data_1B0K
# 
_entry.id   1B0K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1B0K         
RCSB  RCSB008107   
WWPDB D_1000008107 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1B0K 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1AS9 
_pdbx_database_PDB_obs_spr.date             1999-11-18 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B0K 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-11 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lloyd, S.J.'  1 
'Lauble, H.'   2 
'Prasad, G.S.' 3 
'Stout, C.D.'  4 
# 
_citation.id                        primary 
_citation.title                     'The mechanism of aconitase: 1.8 A resolution crystal structure of the S642a:citrate complex.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            8 
_citation.page_first                2655 
_citation.page_last                 2662 
_citation.year                      1999 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10631981 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lloyd, S.J.'  1 
primary 'Lauble, H.'   2 
primary 'Prasad, G.S.' 3 
primary 'Stout, C.D.'  4 
# 
_cell.entry_id           1B0K 
_cell.length_a           187.800 
_cell.length_b           72.300 
_cell.length_c           74.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        77.60 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1B0K 
_symmetry.space_group_name_H-M             'B 1 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (ACONITASE)' 82661.945 1   4.2.1.3 S642A ? ? 
2 non-polymer syn 'CITRATE ANION'       189.100   1   ?       ?     ? ? 
3 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640   1   ?       ?     ? ? 
4 non-polymer syn 'OXYGEN ATOM'         15.999    1   ?       ?     ? ? 
5 water       nat water                 18.015    303 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CITRATE HYDRO-LYASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAML
QFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLL
IGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYH
GPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQVIEINLSELKPH
INGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIE
RDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFN
PETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKV
KGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYGEG
ASREHSALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNGT
QETILLNHTFNETQIEWFRAGSALNRMKELQQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAML
QFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLL
IGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYH
GPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQVIEINLSELKPH
INGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIE
RDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFN
PETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKV
KGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYGEG
ASREHSALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNGT
QETILLNHTFNETQIEWFRAGSALNRMKELQQK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   ALA n 
1 3   LYS n 
1 4   VAL n 
1 5   ALA n 
1 6   MET n 
1 7   SER n 
1 8   HIS n 
1 9   PHE n 
1 10  GLU n 
1 11  PRO n 
1 12  HIS n 
1 13  GLU n 
1 14  TYR n 
1 15  ILE n 
1 16  ARG n 
1 17  TYR n 
1 18  ASP n 
1 19  LEU n 
1 20  LEU n 
1 21  GLU n 
1 22  LYS n 
1 23  ASN n 
1 24  ILE n 
1 25  ASP n 
1 26  ILE n 
1 27  VAL n 
1 28  ARG n 
1 29  LYS n 
1 30  ARG n 
1 31  LEU n 
1 32  ASN n 
1 33  ARG n 
1 34  PRO n 
1 35  LEU n 
1 36  THR n 
1 37  LEU n 
1 38  SER n 
1 39  GLU n 
1 40  LYS n 
1 41  ILE n 
1 42  VAL n 
1 43  TYR n 
1 44  GLY n 
1 45  HIS n 
1 46  LEU n 
1 47  ASP n 
1 48  ASP n 
1 49  PRO n 
1 50  ALA n 
1 51  ASN n 
1 52  GLN n 
1 53  GLU n 
1 54  ILE n 
1 55  GLU n 
1 56  ARG n 
1 57  GLY n 
1 58  LYS n 
1 59  THR n 
1 60  TYR n 
1 61  LEU n 
1 62  ARG n 
1 63  LEU n 
1 64  ARG n 
1 65  PRO n 
1 66  ASP n 
1 67  ARG n 
1 68  VAL n 
1 69  ALA n 
1 70  MET n 
1 71  GLN n 
1 72  ASP n 
1 73  ALA n 
1 74  THR n 
1 75  ALA n 
1 76  GLN n 
1 77  MET n 
1 78  ALA n 
1 79  MET n 
1 80  LEU n 
1 81  GLN n 
1 82  PHE n 
1 83  ILE n 
1 84  SER n 
1 85  SER n 
1 86  GLY n 
1 87  LEU n 
1 88  PRO n 
1 89  LYS n 
1 90  VAL n 
1 91  ALA n 
1 92  VAL n 
1 93  PRO n 
1 94  SER n 
1 95  THR n 
1 96  ILE n 
1 97  HIS n 
1 98  CYS n 
1 99  ASP n 
1 100 HIS n 
1 101 LEU n 
1 102 ILE n 
1 103 GLU n 
1 104 ALA n 
1 105 GLN n 
1 106 LEU n 
1 107 GLY n 
1 108 GLY n 
1 109 GLU n 
1 110 LYS n 
1 111 ASP n 
1 112 LEU n 
1 113 ARG n 
1 114 ARG n 
1 115 ALA n 
1 116 LYS n 
1 117 ASP n 
1 118 ILE n 
1 119 ASN n 
1 120 GLN n 
1 121 GLU n 
1 122 VAL n 
1 123 TYR n 
1 124 ASN n 
1 125 PHE n 
1 126 LEU n 
1 127 ALA n 
1 128 THR n 
1 129 ALA n 
1 130 GLY n 
1 131 ALA n 
1 132 LYS n 
1 133 TYR n 
1 134 GLY n 
1 135 VAL n 
1 136 GLY n 
1 137 PHE n 
1 138 TRP n 
1 139 ARG n 
1 140 PRO n 
1 141 GLY n 
1 142 SER n 
1 143 GLY n 
1 144 ILE n 
1 145 ILE n 
1 146 HIS n 
1 147 GLN n 
1 148 ILE n 
1 149 ILE n 
1 150 LEU n 
1 151 GLU n 
1 152 ASN n 
1 153 TYR n 
1 154 ALA n 
1 155 TYR n 
1 156 PRO n 
1 157 GLY n 
1 158 VAL n 
1 159 LEU n 
1 160 LEU n 
1 161 ILE n 
1 162 GLY n 
1 163 THR n 
1 164 ASP n 
1 165 SER n 
1 166 HIS n 
1 167 THR n 
1 168 PRO n 
1 169 ASN n 
1 170 GLY n 
1 171 GLY n 
1 172 GLY n 
1 173 LEU n 
1 174 GLY n 
1 175 GLY n 
1 176 ILE n 
1 177 CYS n 
1 178 ILE n 
1 179 GLY n 
1 180 VAL n 
1 181 GLY n 
1 182 GLY n 
1 183 ALA n 
1 184 ASP n 
1 185 ALA n 
1 186 VAL n 
1 187 ASP n 
1 188 VAL n 
1 189 MET n 
1 190 ALA n 
1 191 GLY n 
1 192 ILE n 
1 193 PRO n 
1 194 TRP n 
1 195 GLU n 
1 196 LEU n 
1 197 LYS n 
1 198 CYS n 
1 199 PRO n 
1 200 LYS n 
1 201 VAL n 
1 202 ILE n 
1 203 GLY n 
1 204 VAL n 
1 205 LYS n 
1 206 LEU n 
1 207 THR n 
1 208 GLY n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 GLY n 
1 213 TRP n 
1 214 THR n 
1 215 SER n 
1 216 PRO n 
1 217 LYS n 
1 218 ASP n 
1 219 VAL n 
1 220 ILE n 
1 221 LEU n 
1 222 LYS n 
1 223 VAL n 
1 224 ALA n 
1 225 GLY n 
1 226 ILE n 
1 227 LEU n 
1 228 THR n 
1 229 VAL n 
1 230 LYS n 
1 231 GLY n 
1 232 GLY n 
1 233 THR n 
1 234 GLY n 
1 235 ALA n 
1 236 ILE n 
1 237 VAL n 
1 238 GLU n 
1 239 TYR n 
1 240 HIS n 
1 241 GLY n 
1 242 PRO n 
1 243 GLY n 
1 244 VAL n 
1 245 ASP n 
1 246 SER n 
1 247 ILE n 
1 248 SER n 
1 249 CYS n 
1 250 THR n 
1 251 GLY n 
1 252 MET n 
1 253 ALA n 
1 254 THR n 
1 255 ILE n 
1 256 CYS n 
1 257 ASN n 
1 258 MET n 
1 259 GLY n 
1 260 ALA n 
1 261 GLU n 
1 262 ILE n 
1 263 GLY n 
1 264 ALA n 
1 265 THR n 
1 266 THR n 
1 267 SER n 
1 268 VAL n 
1 269 PHE n 
1 270 PRO n 
1 271 TYR n 
1 272 ASN n 
1 273 HIS n 
1 274 ARG n 
1 275 MET n 
1 276 LYS n 
1 277 LYS n 
1 278 TYR n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 THR n 
1 283 GLY n 
1 284 ARG n 
1 285 ALA n 
1 286 ASP n 
1 287 ILE n 
1 288 ALA n 
1 289 ASN n 
1 290 LEU n 
1 291 ALA n 
1 292 ASP n 
1 293 GLU n 
1 294 PHE n 
1 295 LYS n 
1 296 ASP n 
1 297 HIS n 
1 298 LEU n 
1 299 VAL n 
1 300 PRO n 
1 301 ASP n 
1 302 PRO n 
1 303 GLY n 
1 304 CYS n 
1 305 HIS n 
1 306 TYR n 
1 307 ASP n 
1 308 GLN n 
1 309 VAL n 
1 310 ILE n 
1 311 GLU n 
1 312 ILE n 
1 313 ASN n 
1 314 LEU n 
1 315 SER n 
1 316 GLU n 
1 317 LEU n 
1 318 LYS n 
1 319 PRO n 
1 320 HIS n 
1 321 ILE n 
1 322 ASN n 
1 323 GLY n 
1 324 PRO n 
1 325 PHE n 
1 326 THR n 
1 327 PRO n 
