  N   . MET A 1 44  ? 8.163  61.870 0.261   1.00 13.18 ? 541 MET A N   1 
ATOM   347  C  CA  . MET A 1 44  ? 9.116  61.398 -0.751  1.00 10.35 ? 541 MET A CA  1 
ATOM   348  C  C   . MET A 1 44  ? 9.107  59.895 -0.969  1.00 16.49 ? 541 MET A C   1 
ATOM   349  O  O   . MET A 1 44  ? 9.225  59.438 -2.111  1.00 20.40 ? 541 MET A O   1 
ATOM   350  C  CB  . MET A 1 44  ? 10.537 61.813 -0.370  1.00 9.58  ? 541 MET A CB  1 
ATOM   351  C  CG  . MET A 1 44  ? 10.820 63.276 -0.620  1.00 11.21 ? 541 MET A CG  1 
ATOM   352  S  SD  . MET A 1 44  ? 12.434 63.842 -0.058  1.00 12.89 ? 541 MET A SD  1 
ATOM   353  C  CE  . MET A 1 44  ? 13.392 63.835 -1.500  1.00 15.28 ? 541 MET A CE  1 
ATOM   354  N  N   . GLU A 1 45  ? 8.985  59.119 0.107   1.00 16.56 ? 542 GLU A N   1 
ATOM   355  C  CA  . GLU A 1 45  ? 8.971  57.657 -0.008  1.00 13.92 ? 542 GLU A CA  1 
ATOM   356  C  C   . GLU A 1 45  ? 7.759  57.174 -0.818  1.00 14.26 ? 542 GLU A C   1 
ATOM   357  O  O   . GLU A 1 45  ? 7.789  56.104 -1.430  1.00 15.31 ? 542 GLU A O   1 
ATOM   358  C  CB  . GLU A 1 45  ? 8.925  57.018 1.382   1.00 12.65 ? 542 GLU A CB  1 
ATOM   359  C  CG  . GLU A 1 45  ? 10.175 57.228 2.230   1.00 15.01 ? 542 GLU A CG  1 
ATOM   360  C  CD  . GLU A 1 45  ? 10.155 56.422 3.528   1.00 13.47 ? 542 GLU A CD  1 
ATOM   361  O  OE1 . GLU A 1 45  ? 9.181  55.694 3.785   1.00 18.27 ? 542 GLU A OE1 1 
ATOM   362  O  OE2 . GLU A 1 45  ? 11.109 56.518 4.308   1.00 15.89 ? 542 GLU A OE2 1 
ATOM   363  N  N   . ARG A 1 46  ? 6.688  57.961 -0.789  1.00 12.61 ? 543 ARG A N   1 
ATOM   364  C  CA  . ARG A 1 46  ? 5.451  57.633 -1.473  1.00 10.82 ? 543 ARG A CA  1 
ATOM   365  C  C   . ARG A 1 46  ? 5.388  58.327 -2.827  1.00 11.37 ? 543 ARG A C   1 
ATOM   366  O  O   . ARG A 1 46  ? 4.310  58.574 -3.373  1.00 13.23 ? 543 ARG A O   1 
ATOM   367  C  CB  . ARG A 1 46  ? 4.285  58.069 -0.593  1.00 9.75  ? 543 ARG A CB  1 
ATOM   368  C  CG  . ARG A 1 46  ? 4.168  57.203 0.632   1.00 8.93  ? 543 ARG A CG  1 
ATOM   369  C  CD  . ARG A 1 46  ? 3.353  57.841 1.737   1.00 9.66  ? 543 ARG A CD  1 
ATOM   370  N  NE  . ARG A 1 46  ? 3.241  56.878 2.835   1.00 17.05 ? 543 ARG A NE  1 
ATOM   371  C  CZ  . ARG A 1 46  ? 4.196  56.652 3.737   1.00 12.00 ? 543 ARG A CZ  1 
ATOM   372  N  NH1 . ARG A 1 46  ? 5.341  57.332 3.697   1.00 9.90  ? 543 ARG A NH1 1 
ATOM   373  N  NH2 . ARG A 1 46  ? 4.044  55.681 4.634   1.00 15.47 ? 543 ARG A NH2 1 
ATOM   374  N  N   . LEU A 1 47  ? 6.554  58.559 -3.401  1.00 13.34 ? 544 LEU A N   1 
ATOM   375  C  CA  . LEU A 1 47  ? 6.676  59.214 -4.688  1.00 15.24 ? 544 LEU A CA  1 
ATOM   376  C  C   . LEU A 1 47  ? 7.606  58.388 -5.574  1.00 16.79 ? 544 LEU A C   1 
ATOM   377  O  O   . LEU A 1 47  ? 8.633  57.871 -5.103  1.00 17.01 ? 544 LEU A O   1 
ATOM   378  C  CB  . LEU A 1 47  ? 7.318  60.578 -4.465  1.00 12.06 ? 544 LEU A CB  1 
ATOM   379  C  CG  . LEU A 1 47  ? 6.539  61.886 -4.546  1.00 11.78 ? 544 LEU A CG  1 
ATOM   380  C  CD1 . LEU A 1 47  ? 5.138  61.769 -4.046  1.00 11.41 ? 544 LEU A CD1 1 
ATOM   381  C  CD2 . LEU A 1 47  ? 7.315  62.896 -3.751  1.00 8.97  ? 544 LEU A CD2 1 
ATOM   382  N  N   . ARG A 1 48  ? 7.283  58.269 -6.855  1.00 15.28 ? 545 ARG A N   1 
ATOM   383  C  CA  . ARG A 1 48  ? 8.187  57.551 -7.740  1.00 15.08 ? 545 ARG A CA  1 
ATOM   384  C  C   . ARG A 1 48  ? 9.110  58.627 -8.278  1.00 17.33 ? 545 ARG A C   1 
ATOM   385  O  O   . ARG A 1 48  ? 8.794  59.266 -9.283  1.00 19.41 ? 545 ARG A O   1 
ATOM   386  C  CB  . ARG A 1 48  ? 7.431  56.887 -8.875  1.00 16.99 ? 545 ARG A CB  1 
ATOM   387  C  CG  . ARG A 1 48  ? 8.327  56.142 -9.837  1.00 20.50 ? 545 ARG A CG  1 
ATOM   388  C  CD  . ARG A 1 48  ? 7.453  55.493 -10.868 1.00 26.46 ? 545 ARG A CD  1 
ATOM   389  N  NE  . ARG A 1 48  ? 8.195  54.796 -11.903 1.00 28.51 ? 545 ARG A NE  1 
ATOM   390  C  CZ  . ARG A 1 48  ? 7.644  53.877 -12.690 1.00 33.26 ? 545 ARG A CZ  1 
ATOM   391  N  NH1 . ARG A 1 48  ? 6.357  53.572 -12.541 1.00 31.05 ? 545 ARG A NH1 1 
ATOM   392  N  NH2 . ARG A 1 48  ? 8.368  53.259 -13.617 1.00 30.37 ? 545 ARG A NH2 1 
ATOM   393  N  N   . ILE A 1 49  ? 10.205 58.879 -7.556  1.00 18.27 ? 546 ILE A N   1 
ATOM   394  C  CA  . ILE A 1 49  ? 11.177 59.909 -7.919  1.00 18.03 ? 546 ILE A CA  1 
ATOM   395  C  C   . ILE A 1 49  ? 12.039 59.480 -9.084  1.00 19.30 ? 546 ILE A C   1 
ATOM   396  O  O   . ILE A 1 49  ? 12.750 58.477 -9.014  1.00 20.66 ? 546 ILE A O   1 
ATOM   397  C  CB  . ILE A 1 49  ? 12.065 60.290 -6.714  1.00 13.91 ? 546 ILE A CB  1 
ATOM   398  C  CG1 . ILE A 1 49  ? 11.234 60.956 -5.622  1.00 10.37 ? 546 ILE A CG1 1 
ATOM   399  C  CG2 . ILE A 1 49  ? 13.134 61.243 -7.134  1.00 10.93 ? 546 ILE A CG2 1 
ATOM   400  C  CD1 . ILE A 1 49  ? 11.981 61.088 -4.306  1.00 8.23  ? 546 ILE A CD1 1 
ATOM   401  N  N   . SER A 1 50  ? 11.986 60.270 -10.152 1.00 20.13 ? 547 SER A N   1 
ATOM   402  C  CA  . SER A 1 50  ? 12.725 59.968 -11.360 1.00 18.38 ? 547 SER A CA  1 
ATOM   403  C  C   . SER A 1 50  ? 12.518 61.108 -12.348 1.00 20.11 ? 547 SER A C   1 
ATOM   404  O  O   . SER A 1 50  ? 11.443 61.710 -12.407 1.00 19.86 ? 547 SER A O   1 
ATOM   405  C  CB  . SER A 1 50  ? 12.191 58.664 -11.956 1.00 19.67 ? 547 SER A CB  1 
ATOM   406  O  OG  . SER A 1 50  ? 12.939 58.238 -13.078 1.00 24.56 ? 547 SER A OG  1 
ATOM   407  N  N   . GLN A 1 51  ? 13.542 61.364 -13.156 1.00 21.04 ? 548 GLN A N   1 
ATOM   408  C  CA  . GLN A 1 51  ? 13.527 62.426 -14.159 1.00 22.05 ? 548 GLN A CA  1 
ATOM   409  C  C   . GLN A 1 51  ? 12.335 62.253 -15.121 1.00 23.36 ? 548 GLN A C   1 
ATOM   410  O  O   . GLN A 1 51  ? 11.802 63.236 -15.645 1.00 26.68 ? 548 GLN A O   1 
ATOM   411  C  CB  . GLN A 1 51  ? 14.869 62.399 -14.905 1.00 23.09 ? 548 GLN A CB  1 
ATOM   412  C  CG  . GLN A 1 51  ? 15.601 63.727 -15.086 1.00 25.87 ? 548 GLN A CG  1 
ATOM   413  C  CD  . GLN A 1 51  ? 15.738 64.560 -13.825 1.00 27.98 ? 548 GLN A CD  1 
ATOM   414  O  OE1 . GLN A 1 51  ? 15.630 65.783 -13.890 1.00 34.12 ? 548 GLN A OE1 1 
ATOM   415  N  NE2 . GLN A 1 51  ? 15.977 63.925 -12.684 1.00 25.55 ? 548 GLN A NE2 1 
ATOM   416  N  N   . LYS A 1 52  ? 11.894 61.009 -15.304 1.00 21.82 ? 549 LYS A N   1 
ATOM   417  C  CA  . LYS A 1 52  ? 10.766 60.701 -16.182 1.00 21.44 ? 549 LYS A CA  1 
ATOM   418  C  C   . LYS A 1 52  ? 9.453  60.554 -15.390 1.00 22.62 ? 549 LYS A C   1 
ATOM   419  O  O   . LYS A 1 52  ? 8.374  60.330 -15.971 1.00 18.28 ? 549 LYS A O   1 
ATOM   420  C  CB  . LYS A 1 52  ? 11.041 59.406 -16.955 1.00 24.39 ? 549 LYS A CB  1 
ATOM   421  C  CG  . LYS A 1 52  ? 12.431 59.320 -17.575 1.00 34.15 ? 549 LYS A CG  1 
ATOM   422  C  CD  . LYS A 1 52  ? 12.762 60.573 -18.390 1.00 44.91 ? 549 LYS A CD  1 
ATOM   423  C  CE  . LYS A 1 52  ? 14.154 60.513 -19.044 1.00 51.62 ? 549 LYS A CE  1 
ATOM   424  N  NZ  . LYS A 1 52  ? 15.302 60.529 -18.076 1.00 53.07 ? 549 LYS A NZ  1 
ATOM   425  N  N   . TRP A 1 53  ? 9.535  60.665 -14.064 1.00 19.15 ? 550 TRP A N   1 
ATOM   426  C  CA  . TRP A 1 53  ? 8.350  60.544 -13.241 1.00 18.15 ? 550 TRP A CA  1 
ATOM   427  C  C   . TRP A 1 53  ? 8.178  61.740 -12.313 1.00 17.14 ? 550 TRP A C   1 
ATOM   428  O  O   . TRP A 1 53  ? 7.755  62.808 -12.759 1.00 17.54 ? 550 TRP A O   1 
ATOM   429  C  CB  . TRP A 1 53  ? 8.383  59.219 -12.473 1.00 22.31 ? 550 TRP A CB  1 
ATOM   430  C  CG  . TRP A 1 53  ? 8.360  58.034 -13.381 1.00 24.07 ? 550 TRP A CG  1 
ATOM   431  C  CD1 . TRP A 1 53  ? 9.420  57.250 -13.752 1.00 25.74 ? 550 TRP A CD1 1 
ATOM   432  C  CD2 . TRP A 1 53  ? 7.228  57.533 -14.096 1.00 23.63 ? 550 TRP A CD2 1 
ATOM   433  N  NE1 . TRP A 1 53  ? 9.016  56.302 -14.667 1.00 25.59 ? 550 TRP A NE1 1 
ATOM   434  C  CE2 . TRP A 1 53  ? 7.665  56.461 -14.894 1.00 25.02 ? 550 TRP A CE2 1 
ATOM   435  C  CE3 . TRP A 1 53  ? 5.875  57.905 -14.136 1.00 23.56 ? 550 TRP A CE3 1 
ATOM   436  C  CZ2 . TRP A 1 53  ? 6.807  55.743 -15.734 1.00 25.72 ? 550 TRP A CZ2 1 
ATOM   437  C  CZ3 . TRP A 1 53  ? 5.017  57.196 -14.970 1.00 25.40 ? 550 TRP A CZ3 1 
ATOM   438  C  CH2 . TRP A 1 53  ? 5.487  56.125 -15.758 1.00 24.34 ? 550 TRP A CH2 1 
ATOM   439  N  N   . VAL A 1 54  ? 8.465  61.572 -11.022 1.00 18.80 ? 551 VAL A N   1 
ATOM   440  C  CA  . VAL A 1 54  ? 8.321  62.674 -10.069 1.00 16.63 ? 551 VAL A CA  1 
ATOM   441  C  C   . VAL A 1 54  ? 9.695  63.240 -9.739  1.00 14.99 ? 551 VAL A C   1 
ATOM   442  O  O   . VAL A 1 54  ? 10.599 62.501 -9.362  1.00 15.74 ? 551 VAL A O   1 
ATOM   443  C  CB  . VAL A 1 54  ? 7.614  62.214 -8.731  1.00 16.18 ? 551 VAL A CB  1 
ATOM   444  C  CG1 . VAL A 1 54  ? 7.477  63.406 -7.761  1.00 10.00 ? 551 VAL A CG1 1 
ATOM   445  C  CG2 . VAL A 1 54  ? 6.231  61.611 -9.016  1.00 12.35 ? 551 VAL A CG2 1 
ATOM   446  N  N   . ARG A 1 55  ? 9.876  64.536 -9.950  1.00 14.51 ? 552 ARG A N   1 
ATOM   447  C  CA  . ARG A 1 55  ? 11.142 65.180 -9.612  1.00 14.95 ? 552 ARG A CA  1 
ATOM   448  C  C   . ARG A 1 55  ? 10.860 66.010 -8.358  1.00 14.50 ? 552 ARG A C   1 
ATOM   449  O  O   . ARG A 1 55  ? 9.756  66.543 -8.188  1.00 12.82 ? 552 ARG A O   1 
ATOM   450  C  CB  . ARG A 1 55  ? 11.639 66.066 -10.757 1.00 13.60 ? 552 ARG A CB  1 
ATOM   451  C  CG  . ARG A 1 55  ? 11.890 65.318 -12.052 1.00 14.38 ? 552 ARG A CG  1 
ATOM   452  C  CD  . ARG A 1 55  ? 12.686 66.146 -13.018 1.00 14.42 ? 552 ARG A CD  1 
ATOM   453  N  NE  . ARG A 1 55  ? 11.980 67.368 -13.388 1.00 22.75 ? 552 ARG A NE  1 
ATOM   454  C  CZ  . ARG A 1 55  ? 12.544 68.383 -14.035 1.00 19.53 ? 552 ARG A CZ  1 
ATOM   455  N  NH1 . ARG A 1 55  ? 13.824 68.318 -14.381 1.00 24.67 ? 552 ARG A NH1 1 
ATOM   456  N  NH2 . ARG A 1 55  ? 11.823 69.436 -14.383 1.00 12.20 ? 552 ARG A NH2 1 
ATOM   457  N  N   . VAL A 1 56  ? 11.844 66.108 -7.469  1.00 18.50 ? 553 VAL A N   1 
ATOM   458  C  CA  . VAL A 1 56  ? 11.654 66.840 -6.209  1.00 19.75 ? 553 VAL A CA  1 
ATOM   459  C  C   . VAL A 1 56  ? 12.740 67.861 -5.972  1.00 19.66 ? 553 VAL A C   1 
ATOM   460  O  O   . VAL A 1 56  ? 13.872 67.695 -6.406  1.00 22.27 ? 553 VAL A O   1 
ATOM   461  C  CB  . VAL A 1 56  ? 11.677 65.886 -4.956  1.00 18.81 ? 553 VAL A CB  1 
ATOM   462  C  CG1 . VAL A 1 56  ? 10.441 64.952 -4.920  1.00 7.54  ? 553 VAL A CG1 1 
ATOM   463  C  CG2 . VAL A 1 56  ? 12.966 65.070 -4.942  1.00 19.00 ? 553 VAL A CG2 1 
ATOM   464  N  N   . ALA A 1 57  ? 12.385 68.930 -5.279  1.00 17.64 ? 554 ALA A N   1 
ATOM   465  C  CA  . ALA A 1 57  ? 13.356 69.958 -4.924  1.00 16.45 ? 554 ALA A CA  1 
ATOM   466  C  C   . ALA A 1 57  ? 13.038 70.208 -3.450  1.00 14.99 ? 554 ALA A C   1 
ATOM   467  O  O   . ALA A 1 57  ? 11.882 70.006 -3.030  1.00 12.08 ? 554 ALA A O   1 
ATOM   468  C  CB  . ALA A 1 57  ? 13.153 71.224 -5.764  1.00 6.96  ? 554 ALA A CB  1 
ATOM   469  N  N   . VAL A 1 58  ? 14.063 70.516 -2.651  1.00 13.54 ? 555 VAL A N   1 
ATOM   470  C  CA  . VAL A 1 58  ? 13.879 70.778 -1.220  1.00 14.53 ? 555 VAL A CA  1 
ATOM   471  C  C   . VAL A 1 58  ? 14.590 72.068 -0.892  1.00 11.41 ? 555 VAL A C   1 
ATOM   472  O  O   . VAL A 1 58  ? 15.769 72.191 -1.175  1.00 10.57 ? 555 VAL A O   1 
ATOM   473  C  CB  . VAL A 1 58  ? 14.402 69.594 -0.318  1.00 14.50 ? 555 VAL A CB  1 
ATOM   474  C  CG1 . VAL A 1 58  ? 14.355 69.980 1.182   1.00 10.37 ? 555 VAL A CG1 1 
ATOM   475  C  CG2 . VAL A 1 58  ? 13.491 68.358 -0.515  1.00 11.88 ? 555 VAL A CG2 1 
ATOM   476  N  N   . VAL A 1 59  ? 13.857 73.044 -0.359  1.00 11.91 ? 556 VAL A N   1 
ATOM   477  C  CA  . VAL A 1 59  ? 14.424 74.337 -0.026  1.00 14.48 ? 556 VAL A CA  1 
ATOM   478  C  C   . VAL A 1 59  ? 13.996 74.729 1.394   1.00 18.03 ? 556 VAL A C   1 
ATOM   479  O  O   . VAL A 1 59  ? 12.807 74.771 1.717   1.00 18.24 ? 556 VAL A O   1 
ATOM   480  C  CB  . VAL A 1 59  ? 13.929 75.435 -0.999  1.00 16.63 ? 556 VAL A CB  1 
ATOM   481  C  CG1 . VAL A 1 59  ? 14.721 76.700 -0.812  1.00 12.12 ? 556 VAL A CG1 1 
ATOM   482  C  CG2 . VAL A 1 59  ? 14.022 74.948 -2.450  1.00 17.97 ? 556 VAL A CG2 1 
ATOM   483  N  N   . GLU A 1 60  ? 14.977 75.023 2.228   1.00 15.76 ? 557 GLU A N   1 
ATOM   484  C  CA  . GLU A 1 60  ? 14.750 75.431 3.594   1.00 16.18 ? 557 GLU A CA  1 
ATOM   485  C  C   . GLU A 1 60  ? 14.810 76.937 3.456   1.00 19.44 ? 557 GLU A C   1 
ATOM   486  O  O   . GLU A 1 60  ? 15.751 77.448 2.847   1.00 20.78 ? 557 GLU A O   1 
ATOM   487  C  CB  . GLU A 1 60  ? 15.922 74.921 4.451   1.00 21.73 ? 557 GLU A CB  1 
ATOM   488  C  CG  . GLU A 1 60  ? 16.042 75.479 5.890   1.00 22.98 ? 557 GLU A CG  1 
ATOM   489  C  CD  . GLU A 1 60  ? 17.093 76.581 6.011   1.00 26.66 ? 557 GLU A CD  1 
ATOM   490  O  OE1 . GLU A 1 60  ? 18.322 76.271 6.047   1.00 27.04 ? 557 GLU A OE1 1 
ATOM   491  O  OE2 . GLU A 1 60  ? 16.666 77.755 6.075   1.00 18.13 ? 557 GLU A OE2 1 
ATOM   492  N  N   . TYR A 1 61  ? 13.823 77.668 3.964   1.00 16.82 ? 558 TYR A N   1 
ATOM   493  C  CA  . TYR A 1 61  ? 13.878 79.117 3.826   1.00 19.30 ? 558 TYR A CA  1 
ATOM   494  C  C   . TYR A 1 61  ? 13.894 79.898 5.123   1.00 21.56 ? 558 TYR A C   1 
ATOM   495  O  O   . TYR A 1 61  ? 13.367 79.450 6.146   1.00 18.80 ? 558 TYR A O   1 
ATOM   496  C  CB  . TYR A 1 61  ? 12.769 79.638 2.903   1.00 18.20 ? 558 TYR A CB  1 
ATOM   497  C  CG  . TYR A 1 61  ? 11.350 79.457 3.414   1.00 21.51 ? 558 TYR A CG  1 
ATOM   498  C  CD1 . TYR A 1 61  ? 10.681 78.250 3.251   1.00 19.46 ? 558 TYR A CD1 1 
ATOM   499  C  CD2 . TYR A 1 61  ? 10.662 80.511 4.037   1.00 17.80 ? 558 TYR A CD2 1 
ATOM   500  C  CE1 . TYR A 1 61  ? 9.360  78.101 3.689   1.00 17.32 ? 558 TYR A CE1 1 
ATOM   501  C  CE2 . TYR A 1 61  ? 9.361  80.361 4.462   1.00 11.71 ? 558 TYR A CE2 1 
ATOM   502  C  CZ  . TYR A 1 61  ? 8.727  79.158 4.289   1.00 14.15 ? 558 TYR A CZ  1 
ATOM   503  O  OH  . TYR A 1 61  ? 7.443  78.997 4.727   1.00 21.33 ? 558 TYR A OH  1 
ATOM   504  N  N   . HIS A 1 62  ? 14.548 81.054 5.077   1.00 22.82 ? 559 HIS A N   1 
ATOM   505  C  CA  . HIS A 1 62  ? 14.659 81.942 6.228   1.00 22.57 ? 559 HIS A CA  1 
ATOM   506  C  C   . HIS A 1 62  ? 14.761 83.343 5.632   1.00 24.28 ? 559 HIS A C   1 
ATOM   507  O  O   . HIS A 1 62  ? 13.803 83.820 5.035   1.00 24.51 ? 559 HIS A O   1 
ATOM   508  C  CB  . HIS A 1 62  ? 15.877 81.580 7.084   1.00 23.05 ? 559 HIS A CB  1 
ATOM   509  C  CG  . HIS A 1 62  ? 17.138 81.409 6.295   1.00 31.12 ? 559 HIS A CG  1 
ATOM   510  N  ND1 . HIS A 1 62  ? 17.327 80.384 5.400   1.00 35.63 ? 559 HIS A ND1 1 
ATOM   511  C  CD2 . HIS A 1 62  ? 18.274 82.154 6.254   1.00 35.29 ? 559 HIS A CD2 1 
ATOM   512  C  CE1 . HIS A 1 62  ? 18.512 80.499 4.841   1.00 34.53 ? 559 HIS A CE1 1 
ATOM   513  N  NE2 . HIS A 1 62  ? 19.109 81.564 5.342   1.00 33.84 ? 559 HIS A NE2 1 
ATOM   514  N  N   . ASP A 1 63  ? 15.895 84.013 5.788   1.00 29.85 ? 560 ASP A N   1 
ATOM   515  C  CA  . ASP A 1 63  ? 16.077 85.336 5.194   1.00 37.48 ? 560 ASP A CA  1 
ATOM   516  C  C   . ASP A 1 63  ? 16.114 85.132 3.676   1.00 36.28 ? 560 ASP A C   1 
ATOM   517  O  O   . ASP A 1 63  ? 15.522 85.892 2.912   1.00 39.28 ? 560 ASP A O   1 
ATOM   518  C  CB  . ASP A 1 63  ? 17.391 85.957 5.686   1.00 46.15 ? 560 ASP A CB  1 
ATOM   519  C  CG  . ASP A 1 63  ? 17.242 87.430 6.059   1.00 55.52 ? 560 ASP A CG  1 
ATOM   520  O  OD1 . ASP A 1 63  ? 16.086 87.905 6.195   1.00 60.53 ? 560 ASP A OD1 1 
ATOM   521  O  OD2 . ASP A 1 63  ? 18.286 88.112 6.218   1.00 59.22 ? 560 ASP A OD2 1 
ATOM   522  N  N   . GLY A 1 64  ? 16.849 84.101 3.271   1.00 34.51 ? 561 GLY A N   1 
ATOM   523  C  CA  . GLY A 1 64  ? 16.973 83.729 1.879   1.00 29.45 ? 561 GLY A CA  1 
ATOM   524  C  C   . GLY A 1 64  ? 16.599 82.261 1.769   1.00 28.57 ? 561 GLY A C   1 
ATOM   525  O  O   . GLY A 1 64  ? 15.991 81.698 2.689   1.00 25.19 ? 561 GLY A O   1 
ATOM   526  N  N   . SER A 1 65  ? 17.044 81.614 0.700   1.00 27.35 ? 562 SER A N   1 
ATOM   527  C  CA  . SER A 1 65  ? 16.730 80.216 0.502   1.00 26.74 ? 562 SER A CA  1 
ATOM   528  C  C   . SER A 1 65  ? 17.984 79.376 0.408   1.00 28.35 ? 562 SER A C   1 
ATOM   529  O  O   . SER A 1 65  ? 18.981 79.803 -0.164  1.00 29.74 ? 562 SER A O   1 
ATOM   530  C  CB  . SER A 1 65  ? 15.903 80.028 -0.770  1.00 25.65 ? 562 SER A CB  1 
ATOM   531  O  OG  . SER A 1 65  ? 14.733 80.834 -0.746  1.00 25.69 ? 562 SER A OG  1 
ATOM   532  N  N   . HIS A 1 66  ? 17.952 78.221 1.058   1.00 26.61 ? 563 HIS A N   1 
ATOM   533  C  CA  . HIS A 1 66  ? 19.052 77.273 1.016   1.00 28.05 ? 563 HIS A CA  1 
ATOM   534  C  C   . HIS A 1 66  ? 18.452 76.026 0.354   1.00 25.45 ? 563 HIS A C   1 
ATOM   535  O  O   . HIS A 1 66  ? 17.662 75.317 0.977   1.00 26.54 ? 563 HIS A O   1 
ATOM   536  C  CB  . HIS A 1 66  ? 19.565 76.923 2.425   1.00 33.01 ? 563 HIS A CB  1 
ATOM   537  C  CG  . HIS A 1 66  ? 20.592 77.879 2.971   1.00 42.56 ? 563 HIS A CG  1 
ATOM   538  N  ND1 . HIS A 1 66  ? 21.368 77.586 4.081   1.00 41.44 ? 563 HIS A ND1 1 
ATOM   539  C  CD2 . HIS A 1 66  ? 20.950 79.129 2.588   1.00 41.45 ? 563 HIS A CD2 1 
ATOM   540  C  CE1 . HIS A 1 66  ? 22.148 78.615 4.351   1.00 39.61 ? 563 HIS A CE1 1 
ATOM   541  N  NE2 . HIS A 1 66  ? 21.919 79.566 3.466   1.00 38.40 ? 563 HIS A NE2 1 
ATOM   542  N  N   . ALA A 1 67  ? 18.736 75.824 -0.929  1.00 22.09 ? 564 ALA A N   1 
ATOM   543  C  CA  . ALA A 1 67  ? 18.220 74.671 -1.653  1.00 20.28 ? 564 ALA A CA  1 
ATOM   544  C  C   . ALA A 1 67  ? 19.183 73.513 -1.505  1.00 18.53 ? 564 ALA A C   1 
ATOM   545  O  O   . ALA A 1 67  ? 20.359 73.650 -1.785  1.00 21.05 ? 564 ALA A O   1 
ATOM   546  C  CB  . ALA A 1 67  ? 18.040 75.005 -3.108  1.00 16.92 ? 564 ALA A CB  1 
ATOM   547  N  N   . TYR A 1 68  ? 18.675 72.384 -1.028  1.00 18.56 ? 565 TYR A N   1 
ATOM   548  C  CA  . TYR A 1 68  ? 19.463 71.183 -0.840  1.00 15.69 ? 565 TYR A CA  1 
ATOM   549  C  C   . TYR A 1 68  ? 19.236 70.245 -2.021  1.00 16.43 ? 565 TYR A C   1 
ATOM   550  O  O   . TYR A 1 68  ? 20.096 69.461 -2.376  1.00 14.38 ? 565 TYR A O   1 
ATOM   551  C  CB  . TYR A 1 68  ? 19.035 70.473 0.434   1.00 18.28 ? 565 TYR A CB  1 
ATOM   552  C  CG  . TYR A 1 68  ? 19.373 71.214 1.691   1.00 20.29 ? 565 TYR A CG  1 
ATOM   553  C  CD1 . TYR A 1 68  ? 18.609 72.296 2.105   1.00 19.07 ? 565 TYR A CD1 1 
ATOM   554  C  CD2 . TYR A 1 68  ? 20.450 70.816 2.485   1.00 24.63 ? 565 TYR A CD2 1 
ATOM   555  C  CE1 . TYR A 1 68  ? 18.899 72.966 3.277   1.00 23.97 ? 565 TYR A CE1 1 
ATOM   556  C  CE2 . TYR A 1 68  ? 20.752 71.476 3.670   1.00 25.91 ? 565 TYR A CE2 1 
ATOM   557  C  CZ  . TYR A 1 68  ? 19.971 72.552 4.061   1.00 24.70 ? 565 TYR A CZ  1 
ATOM   558  O  OH  . TYR A 1 68  ? 20.247 73.212 5.240   1.00 28.07 ? 565 TYR A OH  1 
ATOM   559  N  N   . ILE A 1 69  ? 18.050 70.302 -2.599  1.00 16.43 ? 566 ILE A N   1 
ATOM   560  C  CA  . ILE A 1 69  ? 17.720 69.445 -3.721  1.00 16.83 ? 566 ILE A CA  1 
ATOM   561  C  C   . ILE A 1 69  ? 17.121 70.236 -4.876  1.00 14.70 ? 566 ILE A C   1 
ATOM   562  O  O   . ILE A 1 69  ? 16.222 71.044 -4.662  1.00 16.54 ? 566 ILE A O   1 
ATOM   563  C  CB  . ILE A 1 69  ? 16.690 68.368 -3.301  1.00 15.97 ? 566 ILE A CB  1 
ATOM   564  C  CG1 . ILE A 1 69  ? 17.187 67.570 -2.097  1.00 18.44 ? 566 ILE A CG1 1 
ATOM   565  C  CG2 . ILE A 1 69  ? 16.392 67.432 -4.446  1.00 16.90 ? 566 ILE A CG2 1 
ATOM   566  C  CD1 . ILE A 1 69  ? 18.416 66.752 -2.370  1.00 28.29 ? 566 ILE A CD1 1 
ATOM   567  N  N   . GLY A 1 70  ? 17.667 70.052 -6.075  1.00 14.70 ? 567 GLY A N   1 
ATOM   568  C  CA  . GLY A 1 70  ? 17.123 70.694 -7.261  1.00 14.69 ? 567 GLY A CA  1 
ATOM   569  C  C   . GLY A 1 70  ? 16.372 69.660 -8.106  1.00 15.85 ? 567 GLY A C   1 
ATOM   570  O  O   . GLY A 1 70  ? 16.730 68.469 -8.109  1.00 16.56 ? 567 GLY A O   1 
ATOM   571  N  N   . LEU A 1 71  ? 15.392 70.097 -8.892  1.00 17.74 ? 568 LEU A N   1 
ATOM   572  C  CA  . LEU A 1 71  ? 14.622 69.174 -9.722  1.00 16.77 ? 568 LEU A CA  1 
ATOM   573  C  C   . LEU A 1 71  ? 15.471 68.292 -10.628 1.00 18.54 ? 568 LEU A C   1 
ATOM   574  O  O   . LEU A 1 71  ? 15.177 67.117 -10.807 1.00 24.33 ? 568 LEU A O   1 
ATOM   575  C  CB  . LEU A 1 71  ? 13.591 69.935 -10.559 1.00 11.30 ? 568 LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 71  ? 12.456 70.603 -9.767  1.00 11.42 ? 568 LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 71  ? 11.744 71.638 -10.640 1.00 6.22  ? 568 LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 71  ? 11.508 69.583 -9.227  1.00 3.91  ? 568 LEU A CD2 1 
ATOM   579  N  N   . LYS A 1 72  ? 16.512 68.864 -11.212 1.00 23.19 ? 569 LYS A N   1 
ATOM   580  C  CA  . LYS A 1 72  ? 17.393 68.123 -12.124 1.00 23.15 ? 569 LYS A CA  1 
ATOM   581  C  C   . LYS A 1 72  ? 18.459 67.248 -11.458 1.00 23.97 ? 569 LYS A C   1 
ATOM   582  O  O   . LYS A 1 72  ? 19.272 66.623 -12.149 1.00 21.55 ? 569 LYS A O   1 
ATOM   583  C  CB  . LYS A 1 72  ? 18.087 69.098 -13.067 1.00 23.83 ? 569 LYS A CB  1 
ATOM   584  C  CG  . LYS A 1 72  ? 17.154 69.828 -14.027 1.00 29.42 ? 569 LYS A CG  1 
ATOM   585  C  CD  . LYS A 1 72  ? 17.882 71.015 -14.638 1.00 32.89 ? 569 LYS A CD  1 
ATOM   586  C  CE  . LYS A 1 72  ? 16.994 71.782 -15.588 1.00 36.32 ? 569 LYS A CE  1 
ATOM   587  N  NZ  . LYS A 1 72  ? 17.497 71.604 -16.981 1.00 42.82 ? 569 LYS A NZ  1 
ATOM   588  N  N   . ASP A 1 73  ? 18.477 67.207 -10.128 1.00 24.14 ? 570 ASP A N   1 
ATOM   589  C  CA  . ASP A 1 73  ? 19.476 66.409 -9.435  1.00 26.34 ? 570 ASP A CA  1 
ATOM   590  C  C   . ASP A 1 73  ? 19.300 64.950 -9.749  1.00 31.25 ? 570 ASP A C   1 
ATOM   591  O  O   . ASP A 1 73  ? 18.335 64.336 -9.314  1.00 34.28 ? 570 ASP A O   1 
ATOM   592  C  CB  . ASP A 1 73  ? 19.389 66.624 -7.930  1.00 23.64 ? 570 ASP A CB  1 
ATOM   593  C  CG  . ASP A 1 73  ? 20.081 67.890 -7.493  1.00 24.59 ? 570 ASP A CG  1 
ATOM   594  O  OD1 . ASP A 1 73  ? 20.678 68.575 -8.352  1.00 27.05 ? 570 ASP A OD1 1 
ATOM   595  O  OD2 . ASP A 1 73  ? 20.041 68.200 -6.289  1.00 24.49 ? 570 ASP A OD2 1 
ATOM   596  N  N   . ARG A 1 74  ? 20.223 64.390 -10.523 1.00 34.80 ? 571 ARG A N   1 
ATOM   597  C  CA  . ARG A 1 74  ? 20.126 62.983 -10.869 1.00 35.48 ? 571 ARG A CA  1 
ATOM   598  C  C   . ARG A 1 74  ? 20.829 62.155 -9.817  1.00 30.97 ? 571 ARG A C   1 
ATOM   599  O  O   . ARG A 1 74  ? 22.025 61.861 -9.922  1.00 29.82 ? 571 ARG A O   1 
ATOM   600  C  CB  . ARG A 1 74  ? 20.710 62.721 -12.246 1.00 46.16 ? 571 ARG A CB  1 
ATOM   601  C  CG  . ARG A 1 74  ? 20.453 61.315 -12.743 1.00 60.41 ? 571 ARG A CG  1 
ATOM   602  C  CD  . ARG A 1 74  ? 21.501 60.929 -13.762 1.00 70.06 ? 571 ARG A CD  1 
ATOM   603  N  NE  . ARG A 1 74  ? 21.379 59.540 -14.198 1.00 76.92 ? 571 ARG A NE  1 
ATOM   604  C  CZ  . ARG A 1 74  ? 22.061 59.032 -15.218 1.00 82.89 ? 571 ARG A CZ  1 
ATOM   605  N  NH1 . ARG A 1 74  ? 22.910 59.802 -15.892 1.00 86.30 ? 571 ARG A NH1 1 
ATOM   606  N  NH2 . ARG A 1 74  ? 21.877 57.770 -15.579 1.00 85.49 ? 571 ARG A NH2 1 
ATOM   607  N  N   . LYS A 1 75  ? 20.093 61.876 -8.750  1.00 23.93 ? 572 LYS A N   1 
ATOM   608  C  CA  . LYS A 1 75  ? 20.588 61.086 -7.634  1.00 20.81 ? 572 LYS A CA  1 
ATOM   609  C  C   . LYS A 1 75  ? 19.511 60.067 -7.365  1.00 16.06 ? 572 LYS A C   1 
ATOM   610  O  O   . LYS A 1 75  ? 18.381 60.237 -7.789  1.00 17.31 ? 572 LYS A O   1 
ATOM   611  C  CB  . LYS A 1 75  ? 20.843 61.966 -6.393  1.00 18.06 ? 572 LYS A CB  1 
ATOM   612  C  CG  . LYS A 1 75  ? 22.004 62.929 -6.578  1.00 20.31 ? 572 LYS A CG  1 
ATOM   613  C  CD  . LYS A 1 75  ? 22.138 63.949 -5.468  1.00 23.14 ? 572 LYS A CD  1 
ATOM   614  C  CE  . LYS A 1 75  ? 23.202 64.988 -5.836  1.00 24.18 ? 572 LYS A CE  1 
ATOM   615  N  NZ  . LYS A 1 75  ? 23.545 65.977 -4.755  1.00 20.57 ? 572 LYS A NZ  1 
ATOM   616  N  N   . ARG A 1 76  ? 19.857 58.956 -6.750  1.00 20.74 ? 573 ARG A N   1 
ATOM   617  C  CA  . ARG A 1 76  ? 18.834 57.949 -6.475  1.00 22.56 ? 573 ARG A CA  1 
ATOM   618  C  C   . ARG A 1 76  ? 17.883 58.457 -5.379  1.00 20.74 ? 573 ARG A C   1 
ATOM   619  O  O   . ARG A 1 76  ? 18.280 59.311 -4.565  1.00 23.29 ? 573 ARG A O   1 
ATOM   620  C  CB  . ARG A 1 76  ? 19.498 56.617 -6.138  1.00 27.37 ? 573 ARG A CB  1 
ATOM   621  C  CG  . ARG A 1 76  ? 20.682 56.741 -5.228  1.00 35.56 ? 573 ARG A CG  1 
ATOM   622  C  CD  . ARG A 1 76  ? 21.369 55.399 -5.040  1.00 44.36 ? 573 ARG A CD  1 
ATOM   623  N  NE  . ARG A 1 76  ? 22.340 55.095 -6.087  1.00 49.02 ? 573 ARG A NE  1 
ATOM   624  C  CZ  . ARG A 1 76  ? 22.261 54.052 -6.916  1.00 54.28 ? 573 ARG A CZ  1 
ATOM   625  N  NH1 . ARG A 1 76  ? 21.240 53.191 -6.847  1.00 56.03 ? 573 ARG A NH1 1 
ATOM   626  N  NH2 . ARG A 1 76  ? 23.226 53.851 -7.805  1.00 52.89 ? 573 ARG A NH2 1 
ATOM   627  N  N   . PRO A 1 77  ? 16.610 57.997 -5.375  1.00 17.46 ? 574 PRO A N   1 
ATOM   628  C  CA  . PRO A 1 77  ? 15.610 58.412 -4.392  1.00 12.01 ? 574 PRO A CA  1 
ATOM   629  C  C   . PRO A 1 77  ? 16.092 58.327 -2.953  1.00 14.44 ? 574 PRO A C   1 
ATOM   630  O  O   . PRO A 1 77  ? 15.816 59.220 -2.163  1.00 17.36 ? 574 PRO A O   1 
ATOM   631  C  CB  . PRO A 1 77  ? 14.472 57.442 -4.650  1.00 16.28 ? 574 PRO A CB  1 
ATOM   632  C  CG  . PRO A 1 77  ? 14.547 57.219 -6.088  1.00 11.38 ? 574 PRO A CG  1 
ATOM   633  C  CD  . PRO A 1 77  ? 16.024 57.002 -6.291  1.00 18.26 ? 574 PRO A CD  1 
ATOM   634  N  N   . SER A 1 78  ? 16.880 57.305 -2.639  1.00 13.89 ? 575 SER A N   1 
ATOM   635  C  CA  . SER A 1 78  ? 17.394 57.104 -1.289  1.00 15.54 ? 575 SER A CA  1 
ATOM   636  C  C   . SER A 1 78  ? 18.385 58.170 -0.880  1.00 18.01 ? 575 SER A C   1 
ATOM   637  O  O   . SER A 1 78  ? 18.394 58.619 0.269   1.00 19.91 ? 575 SER A O   1 
ATOM   638  C  CB  . SER A 1 78  ? 18.052 55.742 -1.163  1.00 11.08 ? 575 SER A CB  1 
ATOM   639  O  OG  . SER A 1 78  ? 19.038 55.601 -2.157  1.00 15.54 ? 575 SER A OG  1 
ATOM   640  N  N   . GLU A 1 79  ? 19.221 58.599 -1.810  1.00 19.82 ? 576 GLU A N   1 
ATOM   641  C  CA  . GLU A 1 79  ? 20.180 59.616 -1.445  1.00 19.22 ? 576 GLU A CA  1 
ATOM   642  C  C   . GLU A 1 79  ? 19.456 60.923 -1.244  1.00 19.69 ? 576 GLU A C   1 
ATOM   643  O  O   . GLU A 1 79  ? 19.754 61.678 -0.322  1.00 21.30 ? 576 GLU A O   1 
ATOM   644  C  CB  . GLU A 1 79  ? 21.287 59.774 -2.483  1.00 24.50 ? 576 GLU A CB  1 
ATOM   645  C  CG  . GLU A 1 79  ? 22.414 60.647 -1.930  1.00 34.07 ? 576 GLU A CG  1 
ATOM   646  C  CD  . GLU A 1 79  ? 23.375 61.108 -2.979  1.00 44.16 ? 576 GLU A CD  1 
ATOM   647  O  OE1 . GLU A 1 79  ? 23.681 60.305 -3.893  1.00 48.95 ? 576 GLU A OE1 1 
ATOM   648  O  OE2 . GLU A 1 79  ? 23.816 62.283 -2.891  1.00 50.40 ? 576 GLU A OE2 1 
ATOM   649  N  N   . LEU A 1 80  ? 18.495 61.191 -2.106  1.00 18.39 ? 577 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 80  ? 17.734 62.419 -1.993  1.00 18.06 ? 577 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 80  ? 17.042 62.469 -0.640  1.00 15.66 ? 577 LEU A C   1 
ATOM   652  O  O   . LEU A 1 80  ? 17.081 63.482 0.056   1.00 16.14 ? 577 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 80  ? 16.715 62.518 -3.141  1.00 14.46 ? 577 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 80  ? 17.362 62.681 -4.522  1.00 13.01 ? 577 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 80  ? 16.309 62.686 -5.592  1.00 12.16 ? 577 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 80  ? 18.182 63.963 -4.564  1.00 10.44 ? 577 LEU A CD2 1 
ATOM   657  N  N   . ARG A 1 81  ? 16.431 61.356 -0.258  1.00 18.03 ? 578 ARG A N   1 
ATOM   658  C  CA  . ARG A 1 81  ? 15.721 61.282 1.013   1.00 16.42 ? 578 ARG A CA  1 
ATOM   659  C  C   . ARG A 1 81  ? 16.656 61.533 2.177   1.00 18.59 ? 578 ARG A C   1 
ATOM   660  O  O   . ARG A 1 81  ? 16.276 62.207 3.136   1.00 23.30 ? 578 ARG A O   1 
ATOM   661  C  CB  . ARG A 1 81  ? 15.005 59.939 1.169   1.00 14.49 ? 578 ARG A CB  1 
ATOM   662  C  CG  . ARG A 1 81  ? 13.822 59.783 0.220   1.00 9.10  ? 578 ARG A CG  1 
ATOM   663  C  CD  . ARG A 1 81  ? 12.924 58.631 0.583   1.00 7.18  ? 578 ARG A CD  1 
ATOM   664  N  NE  . ARG A 1 81  ? 13.668 57.391 0.758   1.00 13.10 ? 578 ARG A NE  1 
ATOM   665  C  CZ  . ARG A 1 81  ? 13.780 56.455 -0.164  1.00 11.87 ? 578 ARG A CZ  1 
ATOM   666  N  NH1 . ARG A 1 81  ? 13.191 56.622 -1.340  1.00 9.76  ? 578 ARG A NH1 1 
ATOM   667  N  NH2 . ARG A 1 81  ? 14.501 55.368 0.083   1.00 14.50 ? 578 ARG A NH2 1 
ATOM   668  N  N   . ARG A 1 82  ? 17.889 61.046 2.070   1.00 17.36 ? 579 ARG A N   1 
ATOM   669  C  CA  . ARG A 1 82  ? 18.879 61.248 3.119   1.00 17.76 ? 579 ARG A CA  1 
ATOM   670  C  C   . ARG A 1 82  ? 19.246 62.719 3.237   1.00 18.99 ? 579 ARG A C   1 
ATOM   671  O  O   . ARG A 1 82  ? 19.372 63.252 4.341   1.00 21.54 ? 579 ARG A O   1 
ATOM   672  C  CB  . ARG A 1 82  ? 20.132 60.414 2.833   1.00 18.77 ? 579 ARG A CB  1 
ATOM   673  C  CG  . ARG A 1 82  ? 21.347 60.787 3.684   1.00 24.17 ? 579 ARG A CG  1 
ATOM   674  C  CD  . ARG A 1 82  ? 22.532 59.857 3.461   1.00 26.24 ? 579 ARG A CD  1 
ATOM   675  N  NE  . ARG A 1 82  ? 22.856 59.678 2.045   1.00 36.84 ? 579 ARG A NE  1 
ATOM   676  C  CZ  . ARG A 1 82  ? 22.428 58.654 1.296   1.00 39.67 ? 579 ARG A CZ  1 
ATOM   677  N  NH1 . ARG A 1 82  ? 21.640 57.703 1.800   1.00 37.99 ? 579 ARG A NH1 1 
ATOM   678  N  NH2 . ARG A 1 82  ? 22.861 58.521 0.052   1.00 40.49 ? 579 ARG A NH2 1 
ATOM   679  N  N   . ILE A 1 83  ? 19.433 63.377 2.101   1.00 18.54 ? 580 ILE A N   1 
ATOM   680  C  CA  . ILE A 1 83  ? 19.784 64.790 2.098   1.00 14.36 ? 580 ILE A CA  1 
ATOM   681  C  C   . ILE A 1 83  ? 18.681 65.556 2.800   1.00 14.39 ? 580 ILE A C   1 
ATOM   682  O  O   . ILE A 1 83  ? 18.956 66.396 3.643   1.00 15.74 ? 580 ILE A O   1 
ATOM   683  C  CB  . ILE A 1 83  ? 19.969 65.315 0.673   1.00 10.89 ? 580 ILE A CB  1 
ATOM   684  C  CG1 . ILE A 1 83  ? 21.209 64.682 0.067   1.00 16.10 ? 580 ILE A CG1 1 
ATOM   685  C  CG2 . ILE A 1 83  ? 20.087 66.835 0.663   1.00 13.34 ? 580 ILE A CG2 1 
ATOM   686  C  CD1 . ILE A 1 83  ? 21.457 65.030 -1.408  1.00 15.50 ? 580 ILE A CD1 1 
ATOM   687  N  N   . ALA A 1 84  ? 17.432 65.208 2.508   1.00 16.77 ? 581 ALA A N   1 
ATOM   688  C  CA  . ALA A 1 84  ? 16.294 65.881 3.121   1.00 16.31 ? 581 ALA A CA  1 
ATOM   689  C  C   . ALA A 1 84  ? 16.252 65.723 4.646   1.00 17.47 ? 581 ALA A C   1 
ATOM   690  O  O   . ALA A 1 84  ? 15.942 66.670 5.350   1.00 18.94 ? 581 ALA A O   1 
ATOM   691  C  CB  . ALA A 1 84  ? 14.991 65.386 2.487   1.00 12.38 ? 581 ALA A CB  1 
ATOM   692  N  N   . SER A 1 85  ? 16.559 64.539 5.167   1.00 21.47 ? 582 SER A N   1 
ATOM   693  C  CA  . SER A 1 85  ? 16.516 64.344 6.617   1.00 22.46 ? 582 SER A CA  1 
ATOM   694  C  C   . SER A 1 85  ? 17.700 64.984 7.295   1.00 23.44 ? 582 SER A C   1 
ATOM   695  O  O   . SER A 1 85  ? 17.673 65.229 8.497   1.00 29.23 ? 582 SER A O   1 
ATOM   696  C  CB  . SER A 1 85  ? 16.469 62.867 6.974   1.00 21.25 ? 582 SER A CB  1 
ATOM   697  O  OG  . SER A 1 85  ? 17.659 62.228 6.577   1.00 25.04 ? 582 SER A OG  1 
ATOM   698  N  N   . GLN A 1 86  ? 18.728 65.293 6.522   1.00 22.77 ? 583 GLN A N   1 
ATOM   699  C  CA  . GLN A 1 86  ? 19.919 65.910 7.077   1.00 23.36 ? 583 GLN A CA  1 
ATOM   700  C  C   . GLN A 1 86  ? 19.874 67.425 6.981   1.00 21.29 ? 583 GLN A C   1 
ATOM   701  O  O   . GLN A 1 86  ? 20.812 68.117 7.416   1.00 20.02 ? 583 GLN A O   1 
ATOM   702  C  CB  . GLN A 1 86  ? 21.177 65.369 6.398   1.00 30.71 ? 583 GLN A CB  1 
ATOM   703  C  CG  . GLN A 1 86  ? 21.524 63.939 6.797   1.00 42.85 ? 583 GLN A CG  1 
ATOM   704  C  CD  . GLN A 1 86  ? 22.843 63.455 6.192   1.00 55.80 ? 583 GLN A CD  1 
ATOM   705  O  OE1 . GLN A 1 86  ? 23.589 62.715 6.839   1.00 62.99 ? 583 GLN A OE1 1 
ATOM   706  N  NE2 . GLN A 1 86  ? 23.141 63.873 4.950   1.00 59.38 ? 583 GLN A NE2 1 
ATOM   707  N  N   . VAL A 1 87  ? 18.804 67.940 6.389   1.00 15.51 ? 584 VAL A N   1 
ATOM   708  C  CA  . VAL A 1 87  ? 18.622 69.371 6.255   1.00 21.88 ? 584 VAL A CA  1 
ATOM   709  C  C   . VAL A 1 87  ? 18.891 70.018 7.615   1.00 26.42 ? 584 VAL A C   1 
ATOM   710  O  O   . VAL A 1 87  ? 18.367 69.585 8.643   1.00 26.77 ? 584 VAL A O   1 
ATOM   711  C  CB  . VAL A 1 87  ? 17.194 69.706 5.768   1.00 25.45 ? 584 VAL A CB  1 
ATOM   712  C  CG1 . VAL A 1 87  ? 16.944 71.199 5.861   1.00 30.17 ? 584 VAL A CG1 1 
ATOM   713  C  CG2 . VAL A 1 87  ? 17.013 69.269 4.333   1.00 27.33 ? 584 VAL A CG2 1 
ATOM   714  N  N   . LYS A 1 88  ? 19.690 71.073 7.597   1.00 30.58 ? 585 LYS A N   1 
ATOM   715  C  CA  . LYS A 1 88  ? 20.108 71.788 8.798   1.00 33.89 ? 585 LYS A CA  1 
ATOM   716  C  C   . LYS A 1 88  ? 19.091 72.734 9.417   1.00 32.68 ? 585 LYS A C   1 
ATOM   717  O  O   . LYS A 1 88  ? 18.570 73.641 8.747   1.00 33.70 ? 585 LYS A O   1 
ATOM   718  C  CB  . LYS A 1 88  ? 21.398 72.551 8.497   1.00 41.79 ? 585 LYS A CB  1 
ATOM   719  C  CG  . LYS A 1 88  ? 22.643 71.977 9.165   1.00 52.09 ? 585 LYS A CG  1 
ATOM   720  C  CD  . LYS A 1 88  ? 22.693 72.340 10.657  1.00 63.92 ? 585 LYS A CD  1 
ATOM   721  C  CE  . LYS A 1 88  ? 22.857 73.859 10.873  1.00 70.35 ? 585 LYS A CE  1 
ATOM   722  N  NZ  . LYS A 1 88  ? 22.735 74.271 12.316  1.00 74.91 ? 585 LYS A NZ  1 
ATOM   723  N  N   . TYR A 1 89  ? 18.859 72.557 10.718  1.00 30.31 ? 586 TYR A N   1 
ATOM   724  C  CA  . TYR A 1 89  ? 17.928 73.416 11.454  1.00 29.54 ? 586 TYR A CA  1 
ATOM   725  C  C   . TYR A 1 89  ? 18.583 74.776 11.564  1.00 29.75 ? 586 TYR A C   1 
ATOM   726  O  O   . TYR A 1 89  ? 19.696 74.885 12.079  1.00 30.67 ? 586 TYR A O   1 
ATOM   727  C  CB  . TYR A 1 89  ? 17.619 72.856 12.861  1.00 27.95 ? 586 TYR A CB  1 
ATOM   728  C  CG  . TYR A 1 89  ? 16.772 73.793 13.721  1.00 26.56 ? 586 TYR A CG  1 
ATOM   729  C  CD1 . TYR A 1 89  ? 15.389 73.906 13.522  1.00 24.59 ? 586 TYR A CD1 1 
ATOM   730  C  CD2 . TYR A 1 89  ? 17.361 74.604 14.699  1.00 21.69 ? 586 TYR A CD2 1 
ATOM   731  C  CE1 . TYR A 1 89  ? 14.616 74.806 14.265  1.00 20.84 ? 586 TYR A CE1 1 
ATOM   732  C  CE2 . TYR A 1 89  ? 16.590 75.508 15.457  1.00 17.53 ? 586 TYR A CE2 1 
ATOM   733  C  CZ  . TYR A 1 89  ? 15.222 75.601 15.233  1.00 23.50 ? 586 TYR A CZ  1 
ATOM   734  O  OH  . TYR A 1 89  ? 14.461 76.482 15.978  1.00 21.84 ? 586 TYR A OH  1 
ATOM   735  N  N   . ALA A 1 90  ? 17.932 75.788 10.994  1.00 28.03 ? 587 ALA A N   1 
ATOM   736  C  CA  . ALA A 1 90  ? 18.433 77.150 11.016  1.00 27.73 ? 587 ALA A CA  1 