1 328 ASP n 
1 329 LEU n 
1 330 ALA n 
1 331 HIS n 
1 332 PRO n 
1 333 VAL n 
1 334 ALA n 
1 335 GLU n 
1 336 VAL n 
1 337 GLY n 
1 338 SER n 
1 339 VAL n 
1 340 ALA n 
1 341 GLU n 
1 342 LYS n 
1 343 GLU n 
1 344 GLY n 
1 345 TRP n 
1 346 PRO n 
1 347 LEU n 
1 348 ASP n 
1 349 ILE n 
1 350 ARG n 
1 351 VAL n 
1 352 GLY n 
1 353 LEU n 
1 354 ILE n 
1 355 GLY n 
1 356 SER n 
1 357 CYS n 
1 358 THR n 
1 359 ASN n 
1 360 SER n 
1 361 SER n 
1 362 TYR n 
1 363 GLU n 
1 364 ASP n 
1 365 MET n 
1 366 GLY n 
1 367 ARG n 
1 368 SER n 
1 369 ALA n 
1 370 ALA n 
1 371 VAL n 
1 372 ALA n 
1 373 LYS n 
1 374 GLN n 
1 375 ALA n 
1 376 LEU n 
1 377 ALA n 
1 378 HIS n 
1 379 GLY n 
1 380 LEU n 
1 381 LYS n 
1 382 CYS n 
1 383 LYS n 
1 384 SER n 
1 385 GLN n 
1 386 PHE n 
1 387 THR n 
1 388 ILE n 
1 389 THR n 
1 390 PRO n 
1 391 GLY n 
1 392 SER n 
1 393 GLU n 
1 394 GLN n 
1 395 ILE n 
1 396 ARG n 
1 397 ALA n 
1 398 THR n 
1 399 ILE n 
1 400 GLU n 
1 401 ARG n 
1 402 ASP n 
1 403 GLY n 
1 404 TYR n 
1 405 ALA n 
1 406 GLN n 
1 407 VAL n 
1 408 LEU n 
1 409 ARG n 
1 410 ASP n 
1 411 VAL n 
1 412 GLY n 
1 413 GLY n 
1 414 ILE n 
1 415 VAL n 
1 416 LEU n 
1 417 ALA n 
1 418 ASN n 
1 419 ALA n 
1 420 CYS n 
1 421 GLY n 
1 422 PRO n 
1 423 CYS n 
1 424 ILE n 
1 425 GLY n 
1 426 GLN n 
1 427 TRP n 
1 428 ASP n 
1 429 ARG n 
1 430 LYS n 
1 431 ASP n 
1 432 ILE n 
1 433 LYS n 
1 434 LYS n 
1 435 GLY n 
1 436 GLU n 
1 437 LYS n 
1 438 ASN n 
1 439 THR n 
1 440 ILE n 
1 441 VAL n 
1 442 THR n 
1 443 SER n 
1 444 TYR n 
1 445 ASN n 
1 446 ARG n 
1 447 ASN n 
1 448 PHE n 
1 449 THR n 
1 450 GLY n 
1 451 ARG n 
1 452 ASN n 
1 453 ASP n 
1 454 ALA n 
1 455 ASN n 
1 456 PRO n 
1 457 GLU n 
1 458 THR n 
1 459 HIS n 
1 460 ALA n 
1 461 PHE n 
1 462 VAL n 
1 463 THR n 
1 464 SER n 
1 465 PRO n 
1 466 GLU n 
1 467 ILE n 
1 468 VAL n 
1 469 THR n 
1 470 ALA n 
1 471 LEU n 
1 472 ALA n 
1 473 ILE n 
1 474 ALA n 
1 475 GLY n 
1 476 THR n 
1 477 LEU n 
1 478 LYS n 
1 479 PHE n 
1 480 ASN n 
1 481 PRO n 
1 482 GLU n 
1 483 THR n 
1 484 ASP n 
1 485 PHE n 
1 486 LEU n 
1 487 THR n 
1 488 GLY n 
1 489 LYS n 
1 490 ASP n 
1 491 GLY n 
1 492 LYS n 
1 493 LYS n 
1 494 PHE n 
1 495 LYS n 
1 496 LEU n 
1 497 GLU n 
1 498 ALA n 
1 499 PRO n 
1 500 ASP n 
1 501 ALA n 
1 502 ASP n 
1 503 GLU n 
1 504 LEU n 
1 505 PRO n 
1 506 ARG n 
1 507 ALA n 
1 508 GLU n 
1 509 PHE n 
1 510 ASP n 
1 511 PRO n 
1 512 GLY n 
1 513 GLN n 
1 514 ASP n 
1 515 THR n 
1 516 TYR n 
1 517 GLN n 
1 518 HIS n 
1 519 PRO n 
1 520 PRO n 
1 521 LYS n 
1 522 ASP n 
1 523 SER n 
1 524 SER n 
1 525 GLY n 
1 526 GLN n 
1 527 ARG n 
1 528 VAL n 
1 529 ASP n 
1 530 VAL n 
1 531 SER n 
1 532 PRO n 
1 533 THR n 
1 534 SER n 
1 535 GLN n 
1 536 ARG n 
1 537 LEU n 
1 538 GLN n 
1 539 LEU n 
1 540 LEU n 
1 541 GLU n 
1 542 PRO n 
1 543 PHE n 
1 544 ASP n 
1 545 LYS n 
1 546 TRP n 
1 547 ASP n 
1 548 GLY n 
1 549 LYS n 
1 550 ASP n 
1 551 LEU n 
1 552 GLU n 
1 553 ASP n 
1 554 LEU n 
1 555 GLN n 
1 556 ILE n 
1 557 LEU n 
1 558 ILE n 
1 559 LYS n 
1 560 VAL n 
1 561 LYS n 
1 562 GLY n 
1 563 LYS n 
1 564 CYS n 
1 565 THR n 
1 566 THR n 
1 567 ASP n 
1 568 HIS n 
1 569 ILE n 
1 570 SER n 
1 571 ALA n 
1 572 ALA n 
1 573 GLY n 
1 574 PRO n 
1 575 TRP n 
1 576 LEU n 
1 577 LYS n 
1 578 PHE n 
1 579 ARG n 
1 580 GLY n 
1 581 HIS n 
1 582 LEU n 
1 583 ASP n 
1 584 ASN n 
1 585 ILE n 
1 586 SER n 
1 587 ASN n 
1 588 ASN n 
1 589 LEU n 
1 590 LEU n 
1 591 ILE n 
1 592 GLY n 
1 593 ALA n 
1 594 ILE n 
1 595 ASN n 
1 596 ILE n 
1 597 GLU n 
1 598 ASN n 
1 599 ARG n 
1 600 LYS n 
1 601 ALA n 
1 602 ASN n 
1 603 SER n 
1 604 VAL n 
1 605 ARG n 
1 606 ASN n 
1 607 ALA n 
1 608 VAL n 
1 609 THR n 
1 610 GLN n 
1 611 GLU n 
1 612 PHE n 
1 613 GLY n 
1 614 PRO n 
1 615 VAL n 
1 616 PRO n 
1 617 ASP n 
1 618 THR n 
1 619 ALA n 
1 620 ARG n 
1 621 TYR n 
1 622 TYR n 
1 623 LYS n 
1 624 GLN n 
1 625 HIS n 
1 626 GLY n 
1 627 ILE n 
1 628 ARG n 
1 629 TRP n 
1 630 VAL n 
1 631 VAL n 
1 632 ILE n 
1 633 GLY n 
1 634 ASP n 
1 635 GLU n 
1 636 ASN n 
1 637 TYR n 
1 638 GLY n 
1 639 GLU n 
1 640 GLY n 
1 641 ALA n 
1 642 SER n 
1 643 ARG n 
1 644 GLU n 
1 645 HIS n 
1 646 SER n 
1 647 ALA n 
1 648 LEU n 
1 649 GLU n 
1 650 PRO n 
1 651 ARG n 
1 652 HIS n 
1 653 LEU n 
1 654 GLY n 
1 655 GLY n 
1 656 ARG n 
1 657 ALA n 
1 658 ILE n 
1 659 ILE n 
1 660 THR n 
1 661 LYS n 
1 662 SER n 
1 663 PHE n 
1 664 ALA n 
1 665 ARG n 
1 666 ILE n 
1 667 HIS n 
1 668 GLU n 
1 669 THR n 
1 670 ASN n 
1 671 LEU n 
1 672 LYS n 
1 673 LYS n 
1 674 GLN n 
1 675 GLY n 
1 676 LEU n 
1 677 LEU n 
1 678 PRO n 
1 679 LEU n 
1 680 THR n 
1 681 PHE n 
1 682 ALA n 
1 683 ASP n 
1 684 PRO n 
1 685 ALA n 
1 686 ASP n 
1 687 TYR n 
1 688 ASN n 
1 689 LYS n 
1 690 ILE n 
1 691 HIS n 
1 692 PRO n 
1 693 VAL n 
1 694 ASP n 
1 695 LYS n 
1 696 LEU n 
1 697 THR n 
1 698 ILE n 
1 699 GLN n 
1 700 GLY n 
1 701 LEU n 
1 702 LYS n 
1 703 ASP n 
1 704 PHE n 
1 705 ALA n 
1 706 PRO n 
1 707 GLY n 
1 708 LYS n 
1 709 PRO n 
1 710 LEU n 
1 711 LYS n 
1 712 CYS n 
1 713 ILE n 
1 714 ILE n 
1 715 LYS n 
1 716 HIS n 
1 717 PRO n 
1 718 ASN n 
1 719 GLY n 
1 720 THR n 
1 721 GLN n 
1 722 GLU n 
1 723 THR n 
1 724 ILE n 
1 725 LEU n 
1 726 LEU n 
1 727 ASN n 
1 728 HIS n 
1 729 THR n 
1 730 PHE n 
1 731 ASN n 
1 732 GLU n 
1 733 THR n 
1 734 GLN n 
1 735 ILE n 
1 736 GLU n 
1 737 TRP n 
1 738 PHE n 
1 739 ARG n 
1 740 ALA n 
1 741 GLY n 
1 742 SER n 
1 743 ALA n 
1 744 LEU n 
1 745 ASN n 
1 746 ARG n 
1 747 MET n 
1 748 LYS n 
1 749 GLU n 
1 750 LEU n 
1 751 GLN n 
1 752 GLN n 
1 753 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               pig 
_entity_src_gen.gene_src_genus                     Sus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BL21 DE3' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sus scrofa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9823 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                HEART 
_entity_src_gen.pdbx_gene_src_organelle            MITOCHONDRIA 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PUC118 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACON_PIG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P16276 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1B0K 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 753 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16276 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  781 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       754 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1B0K ALA A 641 ? UNP P16276 SER 669 ENGINEERED 642 1 
1 1B0K SER A 646 ? UNP P16276 ARG 674 CONFLICT   647 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
FLC non-polymer         . 'CITRATE ANION'       ? 'C6 H5 O7 -3'    189.100 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
O   non-polymer         . 'OXYGEN ATOM'         ? O                15.999  
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4'         351.640 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1B0K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.97 
_exptl_crystal.density_percent_sol   57. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1B0K 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   30924 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.144 