ATOM   737  C  C   . ALA A 1 90  ? 17.945 77.932 12.220  1.00 27.05 ? 587 ALA A C   1 
ATOM   738  O  O   . ALA A 1 90  ? 18.735 78.601 12.870  1.00 26.39 ? 587 ALA A O   1 
ATOM   739  C  CB  . ALA A 1 90  ? 18.056 77.882 9.719   1.00 29.03 ? 587 ALA A CB  1 
ATOM   740  N  N   . GLY A 1 91  ? 16.643 77.880 12.490  1.00 25.16 ? 588 GLY A N   1 
ATOM   741  C  CA  . GLY A 1 91  ? 16.093 78.606 13.619  1.00 24.35 ? 588 GLY A CA  1 
ATOM   742  C  C   . GLY A 1 91  ? 16.224 80.115 13.484  1.00 26.00 ? 588 GLY A C   1 
ATOM   743  O  O   . GLY A 1 91  ? 16.582 80.806 14.429  1.00 27.67 ? 588 GLY A O   1 
ATOM   744  N  N   . SER A 1 92  ? 15.891 80.626 12.309  1.00 25.60 ? 589 SER A N   1 
ATOM   745  C  CA  . SER A 1 92  ? 15.985 82.044 12.009  1.00 25.91 ? 589 SER A CA  1 
ATOM   746  C  C   . SER A 1 92  ? 14.916 82.905 12.679  1.00 27.91 ? 589 SER A C   1 
ATOM   747  O  O   . SER A 1 92  ? 13.849 82.426 13.050  1.00 23.56 ? 589 SER A O   1 
ATOM   748  C  CB  . SER A 1 92  ? 15.879 82.228 10.495  1.00 26.02 ? 589 SER A CB  1 
ATOM   749  O  OG  . SER A 1 92  ? 16.935 83.028 9.992   1.00 41.28 ? 589 SER A OG  1 
ATOM   750  N  N   . GLN A 1 93  ? 15.212 84.193 12.811  1.00 32.43 ? 590 GLN A N   1 
ATOM   751  C  CA  . GLN A 1 93  ? 14.256 85.130 13.373  1.00 37.48 ? 590 GLN A CA  1 
ATOM   752  C  C   . GLN A 1 93  ? 13.253 85.476 12.296  1.00 35.55 ? 590 GLN A C   1 
ATOM   753  O  O   . GLN A 1 93  ? 12.160 85.937 12.588  1.00 38.88 ? 590 GLN A O   1 
ATOM   754  C  CB  . GLN A 1 93  ? 14.955 86.415 13.821  1.00 39.80 ? 590 GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 93  ? 15.288 86.435 15.295  1.00 56.15 ? 590 GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 93  ? 16.155 87.622 15.686  1.00 65.66 ? 590 GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 93  ? 15.649 88.723 15.932  1.00 71.38 ? 590 GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 93  ? 17.473 87.403 15.742  1.00 67.58 ? 590 GLN A NE2 1 
ATOM   759  N  N   . VAL A 1 94  ? 13.647 85.246 11.047  1.00 34.29 ? 591 VAL A N   1 
ATOM   760  C  CA  . VAL A 1 94  ? 12.832 85.570 9.880   1.00 30.91 ? 591 VAL A CA  1 
ATOM   761  C  C   . VAL A 1 94  ? 12.827 84.471 8.809   1.00 26.09 ? 591 VAL A C   1 
ATOM   762  O  O   . VAL A 1 94  ? 13.885 84.022 8.392   1.00 23.24 ? 591 VAL A O   1 
ATOM   763  C  CB  . VAL A 1 94  ? 13.359 86.907 9.243   1.00 30.16 ? 591 VAL A CB  1 
ATOM   764  C  CG1 . VAL A 1 94  ? 13.067 86.983 7.758   1.00 33.78 ? 591 VAL A CG1 1 
ATOM   765  C  CG2 . VAL A 1 94  ? 12.750 88.102 9.949   1.00 29.76 ? 591 VAL A CG2 1 
ATOM   766  N  N   . ALA A 1 95  ? 11.636 84.000 8.437   1.00 24.70 ? 592 ALA A N   1 
ATOM   767  C  CA  . ALA A 1 95  ? 11.462 83.007 7.372   1.00 20.42 ? 592 ALA A CA  1 
ATOM   768  C  C   . ALA A 1 95  ? 10.529 83.712 6.375   1.00 23.74 ? 592 ALA A C   1 
ATOM   769  O  O   . ALA A 1 95  ? 9.320  83.852 6.629   1.00 19.55 ? 592 ALA A O   1 
ATOM   770  C  CB  . ALA A 1 95  ? 10.829 81.750 7.893   1.00 14.37 ? 592 ALA A CB  1 
ATOM   771  N  N   . SER A 1 96  ? 11.104 84.209 5.277   1.00 22.94 ? 593 SER A N   1 
ATOM   772  C  CA  . SER A 1 96  ? 10.349 84.951 4.270   1.00 23.81 ? 593 SER A CA  1 
ATOM   773  C  C   . SER A 1 96  ? 9.677  84.093 3.224   1.00 22.86 ? 593 SER A C   1 
ATOM   774  O  O   . SER A 1 96  ? 10.336 83.470 2.401   1.00 22.82 ? 593 SER A O   1 
ATOM   775  C  CB  . SER A 1 96  ? 11.232 85.974 3.569   1.00 23.57 ? 593 SER A CB  1 
ATOM   776  O  OG  . SER A 1 96  ? 10.496 86.636 2.556   1.00 14.43 ? 593 SER A OG  1 
ATOM   777  N  N   . THR A 1 97  ? 8.354  84.150 3.212   1.00 22.76 ? 594 THR A N   1 
ATOM   778  C  CA  . THR A 1 97  ? 7.568  83.380 2.263   1.00 22.25 ? 594 THR A CA  1 
ATOM   779  C  C   . THR A 1 97  ? 7.608  84.069 0.898   1.00 21.75 ? 594 THR A C   1 
ATOM   780  O  O   . THR A 1 97  ? 7.593  83.411 -0.143  1.00 21.45 ? 594 THR A O   1 
ATOM   781  C  CB  . THR A 1 97  ? 6.122  83.217 2.768   1.00 19.99 ? 594 THR A CB  1 
ATOM   782  O  OG1 . THR A 1 97  ? 5.593  84.505 3.106   1.00 18.50 ? 594 THR A OG1 1 
ATOM   783  C  CG2 . THR A 1 97  ? 6.110  82.375 4.021   1.00 15.10 ? 594 THR A CG2 1 
ATOM   784  N  N   . SER A 1 98  ? 7.663  85.400 0.901   1.00 21.20 ? 595 SER A N   1 
ATOM   785  C  CA  . SER A 1 98  ? 7.738  86.164 -0.334  1.00 18.60 ? 595 SER A CA  1 
ATOM   786  C  C   . SER A 1 98  ? 9.032  85.850 -1.040  1.00 19.69 ? 595 SER A C   1 
ATOM   787  O  O   . SER A 1 98  ? 9.044  85.513 -2.228  1.00 22.57 ? 595 SER A O   1 
ATOM   788  C  CB  . SER A 1 98  ? 7.661  87.653 -0.037  1.00 11.10 ? 595 SER A CB  1 
ATOM   789  O  OG  . SER A 1 98  ? 6.344  87.985 0.326   1.00 19.37 ? 595 SER A OG  1 
ATOM   790  N  N   . GLU A 1 99  ? 10.122 85.922 -0.294  1.00 21.05 ? 596 GLU A N   1 
ATOM   791  C  CA  . GLU A 1 99  ? 11.418 85.638 -0.863  1.00 23.66 ? 596 GLU A CA  1 
ATOM   792  C  C   . GLU A 1 99  ? 11.591 84.184 -1.299  1.00 22.27 ? 596 GLU A C   1 
ATOM   793  O  O   . GLU A 1 99  ? 12.302 83.905 -2.260  1.00 24.61 ? 596 GLU A O   1 
ATOM   794  C  CB  . GLU A 1 99  ? 12.543 86.151 0.043   1.00 30.29 ? 596 GLU A CB  1 
ATOM   795  C  CG  . GLU A 1 99  ? 13.058 87.575 -0.366  1.00 39.81 ? 596 GLU A CG  1 
ATOM   796  C  CD  . GLU A 1 99  ? 11.948 88.663 -0.449  1.00 45.46 ? 596 GLU A CD  1 
ATOM   797  O  OE1 . GLU A 1 99  ? 11.391 89.067 0.602   1.00 52.14 ? 596 GLU A OE1 1 
ATOM   798  O  OE2 . GLU A 1 99  ? 11.648 89.142 -1.565  1.00 47.05 ? 596 GLU A OE2 1 
ATOM   799  N  N   . VAL A 1 100 ? 10.886 83.257 -0.661  1.00 19.54 ? 597 VAL A N   1 
ATOM   800  C  CA  . VAL A 1 100 ? 10.993 81.869 -1.079  1.00 14.34 ? 597 VAL A CA  1 
ATOM   801  C  C   . VAL A 1 100 ? 10.056 81.566 -2.257  1.00 14.34 ? 597 VAL A C   1 
ATOM   802  O  O   . VAL A 1 100 ? 10.322 80.677 -3.047  1.00 15.50 ? 597 VAL A O   1 
ATOM   803  C  CB  . VAL A 1 100 ? 10.768 80.893 0.077   1.00 10.95 ? 597 VAL A CB  1 
ATOM   804  C  CG1 . VAL A 1 100 ? 9.297  80.603 0.266   1.00 9.01  ? 597 VAL A CG1 1 
ATOM   805  C  CG2 . VAL A 1 100 ? 11.555 79.624 -0.172  1.00 10.66 ? 597 VAL A CG2 1 
ATOM   806  N  N   . LEU A 1 101 ? 8.951  82.287 -2.372  1.00 12.70 ? 598 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 101 ? 8.067  82.083 -3.502  1.00 12.15 ? 598 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 101 ? 8.749  82.749 -4.699  1.00 17.31 ? 598 LEU A C   1 
ATOM   809  O  O   . LEU A 1 101 ? 8.579  82.324 -5.840  1.00 18.32 ? 598 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 101 ? 6.700  82.699 -3.240  1.00 8.81  ? 598 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 101 ? 5.728  81.891 -2.363  1.00 9.60  ? 598 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 101 ? 4.467  82.716 -2.154  1.00 9.06  ? 598 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 101 ? 5.370  80.522 -2.975  1.00 7.06  ? 598 LEU A CD2 1 
ATOM   814  N  N   . LYS A 1 102 ? 9.552  83.777 -4.432  1.00 18.09 ? 599 LYS A N   1 
ATOM   815  C  CA  . LYS A 1 102 ? 10.288 84.442 -5.492  1.00 20.39 ? 599 LYS A CA  1 
ATOM   816  C  C   . LYS A 1 102 ? 11.328 83.475 -6.055  1.00 20.58 ? 599 LYS A C   1 
ATOM   817  O  O   . LYS A 1 102 ? 11.552 83.432 -7.260  1.00 23.57 ? 599 LYS A O   1 
ATOM   818  C  CB  . LYS A 1 102 ? 11.001 85.693 -4.982  1.00 21.30 ? 599 LYS A CB  1 
ATOM   819  C  CG  . LYS A 1 102 ? 11.836 86.366 -6.063  1.00 20.62 ? 599 LYS A CG  1 
ATOM   820  C  CD  . LYS A 1 102 ? 12.331 87.732 -5.633  1.00 28.26 ? 599 LYS A CD  1 
ATOM   821  C  CE  . LYS A 1 102 ? 13.674 87.677 -4.914  1.00 28.15 ? 599 LYS A CE  1 
ATOM   822  N  NZ  . LYS A 1 102 ? 14.463 88.927 -5.268  1.00 36.90 ? 599 LYS A NZ  1 
ATOM   823  N  N   . TYR A 1 103 ? 11.972 82.712 -5.184  1.00 15.33 ? 600 TYR A N   1 
ATOM   824  C  CA  . TYR A 1 103 ? 12.975 81.739 -5.605  1.00 14.72 ? 600 TYR A CA  1 
ATOM   825  C  C   . TYR A 1 103 ? 12.380 80.614 -6.470  1.00 15.26 ? 600 TYR A C   1 
ATOM   826  O  O   . TYR A 1 103 ? 13.031 80.110 -7.394  1.00 14.23 ? 600 TYR A O   1 
ATOM   827  C  CB  . TYR A 1 103 ? 13.659 81.159 -4.369  1.00 10.22 ? 600 TYR A CB  1 
ATOM   828  C  CG  . TYR A 1 103 ? 14.763 80.168 -4.658  1.00 13.36 ? 600 TYR A CG  1 
ATOM   829  C  CD1 . TYR A 1 103 ? 16.091 80.594 -4.820  1.00 9.42  ? 600 TYR A CD1 1 
ATOM   830  C  CD2 . TYR A 1 103 ? 14.488 78.791 -4.745  1.00 9.40  ? 600 TYR A CD2 1 
ATOM   831  C  CE1 . TYR A 1 103 ? 17.123 79.670 -5.066  1.00 8.00  ? 600 TYR A CE1 1 
ATOM   832  C  CE2 . TYR A 1 103 ? 15.502 77.874 -4.987  1.00 11.12 ? 600 TYR A CE2 1 
ATOM   833  C  CZ  . TYR A 1 103 ? 16.812 78.320 -5.154  1.00 13.46 ? 600 TYR A CZ  1 
ATOM   834  O  OH  . TYR A 1 103 ? 17.796 77.412 -5.477  1.00 18.52 ? 600 TYR A OH  1 
ATOM   835  N  N   . THR A 1 104 ? 11.144 80.228 -6.167  1.00 15.74 ? 601 THR A N   1 
ATOM   836  C  CA  . THR A 1 104 ? 10.449 79.163 -6.887  1.00 16.26 ? 601 THR A CA  1 
ATOM   837  C  C   . THR A 1 104 ? 10.062 79.658 -8.291  1.00 18.06 ? 601 THR A C   1 
ATOM   838  O  O   . THR A 1 104 ? 10.189 78.942 -9.297  1.00 20.51 ? 601 THR A O   1 
ATOM   839  C  CB  . THR A 1 104 ? 9.184  78.724 -6.074  1.00 13.62 ? 601 THR A CB  1 
ATOM   840  O  OG1 . THR A 1 104 ? 9.583  78.361 -4.745  1.00 14.88 ? 601 THR A OG1 1 
ATOM   841  C  CG2 . THR A 1 104 ? 8.493  77.517 -6.690  1.00 8.81  ? 601 THR A CG2 1 
ATOM   842  N  N   . LEU A 1 105 ? 9.660  80.914 -8.358  1.00 18.80 ? 602 LEU A N   1 
ATOM   843  C  CA  . LEU A 1 105 ? 9.239  81.517 -9.594  1.00 12.28 ? 602 LEU A CA  1 
ATOM   844  C  C   . LEU A 1 105 ? 10.394 81.808 -10.528 1.00 12.80 ? 602 LEU A C   1 
ATOM   845  O  O   . LEU A 1 105 ? 10.365 81.445 -11.686 1.00 15.88 ? 602 LEU A O   1 
ATOM   846  C  CB  . LEU A 1 105 ? 8.497  82.800 -9.259  1.00 7.41  ? 602 LEU A CB  1 
ATOM   847  C  CG  . LEU A 1 105 ? 7.971  83.645 -10.410 1.00 4.81  ? 602 LEU A CG  1 
ATOM   848  C  CD1 . LEU A 1 105 ? 7.137  82.788 -11.305 1.00 11.16 ? 602 LEU A CD1 1 
ATOM   849  C  CD2 . LEU A 1 105 ? 7.163  84.783 -9.881  1.00 3.73  ? 602 LEU A CD2 1 
ATOM   850  N  N   . PHE A 1 106 ? 11.409 82.496 -10.031 1.00 17.52 ? 603 PHE A N   1 
ATOM   851  C  CA  . PHE A 1 106 ? 12.537 82.883 -10.862 1.00 18.59 ? 603 PHE A CA  1 
ATOM   852  C  C   . PHE A 1 106 ? 13.743 81.966 -10.844 1.00 21.46 ? 603 PHE A C   1 
ATOM   853  O  O   . PHE A 1 106 ? 14.577 82.022 -11.746 1.00 21.41 ? 603 PHE A O   1 
ATOM   854  C  CB  . PHE A 1 106 ? 12.954 84.322 -10.533 1.00 13.06 ? 603 PHE A CB  1 
ATOM   855  C  CG  . PHE A 1 106 ? 11.860 85.333 -10.758 1.00 13.57 ? 603 PHE A CG  1 
ATOM   856  C  CD1 . PHE A 1 106 ? 11.257 85.469 -12.006 1.00 13.30 ? 603 PHE A CD1 1 
ATOM   857  C  CD2 . PHE A 1 106 ? 11.422 86.138 -9.722  1.00 11.61 ? 603 PHE A CD2 1 
ATOM   858  C  CE1 . PHE A 1 106 ? 10.232 86.385 -12.212 1.00 8.39  ? 603 PHE A CE1 1 
ATOM   859  C  CE2 . PHE A 1 106 ? 10.403 87.054 -9.916  1.00 14.44 ? 603 PHE A CE2 1 
ATOM   860  C  CZ  . PHE A 1 106 ? 9.804  87.180 -11.160 1.00 14.78 ? 603 PHE A CZ  1 
ATOM   861  N  N   . GLN A 1 107 ? 13.828 81.087 -9.856  1.00 24.28 ? 604 GLN A N   1 
ATOM   862  C  CA  . GLN A 1 107 ? 14.983 80.205 -9.787  1.00 27.12 ? 604 GLN A CA  1 
ATOM   863  C  C   . GLN A 1 107 ? 14.687 78.739 -10.058 1.00 24.50 ? 604 GLN A C   1 
ATOM   864  O  O   . GLN A 1 107 ? 15.512 78.040 -10.605 1.00 24.04 ? 604 GLN A O   1 
ATOM   865  C  CB  . GLN A 1 107 ? 15.689 80.368 -8.440  1.00 31.32 ? 604 GLN A CB  1 
ATOM   866  C  CG  . GLN A 1 107 ? 16.522 81.621 -8.287  1.00 35.80 ? 604 GLN A CG  1 
ATOM   867  C  CD  . GLN A 1 107 ? 17.861 81.469 -8.960  1.00 45.50 ? 604 GLN A CD  1 
ATOM   868  O  OE1 . GLN A 1 107 ? 18.784 80.859 -8.418  1.00 49.26 ? 604 GLN A OE1 1 
ATOM   869  N  NE2 . GLN A 1 107 ? 17.973 81.999 -10.166 1.00 54.22 ? 604 GLN A NE2 1 
ATOM   870  N  N   . ILE A 1 108 ? 13.521 78.260 -9.660  1.00 23.49 ? 605 ILE A N   1 
ATOM   871  C  CA  . ILE A 1 108 ? 13.196 76.859 -9.881  1.00 22.06 ? 605 ILE A CA  1 
ATOM   872  C  C   . ILE A 1 108 ? 12.418 76.627 -11.163 1.00 25.79 ? 605 ILE A C   1 
ATOM   873  O  O   . ILE A 1 108 ? 12.635 75.633 -11.861 1.00 28.80 ? 605 ILE A O   1 
ATOM   874  C  CB  . ILE A 1 108 ? 12.425 76.243 -8.678  1.00 18.12 ? 605 ILE A CB  1 
ATOM   875  C  CG1 . ILE A 1 108 ? 13.356 76.119 -7.470  1.00 16.09 ? 605 ILE A CG1 1 
ATOM   876  C  CG2 . ILE A 1 108 ? 11.862 74.874 -9.035  1.00 15.46 ? 605 ILE A CG2 1 
ATOM   877  C  CD1 . ILE A 1 108 ? 12.661 75.604 -6.225  1.00 12.12 ? 605 ILE A CD1 1 
ATOM   878  N  N   . PHE A 1 109 ? 11.444 77.484 -11.431 1.00 21.94 ? 606 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 109 ? 10.670 77.333 -12.645 1.00 22.03 ? 606 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 109 ? 10.903 78.556 -13.533 1.00 22.92 ? 606 PHE A C   1 
ATOM   881  O  O   . PHE A 1 109 ? 9.965  79.130 -14.083 1.00 19.90 ? 606 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 109 ? 9.188  77.149 -12.310 1.00 19.38 ? 606 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 109 ? 8.899  75.943 -11.442 1.00 24.03 ? 606 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 109 ? 8.941  74.656 -11.969 1.00 21.11 ? 606 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 109 ? 8.498  76.107 -10.108 1.00 23.28 ? 606 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 109 ? 8.582  73.560 -11.178 1.00 22.09 ? 606 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 109 ? 8.141  75.025 -9.319  1.00 19.77 ? 606 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 109 ? 8.175  73.749 -9.850  1.00 22.92 ? 606 PHE A CZ  1 
ATOM   889  N  N   . SER A 1 110 ? 12.165 78.971 -13.641 1.00 27.16 ? 607 SER A N   1 
ATOM   890  C  CA  . SER A 1 110 ? 12.505 80.127 -14.456 1.00 34.01 ? 607 SER A CA  1 
ATOM   891  C  C   . SER A 1 110 ? 11.927 79.863 -15.832 1.00 41.74 ? 607 SER A C   1 
ATOM   892  O  O   . SER A 1 110 ? 11.276 80.737 -16.421 1.00 49.40 ? 607 SER A O   1 
ATOM   893  C  CB  . SER A 1 110 ? 13.997 80.342 -14.543 1.00 29.88 ? 607 SER A CB  1 
ATOM   894  O  OG  . SER A 1 110 ? 14.209 81.653 -15.023 1.00 31.36 ? 607 SER A OG  1 
ATOM   895  N  N   . LYS A 1 111 ? 12.279 78.717 -16.404 1.00 43.35 ? 608 LYS A N   1 
ATOM   896  C  CA  . LYS A 1 111 ? 11.647 78.316 -17.648 1.00 46.17 ? 608 LYS A CA  1 
ATOM   897  C  C   . LYS A 1 111 ? 11.480 76.817 -17.716 1.00 42.64 ? 608 LYS A C   1 
ATOM   898  O  O   . LYS A 1 111 ? 12.365 76.029 -17.390 1.00 40.78 ? 608 LYS A O   1 
ATOM   899  C  CB  . LYS A 1 111 ? 12.195 78.939 -18.935 1.00 54.48 ? 608 LYS A CB  1 
ATOM   900  C  CG  . LYS A 1 111 ? 11.035 79.221 -19.979 1.00 55.51 ? 608 LYS A CG  1 
ATOM   901  C  CD  . LYS A 1 111 ? 9.997  80.303 -19.504 1.00 54.84 ? 608 LYS A CD  1 
ATOM   902  C  CE  . LYS A 1 111 ? 8.628  79.732 -19.088 1.00 53.13 ? 608 LYS A CE  1 
ATOM   903  N  NZ  . LYS A 1 111 ? 7.777  79.171 -20.196 1.00 50.29 ? 608 LYS A NZ  1 
ATOM   904  N  N   . ILE A 1 112 ? 10.244 76.475 -18.018 1.00 38.42 ? 609 ILE A N   1 
ATOM   905  C  CA  . ILE A 1 112 ? 9.753  75.134 -18.077 1.00 32.87 ? 609 ILE A CA  1 
ATOM   906  C  C   . ILE A 1 112 ? 10.437 74.185 -19.038 1.00 30.65 ? 609 ILE A C   1 
ATOM   907  O  O   . ILE A 1 112 ? 10.108 74.152 -20.208 1.00 34.42 ? 609 ILE A O   1 
ATOM   908  C  CB  . ILE A 1 112 ? 8.235  75.198 -18.302 1.00 31.16 ? 609 ILE A CB  1 
ATOM   909  C  CG1 . ILE A 1 112 ? 7.626  76.217 -17.324 1.00 30.77 ? 609 ILE A CG1 1 
ATOM   910  C  CG2 . ILE A 1 112 ? 7.595  73.836 -18.148 1.00 32.93 ? 609 ILE A CG2 1 
ATOM   911  C  CD1 . ILE A 1 112 ? 8.177  76.152 -15.893 1.00 27.01 ? 609 ILE A CD1 1 
ATOM   912  N  N   . ASP A 1 113 ? 11.382 73.407 -18.512 1.00 29.30 ? 610 ASP A N   1 
ATOM   913  C  CA  . ASP A 1 113 ? 12.115 72.397 -19.278 1.00 26.65 ? 610 ASP A CA  1 
ATOM   914  C  C   . ASP A 1 113 ? 11.296 71.090 -19.348 1.00 24.52 ? 610 ASP A C   1 
ATOM   915  O  O   . ASP A 1 113 ? 11.667 70.160 -20.061 1.00 22.38 ? 610 ASP A O   1 
ATOM   916  C  CB  . ASP A 1 113 ? 13.472 72.100 -18.610 1.00 31.38 ? 610 ASP A CB  1 
ATOM   917  C  CG  . ASP A 1 113 ? 13.326 71.445 -17.208 1.00 40.16 ? 610 ASP A CG  1 
ATOM   918  O  OD1 . ASP A 1 113 ? 12.777 72.111 -16.296 1.00 44.05 ? 610 ASP A OD1 1 
ATOM   919  O  OD2 . ASP A 1 113 ? 13.781 70.280 -17.006 1.00 37.91 ? 610 ASP A OD2 1 
ATOM   920  N  N   . ARG A 1 114 ? 10.207 71.023 -18.586 1.00 20.53 ? 611 ARG A N   1 
ATOM   921  C  CA  . ARG A 1 114 ? 9.338  69.847 -18.523 1.00 17.10 ? 611 ARG A CA  1 
ATOM   922  C  C   . ARG A 1 114 ? 7.882  70.318 -18.565 1.00 18.14 ? 611 ARG A C   1 
ATOM   923  O  O   . ARG A 1 114 ? 7.147  70.151 -17.579 1.00 17.77 ? 611 ARG A O   1 
ATOM   924  C  CB  . ARG A 1 114 ? 9.555  69.117 -17.188 1.00 15.35 ? 611 ARG A CB  1 
ATOM   925  C  CG  . ARG A 1 114 ? 10.090 67.715 -17.279 1.00 19.43 ? 611 ARG A CG  1 
ATOM   926  C  CD  . ARG A 1 114 ? 9.053  66.659 -16.878 1.00 17.95 ? 611 ARG A CD  1 
ATOM   927  N  NE  . ARG A 1 114 ? 9.225  66.220 -15.507 1.00 15.53 ? 611 ARG A NE  1 
ATOM   928  C  CZ  . ARG A 1 114 ? 8.787  65.070 -15.009 1.00 15.73 ? 611 ARG A CZ  1 
ATOM   929  N  NH1 . ARG A 1 114 ? 8.143  64.187 -15.746 1.00 14.15 ? 611 ARG A NH1 1 
ATOM   930  N  NH2 . ARG A 1 114 ? 8.950  64.830 -13.726 1.00 20.70 ? 611 ARG A NH2 1 
ATOM   931  N  N   . PRO A 1 115 ? 7.410  70.799 -19.734 1.00 18.33 ? 612 PRO A N   1 
ATOM   932  C  CA  . PRO A 1 115 ? 6.023  71.278 -19.846 1.00 18.14 ? 612 PRO A CA  1 
ATOM   933  C  C   . PRO A 1 115 ? 4.985  70.176 -19.746 1.00 16.54 ? 612 PRO A C   1 
ATOM   934  O  O   . PRO A 1 115 ? 3.800  70.458 -19.694 1.00 18.83 ? 612 PRO A O   1 
ATOM   935  C  CB  . PRO A 1 115 ? 6.003  71.928 -21.226 1.00 20.27 ? 612 PRO A CB  1 
ATOM   936  C  CG  . PRO A 1 115 ? 6.909  70.998 -22.015 1.00 21.20 ? 612 PRO A CG  1 
ATOM   937  C  CD  . PRO A 1 115 ? 8.066  70.757 -21.054 1.00 19.55 ? 612 PRO A CD  1 
ATOM   938  N  N   . GLU A 1 116 ? 5.439  68.926 -19.694 1.00 17.56 ? 613 GLU A N   1 
ATOM   939  C  CA  . GLU A 1 116 ? 4.539  67.780 -19.590 1.00 18.04 ? 613 GLU A CA  1 
ATOM   940  C  C   . GLU A 1 116 ? 4.265  67.341 -18.137 1.00 20.09 ? 613 GLU A C   1 
ATOM   941  O  O   . GLU A 1 116 ? 3.525  66.376 -17.895 1.00 19.26 ? 613 GLU A O   1 
ATOM   942  C  CB  . GLU A 1 116 ? 5.088  66.593 -20.380 1.00 17.32 ? 613 GLU A CB  1 
ATOM   943  C  CG  . GLU A 1 116 ? 6.320  65.939 -19.764 1.00 16.50 ? 613 GLU A CG  1 
ATOM   944  C  CD  . GLU A 1 116 ? 7.622  66.575 -20.203 1.00 17.75 ? 613 GLU A CD  1 
ATOM   945  O  OE1 . GLU A 1 116 ? 7.609  67.682 -20.775 1.00 21.13 ? 613 GLU A OE1 1 
ATOM   946  O  OE2 . GLU A 1 116 ? 8.680  65.949 -19.979 1.00 18.68 ? 613 GLU A OE2 1 
ATOM   947  N  N   . ALA A 1 117 ? 4.896  67.997 -17.172 1.00 17.80 ? 614 ALA A N   1 
ATOM   948  C  CA  . ALA A 1 117 ? 4.645  67.643 -15.782 1.00 17.35 ? 614 ALA A CA  1 
ATOM   949  C  C   . ALA A 1 117 ? 3.998  68.805 -15.068 1.00 17.82 ? 614 ALA A C   1 
ATOM   950  O  O   . ALA A 1 117 ? 4.245  69.962 -15.422 1.00 18.03 ? 614 ALA A O   1 
ATOM   951  C  CB  . ALA A 1 117 ? 5.929  67.302 -15.103 1.00 14.29 ? 614 ALA A CB  1 
ATOM   952  N  N   . SER A 1 118 ? 3.143  68.502 -14.088 1.00 14.90 ? 615 SER A N   1 
ATOM   953  C  CA  . SER A 1 118 ? 2.532  69.553 -13.297 1.00 13.08 ? 615 SER A CA  1 
ATOM   954  C  C   . SER A 1 118 ? 3.622  70.036 -12.347 1.00 14.27 ? 615 SER A C   1 
ATOM   955  O  O   . SER A 1 118 ? 4.577  69.304 -12.056 1.00 17.25 ? 615 SER A O   1 
ATOM   956  C  CB  . SER A 1 118 ? 1.362  69.029 -12.491 1.00 10.01 ? 615 SER A CB  1 
ATOM   957  O  OG  . SER A 1 118 ? 0.379  68.502 -13.348 1.00 13.32 ? 615 SER A OG  1 
ATOM   958  N  N   . ARG A 1 119 ? 3.505  71.290 -11.929 1.00 13.79 ? 616 ARG A N   1 
ATOM   959  C  CA  . ARG A 1 119 ? 4.441  71.923 -11.021 1.00 10.29 ? 616 ARG A CA  1 
ATOM   960  C  C   . ARG A 1 119 ? 3.696  72.218 -9.722  1.00 8.30  ? 616 ARG A C   1 
ATOM   961  O  O   . ARG A 1 119 ? 2.638  72.841 -9.721  1.00 8.31  ? 616 ARG A O   1 
ATOM   962  C  CB  . ARG A 1 119 ? 4.966  73.188 -11.671 1.00 10.60 ? 616 ARG A CB  1 
ATOM   963  C  CG  . ARG A 1 119 ? 5.580  72.883 -13.020 1.00 11.29 ? 616 ARG A CG  1 
ATOM   964  C  CD  . ARG A 1 119 ? 5.648  74.101 -13.902 1.00 18.79 ? 616 ARG A CD  1 
ATOM   965  N  NE  . ARG A 1 119 ? 5.380  73.740 -15.286 1.00 25.65 ? 616 ARG A NE  1 
ATOM   966  C  CZ  . ARG A 1 119 ? 4.217  73.955 -15.877 1.00 28.89 ? 616 ARG A CZ  1 
ATOM   967  N  NH1 . ARG A 1 119 ? 3.238  74.543 -15.223 1.00 36.05 ? 616 ARG A NH1 1 
ATOM   968  N  NH2 . ARG A 1 119 ? 3.977  73.463 -17.075 1.00 37.22 ? 616 ARG A NH2 1 
ATOM   969  N  N   . ILE A 1 120 ? 4.187  71.673 -8.616  1.00 10.46 ? 617 ILE A N   1 
ATOM   970  C  CA  . ILE A 1 120 ? 3.532  71.893 -7.341  1.00 8.09  ? 617 ILE A CA  1 
ATOM   971  C  C   . ILE A 1 120 ? 4.549  72.311 -6.289  1.00 9.44  ? 617 ILE A C   1 
ATOM   972  O  O   . ILE A 1 120 ? 5.625  71.717 -6.176  1.00 13.23 ? 617 ILE A O   1 
ATOM   973  C  CB  . ILE A 1 120 ? 2.790  70.616 -6.898  1.00 13.19 ? 617 ILE A CB  1 
ATOM   974  C  CG1 . ILE A 1 120 ? 1.747  70.212 -7.951  1.00 12.54 ? 617 ILE A CG1 1 
ATOM   975  C  CG2 . ILE A 1 120 ? 2.102  70.832 -5.549  1.00 17.10 ? 617 ILE A CG2 1 
ATOM   976  C  CD1 . ILE A 1 120 ? 0.818  69.049 -7.489  1.00 9.40  ? 617 ILE A CD1 1 
ATOM   977  N  N   . ALA A 1 121 ? 4.241  73.396 -5.587  1.00 11.26 ? 618 ALA A N   1 
ATOM   978  C  CA  . ALA A 1 121 ? 5.092  73.932 -4.523  1.00 9.88  ? 618 ALA A CA  1 
ATOM   979  C  C   . ALA A 1 121 ? 4.319  73.708 -3.221  1.00 13.13 ? 618 ALA A C   1 
ATOM   980  O  O   . ALA A 1 121 ? 3.164  74.135 -3.084  1.00 13.87 ? 618 ALA A O   1 
ATOM   981  C  CB  . ALA A 1 121 ? 5.332  75.403 -4.747  1.00 6.93  ? 618 ALA A CB  1 
ATOM   982  N  N   . LEU A 1 122 ? 4.920  72.964 -2.304  1.00 11.48 ? 619 LEU A N   1 
ATOM   983  C  CA  . LEU A 1 122 ? 4.286  72.655 -1.029  1.00 14.03 ? 619 LEU A CA  1 
ATOM   984  C  C   . LEU A 1 122 ? 4.900  73.622 -0.022  1.00 12.75 ? 619 LEU A C   1 
ATOM   985  O  O   . LEU A 1 122 ? 6.035  73.447 0.395   1.00 9.90  ? 619 LEU A O   1 
ATOM   986  C  CB  . LEU A 1 122 ? 4.604  71.206 -0.675  1.00 14.36 ? 619 LEU A CB  1 
ATOM   987  C  CG  . LEU A 1 122 ? 3.800  70.416 0.353   1.00 19.68 ? 619 LEU A CG  1 
ATOM   988  C  CD1 . LEU A 1 122 ? 2.311  70.465 0.078   1.00 19.00 ? 619 LEU A CD1 1 
ATOM   989  C  CD2 . LEU A 1 122 ? 4.319  68.989 0.289   1.00 14.02 ? 619 LEU A CD2 1 
ATOM   990  N  N   . LEU A 1 123 ? 4.186  74.700 0.281   1.00 11.45 ? 620 LEU A N   1 
ATOM   991  C  CA  . LEU A 1 123 ? 4.706  75.711 1.201   1.00 14.00 ? 620 LEU A CA  1 
ATOM   992  C  C   . LEU A 1 123 ? 4.397  75.384 2.663   1.00 13.84 ? 620 LEU A C   1 
ATOM   993  O  O   . LEU A 1 123 ? 3.271  75.581 3.123   1.00 10.40 ? 620 LEU A O   1 
ATOM   994  C  CB  . LEU A 1 123 ? 4.156  77.095 0.823   1.00 11.10 ? 620 LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 123 ? 4.779  78.300 1.525   1.00 10.11 ? 620 LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 123 ? 6.276  78.366 1.250   1.00 10.19 ? 620 LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 123 ? 4.089  79.568 1.058   1.00 11.71 ? 620 LEU A CD2 1 
ATOM   998  N  N   . LEU A 1 124 ? 5.397  74.880 3.380   1.00 12.67 ? 621 LEU A N   1 
ATOM   999  C  CA  . LEU A 1 124 ? 5.226  74.528 4.785   1.00 15.42 ? 621 LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 124 ? 5.536  75.770 5.639   1.00 15.14 ? 621 LEU A C   1 
ATOM   1001 O  O   . LEU A 1 124 ? 6.697  76.117 5.882   1.00 17.05 ? 621 LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 124 ? 6.117  73.327 5.100   1.00 11.95 ? 621 LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 124 ? 5.761  72.185 4.115   1.00 11.75 ? 621 LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 124 ? 6.957  71.338 3.727   1.00 7.16  ? 621 LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 124 ? 4.678  71.351 4.702   1.00 7.13  ? 621 LEU A CD2 1 
ATOM   1006 N  N   . MET A 1 125 ? 4.467  76.390 6.131   1.00 13.49 ? 622 MET A N   1 
ATOM   1007 C  CA  . MET A 1 125 ? 4.538  77.624 6.899   1.00 17.11 ? 622 MET A CA  1 
ATOM   1008 C  C   . MET A 1 125 ? 4.273  77.505 8.396   1.00 17.35 ? 622 MET A C   1 
ATOM   1009 O  O   . MET A 1 125 ? 3.211  77.062 8.803   1.00 18.55 ? 622 MET A O   1 
ATOM   1010 C  CB  . MET A 1 125 ? 3.499  78.593 6.341   1.00 19.32 ? 622 MET A CB  1 
ATOM   1011 C  CG  . MET A 1 125 ? 3.634  78.898 4.878   1.00 19.64 ? 622 MET A CG  1 
ATOM   1012 S  SD  . MET A 1 125 ? 2.174  79.715 4.255   1.00 22.75 ? 622 MET A SD  1 
ATOM   1013 C  CE  . MET A 1 125 ? 2.302  81.305 4.988   1.00 20.32 ? 622 MET A CE  1 
ATOM   1014 N  N   . ALA A 1 126 ? 5.199  78.003 9.204   1.00 16.59 ? 623 ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 126 ? 5.057  78.000 10.654  1.00 14.97 ? 623 ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 126 ? 5.115  79.425 11.201  1.00 18.32 ? 623 ALA A C   1 
ATOM   1017 O  O   . ALA A 1 126 ? 4.952  79.648 12.405  1.00 21.62 ? 623 ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 126 ? 6.167  77.173 11.279  1.00 15.96 ? 623 ALA A CB  1 
ATOM   1019 N  N   . SER A 1 127 ? 5.300  80.397 10.323  1.00 19.46 ? 624 SER A N   1 
ATOM   1020 C  CA  . SER A 1 127 ? 5.433  81.772 10.771  1.00 21.55 ? 624 SER A CA  1 
ATOM   1021 C  C   . SER A 1 127 ? 4.869  82.812 9.799   1.00 22.83 ? 624 SER A C   1 
ATOM   1022 O  O   . SER A 1 127 ? 4.108  82.483 8.855   1.00 18.76 ? 624 SER A O   1 
ATOM   1023 C  CB  . SER A 1 127 ? 6.921  82.065 11.026  1.00 18.76 ? 624 SER A CB  1 
ATOM   1024 O  OG  . SER A 1 127 ? 7.721  81.753 9.896   1.00 22.42 ? 624 SER A OG  1 
ATOM   1025 N  N   . GLN A 1 128 ? 5.152  84.075 10.122  1.00 22.23 ? 625 GLN A N   1 
ATOM   1026 C  CA  . GLN A 1 128 ? 4.776  85.204 9.282   1.00 27.39 ? 625 GLN A CA  1 
ATOM   1027 C  C   . GLN A 1 128 ? 5.948  86.161 9.222   1.00 27.09 ? 625 GLN A C   1 
ATOM   1028 O  O   . GLN A 1 128 ? 6.583  86.445 10.227  1.00 27.21 ? 625 GLN A O   1 
ATOM   1029 C  CB  . GLN A 1 128 ? 3.498  85.908 9.742   1.00 27.20 ? 625 GLN A CB  1 
ATOM   1030 C  CG  . GLN A 1 128 ? 3.294  86.097 11.206  1.00 33.26 ? 625 GLN A CG  1 
ATOM   1031 C  CD  . GLN A 1 128 ? 1.881  86.577 11.507  1.00 32.60 ? 625 GLN A CD  1 
ATOM   1032 O  OE1 . GLN A 1 128 ? 1.168  85.979 12.305  1.00 41.09 ? 625 GLN A OE1 1 
ATOM   1033 N  NE2 . GLN A 1 128 ? 1.471  87.647 10.854  1.00 32.88 ? 625 GLN A NE2 1 
ATOM   1034 N  N   . GLU A 1 129 ? 6.326  86.519 8.004   1.00 28.00 ? 626 GLU A N   1 
ATOM   1035 C  CA  . GLU A 1 129 ? 7.434  87.437 7.771   1.00 28.38 ? 626 GLU A CA  1 
ATOM   1036 C  C   . GLU A 1 129 ? 7.013  88.885 8.071   1.00 29.02 ? 626 GLU A C   1 
ATOM   1037 O  O   . GLU A 1 129 ? 5.813  89.221 8.041   1.00 25.62 ? 626 GLU A O   1 
ATOM   1038 C  CB  . GLU A 1 129 ? 7.852  87.355 6.304   1.00 25.11 ? 626 GLU A CB  1 
ATOM   1039 C  CG  . GLU A 1 129 ? 6.807  87.963 5.378   1.00 23.18 ? 626 GLU A CG  1 
ATOM   1040 C  CD  . GLU A 1 129 ? 7.062  87.693 3.915   1.00 24.81 ? 626 GLU A CD  1 
ATOM   1041 O  OE1 . GLU A 1 129 ? 8.171  87.208 3.580   1.00 20.13 ? 626 GLU A OE1 1 
ATOM   1042 O  OE2 . GLU A 1 129 ? 6.129  87.946 3.116   1.00 17.26 ? 626 GLU A OE2 1 
ATOM   1043 N  N   . PRO A 1 130 ? 7.995  89.762 8.367   1.00 29.70 ? 627 PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 130 ? 7.708  91.173 8.653   1.00 31.82 ? 627 PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 130 ? 7.050  91.835 7.441   1.00 33.52 ? 627 PRO A C   1 
ATOM   1046 O  O   . PRO A 1 130 ? 7.505  91.662 6.310   1.00 33.48 ? 627 PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 130 ? 9.096  91.759 8.947   1.00 28.98 ? 627 PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 130 ? 10.037 90.803 8.297   1.00 31.86 ? 627 PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 130 ? 9.420  89.477 8.587   1.00 29.78 ? 627 PRO A CD  1 
ATOM   1050 N  N   . GLN A 1 131 ? 6.000  92.609 7.702   1.00 36.73 ? 628 GLN A N   1 
ATOM   1051 C  CA  . GLN A 1 131 ? 5.208  93.302 6.679   1.00 38.04 ? 628 GLN A CA  1 
ATOM   1052 C  C   . GLN A 1 131 ? 6.026  93.896 5.542   1.00 35.21 ? 628 GLN A C   1 
ATOM   1053 O  O   . GLN A 1 131 ? 5.629  93.832 4.375   1.00 34.60 ? 628 GLN A O   1 
ATOM   1054 C  CB  . GLN A 1 131 ? 4.353  94.406 7.332   1.00 44.33 ? 628 GLN A CB  1 
ATOM   1055 C  CG  . GLN A 1 131 ? 2.922  94.535 6.808   1.00 52.77 ? 628 GLN A CG  1 
ATOM   1056 C  CD  . GLN A 1 131 ? 1.885  94.095 7.834   1.00 60.03 ? 628 GLN A CD  1 
ATOM   1057 O  OE1 . GLN A 1 131 ? 1.070  94.899 8.302   1.00 61.34 ? 628 GLN A OE1 1 
ATOM   1058 N  NE2 . GLN A 1 131 ? 1.923  92.814 8.206   1.00 63.65 ? 628 GLN A NE2 1 
ATOM   1059 N  N   . ARG A 1 132 ? 7.180  94.448 5.884   1.00 32.79 ? 629 ARG A N   1 
ATOM   1060 C  CA  . ARG A 1 132 ? 8.051  95.067 4.898   1.00 34.31 ? 629 ARG A CA  1 
ATOM   1061 C  C   . ARG A 1 132 ? 8.588  94.118 3.822   1.00 30.81 ? 629 ARG A C   1 
ATOM   1062 O  O   . ARG A 1 132 ? 8.919  94.556 2.723   1.00 36.74 ? 629 ARG A O   1 
ATOM   1063 C  CB  . ARG A 1 132 ? 9.209  95.784 5.592   1.00 38.79 ? 629 ARG A CB  1 
ATOM   1064 C  CG  . ARG A 1 132 ? 10.042 94.861 6.431   1.00 47.03 ? 629 ARG A CG  1 
ATOM   1065 C  CD  . ARG A 1 132 ? 11.399 95.422 6.687   1.00 49.94 ? 629 ARG A CD  1 
ATOM   1066 N  NE  . ARG A 1 132 ? 12.324 94.336 6.978   1.00 58.97 ? 629 ARG A NE  1 
ATOM   1067 C  CZ  . ARG A 1 132 ? 13.603 94.339 6.633   1.00 65.16 ? 629 ARG A CZ  1 
ATOM   1068 N  NH1 . ARG A 1 132 ? 14.109 95.379 5.985   1.00 70.46 ? 629 ARG A NH1 1 
ATOM   1069 N  NH2 . ARG A 1 132 ? 14.378 93.314 6.952   1.00 68.49 ? 629 ARG A NH2 1 
ATOM   1070 N  N   . MET A 1 133 ? 8.655  92.828 4.110   1.00 25.21 ? 630 MET A N   1 
ATOM   1071 C  CA  . MET A 1 133 ? 9.171  91.879 3.134   1.00 23.72 ? 630 MET A CA  1 
ATOM   1072 C  C   . MET A 1 133 ? 8.061  91.297 2.268   1.00 24.23 ? 630 MET A C   1 
ATOM   1073 O  O   . MET A 1 133 ? 8.346  90.631 1.270   1.00 25.88 ? 630 MET A O   1 
ATOM   1074 C  CB  . MET A 1 133 ? 9.905  90.735 3.828   1.00 25.55 ? 630 MET A CB  1 
ATOM   1075 C  CG  . MET A 1 133 ? 11.078 91.153 4.687   1.00 28.67 ? 630 MET A CG  1 
ATOM   1076 S  SD  . MET A 1 133 ? 11.844 89.733 5.470   1.00 30.08 ? 630 MET A SD  1 
ATOM   1077 C  CE  . MET A 1 133 ? 13.015 89.228 4.233   1.00 33.64 ? 630 MET A CE  1 
ATOM   1078 N  N   . SER A 1 134 ? 6.811  91.617 2.606   1.00 23.98 ? 631 SER A N   1 
ATOM   1079 C  CA  . SER A 1 134 ? 5.634  91.098 1.906   1.00 24.27 ? 631 SER A CA  1 
ATOM   1080 C  C   . SER A 1 134 ? 5.076  91.919 0.751   1.00 26.26 ? 631 SER A C   1 
ATOM   1081 O  O   . SER A 1 134 ? 4.010  91.584 0.210   1.00 21.34 ? 631 SER A O   1 
ATOM   1082 C  CB  . SER A 1 134 ? 4.504  90.879 2.911   1.00 22.54 ? 631 SER A CB  1 
ATOM   1083 O  OG  . SER A 1 134 ? 4.923  90.050 3.983   1.00 24.17 ? 631 SER A OG  1 
ATOM   1084 N  N   . ARG A 1 135 ? 5.797  92.967 0.357   1.00 29.47 ? 632 ARG A N   1 
ATOM   1085 C  CA  . ARG A 1 135 ? 5.348  93.865 -0.711  1.00 27.92 ? 632 ARG A CA  1 
ATOM   1086 C  C   . ARG A 1 135 ? 4.990  93.255 -2.075  1.00 24.00 ? 632 ARG A C   1 
ATOM   1087 O  O   . ARG A 1 135 ? 4.013  93.653 -2.698  1.00 19.20 ? 632 ARG A O   1 
ATOM   1088 C  CB  . ARG A 1 135 ? 6.350  95.003 -0.869  1.00 32.62 ? 632 ARG A CB  1 
ATOM   1089 C  CG  . ARG A 1 135 ? 6.093  96.167 0.064   1.00 38.66 ? 632 ARG A CG  1 
ATOM   1090 C  CD  . ARG A 1 135 ? 7.198  97.197 -0.041  1.00 48.62 ? 632 ARG A CD  1 
ATOM   1091 N  NE  . ARG A 1 135 ? 8.267  96.958 0.932   1.00 58.66 ? 632 ARG A NE  1 
ATOM   1092 C  CZ  . ARG A 1 135 ? 9.535  97.343 0.786   1.00 61.73 ? 632 ARG A CZ  1 
ATOM   1093 N  NH1 . ARG A 1 135 ? 9.927  97.984 -0.317  1.00 62.36 ? 632 ARG A NH1 1 
ATOM   1094 N  NH2 . ARG A 1 135 ? 10.396 97.139 1.779   1.00 60.51 ? 632 ARG A NH2 1 
ATOM   1095 N  N   . ASN A 1 136 ? 5.754  92.267 -2.520  1.00 22.34 ? 633 ASN A N   1 
ATOM   1096 C  CA  . ASN A 1 136 ? 5.501  91.630 -3.812  1.00 23.39 ? 633 ASN A CA  1 
ATOM   1097 C  C   . ASN A 1 136 ? 4.823  90.274 -3.673  1.00 22.81 ? 633 ASN A C   1 
ATOM   1098 O  O   . ASN A 1 136 ? 4.613  89.592 -4.665  1.00 20.30 ? 633 ASN A O   1 
ATOM   1099 C  CB  . ASN A 1 136 ? 6.815  91.430 -4.583  1.00 19.08 ? 633 ASN A CB  1 
ATOM   1100 C  CG  . ASN A 1 136 ? 7.352  92.708 -5.169  1.00 17.97 ? 633 ASN A CG  1 
ATOM   1101 O  OD1 . ASN A 1 136 ? 6.663  93.724 -5.197  1.00 12.49 ? 633 ASN A OD1 1 
ATOM   1102 N  ND2 . ASN A 1 136 ? 8.602  92.667 -5.644  1.00 17.03 ? 633 ASN A ND2 1 
ATOM   1103 N  N   . PHE A 1 137 ? 4.494  89.889 -2.445  1.00 22.28 ? 634 PHE A N   1 
ATOM   1104 C  CA  . PHE A 1 137 ? 3.878  88.603 -2.182  1.00 19.74 ? 634 PHE A CA  1 
ATOM   1105 C  C   . PHE A 1 137 ? 2.821  88.172 -3.190  1.00 18.80 ? 634 PHE A C   1 
ATOM   1106 O  O   . PHE A 1 137 ? 2.994  87.142 -3.849  1.00 19.49 ? 634 PHE A O   1 
ATOM   1107 C  CB  . PHE A 1 137 ? 3.303  88.536 -0.756  1.00 14.84 ? 634 PHE A CB  1 
ATOM   1108 C  CG  . PHE A 1 137 ? 2.736  87.184 -0.414  1.00 11.94 ? 634 PHE A CG  1 
ATOM   1109 C  CD1 . PHE A 1 137 ? 3.583  86.149 -0.048  1.00 4.10  ? 634 PHE A CD1 1 
ATOM   1110 C  CD2 . PHE A 1 137 ? 1.373  86.920 -0.576  1.00 11.23 ? 634 PHE A CD2 1 
ATOM   1111 C  CE1 . PHE A 1 137 ? 3.095  84.880 0.136   1.00 5.83  ? 634 PHE A CE1 1 
ATOM   1112 C  CE2 . PHE A 1 137 ? 0.858  85.645 -0.393  1.00 10.88 ? 634 PHE A CE2 1 
ATOM   1113 C  CZ  . PHE A 1 137 ? 1.719  84.617 -0.040  1.00 9.89  ? 634 PHE A CZ  1 
ATOM   1114 N  N   . VAL A 1 138 ? 1.751  88.942 -3.365  1.00 18.69 ? 635 VAL A N   1 
ATOM   1115 C  CA  . VAL A 1 138 ? 0.707  88.514 -4.314  1.00 21.28 ? 635 VAL A CA  1 
ATOM   1116 C  C   . VAL A 1 138 ? 1.214  88.374 -5.751  1.00 21.28 ? 635 VAL A C   1 
ATOM   1117 O  O   . VAL A 1 138 ? 0.803  87.478 -6.480  1.00 22.82 ? 635 VAL A O   1 
ATOM   1118 C  CB  . VAL A 1 138 ? -0.500 89.440 -4.280  1.00 20.51 ? 635 VAL A CB  1 
ATOM   1119 C  CG1 . VAL A 1 138 ? -1.510 89.022 -5.316  1.00 25.23 ? 635 VAL A CG1 1 
ATOM   1120 C  CG2 . VAL A 1 138 ? -1.129 89.383 -2.922  1.00 23.14 ? 635 VAL A CG2 1 
ATOM   1121 N  N   . ARG A 1 139 ? 2.160  89.227 -6.111  1.00 18.25 ? 636 ARG A N   1 
ATOM   1122 C  CA  . ARG A 1 139 ? 2.778  89.239 -7.420  1.00 13.92 ? 636 ARG A CA  1 
ATOM   1123 C  C   . ARG A 1 139 ? 3.522  87.936 -7.677  1.00 15.53 ? 636 ARG A C   1 
ATOM   1124 O  O   . ARG A 1 139 ? 3.419  87.366 -8.760  1.00 19.16 ? 636 ARG A O   1 