_reflns.pdbx_netI_over_sigmaI        4.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.63 
_reflns_shell.percent_possible_all   86.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.411 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1B0K 
_refine.ls_number_reflns_obs                     30585 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    91.8 
_refine.ls_R_factor_obs                          0.172 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.172 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.3 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'BULK SOLVENT CORRECTION' 
_refine.pdbx_starting_model                      'PDB ENTRY 1FGH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5814 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             303 
_refine_hist.number_atoms_total               6139 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.018 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.40  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.0  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.33  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1B0K 
_struct.title                     'S642A:FLUOROCITRATE COMPLEX OF ACONITASE' 
_struct.pdbx_descriptor           ACONITASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B0K 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'TRICARBOXYLIC ACID CYCLE, IRON-SULFUR, MITOCHONDRION, TRANSIT PEPTIDE, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 17  ? LEU A 31  ? TYR A 18  LEU A 32  1 ? 15 
HELX_P HELX_P2  2  LEU A 37  ? HIS A 45  ? LEU A 38  HIS A 46  1 ? 9  
HELX_P HELX_P3  3  ASP A 72  ? SER A 85  ? ASP A 73  SER A 86  1 ? 14 
HELX_P HELX_P4  4  GLY A 108 ? ILE A 118 ? GLY A 109 ILE A 119 1 ? 11 
HELX_P HELX_P5  5  GLN A 120 ? TYR A 133 ? GLN A 121 TYR A 134 1 ? 14 
HELX_P HELX_P6  6  ILE A 145 ? ASN A 152 ? ILE A 146 ASN A 153 1 ? 8  
HELX_P HELX_P7  7  SER A 165 ? LEU A 173 ? SER A 166 LEU A 174 5 ? 9  
HELX_P HELX_P8  8  GLY A 182 ? MET A 189 ? GLY A 183 MET A 190 1 ? 8  
HELX_P HELX_P9  9  PRO A 216 ? LEU A 227 ? PRO A 217 LEU A 228 1 ? 12 
HELX_P HELX_P10 10 PRO A 242 ? SER A 246 ? PRO A 243 SER A 247 5 ? 5  
HELX_P HELX_P11 11 CYS A 249 ? ILE A 262 ? CYS A 250 ILE A 263 1 ? 14 
HELX_P HELX_P12 12 HIS A 273 ? THR A 282 ? HIS A 274 THR A 283 1 ? 10 
HELX_P HELX_P13 13 ALA A 285 ? ASP A 292 ? ALA A 286 ASP A 293 1 ? 8  
HELX_P HELX_P14 14 LYS A 295 ? HIS A 297 ? LYS A 296 HIS A 298 5 ? 3  
HELX_P HELX_P15 15 VAL A 336 ? GLU A 343 ? VAL A 337 GLU A 344 1 ? 8  
HELX_P HELX_P16 16 TYR A 362 ? HIS A 378 ? TYR A 363 HIS A 379 1 ? 17 
HELX_P HELX_P17 17 GLU A 393 ? ARG A 401 ? GLU A 394 ARG A 402 1 ? 9  
HELX_P HELX_P18 18 TYR A 404 ? ASP A 410 ? TYR A 405 ASP A 411 1 ? 7  
HELX_P HELX_P19 19 GLY A 421 ? ILE A 424 ? GLY A 422 ILE A 425 5 ? 4  
HELX_P HELX_P20 20 PRO A 465 ? ALA A 474 ? PRO A 466 ALA A 475 1 ? 10 
HELX_P HELX_P21 21 THR A 566 ? ILE A 569 ? THR A 567 ILE A 570 1 ? 4  
HELX_P HELX_P22 22 GLY A 573 ? PHE A 578 ? GLY A 574 PHE A 579 5 ? 6  
HELX_P HELX_P23 23 LEU A 582 ? ASN A 588 ? LEU A 583 ASN A 589 1 ? 7  
HELX_P HELX_P24 24 VAL A 615 ? GLN A 624 ? VAL A 616 GLN A 625 1 ? 10 
HELX_P HELX_P25 25 GLU A 644 ? HIS A 652 ? GLU A 645 HIS A 653 5 ? 9  
HELX_P HELX_P26 26 ARG A 665 ? LYS A 673 ? ARG A 666 LYS A 674 1 ? 9  
HELX_P HELX_P27 27 PRO A 684 ? LYS A 689 ? PRO A 685 LYS A 690 5 ? 6  
HELX_P HELX_P28 28 GLU A 732 ? ALA A 740 ? GLU A 733 ALA A 741 1 ? 9  
HELX_P HELX_P29 29 ALA A 743 ? LEU A 750 ? ALA A 744 LEU A 751 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C SF4 .   FE4 ? ? ? 1_555 D O   . O   ? ? A SF4 755 A O   1100 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc2 metalc ? ? C SF4 .   FE4 ? ? ? 1_555 B FLC . OB1 ? ? A SF4 755 A FLC 756  1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc3 metalc ? ? A CYS 357 SG  ? ? ? 1_555 C SF4 . FE1 ? ? A CYS 358 A SF4 755  1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc4 metalc ? ? A CYS 420 SG  ? ? ? 1_555 C SF4 . FE3 ? ? A CYS 421 A SF4 755  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc5 metalc ? ? A CYS 423 SG  ? ? ? 1_555 C SF4 . FE2 ? ? A CYS 424 A SF4 755  1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc6 metalc ? ? C SF4 .   FE4 ? ? ? 1_555 B FLC . OHB ? ? A SF4 755 A FLC 756  1_555 ? ? ? ? ? ? ? 2.580 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           323 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            324 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    324 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     325 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       20.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 4 ? 
D ? 2 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 60  ? LEU A 63  ? TYR A 61  LEU A 64  
A 2 TRP A 194 ? LYS A 197 ? TRP A 195 LYS A 198 
B 1 GLY A 136 ? TRP A 138 ? GLY A 137 TRP A 139 
B 2 SER A 94  ? HIS A 97  ? SER A 95  HIS A 98  
B 3 ARG A 67  ? GLN A 71  ? ARG A 68  GLN A 72  
B 4 LEU A 159 ? THR A 163 ? LEU A 160 THR A 164 
B 5 ILE A 176 ? GLY A 179 ? ILE A 177 GLY A 180 
C 1 GLN A 308 ? ASN A 313 ? GLN A 309 ASN A 314 
C 2 LYS A 200 ? THR A 207 ? LYS A 201 THR A 208 
C 3 ALA A 235 ? HIS A 240 ? ALA A 236 HIS A 241 
C 4 THR A 266 ? VAL A 268 ? THR A 267 VAL A 269 
D 1 HIS A 320 ? ASN A 322 ? HIS A 321 ASN A 323 
D 2 ALA A 330 ? PRO A 332 ? ALA A 331 PRO A 333 
E 1 GLY A 413 ? LEU A 416 ? GLY A 414 LEU A 417 
E 2 GLN A 385 ? THR A 389 ? GLN A 386 THR A 390 
E 3 ILE A 349 ? ILE A 354 ? ILE A 350 ILE A 355 
E 4 ASN A 438 ? THR A 442 ? ASN A 439 THR A 443 
E 5 THR A 458 ? VAL A 462 ? THR A 459 VAL A 463 
F 1 LEU A 677 ? THR A 680 ? LEU A 678 THR A 681 
F 2 GLY A 655 ? THR A 660 ? GLY A 656 THR A 661 
F 3 TRP A 629 ? GLY A 633 ? TRP A 630 GLY A 634 
F 4 GLN A 555 ? LYS A 559 ? GLN A 556 LYS A 560 
G 1 LYS A 695 ? GLN A 699 ? LYS A 696 GLN A 700 
G 2 LEU A 710 ? LYS A 715 ? LEU A 711 LYS A 716 
G 3 GLN A 721 ? LEU A 726 ? GLN A 722 LEU A 727 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 61  ? O LEU A 62  N LEU A 196 ? N LEU A 197 
B 1 2 O GLY A 136 ? O GLY A 137 N ILE A 96  ? N ILE A 97  
B 2 3 O THR A 95  ? O THR A 96  N VAL A 68  ? N VAL A 69  
B 3 4 O ARG A 67  ? O ARG A 68  N ILE A 161 ? N ILE A 162 
B 4 5 O LEU A 160 ? O LEU A 161 N ILE A 176 ? N ILE A 177 
C 1 2 O GLN A 308 ? O GLN A 309 N GLY A 203 ? N GLY A 204 
C 2 3 O LYS A 200 ? O LYS A 201 N ILE A 236 ? N ILE A 237 
C 3 4 O VAL A 237 ? O VAL A 238 N THR A 266 ? N THR A 267 
D 1 2 O ILE A 321 ? O ILE A 322 N HIS A 331 ? N HIS A 332 
E 1 2 O ILE A 414 ? O ILE A 415 N PHE A 386 ? N PHE A 387 
E 2 3 O GLN A 385 ? O GLN A 386 N GLY A 352 ? N GLY A 353 
E 3 4 O ARG A 350 ? O ARG A 351 N THR A 439 ? N THR A 440 
E 4 5 O ASN A 438 ? O ASN A 439 N HIS A 459 ? N HIS A 460 
F 1 2 O LEU A 677 ? O LEU A 678 N ILE A 658 ? N ILE A 659 
F 2 3 O ARG A 656 ? O ARG A 657 N TRP A 629 ? N TRP A 630 
F 3 4 O VAL A 630 ? O VAL A 631 N GLN A 555 ? N GLN A 556 
G 1 2 O LYS A 695 ? O LYS A 696 N LYS A 715 ? N LYS A 716 
G 2 3 O LEU A 710 ? O LEU A 711 N LEU A 726 ? N LEU A 727 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE FLC A 756' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE O A 1100'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SF4 A 755' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 GLN A 71  ? GLN A 72  . ? 1_555 ? 