ATOM   1125 C  CB  . ARG A 1 139 ? 3.719  90.446 -7.480  1.00 13.52 ? 636 ARG A CB  1 
ATOM   1126 C  CG  . ARG A 1 139 ? 2.923  91.760 -7.492  1.00 21.06 ? 636 ARG A CG  1 
ATOM   1127 C  CD  . ARG A 1 139 ? 3.742  92.986 -7.115  1.00 31.89 ? 636 ARG A CD  1 
ATOM   1128 N  NE  . ARG A 1 139 ? 3.059  94.231 -7.497  1.00 34.04 ? 636 ARG A NE  1 
ATOM   1129 C  CZ  . ARG A 1 139 ? 2.973  95.330 -6.747  1.00 33.28 ? 636 ARG A CZ  1 
ATOM   1130 N  NH1 . ARG A 1 139 ? 3.523  95.373 -5.545  1.00 32.30 ? 636 ARG A NH1 1 
ATOM   1131 N  NH2 . ARG A 1 139 ? 2.396  96.421 -7.233  1.00 35.94 ? 636 ARG A NH2 1 
ATOM   1132 N  N   . TYR A 1 140 ? 4.249  87.439 -6.683  1.00 12.24 ? 637 TYR A N   1 
ATOM   1133 C  CA  . TYR A 1 140 ? 4.969  86.187 -6.837  1.00 13.29 ? 637 TYR A CA  1 
ATOM   1134 C  C   . TYR A 1 140 ? 3.984  85.046 -6.970  1.00 15.41 ? 637 TYR A C   1 
ATOM   1135 O  O   . TYR A 1 140 ? 4.176  84.141 -7.789  1.00 17.67 ? 637 TYR A O   1 
ATOM   1136 C  CB  . TYR A 1 140 ? 5.912  85.942 -5.654  1.00 16.02 ? 637 TYR A CB  1 
ATOM   1137 C  CG  . TYR A 1 140 ? 7.003  86.987 -5.572  1.00 17.66 ? 637 TYR A CG  1 
ATOM   1138 C  CD1 . TYR A 1 140 ? 7.556  87.512 -6.726  1.00 23.47 ? 637 TYR A CD1 1 
ATOM   1139 C  CD2 . TYR A 1 140 ? 7.438  87.486 -4.356  1.00 23.35 ? 637 TYR A CD2 1 
ATOM   1140 C  CE1 . TYR A 1 140 ? 8.507  88.512 -6.684  1.00 24.21 ? 637 TYR A CE1 1 
ATOM   1141 C  CE2 . TYR A 1 140 ? 8.398  88.493 -4.296  1.00 25.27 ? 637 TYR A CE2 1 
ATOM   1142 C  CZ  . TYR A 1 140 ? 8.929  89.000 -5.471  1.00 27.11 ? 637 TYR A CZ  1 
ATOM   1143 O  OH  . TYR A 1 140 ? 9.897  89.989 -5.446  1.00 27.67 ? 637 TYR A OH  1 
ATOM   1144 N  N   . VAL A 1 141 ? 2.892  85.114 -6.212  1.00 17.90 ? 638 VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 141 ? 1.866  84.073 -6.264  1.00 15.71 ? 638 VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 141 ? 1.110  84.107 -7.591  1.00 16.42 ? 638 VAL A C   1 
ATOM   1147 O  O   . VAL A 1 141 ? 0.730  83.057 -8.121  1.00 13.74 ? 638 VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 141 ? 0.879  84.189 -5.070  1.00 14.51 ? 638 VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 141 ? -0.224 83.196 -5.201  1.00 10.64 ? 638 VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 141 ? 1.623  83.907 -3.762  1.00 15.68 ? 638 VAL A CG2 1 
ATOM   1151 N  N   . GLN A 1 142 ? 0.858  85.306 -8.122  1.00 17.70 ? 639 GLN A N   1 
ATOM   1152 C  CA  . GLN A 1 142 ? 0.173  85.418 -9.401  1.00 19.16 ? 639 GLN A CA  1 
ATOM   1153 C  C   . GLN A 1 142 ? 1.132  84.973 -10.494 1.00 20.06 ? 639 GLN A C   1 
ATOM   1154 O  O   . GLN A 1 142 ? 0.705  84.381 -11.500 1.00 21.31 ? 639 GLN A O   1 
ATOM   1155 C  CB  . GLN A 1 142 ? -0.280 86.842 -9.661  1.00 24.29 ? 639 GLN A CB  1 
ATOM   1156 C  CG  . GLN A 1 142 ? -1.377 87.339 -8.758  1.00 33.20 ? 639 GLN A CG  1 
ATOM   1157 C  CD  . GLN A 1 142 ? -1.509 88.855 -8.824  1.00 42.75 ? 639 GLN A CD  1 
ATOM   1158 O  OE1 . GLN A 1 142 ? -0.534 89.573 -9.095  1.00 47.34 ? 639 GLN A OE1 1 
ATOM   1159 N  NE2 . GLN A 1 142 ? -2.709 89.353 -8.572  1.00 47.82 ? 639 GLN A NE2 1 
ATOM   1160 N  N   . GLY A 1 143 ? 2.428  85.212 -10.272 1.00 19.08 ? 640 GLY A N   1 
ATOM   1161 C  CA  . GLY A 1 143 ? 3.465  84.789 -11.212 1.00 16.51 ? 640 GLY A CA  1 
ATOM   1162 C  C   . GLY A 1 143 ? 3.515  83.268 -11.342 1.00 16.94 ? 640 GLY A C   1 
ATOM   1163 O  O   . GLY A 1 143 ? 3.492  82.740 -12.454 1.00 19.48 ? 640 GLY A O   1 
ATOM   1164 N  N   . LEU A 1 144 ? 3.553  82.551 -10.221 1.00 16.74 ? 641 LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 144 ? 3.579  81.088 -10.252 1.00 13.10 ? 641 LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 144 ? 2.269  80.555 -10.792 1.00 13.33 ? 641 LEU A C   1 
ATOM   1167 O  O   . LEU A 1 144 ? 2.206  79.465 -11.355 1.00 18.15 ? 641 LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 144 ? 3.802  80.530 -8.852  1.00 14.38 ? 641 LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 144 ? 5.198  80.681 -8.238  1.00 16.65 ? 641 LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 144 ? 5.139  80.462 -6.733  1.00 18.86 ? 641 LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 144 ? 6.206  79.737 -8.886  1.00 6.08  ? 641 LEU A CD2 1 
ATOM   1172 N  N   . LYS A 1 145 ? 1.205  81.311 -10.605 1.00 14.11 ? 642 LYS A N   1 
ATOM   1173 C  CA  . LYS A 1 145 ? -0.101 80.898 -11.096 1.00 16.06 ? 642 LYS A CA  1 
ATOM   1174 C  C   . LYS A 1 145 ? -0.150 80.870 -12.623 1.00 16.97 ? 642 LYS A C   1 
ATOM   1175 O  O   . LYS A 1 145 ? -0.809 80.019 -13.210 1.00 19.62 ? 642 LYS A O   1 
ATOM   1176 C  CB  . LYS A 1 145 ? -1.169 81.847 -10.555 1.00 16.72 ? 642 LYS A CB  1 
ATOM   1177 C  CG  . LYS A 1 145 ? -2.558 81.585 -11.078 1.00 18.86 ? 642 LYS A CG  1 
ATOM   1178 C  CD  . LYS A 1 145 ? -3.085 82.761 -11.881 1.00 14.53 ? 642 LYS A CD  1 
ATOM   1179 C  CE  . LYS A 1 145 ? -4.522 82.498 -12.267 1.00 25.13 ? 642 LYS A CE  1 
ATOM   1180 N  NZ  . LYS A 1 145 ? -5.053 83.581 -13.128 1.00 33.85 ? 642 LYS A NZ  1 
ATOM   1181 N  N   . LYS A 1 146 ? 0.517  81.829 -13.256 1.00 17.23 ? 643 LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 146 ? 0.554  81.933 -14.714 1.00 15.33 ? 643 LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 146 ? 1.409  80.845 -15.322 1.00 14.03 ? 643 LYS A C   1 
ATOM   1184 O  O   . LYS A 1 146 ? 1.183  80.439 -16.464 1.00 13.60 ? 643 LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 146 ? 1.127  83.281 -15.127 1.00 16.90 ? 643 LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 146 ? 0.301  84.453 -14.692 1.00 23.60 ? 643 LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 146 ? 0.990  85.751 -15.080 1.00 29.59 ? 643 LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 146 ? 0.321  86.922 -14.390 1.00 34.30 ? 643 LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 146 ? 1.216  88.106 -14.326 1.00 35.59 ? 643 LYS A NZ  1 
ATOM   1190 N  N   . LYS A 1 147 ? 2.442  80.431 -14.598 1.00 15.71 ? 644 LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 147 ? 3.321  79.373 -15.059 1.00 15.56 ? 644 LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 147 ? 2.720  78.041 -14.644 1.00 13.62 ? 644 LYS A C   1 
ATOM   1193 O  O   . LYS A 1 147 ? 3.351  77.009 -14.825 1.00 16.26 ? 644 LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 147 ? 4.737  79.517 -14.466 1.00 19.22 ? 644 LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 147 ? 5.710  80.398 -15.264 1.00 22.27 ? 644 LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 147 ? 7.123  80.272 -14.690 1.00 24.71 ? 644 LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 147 ? 8.123  81.299 -15.260 1.00 31.85 ? 644 LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 147 ? 9.118  81.871 -14.243 1.00 23.70 ? 644 LYS A NZ  1 
ATOM   1199 N  N   . LYS A 1 148 ? 1.502  78.076 -14.098 1.00 10.95 ? 645 LYS A N   1 
ATOM   1200 C  CA  . LYS A 1 148 ? 0.761  76.876 -13.644 1.00 14.53 ? 645 LYS A CA  1 
ATOM   1201 C  C   . LYS A 1 148 ? 1.425  76.068 -12.527 1.00 15.63 ? 645 LYS A C   1 
ATOM   1202 O  O   . LYS A 1 148 ? 1.324  74.833 -12.481 1.00 10.70 ? 645 LYS A O   1 
ATOM   1203 C  CB  . LYS A 1 148 ? 0.397  75.957 -14.803 1.00 14.90 ? 645 LYS A CB  1 
ATOM   1204 C  CG  . LYS A 1 148 ? -1.087 75.949 -15.174 1.00 16.56 ? 645 LYS A CG  1 
ATOM   1205 C  CD  . LYS A 1 148 ? -1.866 75.078 -14.228 1.00 19.52 ? 645 LYS A CD  1 
ATOM   1206 C  CE  . LYS A 1 148 ? -3.242 75.666 -13.949 1.00 28.98 ? 645 LYS A CE  1 
ATOM   1207 N  NZ  . LYS A 1 148 ? -4.386 74.911 -14.522 1.00 29.12 ? 645 LYS A NZ  1 
ATOM   1208 N  N   . VAL A 1 149 ? 2.095  76.784 -11.630 1.00 13.98 ? 646 VAL A N   1 
ATOM   1209 C  CA  . VAL A 1 149 ? 2.745  76.182 -10.481 1.00 17.17 ? 646 VAL A CA  1 
ATOM   1210 C  C   . VAL A 1 149 ? 1.723  76.303 -9.379  1.00 17.08 ? 646 VAL A C   1 
ATOM   1211 O  O   . VAL A 1 149 ? 1.333  77.413 -9.028  1.00 15.83 ? 646 VAL A O   1 
ATOM   1212 C  CB  . VAL A 1 149 ? 4.004  76.952 -10.065 1.00 15.22 ? 646 VAL A CB  1 
ATOM   1213 C  CG1 . VAL A 1 149 ? 4.628  76.308 -8.805  1.00 14.08 ? 646 VAL A CG1 1 
ATOM   1214 C  CG2 . VAL A 1 149 ? 4.980  76.955 -11.204 1.00 10.59 ? 646 VAL A CG2 1 
ATOM   1215 N  N   . ILE A 1 150 ? 1.247  75.160 -8.895  1.00 17.86 ? 647 ILE A N   1 
ATOM   1216 C  CA  . ILE A 1 150 ? 0.235  75.107 -7.852  1.00 15.74 ? 647 ILE A CA  1 
ATOM   1217 C  C   . ILE A 1 150 ? 0.858  75.303 -6.464  1.00 15.68 ? 647 ILE A C   1 
ATOM   1218 O  O   . ILE A 1 150 ? 1.785  74.592 -6.086  1.00 17.61 ? 647 ILE A O   1 
ATOM   1219 C  CB  . ILE A 1 150 ? -0.514 73.765 -7.947  1.00 14.07 ? 647 ILE A CB  1 
ATOM   1220 C  CG1 . ILE A 1 150 ? -1.094 73.600 -9.364  1.00 17.76 ? 647 ILE A CG1 1 
ATOM   1221 C  CG2 . ILE A 1 150 ? -1.620 73.665 -6.896  1.00 12.37 ? 647 ILE A CG2 1 
ATOM   1222 C  CD1 . ILE A 1 150 ? -1.913 74.795 -9.865  1.00 11.46 ? 647 ILE A CD1 1 
ATOM   1223 N  N   . VAL A 1 151 ? 0.400  76.298 -5.722  1.00 16.62 ? 648 VAL A N   1 
ATOM   1224 C  CA  . VAL A 1 151 ? 0.969  76.519 -4.387  1.00 16.18 ? 648 VAL A CA  1 
ATOM   1225 C  C   . VAL A 1 151 ? 0.004  75.932 -3.365  1.00 15.96 ? 648 VAL A C   1 
ATOM   1226 O  O   . VAL A 1 151 ? -1.158 76.338 -3.284  1.00 14.76 ? 648 VAL A O   1 
ATOM   1227 C  CB  . VAL A 1 151 ? 1.258  78.035 -4.079  1.00 12.13 ? 648 VAL A CB  1 
ATOM   1228 C  CG1 . VAL A 1 151 ? 2.023  78.179 -2.775  1.00 9.31  ? 648 VAL A CG1 1 
ATOM   1229 C  CG2 . VAL A 1 151 ? 2.078  78.678 -5.223  1.00 11.58 ? 648 VAL A CG2 1 
ATOM   1230 N  N   . ILE A 1 152 ? 0.456  74.906 -2.659  1.00 15.66 ? 649 ILE A N   1 
ATOM   1231 C  CA  . ILE A 1 152 ? -0.369 74.276 -1.644  1.00 16.78 ? 649 ILE A CA  1 
ATOM   1232 C  C   . ILE A 1 152 ? 0.222  74.671 -0.306  1.00 17.79 ? 649 ILE A C   1 
ATOM   1233 O  O   . ILE A 1 152 ? 1.223  74.095 0.124   1.00 18.08 ? 649 ILE A O   1 
ATOM   1234 C  CB  . ILE A 1 152 ? -0.376 72.747 -1.769  1.00 14.88 ? 649 ILE A CB  1 
ATOM   1235 C  CG1 . ILE A 1 152 ? -0.873 72.352 -3.159  1.00 16.15 ? 649 ILE A CG1 1 
ATOM   1236 C  CG2 . ILE A 1 152 ? -1.297 72.142 -0.708  1.00 16.62 ? 649 ILE A CG2 1 
ATOM   1237 C  CD1 . ILE A 1 152 ? -0.925 70.873 -3.418  1.00 17.42 ? 649 ILE A CD1 1 
ATOM   1238 N  N   . PRO A 1 153 ? -0.351 75.709 0.334   1.00 16.08 ? 650 PRO A N   1 
ATOM   1239 C  CA  . PRO A 1 153 ? 0.076  76.238 1.627   1.00 12.67 ? 650 PRO A CA  1 
ATOM   1240 C  C   . PRO A 1 153 ? -0.300 75.297 2.775   1.00 15.98 ? 650 PRO A C   1 
ATOM   1241 O  O   . PRO A 1 153 ? -1.478 74.921 2.940   1.00 13.96 ? 650 PRO A O   1 
ATOM   1242 C  CB  . PRO A 1 153 ? -0.737 77.512 1.764   1.00 9.54  ? 650 PRO A CB  1 
ATOM   1243 C  CG  . PRO A 1 153 ? -1.475 77.687 0.465   1.00 13.54 ? 650 PRO A CG  1 
ATOM   1244 C  CD  . PRO A 1 153 ? -1.626 76.326 -0.068  1.00 16.46 ? 650 PRO A CD  1 
ATOM   1245 N  N   . VAL A 1 154 ? 0.693  74.893 3.553   1.00 14.32 ? 651 VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 154 ? 0.422  74.040 4.697   1.00 14.36 ? 651 VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 154 ? 0.728  74.922 5.911   1.00 12.69 ? 651 VAL A C   1 
ATOM   1248 O  O   . VAL A 1 154 ? 1.871  75.307 6.129   1.00 15.37 ? 651 VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 154 ? 1.293  72.782 4.691   1.00 14.81 ? 651 VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 154 ? 0.942  71.918 5.884   1.00 15.50 ? 651 VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 154 ? 1.075  72.004 3.392   1.00 10.07 ? 651 VAL A CG2 1 
ATOM   1252 N  N   . GLY A 1 155 ? -0.307 75.355 6.617   1.00 9.84  ? 652 GLY A N   1 
ATOM   1253 C  CA  . GLY A 1 155 ? -0.102 76.201 7.776   1.00 12.11 ? 652 GLY A CA  1 
ATOM   1254 C  C   . GLY A 1 155 ? 0.074  75.324 8.991   1.00 11.33 ? 652 GLY A C   1 
ATOM   1255 O  O   . GLY A 1 155 ? -0.778 74.503 9.244   1.00 17.62 ? 652 GLY A O   1 
ATOM   1256 N  N   . ILE A 1 156 ? 1.150  75.492 9.742   1.00 13.97 ? 653 ILE A N   1 
ATOM   1257 C  CA  . ILE A 1 156 ? 1.397  74.679 10.931  1.00 18.24 ? 653 ILE A CA  1 
ATOM   1258 C  C   . ILE A 1 156 ? 1.481  75.547 12.197  1.00 21.88 ? 653 ILE A C   1 
ATOM   1259 O  O   . ILE A 1 156 ? 2.468  76.273 12.417  1.00 19.90 ? 653 ILE A O   1 
ATOM   1260 C  CB  . ILE A 1 156 ? 2.728  73.937 10.804  1.00 22.12 ? 653 ILE A CB  1 
ATOM   1261 C  CG1 . ILE A 1 156 ? 2.805  73.167 9.478   1.00 18.02 ? 653 ILE A CG1 1 
ATOM   1262 C  CG2 . ILE A 1 156 ? 2.957  73.057 12.034  1.00 18.87 ? 653 ILE A CG2 1 
ATOM   1263 C  CD1 . ILE A 1 156 ? 4.217  72.868 9.064   1.00 14.43 ? 653 ILE A CD1 1 
ATOM   1264 N  N   . GLY A 1 157 ? 0.445  75.491 13.023  1.00 17.34 ? 654 GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 157 ? 0.480  76.279 14.245  1.00 18.39 ? 654 GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 157 ? -0.111 77.682 14.187  1.00 20.92 ? 654 GLY A C   1 
ATOM   1267 O  O   . GLY A 1 157 ? -0.373 78.214 13.102  1.00 24.39 ? 654 GLY A O   1 
ATOM   1268 N  N   . PRO A 1 158 ? -0.264 78.337 15.363  1.00 20.00 ? 655 PRO A N   1 
ATOM   1269 C  CA  . PRO A 1 158 ? -0.806 79.684 15.601  1.00 15.28 ? 655 PRO A CA  1 
ATOM   1270 C  C   . PRO A 1 158 ? -0.034 80.794 14.911  1.00 16.41 ? 655 PRO A C   1 
ATOM   1271 O  O   . PRO A 1 158 ? -0.588 81.825 14.552  1.00 18.28 ? 655 PRO A O   1 
ATOM   1272 C  CB  . PRO A 1 158 ? -0.642 79.852 17.116  1.00 12.24 ? 655 PRO A CB  1 
ATOM   1273 C  CG  . PRO A 1 158 ? -0.672 78.460 17.630  1.00 13.05 ? 655 PRO A CG  1 
ATOM   1274 C  CD  . PRO A 1 158 ? 0.153  77.719 16.635  1.00 14.07 ? 655 PRO A CD  1 
ATOM   1275 N  N   . HIS A 1 159 ? 1.272  80.622 14.794  1.00 16.41 ? 656 HIS A N   1 
ATOM   1276 C  CA  . HIS A 1 159 ? 2.082  81.667 14.194  1.00 18.52 ? 656 HIS A CA  1 
ATOM   1277 C  C   . HIS A 1 159 ? 2.109  81.703 12.664  1.00 17.35 ? 656 HIS A C   1 
ATOM   1278 O  O   . HIS A 1 159 ? 2.603  82.672 12.084  1.00 17.65 ? 656 HIS A O   1 
ATOM   1279 C  CB  . HIS A 1 159 ? 3.492  81.676 14.815  1.00 16.60 ? 656 HIS A CB  1 
ATOM   1280 C  CG  . HIS A 1 159 ? 3.498  82.026 16.283  1.00 18.39 ? 656 HIS A CG  1 
ATOM   1281 N  ND1 . HIS A 1 159 ? 3.392  81.077 17.277  1.00 18.56 ? 656 HIS A ND1 1 
ATOM   1282 C  CD2 . HIS A 1 159 ? 3.554  83.224 16.915  1.00 16.46 ? 656 HIS A CD2 1 
ATOM   1283 C  CE1 . HIS A 1 159 ? 3.376  81.672 18.451  1.00 13.19 ? 656 HIS A CE1 1 
ATOM   1284 N  NE2 . HIS A 1 159 ? 3.474  82.972 18.258  1.00 16.12 ? 656 HIS A NE2 1 
ATOM   1285 N  N   . ALA A 1 160 ? 1.504  80.703 12.027  1.00 17.30 ? 657 ALA A N   1 
ATOM   1286 C  CA  . ALA A 1 160 ? 1.459  80.616 10.564  1.00 18.06 ? 657 ALA A CA  1 
ATOM   1287 C  C   . ALA A 1 160 ? 0.729  81.810 9.961   1.00 16.82 ? 657 ALA A C   1 
ATOM   1288 O  O   . ALA A 1 160 ? -0.300 82.248 10.464  1.00 19.76 ? 657 ALA A O   1 
ATOM   1289 C  CB  . ALA A 1 160 ? 0.808  79.297 10.121  1.00 13.90 ? 657 ALA A CB  1 
ATOM   1290 N  N   . ASN A 1 161 ? 1.277  82.340 8.877   1.00 19.53 ? 658 ASN A N   1 
ATOM   1291 C  CA  . ASN A 1 161 ? 0.699  83.502 8.226   1.00 16.37 ? 658 ASN A CA  1 
ATOM   1292 C  C   . ASN A 1 161 ? -0.569 83.144 7.494   1.00 18.85 ? 658 ASN A C   1 
ATOM   1293 O  O   . ASN A 1 161 ? -0.575 82.964 6.284   1.00 20.50 ? 658 ASN A O   1 
ATOM   1294 C  CB  . ASN A 1 161 ? 1.704  84.142 7.276   1.00 11.24 ? 658 ASN A CB  1 
ATOM   1295 C  CG  . ASN A 1 161 ? 1.282  85.534 6.844   1.00 11.66 ? 658 ASN A CG  1 
ATOM   1296 O  OD1 . ASN A 1 161 ? 0.098  85.829 6.766   1.00 14.75 ? 658 ASN A OD1 1 
ATOM   1297 N  ND2 . ASN A 1 161 ? 2.251  86.396 6.563   1.00 16.32 ? 658 ASN A ND2 1 
ATOM   1298 N  N   . LEU A 1 162 ? -1.648 83.035 8.251   1.00 20.82 ? 659 LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 162 ? -2.943 82.704 7.700   1.00 19.30 ? 659 LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 162 ? -3.460 83.699 6.664   1.00 20.85 ? 659 LEU A C   1 
ATOM   1301 O  O   . LEU A 1 162 ? -4.230 83.317 5.782   1.00 22.69 ? 659 LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 162 ? -3.950 82.569 8.824   1.00 17.74 ? 659 LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 162 ? -4.579 81.198 8.897   1.00 21.02 ? 659 LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 162 ? -3.505 80.188 9.248   1.00 24.59 ? 659 LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 162 ? -5.665 81.212 9.935   1.00 27.06 ? 659 LEU A CD2 1 
ATOM   1306 N  N   . LYS A 1 163 ? -3.078 84.968 6.782   1.00 22.50 ? 660 LYS A N   1 
ATOM   1307 C  CA  . LYS A 1 163 ? -3.520 85.982 5.822   1.00 23.11 ? 660 LYS A CA  1 
ATOM   1308 C  C   . LYS A 1 163 ? -2.945 85.639 4.452   1.00 24.26 ? 660 LYS A C   1 
ATOM   1309 O  O   . LYS A 1 163 ? -3.663 85.697 3.448   1.00 27.91 ? 660 LYS A O   1 
ATOM   1310 C  CB  . LYS A 1 163 ? -3.068 87.361 6.251   1.00 21.43 ? 660 LYS A CB  1 
ATOM   1311 N  N   . GLN A 1 164 ? -1.667 85.240 4.420   1.00 21.76 ? 661 GLN A N   1 
ATOM   1312 C  CA  . GLN A 1 164 ? -0.991 84.844 3.183   1.00 17.85 ? 661 GLN A CA  1 
ATOM   1313 C  C   . GLN A 1 164 ? -1.570 83.531 2.688   1.00 18.55 ? 661 GLN A C   1 
ATOM   1314 O  O   . GLN A 1 164 ? -1.828 83.372 1.499   1.00 23.06 ? 661 GLN A O   1 
ATOM   1315 C  CB  . GLN A 1 164 ? 0.525  84.730 3.377   1.00 12.86 ? 661 GLN A CB  1 
ATOM   1316 C  CG  . GLN A 1 164 ? 1.237  86.102 3.366   1.00 10.63 ? 661 GLN A CG  1 
ATOM   1317 C  CD  . GLN A 1 164 ? 2.755  86.013 3.544   1.00 14.73 ? 661 GLN A CD  1 
ATOM   1318 O  OE1 . GLN A 1 164 ? 3.287  84.965 3.905   1.00 17.21 ? 661 GLN A OE1 1 
ATOM   1319 N  NE2 . GLN A 1 164 ? 3.451  87.118 3.305   1.00 15.89 ? 661 GLN A NE2 1 
ATOM   1320 N  N   . ILE A 1 165 ? -1.850 82.613 3.607   1.00 17.78 ? 662 ILE A N   1 
ATOM   1321 C  CA  . ILE A 1 165 ? -2.438 81.336 3.237   1.00 15.00 ? 662 ILE A CA  1 
ATOM   1322 C  C   . ILE A 1 165 ? -3.775 81.610 2.537   1.00 19.04 ? 662 ILE A C   1 
ATOM   1323 O  O   . ILE A 1 165 ? -4.050 81.031 1.487   1.00 21.90 ? 662 ILE A O   1 
ATOM   1324 C  CB  . ILE A 1 165 ? -2.580 80.411 4.489   1.00 11.85 ? 662 ILE A CB  1 
ATOM   1325 C  CG1 . ILE A 1 165 ? -1.196 80.040 4.995   1.00 11.79 ? 662 ILE A CG1 1 
ATOM   1326 C  CG2 . ILE A 1 165 ? -3.337 79.126 4.196   1.00 7.88  ? 662 ILE A CG2 1 
ATOM   1327 C  CD1 . ILE A 1 165 ? -1.191 79.084 6.171   1.00 13.32 ? 662 ILE A CD1 1 
ATOM   1328 N  N   . ARG A 1 166 ? -4.558 82.560 3.047   1.00 20.47 ? 663 ARG A N   1 
ATOM   1329 C  CA  . ARG A 1 166 ? -5.850 82.874 2.436   1.00 20.44 ? 663 ARG A CA  1 
ATOM   1330 C  C   . ARG A 1 166 ? -5.704 83.569 1.078   1.00 19.11 ? 663 ARG A C   1 
ATOM   1331 O  O   . ARG A 1 166 ? -6.548 83.416 0.195   1.00 19.37 ? 663 ARG A O   1 
ATOM   1332 C  CB  . ARG A 1 166 ? -6.733 83.701 3.390   1.00 23.96 ? 663 ARG A CB  1 
ATOM   1333 C  CG  . ARG A 1 166 ? -7.123 82.987 4.686   1.00 32.86 ? 663 ARG A CG  1 
ATOM   1334 C  CD  . ARG A 1 166 ? -7.800 81.612 4.456   1.00 41.17 ? 663 ARG A CD  1 
ATOM   1335 N  NE  . ARG A 1 166 ? -7.818 80.785 5.672   1.00 43.59 ? 663 ARG A NE  1 
ATOM   1336 C  CZ  . ARG A 1 166 ? -8.042 79.471 5.708   1.00 44.43 ? 663 ARG A CZ  1 
ATOM   1337 N  NH1 . ARG A 1 166 ? -8.287 78.791 4.604   1.00 40.35 ? 663 ARG A NH1 1 
ATOM   1338 N  NH2 . ARG A 1 166 ? -7.942 78.818 6.853   1.00 47.33 ? 663 ARG A NH2 1 
ATOM   1339 N  N   . LEU A 1 167 ? -4.641 84.338 0.911   1.00 20.67 ? 664 LEU A N   1 
ATOM   1340 C  CA  . LEU A 1 167 ? -4.400 85.016 -0.351  1.00 23.77 ? 664 LEU A CA  1 
ATOM   1341 C  C   . LEU A 1 167 ? -4.006 83.990 -1.425  1.00 24.53 ? 664 LEU A C   1 
ATOM   1342 O  O   . LEU A 1 167 ? -4.470 84.066 -2.570  1.00 25.26 ? 664 LEU A O   1 
ATOM   1343 C  CB  . LEU A 1 167 ? -3.287 86.048 -0.200  1.00 22.42 ? 664 LEU A CB  1 
ATOM   1344 C  CG  . LEU A 1 167 ? -3.695 87.458 0.188   1.00 23.55 ? 664 LEU A CG  1 
ATOM   1345 C  CD1 . LEU A 1 167 ? -2.434 88.240 0.463   1.00 22.20 ? 664 LEU A CD1 1 
ATOM   1346 C  CD2 . LEU A 1 167 ? -4.517 88.113 -0.910  1.00 21.42 ? 664 LEU A CD2 1 
ATOM   1347 N  N   . ILE A 1 168 ? -3.147 83.040 -1.053  1.00 23.53 ? 665 ILE A N   1 
ATOM   1348 C  CA  . ILE A 1 168 ? -2.697 82.009 -1.970  1.00 21.00 ? 665 ILE A CA  1 
ATOM   1349 C  C   . ILE A 1 168 ? -3.895 81.209 -2.462  1.00 22.09 ? 665 ILE A C   1 
ATOM   1350 O  O   . ILE A 1 168 ? -4.064 81.029 -3.659  1.00 24.56 ? 665 ILE A O   1 
ATOM   1351 C  CB  . ILE A 1 168 ? -1.680 81.078 -1.316  1.00 17.66 ? 665 ILE A CB  1 
ATOM   1352 C  CG1 . ILE A 1 168 ? -0.391 81.841 -1.015  1.00 15.92 ? 665 ILE A CG1 1 
ATOM   1353 C  CG2 . ILE A 1 168 ? -1.375 79.913 -2.234  1.00 18.28 ? 665 ILE A CG2 1 
ATOM   1354 C  CD1 . ILE A 1 168 ? 0.629  81.031 -0.194  1.00 6.96  ? 665 ILE A CD1 1 
ATOM   1355 N  N   . GLU A 1 169 ? -4.732 80.747 -1.549  1.00 23.35 ? 666 GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 169 ? -5.917 79.983 -1.918  1.00 19.08 ? 666 GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 169 ? -6.813 80.616 -2.967  1.00 19.61 ? 666 GLU A C   1 
ATOM   1358 O  O   . GLU A 1 169 ? -7.341 79.920 -3.827  1.00 18.02 ? 666 GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 169 ? -6.784 79.754 -0.704  1.00 17.71 ? 666 GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 169 ? -6.367 78.618 0.172   1.00 26.16 ? 666 GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 169 ? -7.515 78.164 1.049   1.00 28.97 ? 666 GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 169 ? -7.910 78.950 1.944   1.00 22.27 ? 666 GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 169 ? -8.030 77.036 0.815   1.00 30.15 ? 666 GLU A OE2 1 
ATOM   1364 N  N   . LYS A 1 170 ? -7.009 81.928 -2.878  1.00 21.77 ? 667 LYS A N   1 
ATOM   1365 C  CA  . LYS A 1 170 ? -7.908 82.604 -3.800  1.00 27.64 ? 667 LYS A CA  1 
ATOM   1366 C  C   . LYS A 1 170 ? -7.336 83.042 -5.140  1.00 28.79 ? 667 LYS A C   1 
ATOM   1367 O  O   . LYS A 1 170 ? -8.067 83.548 -5.999  1.00 33.07 ? 667 LYS A O   1 
ATOM   1368 C  CB  . LYS A 1 170 ? -8.613 83.773 -3.108  1.00 29.02 ? 667 LYS A CB  1 
ATOM   1369 C  CG  . LYS A 1 170 ? -7.764 84.976 -2.848  1.00 34.25 ? 667 LYS A CG  1 
ATOM   1370 C  CD  . LYS A 1 170 ? -8.600 86.097 -2.236  1.00 45.36 ? 667 LYS A CD  1 
ATOM   1371 C  CE  . LYS A 1 170 ? -7.746 87.344 -1.955  1.00 55.46 ? 667 LYS A CE  1 
ATOM   1372 N  NZ  . LYS A 1 170 ? -8.130 88.070 -0.688  1.00 58.49 ? 667 LYS A NZ  1 
ATOM   1373 N  N   . GLN A 1 171 ? -6.042 82.833 -5.329  1.00 29.18 ? 668 GLN A N   1 
ATOM   1374 C  CA  . GLN A 1 171 ? -5.370 83.189 -6.570  1.00 27.43 ? 668 GLN A CA  1 
ATOM   1375 C  C   . GLN A 1 171 ? -5.720 82.143 -7.648  1.00 27.44 ? 668 GLN A C   1 
ATOM   1376 O  O   . GLN A 1 171 ? -5.795 82.459 -8.834  1.00 29.48 ? 668 GLN A O   1 
ATOM   1377 C  CB  . GLN A 1 171 ? -3.856 83.236 -6.324  1.00 24.44 ? 668 GLN A CB  1 
ATOM   1378 C  CG  . GLN A 1 171 ? -3.199 84.560 -6.643  1.00 31.15 ? 668 GLN A CG  1 
ATOM   1379 C  CD  . GLN A 1 171 ? -3.934 85.764 -6.071  1.00 33.50 ? 668 GLN A CD  1 
ATOM   1380 O  OE1 . GLN A 1 171 ? -4.353 86.659 -6.818  1.00 32.99 ? 668 GLN A OE1 1 
ATOM   1381 N  NE2 . GLN A 1 171 ? -4.054 85.819 -4.747  1.00 30.05 ? 668 GLN A NE2 1 
ATOM   1382 N  N   . ALA A 1 172 ? -5.930 80.895 -7.231  1.00 23.35 ? 669 ALA A N   1 
ATOM   1383 C  CA  . ALA A 1 172 ? -6.275 79.816 -8.153  1.00 21.93 ? 669 ALA A CA  1 
ATOM   1384 C  C   . ALA A 1 172 ? -6.968 78.683 -7.379  1.00 20.53 ? 669 ALA A C   1 
ATOM   1385 O  O   . ALA A 1 172 ? -6.590 78.375 -6.267  1.00 22.44 ? 669 ALA A O   1 
ATOM   1386 C  CB  . ALA A 1 172 ? -5.010 79.303 -8.854  1.00 21.51 ? 669 ALA A CB  1 
ATOM   1387 N  N   . PRO A 1 173 ? -7.983 78.041 -7.977  1.00 22.07 ? 670 PRO A N   1 
ATOM   1388 C  CA  . PRO A 1 173 ? -8.697 76.959 -7.300  1.00 19.32 ? 670 PRO A CA  1 
ATOM   1389 C  C   . PRO A 1 173 ? -7.916 75.769 -6.744  1.00 24.31 ? 670 PRO A C   1 
ATOM   1390 O  O   . PRO A 1 173 ? -8.338 75.182 -5.735  1.00 22.85 ? 670 PRO A O   1 
ATOM   1391 C  CB  . PRO A 1 173 ? -9.740 76.517 -8.344  1.00 19.25 ? 670 PRO A CB  1 
ATOM   1392 C  CG  . PRO A 1 173 ? -9.251 77.058 -9.633  1.00 18.97 ? 670 PRO A CG  1 
ATOM   1393 C  CD  . PRO A 1 173 ? -8.649 78.372 -9.251  1.00 22.64 ? 670 PRO A CD  1 
ATOM   1394 N  N   . GLU A 1 174 ? -6.765 75.444 -7.332  1.00 21.90 ? 671 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 174 ? -6.037 74.282 -6.872  1.00 21.53 ? 671 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 174 ? -5.121 74.573 -5.724  1.00 18.85 ? 671 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 174 ? -4.526 73.648 -5.152  1.00 17.02 ? 671 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 174 ? -5.237 73.622 -7.996  1.00 28.16 ? 671 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 174 ? -6.053 73.156 -9.167  1.00 30.85 ? 671 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 174 ? -6.052 74.163 -10.295 1.00 40.33 ? 671 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 174 ? -5.922 75.389 -10.033 1.00 37.89 ? 671 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 174 ? -6.181 73.718 -11.456 1.00 49.39 ? 671 GLU A OE2 1 
ATOM   1403 N  N   . ASN A 1 175 ? -4.915 75.849 -5.440  1.00 16.70 ? 672 ASN A N   1 
ATOM   1404 C  CA  . ASN A 1 175 ? -4.035 76.229 -4.324  1.00 20.34 ? 672 ASN A CA  1 
ATOM   1405 C  C   . ASN A 1 175 ? -4.755 75.885 -3.007  1.00 18.55 ? 672 ASN A C   1 
ATOM   1406 O  O   . ASN A 1 175 ? -5.136 76.780 -2.248  1.00 18.65 ? 672 ASN A O   1 
ATOM   1407 C  CB  . ASN A 1 175 ? -3.751 77.739 -4.359  1.00 19.53 ? 672 ASN A CB  1 
ATOM   1408 C  CG  . ASN A 1 175 ? -2.994 78.186 -5.601  1.00 15.33 ? 672 ASN A CG  1 
ATOM   1409 O  OD1 . ASN A 1 175 ? -2.466 77.384 -6.369  1.00 12.87 ? 672 ASN A OD1 1 
ATOM   1410 N  ND2 . ASN A 1 175 ? -2.914 79.494 -5.778  1.00 17.27 ? 672 ASN A ND2 1 
ATOM   1411 N  N   . LYS A 1 176 ? -4.986 74.601 -2.761  1.00 17.76 ? 673 LYS A N   1 
ATOM   1412 C  CA  . LYS A 1 176 ? -5.708 74.178 -1.568  1.00 21.07 ? 673 LYS A CA  1 
ATOM   1413 C  C   . LYS A 1 176 ? -4.820 74.299 -0.335  1.00 20.99 ? 673 LYS A C   1 
ATOM   1414 O  O   . LYS A 1 176 ? -3.655 73.896 -0.360  1.00 26.08 ? 673 LYS A O   1 
ATOM   1415 C  CB  . LYS A 1 176 ? -6.222 72.732 -1.710  1.00 19.00 ? 673 LYS A CB  1 
ATOM   1416 C  CG  . LYS A 1 176 ? -7.480 72.469 -0.858  1.00 30.07 ? 673 LYS A CG  1 
ATOM   1417 C  CD  . LYS A 1 176 ? -7.457 71.176 -0.047  1.00 30.38 ? 673 LYS A CD  1 
ATOM   1418 C  CE  . LYS A 1 176 ? -7.751 69.983 -0.913  1.00 36.80 ? 673 LYS A CE  1 
ATOM   1419 N  NZ  . LYS A 1 176 ? -7.645 68.682 -0.181  1.00 45.16 ? 673 LYS A NZ  1 
ATOM   1420 N  N   . ALA A 1 177 ? -5.357 74.891 0.727   1.00 18.75 ? 674 ALA A N   1 
ATOM   1421 C  CA  . ALA A 1 177 ? -4.613 75.043 1.959   1.00 15.72 ? 674 ALA A CA  1 
ATOM   1422 C  C   . ALA A 1 177 ? -4.928 73.914 2.916   1.00 18.41 ? 674 ALA A C   1 
ATOM   1423 O  O   . ALA A 1 177 ? -6.047 73.370 2.935   1.00 12.37 ? 674 ALA A O   1 
ATOM   1424 C  CB  . ALA A 1 177 ? -4.938 76.362 2.607   1.00 14.82 ? 674 ALA A CB  1 
ATOM   1425 N  N   . PHE A 1 178 ? -3.916 73.577 3.716   1.00 20.72 ? 675 PHE A N   1 
ATOM   1426 C  CA  . PHE A 1 178 ? -4.021 72.560 4.751   1.00 17.35 ? 675 PHE A CA  1 
ATOM   1427 C  C   . PHE A 1 178 ? -3.565 73.235 6.032   1.00 13.94 ? 675 PHE A C   1 
ATOM   1428 O  O   . PHE A 1 178 ? -2.414 73.594 6.162   1.00 16.79 ? 675 PHE A O   1 
ATOM   1429 C  CB  . PHE A 1 178 ? -3.148 71.357 4.421   1.00 17.30 ? 675 PHE A CB  1 
ATOM   1430 C  CG  . PHE A 1 178 ? -3.667 70.547 3.276   1.00 16.73 ? 675 PHE A CG  1 
ATOM   1431 C  CD1 . PHE A 1 178 ? -3.357 70.890 1.961   1.00 18.39 ? 675 PHE A CD1 1 
ATOM   1432 C  CD2 . PHE A 1 178 ? -4.502 69.469 3.501   1.00 11.98 ? 675 PHE A CD2 1 
ATOM   1433 C  CE1 . PHE A 1 178 ? -3.880 70.177 0.880   1.00 11.40 ? 675 PHE A CE1 1 
ATOM   1434 C  CE2 . PHE A 1 178 ? -5.031 68.746 2.416   1.00 15.53 ? 675 PHE A CE2 1 
ATOM   1435 C  CZ  . PHE A 1 178 ? -4.717 69.111 1.108   1.00 13.44 ? 675 PHE A CZ  1 
ATOM   1436 N  N   . VAL A 1 179 ? -4.509 73.561 6.899   1.00 17.73 ? 676 VAL A N   1 
ATOM   1437 C  CA  . VAL A 1 179 ? -4.176 74.211 8.163   1.00 19.36 ? 676 VAL A CA  1 
ATOM   1438 C  C   . VAL A 1 179 ? -4.128 73.145 9.260   1.00 20.91 ? 676 VAL A C   1 
ATOM   1439 O  O   . VAL A 1 179 ? -5.035 72.324 9.395   1.00 19.66 ? 676 VAL A O   1 
ATOM   1440 C  CB  . VAL A 1 179 ? -5.175 75.326 8.489   1.00 17.55 ? 676 VAL A CB  1 
ATOM   1441 C  CG1 . VAL A 1 179 ? -4.779 76.031 9.769   1.00 18.65 ? 676 VAL A CG1 1 
ATOM   1442 C  CG2 . VAL A 1 179 ? -5.219 76.328 7.325   1.00 19.14 ? 676 VAL A CG2 1 
ATOM   1443 N  N   . LEU A 1 180 ? -2.994 73.100 9.952   1.00 23.37 ? 677 LEU A N   1 
ATOM   1444 C  CA  . LEU A 1 180 ? -2.740 72.122 11.003  1.00 21.69 ? 677 LEU A CA  1 
ATOM   1445 C  C   . LEU A 1 180 ? -2.362 72.830 12.284  1.00 17.44 ? 677 LEU A C   1 
ATOM   1446 O  O   . LEU A 1 180 ? -1.870 73.965 12.263  1.00 11.94 ? 677 LEU A O   1 
ATOM   1447 C  CB  . LEU A 1 180 ? -1.597 71.184 10.603  1.00 25.46 ? 677 LEU A CB  1 
ATOM   1448 C  CG  . LEU A 1 180 ? -1.766 70.099 9.540   1.00 25.42 ? 677 LEU A CG  1 
ATOM   1449 C  CD1 . LEU A 1 180 ? -2.269 70.624 8.236   1.00 23.58 ? 677 LEU A CD1 1 
ATOM   1450 C  CD2 . LEU A 1 180 ? -0.422 69.495 9.346   1.00 30.67 ? 677 LEU A CD2 1 
ATOM   1451 N  N   . SER A 1 181 ? -2.591 72.153 13.403  1.00 15.75 ? 678 SER A N   1 
ATOM   1452 C  CA  . SER A 1 181 ? -2.279 72.728 14.704  1.00 18.74 ? 678 SER A CA  1 
ATOM   1453 C  C   . SER A 1 181 ? -0.805 72.690 15.096  1.00 15.98 ? 678 SER A C   1 
ATOM   1454 O  O   . SER A 1 181 ? -0.305 73.594 15.775  1.00 16.52 ? 678 SER A O   1 
ATOM   1455 C  CB  . SER A 1 181 ? -3.143 72.085 15.783  1.00 17.24 ? 678 SER A CB  1 
ATOM   1456 O  OG  . SER A 1 181 ? -4.495 72.476 15.621  1.00 23.02 ? 678 SER A OG  1 
ATOM   1457 N  N   . SER A 1 182 ? -0.095 71.679 14.621  1.00 15.13 ? 679 SER A N   1 
ATOM   1458 C  CA  . SER A 1 182 ? 1.305  71.550 14.954  1.00 16.64 ? 679 SER A CA  1 
ATOM   1459 C  C   . SER A 1 182 ? 1.891  70.526 13.993  1.00 16.28 ? 679 SER A C   1 
ATOM   1460 O  O   . SER A 1 182 ? 1.152  69.830 13.284  1.00 16.75 ? 679 SER A O   1 
ATOM   1461 C  CB  . SER A 1 182 ? 1.424  71.025 16.389  1.00 20.41 ? 679 SER A CB  1 
ATOM   1462 O  OG  . SER A 1 182 ? 0.924  69.683 16.472  1.00 15.18 ? 679 SER A OG  1 
ATOM   1463 N  N   . VAL A 1 183 ? 3.212  70.389 14.023  1.00 14.70 ? 680 VAL A N   1 
ATOM   1464 C  CA  . VAL A 1 183 ? 3.881  69.426 13.165  1.00 18.08 ? 680 VAL A CA  1 
ATOM   1465 C  C   . VAL A 1 183 ? 3.441  67.999 13.506  1.00 21.23 ? 680 VAL A C   1 
ATOM   1466 O  O   . VAL A 1 183 ? 3.598  67.092 12.692  1.00 22.59 ? 680 VAL A O   1 
ATOM   1467 C  CB  . VAL A 1 183 ? 5.421  69.505 13.291  1.00 15.16 ? 680 VAL A CB  1 
ATOM   1468 C  CG1 . VAL A 1 183 ? 5.953  70.852 12.792  1.00 14.14 ? 680 VAL A CG1 1 
ATOM   1469 C  CG2 . VAL A 1 183 ? 5.844  69.260 14.728  1.00 15.78 ? 680 VAL A CG2 1 
ATOM   1470 N  N   . ASP A 1 184 ? 2.845  67.803 14.680  1.00 23.61 ? 681 ASP A N   1 
ATOM   1471 C  CA  . ASP A 1 184 ? 2.431  66.465 15.090  1.00 20.29 ? 681 ASP A CA  1 
ATOM   1472 C  C   . ASP A 1 184 ? 1.267  65.967 14.292  1.00 17.46 ? 681 ASP A C   1 
ATOM   1473 O  O   . ASP A 1 184 ? 1.021  64.758 14.254  1.00 19.43 ? 681 ASP A O   1 
ATOM   1474 C  CB  . ASP A 1 184 ? 2.118  66.404 16.586  1.00 22.71 ? 681 ASP A CB  1 
ATOM   1475 C  CG  . ASP A 1 184 ? 3.360  66.605 17.455  1.00 27.60 ? 681 ASP A CG  1 
ATOM   1476 O  OD1 . ASP A 1 184 ? 4.485  66.251 17.021  1.00 31.79 ? 681 ASP A OD1 1 
ATOM   1477 O  OD2 . ASP A 1 184 ? 3.205  67.117 18.585  1.00 30.83 ? 681 ASP A OD2 1 
ATOM   1478 N  N   . GLU A 1 185 ? 0.559  66.891 13.648  1.00 19.92 ? 682 GLU A N   1 
ATOM   1479 C  CA  . GLU A 1 185 ? -0.593 66.532 12.823  1.00 19.43 ? 682 GLU A CA  1 
ATOM   1480 C  C   . GLU A 1 185 ? -0.246 66.200 11.373  1.00 16.94 ? 682 GLU A C   1 
ATOM   1481 O  O   . GLU A 1 185 ? -1.031 65.593 10.678  1.00 20.34 ? 682 GLU A O   1 
ATOM   1482 C  CB  . GLU A 1 185 ? -1.664 67.616 12.904  1.00 19.71 ? 682 GLU A CB  1 
ATOM   1483 C  CG  . GLU A 1 185 ? -2.031 67.903 14.337  1.00 27.72 ? 682 GLU A CG  1 
ATOM   1484 C  CD  . GLU A 1 185 ? -3.385 68.541 14.516  1.00 32.65 ? 682 GLU A CD  1 
ATOM   1485 O  OE1 . GLU A 1 185 ? -3.806 69.338 13.643  1.00 32.50 ? 682 GLU A OE1 1 
ATOM   1486 O  OE2 . GLU A 1 185 ? -4.013 68.250 15.567  1.00 36.39 ? 682 GLU A OE2 1 
ATOM   1487 N  N   . LEU A 1 186 ? 0.968  66.533 10.953  1.00 19.46 ? 683 LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 186 ? 1.430  66.270 9.591   1.00 18.53 ? 683 LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 186 ? 1.230  64.820 9.159   1.00 19.54 ? 683 LEU A C   1 
ATOM   1490 O  O   . LEU A 1 186 ? 0.759  64.567 8.050   1.00 21.33 ? 683 LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 186 ? 2.913  66.629 9.458   1.00 9.01  ? 683 LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 186 ? 3.212  68.119 9.485   1.00 11.07 ? 683 LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 186 ? 4.725  68.380 9.521   1.00 6.20  ? 683 LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 186 ? 2.581  68.729 8.268   1.00 9.94  ? 683 LEU A CD2 1 
ATOM   1495 N  N   . GLU A 1 187 ? 1.577  63.879 10.027  1.00 17.82 ? 684 GLU A N   1 
ATOM   1496 C  CA  . GLU A 1 187 ? 1.449  62.470 9.701   1.00 21.58 ? 684 GLU A CA  1 
ATOM   1497 C  C   . GLU A 1 187 ? 0.026  62.043 9.404   1.00 20.80 ? 684 GLU A C   1 
ATOM   1498 O  O   . GLU A 1 187 ? -0.204 61.216 8.521   1.00 21.28 ? 684 GLU A O   1 
ATOM   1499 C  CB  . GLU A 1 187 ? 2.022  61.614 10.826  1.00 27.44 ? 684 GLU A CB  1 
ATOM   1500 C  CG  . GLU A 1 187 ? 1.799  60.112 10.601  1.00 42.61 ? 684 GLU A CG  1 
ATOM   1501 C  CD  . GLU A 1 187 ? 2.605  59.219 11.539  1.00 48.25 ? 684 GLU A CD  1 
ATOM   1502 O  OE1 . GLU A 1 187 ? 2.910  59.655 12.683  1.00 46.17 ? 684 GLU A OE1 1 
ATOM   1503 O  OE2 . GLU A 1 187 ? 2.915  58.071 11.116  1.00 50.28 ? 684 GLU A OE2 1 
ATOM   1504 N  N   . GLN A 1 188 ? -0.914 62.632 10.133  1.00 22.35 ? 685 GLN A N   1 
ATOM   1505 C  CA  . GLN A 1 188 ? -2.349 62.353 10.005  1.00 25.85 ? 685 GLN A CA  1 
ATOM   1506 C  C   . GLN A 1 188 ? -2.958 62.892 8.709   1.00 22.14 ? 685 GLN A C   1 
ATOM   1507 O  O   . GLN A 1 188 ? -4.089 62.579 8.381   1.00 25.03 ? 685 GLN A O   1 
ATOM   1508 C  CB  . GLN A 1 188 ? -3.117 63.008 11.162  1.00 25.71 ? 685 GLN A CB  1 