2  AC1 10 HIS A 100 ? HIS A 101 . ? 1_555 ? 
3  AC1 10 ASP A 164 ? ASP A 165 . ? 1_555 ? 
4  AC1 10 SER A 165 ? SER A 166 . ? 1_555 ? 
5  AC1 10 ARG A 446 ? ARG A 447 . ? 1_555 ? 
6  AC1 10 ARG A 451 ? ARG A 452 . ? 1_555 ? 
7  AC1 10 ARG A 579 ? ARG A 580 . ? 1_555 ? 
8  AC1 10 ALA A 641 ? ALA A 642 . ? 1_555 ? 
9  AC1 10 SER A 642 ? SER A 643 . ? 1_555 ? 
10 AC1 10 ARG A 643 ? ARG A 644 . ? 1_555 ? 
11 AC2 2  ASP A 164 ? ASP A 165 . ? 1_555 ? 
12 AC2 2  HIS A 166 ? HIS A 167 . ? 1_555 ? 
13 AC3 7  HIS A 100 ? HIS A 101 . ? 1_555 ? 
14 AC3 7  HIS A 166 ? HIS A 167 . ? 1_555 ? 
15 AC3 7  CYS A 357 ? CYS A 358 . ? 1_555 ? 
16 AC3 7  CYS A 420 ? CYS A 421 . ? 1_555 ? 
17 AC3 7  CYS A 423 ? CYS A 424 . ? 1_555 ? 
18 AC3 7  ILE A 424 ? ILE A 425 . ? 1_555 ? 
19 AC3 7  ASN A 445 ? ASN A 446 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1B0K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1B0K 
_atom_sites.fract_transf_matrix[1][1]   0.005325 
_atom_sites.fract_transf_matrix[1][2]   -0.001171 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014162 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013495 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 1   ? 24.942 1.331  88.840  1.00 44.11 ? 2    ARG A N   1 
ATOM   2    C  CA  . ARG A 1 1   ? 24.109 1.232  87.652  1.00 44.34 ? 2    ARG A CA  1 
ATOM   3    C  C   . ARG A 1 1   ? 25.214 0.697  86.709  1.00 42.24 ? 2    ARG A C   1 
ATOM   4    O  O   . ARG A 1 1   ? 26.066 -0.139 87.064  1.00 41.24 ? 2    ARG A O   1 
ATOM   5    C  CB  . ARG A 1 1   ? 23.591 2.690  87.273  1.00 47.19 ? 2    ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 1   ? 22.141 2.983  86.791  1.00 51.02 ? 2    ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 1   ? 21.090 3.303  87.918  1.00 54.05 ? 2    ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 1   ? 19.671 3.232  87.473  1.00 57.69 ? 2    ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 1   ? 18.690 4.142  87.719  1.00 59.36 ? 2    ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 1   ? 18.890 5.236  88.474  1.00 60.29 ? 2    ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 1   ? 17.444 3.983  87.214  1.00 58.99 ? 2    ARG A NH2 1 
ATOM   12   N  N   . ALA A 1 2   ? 25.265 1.214  85.484  1.00 39.77 ? 3    ALA A N   1 
ATOM   13   C  CA  . ALA A 1 2   ? 26.340 0.905  84.573  1.00 37.08 ? 3    ALA A CA  1 
ATOM   14   C  C   . ALA A 1 2   ? 27.635 1.635  84.971  1.00 34.80 ? 3    ALA A C   1 
ATOM   15   O  O   . ALA A 1 2   ? 27.624 2.516  85.847  1.00 35.40 ? 3    ALA A O   1 
ATOM   16   C  CB  . ALA A 1 2   ? 25.902 1.340  83.179  1.00 37.31 ? 3    ALA A CB  1 
ATOM   17   N  N   . LYS A 1 3   ? 28.809 1.276  84.458  1.00 31.21 ? 4    LYS A N   1 
ATOM   18   C  CA  . LYS A 1 3   ? 29.978 2.096  84.612  1.00 28.19 ? 4    LYS A CA  1 
ATOM   19   C  C   . LYS A 1 3   ? 30.512 2.387  83.211  1.00 25.87 ? 4    LYS A C   1 
ATOM   20   O  O   . LYS A 1 3   ? 31.301 1.666  82.613  1.00 25.41 ? 4    LYS A O   1 
ATOM   21   C  CB  . LYS A 1 3   ? 30.900 1.328  85.504  1.00 29.50 ? 4    LYS A CB  1 
ATOM   22   C  CG  . LYS A 1 3   ? 30.384 1.498  86.934  1.00 32.73 ? 4    LYS A CG  1 
ATOM   23   C  CD  . LYS A 1 3   ? 30.997 0.498  87.882  1.00 36.72 ? 4    LYS A CD  1 
ATOM   24   C  CE  . LYS A 1 3   ? 32.549 0.510  88.077  1.00 40.71 ? 4    LYS A CE  1 
ATOM   25   N  NZ  . LYS A 1 3   ? 33.417 0.031  86.987  1.00 43.01 ? 4    LYS A NZ  1 
ATOM   26   N  N   . VAL A 1 4   ? 29.966 3.457  82.630  1.00 23.40 ? 5    VAL A N   1 
ATOM   27   C  CA  . VAL A 1 4   ? 30.356 3.947  81.316  1.00 21.79 ? 5    VAL A CA  1 
ATOM   28   C  C   . VAL A 1 4   ? 31.158 5.240  81.566  1.00 22.31 ? 5    VAL A C   1 
ATOM   29   O  O   . VAL A 1 4   ? 30.798 6.070  82.411  1.00 22.80 ? 5    VAL A O   1 
ATOM   30   C  CB  . VAL A 1 4   ? 29.119 4.246  80.474  1.00 20.41 ? 5    VAL A CB  1 
ATOM   31   C  CG1 . VAL A 1 4   ? 29.492 4.846  79.151  1.00 16.10 ? 5    VAL A CG1 1 
ATOM   32   C  CG2 . VAL A 1 4   ? 28.372 2.955  80.250  1.00 18.50 ? 5    VAL A CG2 1 
ATOM   33   N  N   . ALA A 1 5   ? 32.253 5.425  80.828  1.00 21.11 ? 6    ALA A N   1 
ATOM   34   C  CA  . ALA A 1 5   ? 33.187 6.481  81.108  1.00 20.24 ? 6    ALA A CA  1 
ATOM   35   C  C   . ALA A 1 5   ? 32.839 7.675  80.289  1.00 19.85 ? 6    ALA A C   1 
ATOM   36   O  O   . ALA A 1 5   ? 32.333 7.529  79.176  1.00 20.27 ? 6    ALA A O   1 
ATOM   37   C  CB  . ALA A 1 5   ? 34.555 6.031  80.730  1.00 19.96 ? 6    ALA A CB  1 
ATOM   38   N  N   . MET A 1 6   ? 33.168 8.845  80.824  1.00 20.21 ? 7    MET A N   1 
ATOM   39   C  CA  . MET A 1 6   ? 32.931 10.126 80.159  1.00 20.89 ? 7    MET A CA  1 
ATOM   40   C  C   . MET A 1 6   ? 33.689 10.346 78.865  1.00 20.98 ? 7    MET A C   1 
ATOM   41   O  O   . MET A 1 6   ? 33.172 11.005 77.964  1.00 22.89 ? 7    MET A O   1 
ATOM   42   C  CB  . MET A 1 6   ? 33.278 11.264 81.072  1.00 21.42 ? 7    MET A CB  1 
ATOM   43   C  CG  . MET A 1 6   ? 32.398 11.376 82.279  1.00 21.30 ? 7    MET A CG  1 
ATOM   44   S  SD  . MET A 1 6   ? 33.104 12.759 83.186  1.00 23.84 ? 7    MET A SD  1 
ATOM   45   C  CE  . MET A 1 6   ? 31.804 12.804 84.371  1.00 21.91 ? 7    MET A CE  1 
ATOM   46   N  N   . SER A 1 7   ? 34.934 9.907  78.767  1.00 20.96 ? 8    SER A N   1 
ATOM   47   C  CA  . SER A 1 7   ? 35.654 9.841  77.505  1.00 21.60 ? 8    SER A CA  1 
ATOM   48   C  C   . SER A 1 7   ? 36.651 8.677  77.513  1.00 23.19 ? 8    SER A C   1 
ATOM   49   O  O   . SER A 1 7   ? 36.770 7.888  78.473  1.00 22.88 ? 8    SER A O   1 
ATOM   50   C  CB  . SER A 1 7   ? 36.423 11.112 77.257  1.00 22.30 ? 8    SER A CB  1 
ATOM   51   O  OG  . SER A 1 7   ? 37.174 11.538 78.378  1.00 22.15 ? 8    SER A OG  1 
ATOM   52   N  N   . HIS A 1 8   ? 37.385 8.609  76.388  1.00 25.07 ? 9    HIS A N   1 
ATOM   53   C  CA  . HIS A 1 8   ? 38.482 7.677  76.194  1.00 26.13 ? 9    HIS A CA  1 
ATOM   54   C  C   . HIS A 1 8   ? 39.738 7.994  76.949  1.00 26.20 ? 9    HIS A C   1 
ATOM   55   O  O   . HIS A 1 8   ? 40.641 7.160  76.986  1.00 26.79 ? 9    HIS A O   1 
ATOM   56   C  CB  . HIS A 1 8   ? 38.902 7.601  74.773  1.00 28.97 ? 9    HIS A CB  1 
ATOM   57   C  CG  . HIS A 1 8   ? 37.834 7.028  73.870  1.00 33.33 ? 9    HIS A CG  1 
ATOM   58   N  ND1 . HIS A 1 8   ? 36.724 6.322  74.138  1.00 35.26 ? 9    HIS A ND1 1 
ATOM   59   C  CD2 . HIS A 1 8   ? 37.892 7.194  72.509  1.00 35.26 ? 9    HIS A CD2 1 
ATOM   60   C  CE1 . HIS A 1 8   ? 36.119 6.056  73.000  1.00 36.93 ? 9    HIS A CE1 1 
ATOM   61   N  NE2 . HIS A 1 8   ? 36.834 6.587  72.025  1.00 37.13 ? 9    HIS A NE2 1 
ATOM   62   N  N   . PHE A 1 9   ? 39.796 9.199  77.509  1.00 26.14 ? 10   PHE A N   1 
ATOM   63   C  CA  . PHE A 1 9   ? 40.950 9.672  78.237  1.00 26.63 ? 10   PHE A CA  1 
ATOM   64   C  C   . PHE A 1 9   ? 40.630 9.728  79.736  1.00 27.53 ? 10   PHE A C   1 
ATOM   65   O  O   . PHE A 1 9   ? 41.562 9.960  80.517  1.00 27.64 ? 10   PHE A O   1 
ATOM   66   C  CB  . PHE A 1 9   ? 41.352 11.082 77.763  1.00 25.87 ? 10   PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 9   ? 41.206 11.318 76.264  1.00 23.81 ? 10   PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 9   ? 42.184 10.894 75.364  1.00 22.50 ? 10   PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 9   ? 40.058 11.952 75.805  1.00 23.61 ? 10   PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 9   ? 42.007 11.107 74.004  1.00 21.72 ? 10   PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 9   ? 39.885 12.156 74.448  1.00 22.71 ? 10   PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 9   ? 40.860 11.735 73.553  1.00 22.18 ? 10   PHE A CZ  1 
ATOM   73   N  N   . GLU A 1 10  ? 39.357 9.530  80.179  1.00 27.20 ? 11   GLU A N   1 
ATOM   74   C  CA  . GLU A 1 10  ? 39.036 9.522  81.594  1.00 26.97 ? 11   GLU A CA  1 
ATOM   75   C  C   . GLU A 1 10  ? 38.217 8.269  81.885  1.00 27.97 ? 11   GLU A C   1 
ATOM   76   O  O   . GLU A 1 10  ? 37.001 8.332  82.136  1.00 27.98 ? 11   GLU A O   1 
ATOM   77   C  CB  . GLU A 1 10  ? 38.219 10.729 81.993  1.00 27.15 ? 11   GLU A CB  1 
ATOM   78   C  CG  . GLU A 1 10  ? 38.879 12.076 82.072  1.00 26.75 ? 11   GLU A CG  1 
ATOM   79   C  CD  . GLU A 1 10  ? 38.396 13.066 81.039  1.00 25.81 ? 11   GLU A CD  1 
ATOM   80   O  OE1 . GLU A 1 10  ? 37.260 12.940 80.605  1.00 26.52 ? 11   GLU A OE1 1 
ATOM   81   O  OE2 . GLU A 1 10  ? 39.162 13.960 80.693  1.00 25.11 ? 11   GLU A OE2 1 
ATOM   82   N  N   . PRO A 1 11  ? 38.869 7.085  81.876  1.00 28.41 ? 12   PRO A N   1 
ATOM   83   C  CA  . PRO A 1 11  ? 38.227 5.762  82.012  1.00 28.73 ? 12   PRO A CA  1 
ATOM   84   C  C   . PRO A 1 11  ? 37.632 5.333  83.346  1.00 28.67 ? 12   PRO A C   1 
ATOM   85   O  O   . PRO A 1 11  ? 36.883 4.366  83.449  1.00 28.97 ? 12   PRO A O   1 
ATOM   86   C  CB  . PRO A 1 11  ? 39.305 4.819  81.523  1.00 29.12 ? 12   PRO A CB  1 
ATOM   87   C  CG  . PRO A 1 11  ? 40.587 5.518  81.995  1.00 29.19 ? 12   PRO A CG  1 
ATOM   88   C  CD  . PRO A 1 11  ? 40.317 6.952  81.659  1.00 28.45 ? 12   PRO A CD  1 
ATOM   89   N  N   . HIS A 1 12  ? 37.857 6.240  84.284  1.00 29.25 ? 13   HIS A N   1 
ATOM   90   C  CA  . HIS A 1 12  ? 37.554 6.138  85.696  1.00 29.57 ? 13   HIS A CA  1 
ATOM   91   C  C   . HIS A 1 12  ? 36.522 7.172  86.150  1.00 27.69 ? 13   HIS A C   1 
ATOM   92   O  O   . HIS A 1 12  ? 36.174 7.196  87.334  1.00 26.38 ? 13   HIS A O   1 
ATOM   93   C  CB  . HIS A 1 12  ? 38.869 6.342  86.467  1.00 35.25 ? 13   HIS A CB  1 
ATOM   94   C  CG  . HIS A 1 12  ? 39.551 7.692  86.108  1.00 40.02 ? 13   HIS A CG  1 
ATOM   95   N  ND1 . HIS A 1 12  ? 39.337 8.945  86.576  1.00 41.37 ? 13   HIS A ND1 1 
ATOM   96   C  CD2 . HIS A 1 12  ? 40.497 7.798  85.109  1.00 40.82 ? 13   HIS A CD2 1 
ATOM   97   C  CE1 . HIS A 1 12  ? 40.094 9.777  85.894  1.00 41.98 ? 13   HIS A CE1 1 
ATOM   98   N  NE2 . HIS A 1 12  ? 40.779 9.074  85.021  1.00 42.21 ? 13   HIS A NE2 1 
ATOM   99   N  N   . GLU A 1 13  ? 36.038 8.041  85.232  1.00 25.56 ? 14   GLU A N   1 
ATOM   100  C  CA  . GLU A 1 13  ? 35.085 9.114  85.523  1.00 22.80 ? 14   GLU A CA  1 
ATOM   101  C  C   . GLU A 1 13  ? 33.813 8.688  84.864  1.00 20.82 ? 14   GLU A C   1 
ATOM   102  O  O   . GLU A 1 13  ? 33.709 8.659  83.635  1.00 20.71 ? 14   GLU A O   1 
ATOM   103  C  CB  . GLU A 1 13  ? 35.451 10.408 84.883  1.00 24.61 ? 14   GLU A CB  1 
ATOM   104  C  CG  . GLU A 1 13  ? 36.770 11.024 85.310  1.00 27.94 ? 14   GLU A CG  1 
ATOM   105  C  CD  . GLU A 1 13  ? 36.813 11.487 86.770  1.00 29.42 ? 14   GLU A CD  1 
ATOM   106  O  OE1 . GLU A 1 13  ? 35.776 11.873 87.329  1.00 30.22 ? 14   GLU A OE1 1 
ATOM   107  O  OE2 . GLU A 1 13  ? 37.909 11.472 87.342  1.00 31.91 ? 14   GLU A OE2 1 
ATOM   108  N  N   . TYR A 1 14  ? 32.805 8.363  85.636  1.00 19.17 ? 15   TYR A N   1 
ATOM   109  C  CA  . TYR A 1 14  ? 31.620 7.855  84.995  1.00 16.89 ? 15   TYR A CA  1 
ATOM   110  C  C   . TYR A 1 14  ? 30.533 8.895  84.880  1.00 16.27 ? 15   TYR A C   1 
ATOM   111  O  O   . TYR A 1 14  ? 30.430 9.836  85.662  1.00 15.04 ? 15   TYR A O   1 
ATOM   112  C  CB  . TYR A 1 14  ? 31.113 6.662  85.776  1.00 16.33 ? 15   TYR A CB  1 
ATOM   113  C  CG  . TYR A 1 14  ? 32.134 5.550  85.853  1.00 16.45 ? 15   TYR A CG  1 
ATOM   114  C  CD1 . TYR A 1 14  ? 32.690 4.958  84.716  1.00 16.20 ? 15   TYR A CD1 1 
ATOM   115  C  CD2 . TYR A 1 14  ? 32.573 5.162  87.125  1.00 18.55 ? 15   TYR A CD2 1 
ATOM   116  C  CE1 . TYR A 1 14  ? 33.688 3.987  84.842  1.00 17.15 ? 15   TYR A CE1 1 
ATOM   117  C  CE2 . TYR A 1 14  ? 33.583 4.186  87.279  1.00 18.83 ? 15   TYR A CE2 1 
ATOM   118  C  CZ  . TYR A 1 14  ? 34.143 3.601  86.119  1.00 19.49 ? 15   TYR A CZ  1 
ATOM   119  O  OH  . TYR A 1 14  ? 35.180 2.665  86.234  1.00 19.78 ? 15   TYR A OH  1 
ATOM   120  N  N   . ILE A 1 15  ? 29.725 8.658  83.834  1.00 16.86 ? 16   ILE A N   1 
ATOM   121  C  CA  . ILE A 1 15  ? 28.451 9.351  83.574  1.00 15.78 ? 16   ILE A CA  1 
ATOM   122  C  C   . ILE A 1 15  ? 27.432 8.971  84.679  1.00 16.90 ? 16   ILE A C   1 
ATOM   123  O  O   . ILE A 1 15  ? 27.216 7.801  85.008  1.00 16.69 ? 16   ILE A O   1 
ATOM   124  C  CB  . ILE A 1 15  ? 27.942 8.921  82.173  1.00 14.16 ? 16   ILE A CB  1 
ATOM   125  C  CG1 . ILE A 1 15  ? 28.938 9.413  81.076  1.00 11.95 ? 16   ILE A CG1 1 
ATOM   126  C  CG2 . ILE A 1 15  ? 26.455 9.375  82.044  1.00 13.72 ? 16   ILE A CG2 1 
ATOM   127  C  CD1 . ILE A 1 15  ? 28.563 9.041  79.634  1.00 7.70  ? 16   ILE A CD1 1 
ATOM   128  N  N   . ARG A 1 16  ? 26.725 9.956  85.218  1.00 17.57 ? 17   ARG A N   1 
ATOM   129  C  CA  . ARG A 1 16  ? 25.870 9.733  86.340  1.00 18.19 ? 17   ARG A CA  1 
ATOM   130  C  C   . ARG A 1 16  ? 24.468 10.092 85.962  1.00 18.18 ? 17   ARG A C   1 
ATOM   131  O  O   . ARG A 1 16  ? 23.927 11.056 86.497  1.00 17.97 ? 17   ARG A O   1 
ATOM   132  C  CB  . ARG A 1 16  ? 26.319 10.592 87.524  1.00 20.74 ? 17   ARG A CB  1 