ATOM   1509 C  CG  . GLN A 1 188 ? -2.414 62.982 12.509  1.00 34.50 ? 685 GLN A CG  1 
ATOM   1510 C  CD  . GLN A 1 188 ? -3.192 63.753 13.571  1.00 41.31 ? 685 GLN A CD  1 
ATOM   1511 O  OE1 . GLN A 1 188 ? -4.338 64.167 13.356  1.00 40.86 ? 685 GLN A OE1 1 
ATOM   1512 N  NE2 . GLN A 1 188 ? -2.565 63.957 14.726  1.00 45.33 ? 685 GLN A NE2 1 
ATOM   1513 N  N   . GLN A 1 189 ? -2.245 63.789 8.044   1.00 20.96 ? 686 GLN A N   1 
ATOM   1514 C  CA  . GLN A 1 189 ? -2.715 64.404 6.813   1.00 23.16 ? 686 GLN A CA  1 
ATOM   1515 C  C   . GLN A 1 189 ? -1.882 64.075 5.583   1.00 19.32 ? 686 GLN A C   1 
ATOM   1516 O  O   . GLN A 1 189 ? -2.328 64.299 4.456   1.00 22.21 ? 686 GLN A O   1 
ATOM   1517 C  CB  . GLN A 1 189 ? -2.709 65.912 6.982   1.00 26.35 ? 686 GLN A CB  1 
ATOM   1518 C  CG  . GLN A 1 189 ? -3.709 66.416 7.948   1.00 35.22 ? 686 GLN A CG  1 
ATOM   1519 C  CD  . GLN A 1 189 ? -4.816 67.142 7.241   1.00 42.30 ? 686 GLN A CD  1 
ATOM   1520 O  OE1 . GLN A 1 189 ? -4.941 68.365 7.350   1.00 45.54 ? 686 GLN A OE1 1 
ATOM   1521 N  NE2 . GLN A 1 189 ? -5.616 66.400 6.478   1.00 44.88 ? 686 GLN A NE2 1 
ATOM   1522 N  N   . ARG A 1 190 ? -0.683 63.557 5.803   1.00 14.84 ? 687 ARG A N   1 
ATOM   1523 C  CA  . ARG A 1 190 ? 0.238  63.225 4.731   1.00 17.34 ? 687 ARG A CA  1 
ATOM   1524 C  C   . ARG A 1 190 ? -0.364 62.511 3.524   1.00 17.95 ? 687 ARG A C   1 
ATOM   1525 O  O   . ARG A 1 190 ? -0.248 62.982 2.402   1.00 18.16 ? 687 ARG A O   1 
ATOM   1526 C  CB  . ARG A 1 190 ? 1.405  62.429 5.303   1.00 12.76 ? 687 ARG A CB  1 
ATOM   1527 C  CG  . ARG A 1 190 ? 2.512  62.076 4.320   1.00 12.31 ? 687 ARG A CG  1 
ATOM   1528 C  CD  . ARG A 1 190 ? 2.812  60.589 4.398   1.00 15.47 ? 687 ARG A CD  1 
ATOM   1529 N  NE  . ARG A 1 190 ? 2.836  60.134 5.786   1.00 27.33 ? 687 ARG A NE  1 
ATOM   1530 C  CZ  . ARG A 1 190 ? 2.343  58.985 6.234   1.00 25.36 ? 687 ARG A CZ  1 
ATOM   1531 N  NH1 . ARG A 1 190 ? 1.783  58.118 5.416   1.00 25.62 ? 687 ARG A NH1 1 
ATOM   1532 N  NH2 . ARG A 1 190 ? 2.342  58.744 7.535   1.00 34.14 ? 687 ARG A NH2 1 
ATOM   1533 N  N   . ASP A 1 191 ? -1.044 61.397 3.749   1.00 22.35 ? 688 ASP A N   1 
ATOM   1534 C  CA  . ASP A 1 191 ? -1.603 60.649 2.632   1.00 20.59 ? 688 ASP A CA  1 
ATOM   1535 C  C   . ASP A 1 191 ? -2.651 61.418 1.872   1.00 23.19 ? 688 ASP A C   1 
ATOM   1536 O  O   . ASP A 1 191 ? -2.732 61.326 0.653   1.00 23.82 ? 688 ASP A O   1 
ATOM   1537 C  CB  . ASP A 1 191 ? -2.128 59.301 3.096   1.00 21.54 ? 688 ASP A CB  1 
ATOM   1538 C  CG  . ASP A 1 191 ? -1.008 58.365 3.518   1.00 24.25 ? 688 ASP A CG  1 
ATOM   1539 O  OD1 . ASP A 1 191 ? 0.172  58.697 3.266   1.00 31.52 ? 688 ASP A OD1 1 
ATOM   1540 O  OD2 . ASP A 1 191 ? -1.287 57.289 4.083   1.00 26.17 ? 688 ASP A OD2 1 
ATOM   1541 N  N   . GLU A 1 192 ? -3.395 62.253 2.575   1.00 23.99 ? 689 GLU A N   1 
ATOM   1542 C  CA  . GLU A 1 192 ? -4.419 63.045 1.927   1.00 26.49 ? 689 GLU A CA  1 
ATOM   1543 C  C   . GLU A 1 192 ? -3.796 64.142 1.054   1.00 25.62 ? 689 GLU A C   1 
ATOM   1544 O  O   . GLU A 1 192 ? -4.376 64.536 0.034   1.00 26.10 ? 689 GLU A O   1 
ATOM   1545 C  CB  . GLU A 1 192 ? -5.334 63.663 2.981   1.00 34.19 ? 689 GLU A CB  1 
ATOM   1546 C  CG  . GLU A 1 192 ? -6.456 64.543 2.429   1.00 36.12 ? 689 GLU A CG  1 
ATOM   1547 C  CD  . GLU A 1 192 ? -7.358 65.061 3.527   1.00 42.19 ? 689 GLU A CD  1 
ATOM   1548 O  OE1 . GLU A 1 192 ? -7.532 64.327 4.532   1.00 50.63 ? 689 GLU A OE1 1 
ATOM   1549 O  OE2 . GLU A 1 192 ? -7.895 66.189 3.385   1.00 42.61 ? 689 GLU A OE2 1 
ATOM   1550 N  N   . ILE A 1 193 ? -2.645 64.665 1.478   1.00 21.08 ? 690 ILE A N   1 
ATOM   1551 C  CA  . ILE A 1 193 ? -1.951 65.705 0.726   1.00 19.71 ? 690 ILE A CA  1 
ATOM   1552 C  C   . ILE A 1 193 ? -1.312 65.124 -0.514  1.00 20.60 ? 690 ILE A C   1 
ATOM   1553 O  O   . ILE A 1 193 ? -1.368 65.722 -1.567  1.00 23.29 ? 690 ILE A O   1 
ATOM   1554 C  CB  . ILE A 1 193 ? -0.881 66.388 1.572   1.00 20.01 ? 690 ILE A CB  1 
ATOM   1555 C  CG1 . ILE A 1 193 ? -1.550 67.130 2.737   1.00 18.80 ? 690 ILE A CG1 1 
ATOM   1556 C  CG2 . ILE A 1 193 ? -0.054 67.322 0.713   1.00 19.33 ? 690 ILE A CG2 1 
ATOM   1557 C  CD1 . ILE A 1 193 ? -0.610 67.889 3.623   1.00 13.89 ? 690 ILE A CD1 1 
ATOM   1558 N  N   . VAL A 1 194 ? -0.694 63.958 -0.394  1.00 22.47 ? 691 VAL A N   1 
ATOM   1559 C  CA  . VAL A 1 194 ? -0.083 63.301 -1.543  1.00 21.73 ? 691 VAL A CA  1 
ATOM   1560 C  C   . VAL A 1 194 ? -1.144 62.902 -2.579  1.00 20.40 ? 691 VAL A C   1 
ATOM   1561 O  O   . VAL A 1 194 ? -0.923 63.076 -3.767  1.00 22.98 ? 691 VAL A O   1 
ATOM   1562 C  CB  . VAL A 1 194 ? 0.750  62.083 -1.110  1.00 22.75 ? 691 VAL A CB  1 
ATOM   1563 C  CG1 . VAL A 1 194 ? 1.147  61.263 -2.296  1.00 29.43 ? 691 VAL A CG1 1 
ATOM   1564 C  CG2 . VAL A 1 194 ? 1.988  62.555 -0.431  1.00 23.51 ? 691 VAL A CG2 1 
ATOM   1565 N  N   . SER A 1 195 ? -2.296 62.407 -2.139  1.00 17.46 ? 692 SER A N   1 
ATOM   1566 C  CA  . SER A 1 195 ? -3.371 62.031 -3.054  1.00 15.69 ? 692 SER A CA  1 
ATOM   1567 C  C   . SER A 1 195 ? -3.894 63.216 -3.856  1.00 16.29 ? 692 SER A C   1 
ATOM   1568 O  O   . SER A 1 195 ? -4.106 63.117 -5.060  1.00 19.86 ? 692 SER A O   1 
ATOM   1569 C  CB  . SER A 1 195 ? -4.532 61.435 -2.283  1.00 15.65 ? 692 SER A CB  1 
ATOM   1570 O  OG  . SER A 1 195 ? -4.134 60.230 -1.674  1.00 28.15 ? 692 SER A OG  1 
ATOM   1571 N  N   . TYR A 1 196 ? -4.129 64.319 -3.168  1.00 16.74 ? 693 TYR A N   1 
ATOM   1572 C  CA  . TYR A 1 196 ? -4.632 65.536 -3.768  1.00 15.99 ? 693 TYR A CA  1 
ATOM   1573 C  C   . TYR A 1 196 ? -3.654 65.960 -4.833  1.00 18.79 ? 693 TYR A C   1 
ATOM   1574 O  O   . TYR A 1 196 ? -3.983 66.084 -6.006  1.00 21.36 ? 693 TYR A O   1 
ATOM   1575 C  CB  . TYR A 1 196 ? -4.725 66.619 -2.702  1.00 11.55 ? 693 TYR A CB  1 
ATOM   1576 C  CG  . TYR A 1 196 ? -5.078 67.969 -3.259  1.00 19.55 ? 693 TYR A CG  1 
ATOM   1577 C  CD1 . TYR A 1 196 ? -6.374 68.238 -3.748  1.00 20.06 ? 693 TYR A CD1 1 
ATOM   1578 C  CD2 . TYR A 1 196 ? -4.102 68.960 -3.394  1.00 13.67 ? 693 TYR A CD2 1 
ATOM   1579 C  CE1 . TYR A 1 196 ? -6.665 69.458 -4.365  1.00 14.61 ? 693 TYR A CE1 1 
ATOM   1580 C  CE2 . TYR A 1 196 ? -4.394 70.165 -4.002  1.00 14.06 ? 693 TYR A CE2 1 
ATOM   1581 C  CZ  . TYR A 1 196 ? -5.664 70.402 -4.489  1.00 14.63 ? 693 TYR A CZ  1 
ATOM   1582 O  OH  . TYR A 1 196 ? -5.911 71.592 -5.123  1.00 17.27 ? 693 TYR A OH  1 
ATOM   1583 N  N   . LEU A 1 197 ? -2.416 66.070 -4.401  1.00 21.64 ? 694 LEU A N   1 
ATOM   1584 C  CA  . LEU A 1 197 ? -1.287 66.480 -5.216  1.00 22.01 ? 694 LEU A CA  1 
ATOM   1585 C  C   . LEU A 1 197 ? -1.001 65.549 -6.414  1.00 24.72 ? 694 LEU A C   1 
ATOM   1586 O  O   . LEU A 1 197 ? -0.819 66.007 -7.560  1.00 21.88 ? 694 LEU A O   1 
ATOM   1587 C  CB  . LEU A 1 197 ? -0.131 66.631 -4.229  1.00 19.20 ? 694 LEU A CB  1 
ATOM   1588 C  CG  . LEU A 1 197 ? 1.365  66.561 -4.388  1.00 23.50 ? 694 LEU A CG  1 
ATOM   1589 C  CD1 . LEU A 1 197 ? 1.939  67.326 -3.227  1.00 20.23 ? 694 LEU A CD1 1 
ATOM   1590 C  CD2 . LEU A 1 197 ? 1.840  65.126 -4.387  1.00 21.48 ? 694 LEU A CD2 1 
ATOM   1591 N  N   . CYS A 1 198 ? -1.033 64.243 -6.178  1.00 24.01 ? 695 CYS A N   1 
ATOM   1592 C  CA  . CYS A 1 198 ? -0.805 63.264 -7.230  1.00 23.59 ? 695 CYS A CA  1 
ATOM   1593 C  C   . CYS A 1 198 ? -1.913 63.363 -8.266  1.00 23.92 ? 695 CYS A C   1 
ATOM   1594 O  O   . CYS A 1 198 ? -1.662 63.443 -9.476  1.00 20.77 ? 695 CYS A O   1 
ATOM   1595 C  CB  . CYS A 1 198 ? -0.785 61.851 -6.639  1.00 21.84 ? 695 CYS A CB  1 
ATOM   1596 S  SG  . CYS A 1 198 ? -0.122 60.600 -7.770  1.00 25.31 ? 695 CYS A SG  1 
ATOM   1597 N  N   . ASP A 1 199 ? -3.141 63.401 -7.775  1.00 25.04 ? 696 ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 199 ? -4.312 63.463 -8.634  1.00 30.16 ? 696 ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 199 ? -4.295 64.617 -9.630  1.00 29.12 ? 696 ASP A C   1 
ATOM   1600 O  O   . ASP A 1 199 ? -4.933 64.557 -10.678 1.00 33.49 ? 696 ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 199 ? -5.569 63.536 -7.775  1.00 33.29 ? 696 ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 199 ? -6.827 63.645 -8.598  1.00 40.85 ? 696 ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 199 ? -7.215 62.641 -9.244  1.00 44.44 ? 696 ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 199 ? -7.416 64.749 -8.613  1.00 45.63 ? 696 ASP A OD2 1 
ATOM   1605 N  N   . LEU A 1 200 ? -3.544 65.655 -9.296  1.00 27.97 ? 697 LEU A N   1 
ATOM   1606 C  CA  . LEU A 1 200 ? -3.421 66.863 -10.108 1.00 23.65 ? 697 LEU A CA  1 
ATOM   1607 C  C   . LEU A 1 200 ? -2.498 66.673 -11.297 1.00 21.19 ? 697 LEU A C   1 
ATOM   1608 O  O   . LEU A 1 200 ? -2.676 67.307 -12.337 1.00 23.84 ? 697 LEU A O   1 
ATOM   1609 C  CB  . LEU A 1 200 ? -2.863 67.990 -9.227  1.00 19.78 ? 697 LEU A CB  1 
ATOM   1610 C  CG  . LEU A 1 200 ? -3.679 69.216 -8.812  1.00 18.30 ? 697 LEU A CG  1 
ATOM   1611 C  CD1 . LEU A 1 200 ? -5.186 68.949 -8.767  1.00 12.42 ? 697 LEU A CD1 1 
ATOM   1612 C  CD2 . LEU A 1 200 ? -3.128 69.715 -7.478  1.00 11.15 ? 697 LEU A CD2 1 
ATOM   1613 N  N   . ALA A 1 201 ? -1.467 65.864 -11.106 1.00 20.21 ? 698 ALA A N   1 
ATOM   1614 C  CA  . ALA A 1 201 ? -0.472 65.597 -12.128 1.00 18.13 ? 698 ALA A CA  1 
ATOM   1615 C  C   . ALA A 1 201 ? -0.972 64.732 -13.286 1.00 18.60 ? 698 ALA A C   1 
ATOM   1616 O  O   . ALA A 1 201 ? -1.904 63.935 -13.128 1.00 20.41 ? 698 ALA A O   1 
ATOM   1617 C  CB  . ALA A 1 201 ? 0.746  64.965 -11.481 1.00 16.85 ? 698 ALA A CB  1 
ATOM   1618 N  N   . PRO A 1 202 ? -0.362 64.887 -14.479 1.00 15.84 ? 699 PRO A N   1 
ATOM   1619 C  CA  . PRO A 1 202 ? -0.802 64.081 -15.622 1.00 14.86 ? 699 PRO A CA  1 
ATOM   1620 C  C   . PRO A 1 202 ? -0.313 62.649 -15.472 1.00 17.66 ? 699 PRO A C   1 
ATOM   1621 O  O   . PRO A 1 202 ? 0.687  62.397 -14.808 1.00 18.33 ? 699 PRO A O   1 
ATOM   1622 C  CB  . PRO A 1 202 ? -0.131 64.763 -16.817 1.00 10.16 ? 699 PRO A CB  1 
ATOM   1623 C  CG  . PRO A 1 202 ? 0.224  66.151 -16.293 1.00 11.52 ? 699 PRO A CG  1 
ATOM   1624 C  CD  . PRO A 1 202 ? 0.636  65.888 -14.889 1.00 12.64 ? 699 PRO A CD  1 
ATOM   1625 N  N   . GLU A 1 203 ? -1.029 61.702 -16.058 1.00 18.23 ? 700 GLU A N   1 
ATOM   1626 C  CA  . GLU A 1 203 ? -0.585 60.329 -15.996 1.00 21.35 ? 700 GLU A CA  1 
ATOM   1627 C  C   . GLU A 1 203 ? 0.318  60.141 -17.171 1.00 24.65 ? 700 GLU A C   1 
ATOM   1628 O  O   . GLU A 1 203 ? 0.213  60.873 -18.137 1.00 29.66 ? 700 GLU A O   1 
ATOM   1629 C  CB  . GLU A 1 203 ? -1.730 59.377 -16.176 1.00 19.18 ? 700 GLU A CB  1 
ATOM   1630 C  CG  . GLU A 1 203 ? -2.640 59.327 -15.036 1.00 27.76 ? 700 GLU A CG  1 
ATOM   1631 C  CD  . GLU A 1 203 ? -3.623 58.221 -15.210 1.00 30.98 ? 700 GLU A CD  1 
ATOM   1632 O  OE1 . GLU A 1 203 ? -3.184 57.061 -15.339 1.00 35.58 ? 700 GLU A OE1 1 
ATOM   1633 O  OE2 . GLU A 1 203 ? -4.833 58.511 -15.269 1.00 39.02 ? 700 GLU A OE2 1 
ATOM   1634 N  N   . ALA A 1 204 ? 1.223  59.173 -17.083 1.00 33.25 ? 701 ALA A N   1 
ATOM   1635 C  CA  . ALA A 1 204 ? 2.109  58.864 -18.203 1.00 34.46 ? 701 ALA A CA  1 
ATOM   1636 C  C   . ALA A 1 204 ? 1.251  58.146 -19.254 1.00 36.32 ? 701 ALA A C   1 
ATOM   1637 O  O   . ALA A 1 204 ? 0.277  57.456 -18.916 1.00 30.64 ? 701 ALA A O   1 
ATOM   1638 C  CB  . ALA A 1 204 ? 3.251  57.962 -17.739 1.00 32.72 ? 701 ALA A CB  1 
ATOM   1639 N  N   . PRO A 1 205 ? 1.537  58.370 -20.545 1.00 42.71 ? 702 PRO A N   1 
ATOM   1640 C  CA  . PRO A 1 205 ? 0.790  57.732 -21.634 1.00 47.12 ? 702 PRO A CA  1 
ATOM   1641 C  C   . PRO A 1 205 ? 1.089  56.237 -21.591 1.00 49.56 ? 702 PRO A C   1 
ATOM   1642 O  O   . PRO A 1 205 ? 2.244  55.851 -21.342 1.00 48.33 ? 702 PRO A O   1 
ATOM   1643 C  CB  . PRO A 1 205 ? 1.402  58.353 -22.886 1.00 45.52 ? 702 PRO A CB  1 
ATOM   1644 C  CG  . PRO A 1 205 ? 1.918  59.687 -22.387 1.00 48.78 ? 702 PRO A CG  1 
ATOM   1645 C  CD  . PRO A 1 205 ? 2.530  59.322 -21.073 1.00 44.35 ? 702 PRO A CD  1 
ATOM   1646 N  N   . PRO A 1 206 ? 0.080  55.383 -21.849 1.00 51.95 ? 703 PRO A N   1 
ATOM   1647 C  CA  . PRO A 1 206 ? 0.189  53.922 -21.841 1.00 54.88 ? 703 PRO A CA  1 
ATOM   1648 C  C   . PRO A 1 206 ? 1.480  53.458 -22.521 1.00 59.06 ? 703 PRO A C   1 
ATOM   1649 O  O   . PRO A 1 206 ? 1.819  53.929 -23.616 1.00 56.81 ? 703 PRO A O   1 
ATOM   1650 C  CB  . PRO A 1 206 ? -1.057 53.477 -22.606 1.00 53.66 ? 703 PRO A CB  1 
ATOM   1651 C  CG  . PRO A 1 206 ? -2.041 54.516 -22.235 1.00 53.29 ? 703 PRO A CG  1 
ATOM   1652 C  CD  . PRO A 1 206 ? -1.240 55.790 -22.379 1.00 53.11 ? 703 PRO A CD  1 
ATOM   1653 N  N   . PRO A 1 207 ? 2.271  52.622 -21.816 1.00 64.17 ? 704 PRO A N   1 
ATOM   1654 C  CA  . PRO A 1 207 ? 3.533  52.117 -22.370 1.00 66.20 ? 704 PRO A CA  1 
ATOM   1655 C  C   . PRO A 1 207 ? 3.250  51.526 -23.741 1.00 67.33 ? 704 PRO A C   1 
ATOM   1656 O  O   . PRO A 1 207 ? 2.480  50.565 -23.877 1.00 66.63 ? 704 PRO A O   1 
ATOM   1657 C  CB  . PRO A 1 207 ? 3.946  51.050 -21.356 1.00 66.86 ? 704 PRO A CB  1 
ATOM   1658 C  CG  . PRO A 1 207 ? 3.457  51.639 -20.067 1.00 65.74 ? 704 PRO A CG  1 
ATOM   1659 C  CD  . PRO A 1 207 ? 2.065  52.108 -20.449 1.00 64.51 ? 704 PRO A CD  1 
ATOM   1660 N  N   . THR A 1 208 ? 3.885  52.118 -24.741 1.00 67.88 ? 705 THR A N   1 
ATOM   1661 C  CA  . THR A 1 208 ? 3.712  51.735 -26.130 1.00 68.43 ? 705 THR A CA  1 
ATOM   1662 C  C   . THR A 1 208 ? 5.009  51.114 -26.688 1.00 68.19 ? 705 THR A C   1 
ATOM   1663 O  O   . THR A 1 208 ? 4.932  50.046 -27.340 1.00 66.67 ? 705 THR A O   1 
ATOM   1664 C  CB  . THR A 1 208 ? 3.231  52.998 -26.933 1.00 69.60 ? 705 THR A CB  1 
ATOM   1665 O  OG1 . THR A 1 208 ? 2.672  52.619 -28.198 1.00 70.05 ? 705 THR A OG1 1 
ATOM   1666 C  CG2 . THR A 1 208 ? 4.357  54.013 -27.124 1.00 68.20 ? 705 THR A CG2 1 
ATOM   1667 O  OXT . THR A 1 208 ? 6.102  51.650 -26.404 1.00 67.96 ? 705 THR A OXT 1 
HETATM 1668 CD CD  . CD  B 2 .   ? 21.087 82.400 3.808   1.00 63.56 ? 400 CD  A CD  1 
HETATM 1669 O  O   . HOH C 3 .   ? 12.843 89.255 -8.795  1.00 19.95 ? 2   HOH A O   1 
HETATM 1670 O  O   . HOH C 3 .   ? 11.338 57.813 -2.986  1.00 17.83 ? 3   HOH A O   1 
HETATM 1671 O  O   . HOH C 3 .   ? 5.855  84.662 13.244  1.00 18.34 ? 4   HOH A O   1 
HETATM 1672 O  O   . HOH C 3 .   ? 7.459  71.500 -15.455 1.00 20.43 ? 5   HOH A O   1 
HETATM 1673 O  O   . HOH C 3 .   ? 20.176 56.138 3.391   1.00 19.87 ? 6   HOH A O   1 
HETATM 1674 O  O   . HOH C 3 .   ? 6.823  82.971 6.912   1.00 14.79 ? 7   HOH A O   1 
HETATM 1675 O  O   . HOH C 3 .   ? -4.298 63.951 -14.246 1.00 20.64 ? 8   HOH A O   1 
HETATM 1676 O  O   . HOH C 3 .   ? -2.742 79.778 -15.142 1.00 20.71 ? 9   HOH A O   1 
HETATM 1677 O  O   . HOH C 3 .   ? 12.081 54.498 -4.158  1.00 23.36 ? 10  HOH A O   1 
HETATM 1678 O  O   . HOH C 3 .   ? 0.799  72.210 -13.030 1.00 12.91 ? 11  HOH A O   1 
HETATM 1679 O  O   . HOH C 3 .   ? -1.670 59.748 6.592   1.00 25.86 ? 12  HOH A O   1 
HETATM 1680 O  O   . HOH C 3 .   ? 16.429 60.018 -9.580  1.00 24.16 ? 13  HOH A O   1 
HETATM 1681 O  O   . HOH C 3 .   ? 6.400  54.885 7.120   1.00 20.00 ? 14  HOH A O   1 
HETATM 1682 O  O   . HOH C 3 .   ? -3.778 62.357 -17.005 1.00 23.31 ? 15  HOH A O   1 
HETATM 1683 O  O   . HOH C 3 .   ? 4.165  88.525 -13.450 1.00 24.68 ? 16  HOH A O   1 
HETATM 1684 O  O   . HOH C 3 .   ? 5.521  63.424 10.095  1.00 22.52 ? 17  HOH A O   1 
HETATM 1685 O  O   . HOH C 3 .   ? 20.565 82.483 0.524   1.00 29.62 ? 18  HOH A O   1 
HETATM 1686 O  O   . HOH C 3 .   ? -6.982 66.383 -6.517  1.00 25.55 ? 19  HOH A O   1 
HETATM 1687 O  O   . HOH C 3 .   ? -3.223 76.783 14.683  1.00 26.93 ? 20  HOH A O   1 
HETATM 1688 O  O   . HOH C 3 .   ? 11.463 83.395 -15.168 1.00 32.83 ? 21  HOH A O   1 
HETATM 1689 O  O   . HOH C 3 .   ? 3.714  64.286 12.019  1.00 23.88 ? 22  HOH A O   1 
HETATM 1690 O  O   . HOH C 3 .   ? 13.905 64.214 10.471  1.00 31.70 ? 23  HOH A O   1 
HETATM 1691 O  O   . HOH C 3 .   ? 12.155 55.043 -8.536  1.00 34.03 ? 24  HOH A O   1 
HETATM 1692 O  O   . HOH C 3 .   ? 13.710 51.088 -2.523  1.00 20.07 ? 25  HOH A O   1 
HETATM 1693 O  O   . HOH C 3 .   ? -5.049 74.711 13.638  1.00 35.15 ? 26  HOH A O   1 
HETATM 1694 O  O   . HOH C 3 .   ? 13.114 65.475 -17.704 1.00 53.17 ? 27  HOH A O   1 
HETATM 1695 O  O   . HOH C 3 .   ? -0.006 53.108 -5.947  1.00 33.74 ? 28  HOH A O   1 
HETATM 1696 O  O   . HOH C 3 .   ? -6.320 65.690 15.632  1.00 25.71 ? 29  HOH A O   1 
HETATM 1697 O  O   . HOH C 3 .   ? 15.645 62.671 -10.084 1.00 28.88 ? 30  HOH A O   1 
HETATM 1698 O  O   . HOH C 3 .   ? 12.820 75.901 11.433  1.00 20.13 ? 31  HOH A O   1 
HETATM 1699 O  O   . HOH C 3 .   ? 3.280  89.668 6.151   1.00 32.89 ? 32  HOH A O   1 
HETATM 1700 O  O   . HOH C 3 .   ? 16.298 84.297 -12.730 1.00 38.93 ? 33  HOH A O   1 
HETATM 1701 O  O   . HOH C 3 .   ? 15.513 75.234 10.335  1.00 21.86 ? 34  HOH A O   1 
HETATM 1702 O  O   . HOH C 3 .   ? -1.529 78.049 -8.823  1.00 27.27 ? 35  HOH A O   1 
HETATM 1703 O  O   . HOH C 3 .   ? 1.684  65.375 -19.687 1.00 31.52 ? 36  HOH A O   1 