ATOM   133  C  CG  . ARG A 1 16  ? 27.737 10.470 88.098  1.00 24.29 ? 17   ARG A CG  1 
ATOM   134  C  CD  . ARG A 1 16  ? 28.085 9.058  88.573  1.00 27.73 ? 17   ARG A CD  1 
ATOM   135  N  NE  . ARG A 1 16  ? 27.042 8.482  89.423  1.00 31.44 ? 17   ARG A NE  1 
ATOM   136  C  CZ  . ARG A 1 16  ? 27.011 8.580  90.770  1.00 33.38 ? 17   ARG A CZ  1 
ATOM   137  N  NH1 . ARG A 1 16  ? 27.929 9.286  91.442  1.00 31.97 ? 17   ARG A NH1 1 
ATOM   138  N  NH2 . ARG A 1 16  ? 25.992 7.975  91.406  1.00 32.29 ? 17   ARG A NH2 1 
ATOM   139  N  N   . TYR A 1 17  ? 23.878 9.313  85.050  1.00 19.14 ? 18   TYR A N   1 
ATOM   140  C  CA  . TYR A 1 17  ? 22.473 9.457  84.654  1.00 19.71 ? 18   TYR A CA  1 
ATOM   141  C  C   . TYR A 1 17  ? 21.589 8.993  85.793  1.00 20.89 ? 18   TYR A C   1 
ATOM   142  O  O   . TYR A 1 17  ? 20.435 9.384  85.864  1.00 21.13 ? 18   TYR A O   1 
ATOM   143  C  CB  . TYR A 1 17  ? 22.118 8.618  83.394  1.00 18.26 ? 18   TYR A CB  1 
ATOM   144  C  CG  . TYR A 1 17  ? 22.619 9.144  82.052  1.00 15.98 ? 18   TYR A CG  1 
ATOM   145  C  CD1 . TYR A 1 17  ? 22.928 10.495 81.861  1.00 16.31 ? 18   TYR A CD1 1 
ATOM   146  C  CD2 . TYR A 1 17  ? 22.739 8.258  80.986  1.00 17.06 ? 18   TYR A CD2 1 
ATOM   147  C  CE1 . TYR A 1 17  ? 23.340 10.957 80.603  1.00 16.46 ? 18   TYR A CE1 1 
ATOM   148  C  CE2 . TYR A 1 17  ? 23.153 8.699  79.727  1.00 16.62 ? 18   TYR A CE2 1 
ATOM   149  C  CZ  . TYR A 1 17  ? 23.446 10.046 79.554  1.00 16.71 ? 18   TYR A CZ  1 
ATOM   150  O  OH  . TYR A 1 17  ? 23.842 10.511 78.335  1.00 16.71 ? 18   TYR A OH  1 
ATOM   151  N  N   . ASP A 1 18  ? 22.121 8.211  86.729  1.00 22.67 ? 19   ASP A N   1 
ATOM   152  C  CA  . ASP A 1 18  ? 21.381 7.834  87.921  1.00 23.98 ? 19   ASP A CA  1 
ATOM   153  C  C   . ASP A 1 18  ? 21.152 8.982  88.881  1.00 23.06 ? 19   ASP A C   1 
ATOM   154  O  O   . ASP A 1 18  ? 20.111 9.089  89.509  1.00 23.58 ? 19   ASP A O   1 
ATOM   155  C  CB  . ASP A 1 18  ? 22.130 6.708  88.615  1.00 26.48 ? 19   ASP A CB  1 
ATOM   156  C  CG  . ASP A 1 18  ? 23.445 7.109  89.251  1.00 28.88 ? 19   ASP A CG  1 
ATOM   157  O  OD1 . ASP A 1 18  ? 24.304 7.641  88.544  1.00 30.68 ? 19   ASP A OD1 1 
ATOM   158  O  OD2 . ASP A 1 18  ? 23.571 6.893  90.461  1.00 30.22 ? 19   ASP A OD2 1 
ATOM   159  N  N   . LEU A 1 19  ? 22.129 9.862  88.994  1.00 23.78 ? 20   LEU A N   1 
ATOM   160  C  CA  . LEU A 1 19  ? 22.030 11.076 89.800  1.00 24.52 ? 20   LEU A CA  1 
ATOM   161  C  C   . LEU A 1 19  ? 21.190 12.168 89.123  1.00 24.74 ? 20   LEU A C   1 
ATOM   162  O  O   . LEU A 1 19  ? 20.480 12.902 89.815  1.00 23.35 ? 20   LEU A O   1 
ATOM   163  C  CB  . LEU A 1 19  ? 23.416 11.607 90.047  1.00 27.01 ? 20   LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 19  ? 23.788 11.821 91.484  1.00 29.37 ? 20   LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 19  ? 22.870 12.849 92.114  1.00 31.25 ? 20   LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 19  ? 23.614 10.512 92.237  1.00 31.25 ? 20   LEU A CD2 1 
ATOM   167  N  N   . LEU A 1 20  ? 21.299 12.318 87.789  1.00 24.72 ? 21   LEU A N   1 
ATOM   168  C  CA  . LEU A 1 20  ? 20.415 13.171 87.005  1.00 26.92 ? 21   LEU A CA  1 
ATOM   169  C  C   . LEU A 1 20  ? 18.933 12.801 87.259  1.00 27.76 ? 21   LEU A C   1 
ATOM   170  O  O   . LEU A 1 20  ? 18.132 13.678 87.558  1.00 27.70 ? 21   LEU A O   1 
ATOM   171  C  CB  . LEU A 1 20  ? 20.741 13.007 85.507  1.00 26.51 ? 21   LEU A CB  1 
ATOM   172  C  CG  . LEU A 1 20  ? 19.882 13.789 84.534  1.00 27.26 ? 21   LEU A CG  1 
ATOM   173  C  CD1 . LEU A 1 20  ? 20.253 15.238 84.686  1.00 26.58 ? 21   LEU A CD1 1 
ATOM   174  C  CD2 . LEU A 1 20  ? 20.118 13.401 83.097  1.00 27.02 ? 21   LEU A CD2 1 
ATOM   175  N  N   . GLU A 1 21  ? 18.580 11.502 87.151  1.00 28.32 ? 22   GLU A N   1 
ATOM   176  C  CA  . GLU A 1 21  ? 17.247 10.979 87.400  1.00 28.41 ? 22   GLU A CA  1 
ATOM   177  C  C   . GLU A 1 21  ? 16.759 11.295 88.811  1.00 27.32 ? 22   GLU A C   1 
ATOM   178  O  O   . GLU A 1 21  ? 15.692 11.886 88.947  1.00 26.01 ? 22   GLU A O   1 
ATOM   179  C  CB  . GLU A 1 21  ? 17.283 9.465  87.149  1.00 29.97 ? 22   GLU A CB  1 
ATOM   180  C  CG  . GLU A 1 21  ? 15.926 8.777  87.264  1.00 32.50 ? 22   GLU A CG  1 
ATOM   181  C  CD  . GLU A 1 21  ? 15.919 7.266  87.062  1.00 34.33 ? 22   GLU A CD  1 
ATOM   182  O  OE1 . GLU A 1 21  ? 16.279 6.557  88.002  1.00 35.27 ? 22   GLU A OE1 1 
ATOM   183  O  OE2 . GLU A 1 21  ? 15.535 6.802  85.984  1.00 34.63 ? 22   GLU A OE2 1 
ATOM   184  N  N   . LYS A 1 22  ? 17.555 10.953 89.845  1.00 26.78 ? 23   LYS A N   1 
ATOM   185  C  CA  . LYS A 1 22  ? 17.234 11.192 91.245  1.00 26.02 ? 23   LYS A CA  1 
ATOM   186  C  C   . LYS A 1 22  ? 16.751 12.599 91.586  1.00 24.90 ? 23   LYS A C   1 
ATOM   187  O  O   . LYS A 1 22  ? 15.755 12.801 92.283  1.00 24.38 ? 23   LYS A O   1 
ATOM   188  C  CB  . LYS A 1 22  ? 18.472 10.854 92.100  1.00 28.27 ? 23   LYS A CB  1 
ATOM   189  C  CG  . LYS A 1 22  ? 18.145 11.051 93.587  1.00 31.99 ? 23   LYS A CG  1 
ATOM   190  C  CD  . LYS A 1 22  ? 19.302 11.126 94.582  1.00 35.67 ? 23   LYS A CD  1 
ATOM   191  C  CE  . LYS A 1 22  ? 18.983 12.073 95.791  1.00 37.40 ? 23   LYS A CE  1 
ATOM   192  N  NZ  . LYS A 1 22  ? 19.116 13.507 95.481  1.00 40.96 ? 23   LYS A NZ  1 
ATOM   193  N  N   . ASN A 1 23  ? 17.471 13.569 91.007  1.00 24.27 ? 24   ASN A N   1 
ATOM   194  C  CA  . ASN A 1 23  ? 17.267 14.999 91.209  1.00 22.15 ? 24   ASN A CA  1 
ATOM   195  C  C   . ASN A 1 23  ? 16.153 15.557 90.365  1.00 21.26 ? 24   ASN A C   1 
ATOM   196  O  O   . ASN A 1 23  ? 15.441 16.402 90.864  1.00 20.70 ? 24   ASN A O   1 
ATOM   197  C  CB  . ASN A 1 23  ? 18.536 15.797 90.892  1.00 20.84 ? 24   ASN A CB  1 
ATOM   198  C  CG  . ASN A 1 23  ? 19.637 15.604 91.906  1.00 19.26 ? 24   ASN A CG  1 
ATOM   199  O  OD1 . ASN A 1 23  ? 19.401 15.178 93.035  1.00 19.24 ? 24   ASN A OD1 1 
ATOM   200  N  ND2 . ASN A 1 23  ? 20.884 15.846 91.512  1.00 17.95 ? 24   ASN A ND2 1 
ATOM   201  N  N   . ILE A 1 24  ? 16.006 15.159 89.106  1.00 21.05 ? 25   ILE A N   1 
ATOM   202  C  CA  . ILE A 1 24  ? 14.893 15.530 88.239  1.00 22.15 ? 25   ILE A CA  1 
ATOM   203  C  C   . ILE A 1 24  ? 13.626 15.228 89.022  1.00 24.41 ? 25   ILE A C   1 
ATOM   204  O  O   . ILE A 1 24  ? 12.702 16.047 89.105  1.00 24.42 ? 25   ILE A O   1 
ATOM   205  C  CB  . ILE A 1 24  ? 14.982 14.676 86.927  1.00 21.21 ? 25   ILE A CB  1 
ATOM   206  C  CG1 . ILE A 1 24  ? 15.851 15.451 85.948  1.00 17.56 ? 25   ILE A CG1 1 
ATOM   207  C  CG2 . ILE A 1 24  ? 13.613 14.360 86.302  1.00 20.20 ? 25   ILE A CG2 1 
ATOM   208  C  CD1 . ILE A 1 24  ? 16.272 14.500 84.863  1.00 13.78 ? 25   ILE A CD1 1 
ATOM   209  N  N   . ASP A 1 25  ? 13.673 14.047 89.643  1.00 26.07 ? 26   ASP A N   1 
ATOM   210  C  CA  . ASP A 1 25  ? 12.522 13.575 90.366  1.00 28.75 ? 26   ASP A CA  1 
ATOM   211  C  C   . ASP A 1 25  ? 12.156 14.373 91.607  1.00 27.39 ? 26   ASP A C   1 
ATOM   212  O  O   . ASP A 1 25  ? 11.028 14.832 91.721  1.00 27.43 ? 26   ASP A O   1 
ATOM   213  C  CB  . ASP A 1 25  ? 12.825 12.126 90.641  1.00 32.84 ? 26   ASP A CB  1 
ATOM   214  C  CG  . ASP A 1 25  ? 11.603 11.397 91.127  1.00 36.51 ? 26   ASP A CG  1 
ATOM   215  O  OD1 . ASP A 1 25  ? 10.704 11.140 90.296  1.00 38.28 ? 26   ASP A OD1 1 
ATOM   216  O  OD2 . ASP A 1 25  ? 11.597 11.160 92.347  1.00 39.25 ? 26   ASP A OD2 1 
ATOM   217  N  N   . ILE A 1 26  ? 13.082 14.526 92.544  1.00 26.53 ? 27   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 26  ? 12.920 15.428 93.675  1.00 25.86 ? 27   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 26  ? 12.328 16.799 93.294  1.00 26.38 ? 27   ILE A C   1 
ATOM   220  O  O   . ILE A 1 26  ? 11.517 17.379 94.014  1.00 27.16 ? 27   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 26  ? 14.291 15.627 94.326  1.00 24.34 ? 27   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 26  ? 14.778 14.340 94.929  1.00 23.65 ? 27   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 26  ? 14.180 16.691 95.430  1.00 25.53 ? 27   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 26  ? 16.014 14.590 95.853  1.00 20.26 ? 27   ILE A CD1 1 
ATOM   225  N  N   . VAL A 1 27  ? 12.749 17.327 92.147  1.00 26.56 ? 28   VAL A N   1 
ATOM   226  C  CA  . VAL A 1 27  ? 12.326 18.631 91.689  1.00 26.35 ? 28   VAL A CA  1 
ATOM   227  C  C   . VAL A 1 27  ? 10.918 18.599 91.088  1.00 26.87 ? 28   VAL A C   1 
ATOM   228  O  O   . VAL A 1 27  ? 10.125 19.448 91.475  1.00 26.02 ? 28   VAL A O   1 
ATOM   229  C  CB  . VAL A 1 27  ? 13.457 19.136 90.697  1.00 25.49 ? 28   VAL A CB  1 
ATOM   230  C  CG1 . VAL A 1 27  ? 12.950 20.242 89.803  1.00 25.86 ? 28   VAL A CG1 1 
ATOM   231  C  CG2 . VAL A 1 27  ? 14.640 19.730 91.483  1.00 22.53 ? 28   VAL A CG2 1 
ATOM   232  N  N   . ARG A 1 28  ? 10.531 17.688 90.186  1.00 27.85 ? 29   ARG A N   1 
ATOM   233  C  CA  . ARG A 1 28  ? 9.172  17.699 89.647  1.00 28.96 ? 29   ARG A CA  1 
ATOM   234  C  C   . ARG A 1 28  ? 8.077  17.414 90.678  1.00 29.13 ? 29   ARG A C   1 
ATOM   235  O  O   . ARG A 1 28  ? 6.921  17.712 90.404  1.00 30.00 ? 29   ARG A O   1 
ATOM   236  C  CB  . ARG A 1 28  ? 9.039  16.709 88.471  1.00 28.95 ? 29   ARG A CB  1 
ATOM   237  C  CG  . ARG A 1 28  ? 9.371  15.277 88.795  1.00 29.81 ? 29   ARG A CG  1 
ATOM   238  C  CD  . ARG A 1 28  ? 8.798  14.282 87.779  1.00 30.34 ? 29   ARG A CD  1 
ATOM   239  N  NE  . ARG A 1 28  ? 9.459  14.065 86.484  1.00 28.64 ? 29   ARG A NE  1 
ATOM   240  C  CZ  . ARG A 1 28  ? 9.133  14.751 85.396  1.00 28.26 ? 29   ARG A CZ  1 
ATOM   241  N  NH1 . ARG A 1 28  ? 8.387  15.856 85.482  1.00 26.99 ? 29   ARG A NH1 1 
ATOM   242  N  NH2 . ARG A 1 28  ? 9.617  14.352 84.223  1.00 25.64 ? 29   ARG A NH2 1 
ATOM   243  N  N   . LYS A 1 29  ? 8.391  16.882 91.859  1.00 29.80 ? 30   LYS A N   1 
ATOM   244  C  CA  . LYS A 1 29  ? 7.467  16.760 92.983  1.00 30.63 ? 30   LYS A CA  1 
ATOM   245  C  C   . LYS A 1 29  ? 7.224  18.101 93.706  1.00 30.49 ? 30   LYS A C   1 
ATOM   246  O  O   . LYS A 1 29  ? 6.161  18.411 94.270  1.00 31.10 ? 30   LYS A O   1 
ATOM   247  C  CB  . LYS A 1 29  ? 7.990  15.766 94.046  1.00 33.02 ? 30   LYS A CB  1 
ATOM   248  C  CG  . LYS A 1 29  ? 7.444  14.342 94.065  1.00 36.50 ? 30   LYS A CG  1 
ATOM   249  C  CD  . LYS A 1 29  ? 8.178  13.422 93.096  1.00 39.52 ? 30   LYS A CD  1 
ATOM   250  C  CE  . LYS A 1 29  ? 7.931  11.938 93.456  1.00 41.01 ? 30   LYS A CE  1 
ATOM   251  N  NZ  . LYS A 1 29  ? 8.966  11.140 92.819  1.00 41.54 ? 30   LYS A NZ  1 
ATOM   252  N  N   . ARG A 1 30  ? 8.240  18.944 93.744  1.00 29.44 ? 31   ARG A N   1 
ATOM   253  C  CA  . ARG A 1 30  ? 8.062  20.238 94.333  1.00 28.32 ? 31   ARG A CA  1 
ATOM   254  C  C   . ARG A 1 30  ? 7.272  21.083 93.358  1.00 27.47 ? 31   ARG A C   1 
ATOM   255  O  O   . ARG A 1 30  ? 6.354  21.758 93.794  1.00 28.09 ? 31   ARG A O   1 
ATOM   256  C  CB  . ARG A 1 30  ? 9.389  20.873 94.588  1.00 29.07 ? 31   ARG A CB  1 
ATOM   257  C  CG  . ARG A 1 30  ? 10.285 20.051 95.485  1.00 29.58 ? 31   ARG A CG  1 
ATOM   258  C  CD  . ARG A 1 30  ? 11.621 20.740 95.581  1.00 30.68 ? 31   ARG A CD  1 
ATOM   259  N  NE  . ARG A 1 30  ? 11.473 22.109 96.077  1.00 32.20 ? 31   ARG A NE  1 
ATOM   260  C  CZ  . ARG A 1 30  ? 12.269 23.130 95.712  1.00 32.49 ? 31   ARG A CZ  1 
ATOM   261  N  NH1 . ARG A 1 30  ? 13.411 22.970 95.048  1.00 32.84 ? 31   ARG A NH1 1 
ATOM   262  N  NH2 . ARG A 1 30  ? 11.992 24.338 96.164  1.00 33.47 ? 31   ARG A NH2 1 
ATOM   263  N  N   . LEU A 1 31  ? 7.560  21.030 92.055  1.00 26.78 ? 32   LEU A N   1 
ATOM   264  C  CA  . LEU A 1 31  ? 6.940  21.897 91.068  1.00 25.93 ? 32   LEU A CA  1 
ATOM   265  C  C   . LEU A 1 31  ? 5.634  21.433 90.440  1.00 26.20 ? 32   LEU A C   1 
ATOM   266  O  O   . LEU A 1 31  ? 4.875  22.255 89.920  1.00 26.24 ? 32   LEU A O   1 
ATOM   267  C  CB  . LEU A 1 31  ? 7.914  22.177 89.933  1.00 25.27 ? 32   LEU A CB  1 
ATOM   268  C  CG  . LEU A 1 31  ? 9.326  22.659 90.252  1.00 25.49 ? 32   LEU A CG  1 
ATOM   269  C  CD1 . LEU A 1 31  ? 10.123 22.818 88.982  1.00 26.39 ? 32   LEU A CD1 1 
ATOM   270  C  CD2 . LEU A 1 31  ? 9.250  23.959 90.985  1.00 25.94 ? 32   LEU A CD2 1 
ATOM   271  N  N   . ASN A 1 32  ? 5.320  20.143 90.402  1.00 26.01 ? 33   ASN A N   1 
ATOM   272  C  CA  . ASN A 1 32  ? 4.069  19.649 89.837  1.00 25.80 ? 33   ASN A CA  1 
ATOM   273  C  C   . ASN A 1 32  ? 3.693  20.197 88.477  1.00 24.58 ? 33   ASN A C   1 
ATOM   274  O  O   . ASN A 1 32  ? 2.635  20.783 88.310  1.00 24.14 ? 33   ASN A O   1 
ATOM   275  C  CB  . ASN A 1 32  ? 2.942  19.928 90.837  1.00 27.37 ? 33   ASN A CB  1 
ATOM   276  C  CG  . ASN A 1 32  ? 3.052  18.905 91.935  1.00 30.15 ? 33   ASN A CG  1 
ATOM   277  O  OD1 . ASN A 1 32  ? 3.048  17.704 91.630  1.00 31.89 ? 33   ASN A OD1 1 