HETATM 1704 O  O   . HOH C 3 .   ? 21.786 67.805 3.763   1.00 30.08 ? 37  HOH A O   1 
HETATM 1705 O  O   . HOH C 3 .   ? 7.250  58.847 -18.182 1.00 26.27 ? 38  HOH A O   1 
HETATM 1706 O  O   . HOH C 3 .   ? 1.254  89.405 2.944   1.00 29.47 ? 39  HOH A O   1 
HETATM 1707 O  O   . HOH C 3 .   ? 15.260 74.084 19.649  1.00 34.81 ? 40  HOH A O   1 
HETATM 1708 O  O   . HOH C 3 .   ? 7.143  67.828 18.483  1.00 37.13 ? 41  HOH A O   1 
HETATM 1709 O  O   . HOH C 3 .   ? 15.332 72.981 -9.051  1.00 31.11 ? 42  HOH A O   1 
HETATM 1710 O  O   . HOH C 3 .   ? -2.646 77.766 -11.602 1.00 43.04 ? 43  HOH A O   1 
HETATM 1711 O  O   . HOH C 3 .   ? 4.298  72.336 15.777  1.00 25.86 ? 44  HOH A O   1 
HETATM 1712 O  O   . HOH C 3 .   ? -7.781 77.167 -3.587  1.00 28.27 ? 45  HOH A O   1 
HETATM 1713 O  O   . HOH C 3 .   ? 9.819  54.515 -2.145  1.00 26.83 ? 46  HOH A O   1 
HETATM 1714 O  O   . HOH C 3 .   ? 9.233  71.691 21.073  1.00 27.65 ? 47  HOH A O   1 
HETATM 1715 O  O   . HOH C 3 .   ? -6.771 61.702 -11.847 1.00 33.38 ? 48  HOH A O   1 
HETATM 1716 O  O   . HOH C 3 .   ? 2.000  61.947 16.425  1.00 35.24 ? 49  HOH A O   1 
HETATM 1717 O  O   . HOH C 3 .   ? 4.437  61.875 8.136   1.00 19.67 ? 50  HOH A O   1 
HETATM 1718 O  O   . HOH C 3 .   ? -5.984 89.196 -5.953  1.00 27.42 ? 51  HOH A O   1 
HETATM 1719 O  O   . HOH C 3 .   ? -0.301 80.756 -6.984  1.00 16.22 ? 52  HOH A O   1 
HETATM 1720 O  O   . HOH C 3 .   ? 8.003  91.023 -1.635  1.00 22.04 ? 53  HOH A O   1 
HETATM 1721 O  O   . HOH C 3 .   ? 1.984  52.285 1.556   1.00 32.06 ? 54  HOH A O   1 
HETATM 1722 O  O   . HOH C 3 .   ? 22.969 58.802 -6.141  1.00 20.50 ? 55  HOH A O   1 
HETATM 1723 O  O   . HOH C 3 .   ? 22.134 75.168 1.559   1.00 29.56 ? 56  HOH A O   1 
HETATM 1724 O  O   . HOH C 3 .   ? 2.332  68.858 -21.860 1.00 40.22 ? 57  HOH A O   1 
HETATM 1725 O  O   . HOH C 3 .   ? 13.345 99.903 0.118   1.00 31.18 ? 58  HOH A O   1 
HETATM 1726 O  O   . HOH C 3 .   ? 3.315  78.566 14.464  1.00 36.84 ? 59  HOH A O   1 
HETATM 1727 O  O   . HOH C 3 .   ? 13.989 53.672 -2.598  1.00 26.85 ? 60  HOH A O   1 
HETATM 1728 O  O   . HOH C 3 .   ? 11.602 93.708 -4.079  1.00 31.51 ? 61  HOH A O   1 
HETATM 1729 O  O   . HOH C 3 .   ? -4.039 61.401 5.280   1.00 31.62 ? 62  HOH A O   1 
HETATM 1730 O  O   . HOH C 3 .   ? -8.094 63.297 -13.766 1.00 30.71 ? 63  HOH A O   1 
HETATM 1731 O  O   . HOH C 3 .   ? 6.317  80.539 6.552   1.00 16.85 ? 64  HOH A O   1 
HETATM 1732 O  O   . HOH C 3 .   ? 0.089  56.866 -9.265  1.00 51.53 ? 65  HOH A O   1 
HETATM 1733 O  O   . HOH C 3 .   ? 14.012 57.353 3.577   1.00 27.66 ? 66  HOH A O   1 
HETATM 1734 O  O   . HOH C 3 .   ? 15.368 87.826 -8.978  1.00 20.63 ? 67  HOH A O   1 
HETATM 1735 O  O   . HOH C 3 .   ? 20.916 56.088 5.970   1.00 34.46 ? 68  HOH A O   1 
HETATM 1736 O  O   . HOH C 3 .   ? 7.968  74.879 -22.149 1.00 25.16 ? 69  HOH A O   1 
HETATM 1737 O  O   . HOH C 3 .   ? 0.090  50.115 1.752   1.00 59.63 ? 70  HOH A O   1 
HETATM 1738 O  O   . HOH C 3 .   ? 0.835  54.480 3.486   1.00 32.81 ? 72  HOH A O   1 
HETATM 1739 O  O   . HOH C 3 .   ? 3.270  90.410 10.218  1.00 38.62 ? 73  HOH A O   1 
HETATM 1740 O  O   . HOH C 3 .   ? -3.546 69.760 -13.218 1.00 39.17 ? 74  HOH A O   1 
HETATM 1741 O  O   . HOH C 3 .   ? 4.429  62.412 14.575  1.00 28.78 ? 75  HOH A O   1 
HETATM 1742 O  O   . HOH C 3 .   ? 8.746  63.065 -18.468 1.00 37.24 ? 76  HOH A O   1 
HETATM 1743 O  O   . HOH C 3 .   ? 0.268  93.491 -9.341  1.00 31.00 ? 77  HOH A O   1 
HETATM 1744 O  O   . HOH C 3 .   ? 5.181  70.124 19.085  1.00 32.21 ? 78  HOH A O   1 
HETATM 1745 O  O   . HOH C 3 .   ? -0.342 97.522 7.781   1.00 52.86 ? 79  HOH A O   1 
HETATM 1746 O  O   . HOH C 3 .   ? -7.115 85.141 -10.331 1.00 45.38 ? 80  HOH A O   1 
HETATM 1747 O  O   . HOH C 3 .   ? 2.918  89.116 -11.363 1.00 28.79 ? 81  HOH A O   1 
HETATM 1748 O  O   . HOH C 3 .   ? 7.644  47.658 -27.128 1.00 32.11 ? 82  HOH A O   1 
HETATM 1749 O  O   . HOH C 3 .   ? -5.142 74.172 -17.331 1.00 58.76 ? 83  HOH A O   1 
HETATM 1750 O  O   . HOH C 3 .   ? 20.835 88.621 7.665   1.00 49.10 ? 84  HOH A O   1 
HETATM 1751 O  O   . HOH C 3 .   ? 17.968 71.506 -10.822 1.00 33.34 ? 85  HOH A O   1 
HETATM 1752 O  O   . HOH C 3 .   ? 20.185 70.487 12.619  1.00 42.27 ? 86  HOH A O   1 
HETATM 1753 O  O   . HOH C 3 .   ? 22.959 55.233 -14.259 1.00 35.10 ? 87  HOH A O   1 
HETATM 1754 O  O   . HOH C 3 .   ? 16.987 49.785 -11.115 1.00 38.20 ? 88  HOH A O   1 
HETATM 1755 O  O   . HOH C 3 .   ? 14.278 48.507 -2.170  1.00 29.51 ? 89  HOH A O   1 
HETATM 1756 O  O   . HOH C 3 .   ? -9.407 81.532 -8.027  1.00 29.31 ? 90  HOH A O   1 
HETATM 1757 O  O   . HOH C 3 .   ? 4.858  84.275 -14.284 1.00 30.40 ? 91  HOH A O   1 
HETATM 1758 O  O   . HOH C 3 .   ? -2.778 86.559 -12.163 1.00 40.95 ? 92  HOH A O   1 
HETATM 1759 O  O   . HOH C 3 .   ? -5.292 77.287 -11.947 1.00 28.86 ? 93  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   498 498 ASP ASP A . n 
A 1 2   ILE 2   499 499 ILE ILE A . n 
A 1 3   SER 3   500 500 SER SER A . n 
A 1 4   GLU 4   501 501 GLU GLU A . n 
A 1 5   PRO 5   502 502 PRO PRO A . n 
A 1 6   PRO 6   503 503 PRO PRO A . n 
A 1 7   LEU 7   504 504 LEU LEU A . n 
A 1 8   HIS 8   505 505 HIS HIS A . n 
A 1 9   ASP 9   506 506 ASP ASP A . n 
A 1 10  PHE 10  507 507 PHE PHE A . n 
A 1 11  TYR 11  508 508 TYR TYR A . n 
A 1 12  CYS 12  509 509 CYS CYS A . n 
A 1 13  SER 13  510 510 SER SER A . n 
A 1 14  ARG 14  511 511 ARG ARG A . n 
A 1 15  LEU 15  512 512 LEU LEU A . n 
A 1 16  LEU 16  513 513 LEU LEU A . n 
A 1 17  ASP 17  514 514 ASP ASP A . n 
A 1 18  LEU 18  515 515 LEU LEU A . n 
A 1 19  VAL 19  516 516 VAL VAL A . n 
A 1 20  PHE 20  517 517 PHE PHE A . n 
A 1 21  LEU 21  518 518 LEU LEU A . n 
A 1 22  LEU 22  519 519 LEU LEU A . n 
A 1 23  ASP 23  520 520 ASP ASP A . n 
A 1 24  GLY 24  521 521 GLY GLY A . n 
A 1 25  SER 25  522 522 SER SER A . n 
A 1 26  SER 26  523 523 SER SER A . n 
A 1 27  ARG 27  524 524 ARG ARG A . n 
A 1 28  LEU 28  525 525 LEU LEU A . n 
A 1 29  SER 29  526 526 SER SER A . n 
A 1 30  GLU 30  527 527 GLU GLU A . n 
A 1 31  ALA 31  528 528 ALA ALA A . n 
A 1 32  GLU 32  529 529 GLU GLU A . n 
A 1 33  PHE 33  530 530 PHE PHE A . n 
A 1 34  GLU 34  531 531 GLU GLU A . n 
A 1 35  VAL 35  532 532 VAL VAL A . n 
A 1 36  LEU 36  533 533 LEU LEU A . n 
A 1 37  LYS 37  534 534 LYS LYS A . n 
A 1 38  ALA 38  535 535 ALA ALA A . n 
A 1 39  PHE 39  536 536 PHE PHE A . n 
A 1 40  VAL 40  537 537 VAL VAL A . n 
A 1 41  VAL 41  538 538 VAL VAL A . n 
A 1 42  ASP 42  539 539 ASP ASP A . n 
A 1 43  MET 43  540 540 MET MET A . n 
A 1 44  MET 44  541 541 MET MET A . n 
A 1 45  GLU 45  542 542 GLU GLU A . n 
A 1 46  ARG 46  543 543 ARG ARG A . n 
A 1 47  LEU 47  544 544 LEU LEU A . n 
A 1 48  ARG 48  545 545 ARG ARG A . n 
A 1 49  ILE 49  546 546 ILE ILE A . n 
A 1 50  SER 50  547 547 SER SER A . n 
A 1 51  GLN 51  548 548 GLN GLN A . n 
A 1 52  LYS 52  549 549 LYS LYS A . n 
A 1 53  TRP 53  550 550 TRP TRP A . n 
A 1 54  VAL 54  551 551 VAL VAL A . n 
A 1 55  ARG 55  552 552 ARG ARG A . n 
A 1 56  VAL 56  553 553 VAL VAL A . n 
A 1 57  ALA 57  554 554 ALA ALA A . n 
A 1 58  VAL 58  555 555 VAL VAL A . n 
A 1 59  VAL 59  556 556 VAL VAL A . n 
A 1 60  GLU 60  557 557 GLU GLU A . n 
A 1 61  TYR 61  558 558 TYR TYR A . n 
A 1 62  HIS 62  559 559 HIS HIS A . n 
A 1 63  ASP 63  560 560 ASP ASP A . n 
A 1 64  GLY 64  561 561 GLY GLY A . n 
A 1 65  SER 65  562 562 SER SER A . n 
A 1 66  HIS 66  563 563 HIS HIS A . n 
A 1 67  ALA 67  564 564 ALA ALA A . n 
A 1 68  TYR 68  565 565 TYR TYR A . n 
A 1 69  ILE 69  566 566 ILE ILE A . n 
A 1 70  GLY 70  567 567 GLY GLY A . n 
A 1 71  LEU 71  568 568 LEU LEU A . n 
A 1 72  LYS 72  569 569 LYS LYS A . n 
A 1 73  ASP 73  570 570 ASP ASP A . n 
A 1 74  ARG 74  571 571 ARG ARG A . n 
A 1 75  LYS 75  572 572 LYS LYS A . n 
A 1 76  ARG 76  573 573 ARG ARG A . n 
A 1 77  PRO 77  574 574 PRO PRO A . n 
A 1 78  SER 78  575 575 SER SER A . n 
A 1 79  GLU 79  576 576 GLU GLU A . n 
A 1 80  LEU 80  577 577 LEU LEU A . n 
A 1 81  ARG 81  578 578 ARG ARG A . n 
A 1 82  ARG 82  579 579 ARG ARG A . n 
A 1 83  ILE 83  580 580 ILE ILE A . n 
A 1 84  ALA 84  581 581 ALA ALA A . n 
A 1 85  SER 85  582 582 SER SER A . n 
A 1 86  GLN 86  583 583 GLN GLN A . n 
A 1 87  VAL 87  584 584 VAL VAL A . n 
A 1 88  LYS 88  585 585 LYS LYS A . n 
A 1 89  TYR 89  586 586 TYR TYR A . n 
A 1 90  ALA 90  587 587 ALA ALA A . n 
A 1 91  GLY 91  588 588 GLY GLY A . n 
A 1 92  SER 92  589 589 SER SER A . n 
A 1 93  GLN 93  590 590 GLN GLN A . n 
A 1 94  VAL 94  591 591 VAL VAL A . n 
A 1 95  ALA 95  592 592 ALA ALA A . n 
A 1 96  SER 96  593 593 SER SER A . n 
A 1 97  THR 97  594 594 THR THR A . n 
A 1 98  SER 98  595 595 SER SER A . n 
A 1 99  GLU 99  596 596 GLU GLU A . n 
A 1 100 VAL 100 597 597 VAL VAL A . n 
A 1 101 LEU 101 598 598 LEU LEU A . n 
A 1 102 LYS 102 599 599 LYS LYS A . n 
A 1 103 TYR 103 600 600 TYR TYR A . n 
A 1 104 THR 104 601 601 THR THR A . n 
A 1 105 LEU 105 602 602 LEU LEU A . n 
A 1 106 PHE 106 603 603 PHE PHE A . n 
A 1 107 GLN 107 604 604 GLN GLN A . n 
A 1 108 ILE 108 605 605 ILE ILE A . n 
A 1 109 PHE 109 606 606 PHE PHE A . n 
A 1 110 SER 110 607 607 SER SER A . n 
A 1 111 LYS 111 608 608 LYS LYS A . n 
A 1 112 ILE 112 609 609 ILE ILE A . n 
A 1 113 ASP 113 610 610 ASP ASP A . n 
A 1 114 ARG 114 611 611 ARG ARG A . n 
A 1 115 PRO 115 612 612 PRO PRO A . n 
A 1 116 GLU 116 613 613 GLU GLU A . n 
A 1 117 ALA 117 614 614 ALA ALA A . n 
A 1 118 SER 118 615 615 SER SER A . n 
A 1 119 ARG 119 616 616 ARG ARG A . n 
A 1 120 ILE 120 617 617 ILE ILE A . n 
A 1 121 ALA 121 618 618 ALA ALA A . n 
A 1 122 LEU 122 619 619 LEU LEU A . n 
A 1 123 LEU 123 620 620 LEU LEU A . n 
A 1 124 LEU 124 621 621 LEU LEU A . n 
A 1 125 MET 125 622 622 MET MET A . n 
A 1 126 ALA 126 623 623 ALA ALA A . n 
A 1 127 SER 127 624 624 SER SER A . n 
A 1 128 GLN 128 625 625 GLN GLN A . n 
A 1 129 GLU 129 626 626 GLU GLU A . n 
A 1 130 PRO 130 627 627 PRO PRO A . n 
A 1 131 GLN 131 628 628 GLN GLN A . n 
A 1 132 ARG 132 629 629 ARG ARG A . n 
A 1 133 MET 133 630 630 MET MET A . n 
A 1 134 SER 134 631 631 SER SER A . n 
A 1 135 ARG 135 632 632 ARG ARG A . n 
A 1 136 ASN 136 633 633 ASN ASN A . n 
A 1 137 PHE 137 634 634 PHE PHE A . n 
A 1 138 VAL 138 635 635 VAL VAL A . n 
A 1 139 ARG 139 636 636 ARG ARG A . n 
A 1 140 TYR 140 637 637 TYR TYR A . n 
A 1 141 VAL 141 638 638 VAL VAL A . n 
A 1 142 GLN 142 639 639 GLN GLN A . n 
A 1 143 GLY 143 640 640 GLY GLY A . n 
A 1 144 LEU 144 641 641 LEU LEU A . n 
A 1 145 LYS 145 642 642 LYS LYS A . n 
A 1 146 LYS 146 643 643 LYS LYS A . n 
A 1 147 LYS 147 644 644 LYS LYS A . n 
A 1 148 LYS 148 645 645 LYS LYS A . n 
A 1 149 VAL 149 646 646 VAL VAL A . n 
A 1 150 ILE 150 647 647 ILE ILE A . n 
A 1 151 VAL 151 648 648 VAL VAL A . n 
A 1 152 ILE 152 649 649 ILE ILE A . n 
A 1 153 PRO 153 650 650 PRO PRO A . n 
A 1 154 VAL 154 651 651 VAL VAL A . n 
A 1 155 GLY 155 652 652 GLY GLY A . n 
A 1 156 ILE 156 653 653 ILE ILE A . n 
A 1 157 GLY 157 654 654 GLY GLY A . n 
A 1 158 PRO 158 655 655 PRO PRO A . n 
A 1 159 HIS 159 656 656 HIS HIS A . n 
A 1 160 ALA 160 657 657 ALA ALA A . n 
A 1 161 ASN 161 658 658 ASN ASN A . n 
A 1 162 LEU 162 659 659 LEU LEU A . n 
A 1 163 LYS 163 660 660 LYS LYS A . n 
A 1 164 GLN 164 661 661 GLN GLN A . n 
A 1 165 ILE 165 662 662 ILE ILE A . n 
A 1 166 ARG 166 663 663 ARG ARG A . n 
A 1 167 LEU 167 664 664 LEU LEU A . n 
A 1 168 ILE 168 665 665 ILE ILE A . n 
A 1 169 GLU 169 666 666 GLU GLU A . n 
A 1 170 LYS 170 667 667 LYS LYS A . n 
A 1 171 GLN 171 668 668 GLN GLN A . n 
A 1 172 ALA 172 669 669 ALA ALA A . n 
A 1 173 PRO 173 670 670 PRO PRO A . n 
A 1 174 GLU 174 671 671 GLU GLU A . n 
A 1 175 ASN 175 672 672 ASN ASN A . n 
A 1 176 LYS 176 673 673 LYS LYS A . n 
A 1 177 ALA 177 674 674 ALA ALA A . n 
A 1 178 PHE 178 675 675 PHE PHE A . n 
A 1 179 VAL 179 676 676 VAL VAL A . n 
A 1 180 LEU 180 677 677 LEU LEU A . n 
A 1 181 SER 181 678 678 SER SER A . n 
A 1 182 SER 182 679 679 SER SER A . n 
A 1 183 VAL 183 680 680 VAL VAL A . n 
A 1 184 ASP 184 681 681 ASP ASP A . n 
A 1 185 GLU 185 682 682 GLU GLU A . n 
A 1 186 LEU 186 683 683 LEU LEU A . n 
A 1 187 GLU 187 684 684 GLU GLU A . n 
A 1 188 GLN 188 685 685 GLN GLN A . n 
A 1 189 GLN 189 686 686 GLN GLN A . n 
A 1 190 ARG 190 687 687 ARG ARG A . n 
A 1 191 ASP 191 688 688 ASP ASP A . n 
A 1 192 GLU 192 689 689 GLU GLU A . n 
A 1 193 ILE 193 690 690 ILE ILE A . n 
A 1 194 VAL 194 691 691 VAL VAL A . n 
A 1 195 SER 195 692 692 SER SER A . n 
A 1 196 TYR 196 693 693 TYR TYR A . n 
A 1 197 LEU 197 694 694 LEU LEU A . n 
A 1 198 CYS 198 695 695 CYS CYS A . n 
A 1 199 ASP 199 696 696 ASP ASP A . n 
A 1 200 LEU 200 697 697 LEU LEU A . n 
A 1 201 ALA 201 698 698 ALA ALA A . n 
A 1 202 PRO 202 699 699 PRO PRO A . n 
A 1 203 GLU 203 700 700 GLU GLU A . n 
A 1 204 ALA 204 701 701 ALA ALA A . n 
A 1 205 PRO 205 702 702 PRO PRO A . n 
A 1 206 PRO 206 703 703 PRO PRO A . n 
A 1 207 PRO 207 704 704 PRO PRO A . n 
A 1 208 THR 208 705 705 THR THR A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-14 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-09-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Non-polymer description'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
X-PLOR    'model building' 3.843 ? 3 
X-PLOR    refinement       3.843 ? 4 
X-PLOR    phasing          3.843 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A GLY 654 ? ? N  A PRO 655 ? ? CA A PRO 655 ? ? 128.66 119.30 9.36  1.50 Y 
2 1 CA A LEU 694 ? ? CB A LEU 694 ? ? CG A LEU 694 ? ? 132.76 115.30 17.46 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 499 ? ? -104.12 66.00   
2 1 PRO A 502 ? ? -58.91  170.93  
3 1 SER A 547 ? ? -176.43 147.76  
4 1 TRP A 550 ? ? -126.44 -104.88 
5 1 HIS A 559 ? ? -150.31 -113.86 
6 1 ILE A 609 ? ? -58.49  96.30   
7 1 GLN A 628 ? ? -39.72  -39.01  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 660 ? CG ? A LYS 163 CG 
2 1 Y 1 A LYS 660 ? CD ? A LYS 163 CD 
3 1 Y 1 A LYS 660 ? CE ? A LYS 163 CE 
4 1 Y 1 A LYS 660 ? NZ ? A LYS 163 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CADMIUM ION' CD  
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CD  1  400 400 CD  IUM A . 
C 3 HOH 1  2   2   HOH HOH A . 
C 3 HOH 2  3   3   HOH HOH A . 
C 3 HOH 3  4   4   HOH HOH A . 
C 3 HOH 4  5   5   HOH HOH A . 
C 3 HOH 5  6   6   HOH HOH A . 
C 3 HOH 6  7   7   HOH HOH A . 
C 3 HOH 7  8   8   HOH HOH A . 
C 3 HOH 8  9   9   HOH HOH A . 
C 3 HOH 9  10  10  HOH HOH A . 
C 3 HOH 10 11  11  HOH HOH A . 
C 3 HOH 11 12  12  HOH HOH A . 
C 3 HOH 12 13  13  HOH HOH A . 
C 3 HOH 13 14  14  HOH HOH A . 
C 3 HOH 14 15  15  HOH HOH A . 
C 3 HOH 15 16  16  HOH HOH A . 
C 3 HOH 16 17  17  HOH HOH A . 
C 3 HOH 17 18  18  HOH HOH A . 
C 3 HOH 18 19  19  HOH HOH A . 
C 3 HOH 19 20  20  HOH HOH A . 
C 3 HOH 20 21  21  HOH HOH A . 
C 3 HOH 21 22  22  HOH HOH A . 
C 3 HOH 22 23  23  HOH HOH A . 
C 3 HOH 23 24  24  HOH HOH A . 
C 3 HOH 24 25  25  HOH HOH A . 
C 3 HOH 25 26  26  HOH HOH A . 
C 3 HOH 26 27  27  HOH HOH A . 
C 3 HOH 27 28  28  HOH HOH A . 
C 3 HOH 28 29  29  HOH HOH A . 
C 3 HOH 29 30  30  HOH HOH A . 
C 3 HOH 30 31  31  HOH HOH A . 
C 3 HOH 31 32  32  HOH HOH A . 
C 3 HOH 32 33  33  HOH HOH A . 
C 3 HOH 33 34  34  HOH HOH A . 
C 3 HOH 34 35  35  HOH HOH A . 
C 3 HOH 35 36  36  HOH HOH A . 
C 3 HOH 36 37  37  HOH HOH A . 
C 3 HOH 37 38  38  HOH HOH A . 
C 3 HOH 38 39  39  HOH HOH A . 
C 3 HOH 39 40  40  HOH HOH A . 
C 3 HOH 40 41  41  HOH HOH A . 
C 3 HOH 41 42  42  HOH HOH A . 
C 3 HOH 42 43  43  HOH HOH A . 
C 3 HOH 43 44  44  HOH HOH A . 
C 3 HOH 44 45  45  HOH HOH A . 
C 3 HOH 45 46  46  HOH HOH A . 
C 3 HOH 46 47  47  HOH HOH A . 
C 3 HOH 47 48  48  HOH HOH A . 
C 3 HOH 48 49  49  HOH HOH A . 
C 3 HOH 49 50  50  HOH HOH A . 
C 3 HOH 50 51  51  HOH HOH A . 
C 3 HOH 51 52  52  HOH HOH A . 
C 3 HOH 52 53  53  HOH HOH A . 
C 3 HOH 53 54  54  HOH HOH A . 
C 3 HOH 54 55  55  HOH HOH A . 
C 3 HOH 55 56  56  HOH HOH A . 
C 3 HOH 56 57  57  HOH HOH A . 
C 3 HOH 57 58  58  HOH HOH A . 
C 3 HOH 58 59  59  HOH HOH A . 
C 3 HOH 59 60  60  HOH HOH A . 
C 3 HOH 60 61  61  HOH HOH A . 
C 3 HOH 61 62  62  HOH HOH A . 
C 3 HOH 62 63  63  HOH HOH A . 
C 3 HOH 63 64  64  HOH HOH A . 
C 3 HOH 64 65  65  HOH HOH A . 
C 3 HOH 65 66  66  HOH HOH A . 
C 3 HOH 66 67  67  HOH HOH A . 
C 3 HOH 67 68  68  HOH HOH A . 
C 3 HOH 68 69  69  HOH HOH A . 
C 3 HOH 69 70  70  HOH HOH A . 
C 3 HOH 70 72  72  HOH HOH A . 
C 3 HOH 71 73  73  HOH HOH A . 
C 3 HOH 72 74  74  HOH HOH A . 
C 3 HOH 73 75  75  HOH HOH A . 
C 3 HOH 74 76  76  HOH HOH A . 
C 3 HOH 75 77  77  HOH HOH A . 
C 3 HOH 76 78  78  HOH HOH A . 
C 3 HOH 77 79  79  HOH HOH A . 
C 3 HOH 78 80  80  HOH HOH A . 
C 3 HOH 79 81  81  HOH HOH A . 
C 3 HOH 80 82  82  HOH HOH A . 
C 3 HOH 81 83  83  HOH HOH A . 
C 3 HOH 82 84  84  HOH HOH A . 
C 3 HOH 83 85  85  HOH HOH A . 
C 3 HOH 84 86  86  HOH HOH A . 
C 3 HOH 85 87  87  HOH HOH A . 
C 3 HOH 86 88  88  HOH HOH A . 
C 3 HOH 87 89  89  HOH HOH A . 
C 3 HOH 88 90  90  HOH HOH A . 
C 3 HOH 89 91  91  HOH HOH A . 
C 3 HOH 90 92  92  HOH HOH A . 
C 3 HOH 91 93  93  HOH HOH A . 
#