ATOM   278  N  ND2 . ASN A 1 32  ? 3.128  19.318 93.210  1.00 31.44 ? 33   ASN A ND2 1 
ATOM   279  N  N   . ARG A 1 33  ? 4.605  20.146 87.515  1.00 23.87 ? 34   ARG A N   1 
ATOM   280  C  CA  . ARG A 1 33  ? 4.319  20.582 86.152  1.00 21.61 ? 34   ARG A CA  1 
ATOM   281  C  C   . ARG A 1 33  ? 5.298  19.911 85.225  1.00 19.54 ? 34   ARG A C   1 
ATOM   282  O  O   . ARG A 1 33  ? 6.317  19.414 85.727  1.00 17.79 ? 34   ARG A O   1 
ATOM   283  C  CB  . ARG A 1 33  ? 4.433  22.121 86.002  1.00 21.71 ? 34   ARG A CB  1 
ATOM   284  C  CG  . ARG A 1 33  ? 5.567  22.869 86.701  1.00 22.86 ? 34   ARG A CG  1 
ATOM   285  C  CD  . ARG A 1 33  ? 5.788  24.194 85.953  1.00 22.19 ? 34   ARG A CD  1 
ATOM   286  N  NE  . ARG A 1 33  ? 7.025  24.861 86.349  1.00 23.64 ? 34   ARG A NE  1 
ATOM   287  C  CZ  . ARG A 1 33  ? 8.176  24.742 85.656  1.00 25.54 ? 34   ARG A CZ  1 
ATOM   288  N  NH1 . ARG A 1 33  ? 8.295  23.900 84.608  1.00 24.58 ? 34   ARG A NH1 1 
ATOM   289  N  NH2 . ARG A 1 33  ? 9.267  25.425 86.044  1.00 24.61 ? 34   ARG A NH2 1 
ATOM   290  N  N   . PRO A 1 34  ? 5.005  19.857 83.904  1.00 18.85 ? 35   PRO A N   1 
ATOM   291  C  CA  . PRO A 1 34  ? 5.962  19.478 82.888  1.00 18.23 ? 35   PRO A CA  1 
ATOM   292  C  C   . PRO A 1 34  ? 7.163  20.433 82.907  1.00 18.33 ? 35   PRO A C   1 
ATOM   293  O  O   . PRO A 1 34  ? 7.051  21.665 83.081  1.00 19.74 ? 35   PRO A O   1 
ATOM   294  C  CB  . PRO A 1 34  ? 5.163  19.511 81.576  1.00 18.18 ? 35   PRO A CB  1 
ATOM   295  C  CG  . PRO A 1 34  ? 3.770  19.160 82.006  1.00 17.75 ? 35   PRO A CG  1 
ATOM   296  C  CD  . PRO A 1 34  ? 3.667  19.959 83.292  1.00 17.74 ? 35   PRO A CD  1 
ATOM   297  N  N   . LEU A 1 35  ? 8.306  19.780 82.717  1.00 17.28 ? 36   LEU A N   1 
ATOM   298  C  CA  . LEU A 1 35  ? 9.616  20.402 82.734  1.00 15.24 ? 36   LEU A CA  1 
ATOM   299  C  C   . LEU A 1 35  ? 10.092 20.441 81.318  1.00 14.47 ? 36   LEU A C   1 
ATOM   300  O  O   . LEU A 1 35  ? 9.935  19.396 80.693  1.00 15.08 ? 36   LEU A O   1 
ATOM   301  C  CB  . LEU A 1 35  ? 10.614 19.575 83.455  1.00 13.30 ? 36   LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 35  ? 10.496 19.392 84.921  1.00 12.94 ? 36   LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 35  ? 11.745 18.694 85.408  1.00 13.52 ? 36   LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 35  ? 10.455 20.751 85.646  1.00 12.76 ? 36   LEU A CD2 1 
ATOM   305  N  N   . THR A 1 36  ? 10.760 21.458 80.776  1.00 13.46 ? 37   THR A N   1 
ATOM   306  C  CA  . THR A 1 36  ? 11.207 21.354 79.399  1.00 11.87 ? 37   THR A CA  1 
ATOM   307  C  C   . THR A 1 36  ? 12.491 20.566 79.311  1.00 10.23 ? 37   THR A C   1 
ATOM   308  O  O   . THR A 1 36  ? 12.975 20.214 80.370  1.00 10.26 ? 37   THR A O   1 
ATOM   309  C  CB  . THR A 1 36  ? 11.394 22.753 78.864  1.00 13.16 ? 37   THR A CB  1 
ATOM   310  O  OG1 . THR A 1 36  ? 12.503 23.257 79.576  1.00 13.92 ? 37   THR A OG1 1 
ATOM   311  C  CG2 . THR A 1 36  ? 10.253 23.714 79.110  1.00 14.13 ? 37   THR A CG2 1 
ATOM   312  N  N   . LEU A 1 37  ? 13.135 20.276 78.167  1.00 10.40 ? 38   LEU A N   1 
ATOM   313  C  CA  . LEU A 1 37  ? 14.400 19.521 78.188  1.00 11.42 ? 38   LEU A CA  1 
ATOM   314  C  C   . LEU A 1 37  ? 15.542 20.189 78.991  1.00 13.07 ? 38   LEU A C   1 
ATOM   315  O  O   . LEU A 1 37  ? 16.223 19.518 79.789  1.00 14.65 ? 38   LEU A O   1 
ATOM   316  C  CB  . LEU A 1 37  ? 14.872 19.280 76.759  1.00 9.40  ? 38   LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 37  ? 16.250 18.685 76.592  1.00 8.72  ? 38   LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 37  ? 16.335 17.415 77.365  1.00 7.83  ? 38   LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 37  ? 16.511 18.342 75.184  1.00 7.70  ? 38   LEU A CD2 1 
ATOM   320  N  N   . SER A 1 38  ? 15.778 21.501 78.808  1.00 13.52 ? 39   SER A N   1 
ATOM   321  C  CA  . SER A 1 38  ? 16.803 22.231 79.539  1.00 13.09 ? 39   SER A CA  1 
ATOM   322  C  C   . SER A 1 38  ? 16.498 22.359 81.025  1.00 14.14 ? 39   SER A C   1 
ATOM   323  O  O   . SER A 1 38  ? 17.463 22.429 81.765  1.00 15.28 ? 39   SER A O   1 
ATOM   324  C  CB  . SER A 1 38  ? 16.944 23.608 78.964  1.00 11.24 ? 39   SER A CB  1 
ATOM   325  O  OG  . SER A 1 38  ? 15.713 24.316 78.991  1.00 8.38  ? 39   SER A OG  1 
ATOM   326  N  N   . GLU A 1 39  ? 15.239 22.414 81.533  1.00 14.67 ? 40   GLU A N   1 
ATOM   327  C  CA  . GLU A 1 39  ? 14.900 22.439 82.960  1.00 12.90 ? 40   GLU A CA  1 
ATOM   328  C  C   . GLU A 1 39  ? 15.323 21.117 83.544  1.00 12.59 ? 40   GLU A C   1 
ATOM   329  O  O   . GLU A 1 39  ? 15.959 21.054 84.573  1.00 11.99 ? 40   GLU A O   1 
ATOM   330  C  CB  . GLU A 1 39  ? 13.414 22.602 83.156  1.00 14.58 ? 40   GLU A CB  1 
ATOM   331  C  CG  . GLU A 1 39  ? 12.899 23.988 82.786  1.00 16.89 ? 40   GLU A CG  1 
ATOM   332  C  CD  . GLU A 1 39  ? 11.477 24.297 83.247  1.00 19.81 ? 40   GLU A CD  1 
ATOM   333  O  OE1 . GLU A 1 39  ? 10.537 23.646 82.769  1.00 21.04 ? 40   GLU A OE1 1 
ATOM   334  O  OE2 . GLU A 1 39  ? 11.317 25.225 84.053  1.00 20.78 ? 40   GLU A OE2 1 
ATOM   335  N  N   . LYS A 1 40  ? 15.089 20.000 82.865  1.00 13.02 ? 41   LYS A N   1 
ATOM   336  C  CA  . LYS A 1 40  ? 15.513 18.703 83.378  1.00 12.74 ? 41   LYS A CA  1 
ATOM   337  C  C   . LYS A 1 40  ? 17.005 18.538 83.594  1.00 12.53 ? 41   LYS A C   1 
ATOM   338  O  O   . LYS A 1 40  ? 17.430 18.090 84.676  1.00 11.48 ? 41   LYS A O   1 
ATOM   339  C  CB  . LYS A 1 40  ? 15.062 17.594 82.440  1.00 12.50 ? 41   LYS A CB  1 
ATOM   340  C  CG  . LYS A 1 40  ? 13.597 17.244 82.495  1.00 11.32 ? 41   LYS A CG  1 
ATOM   341  C  CD  . LYS A 1 40  ? 13.429 16.243 81.368  1.00 11.13 ? 41   LYS A CD  1 
ATOM   342  C  CE  . LYS A 1 40  ? 11.992 15.909 81.415  1.00 12.29 ? 41   LYS A CE  1 
ATOM   343  N  NZ  . LYS A 1 40  ? 11.557 15.130 80.267  1.00 13.64 ? 41   LYS A NZ  1 
ATOM   344  N  N   . ILE A 1 41  ? 17.759 18.886 82.517  1.00 12.34 ? 42   ILE A N   1 
ATOM   345  C  CA  . ILE A 1 41  ? 19.213 18.773 82.563  1.00 11.71 ? 42   ILE A CA  1 
ATOM   346  C  C   . ILE A 1 41  ? 19.802 19.825 83.516  1.00 11.71 ? 42   ILE A C   1 
ATOM   347  O  O   . ILE A 1 41  ? 20.656 19.516 84.336  1.00 11.07 ? 42   ILE A O   1 
ATOM   348  C  CB  . ILE A 1 41  ? 19.778 18.900 81.104  1.00 10.96 ? 42   ILE A CB  1 
ATOM   349  C  CG1 . ILE A 1 41  ? 19.309 17.786 80.174  1.00 10.10 ? 42   ILE A CG1 1 
ATOM   350  C  CG2 . ILE A 1 41  ? 21.293 18.778 81.188  1.00 12.58 ? 42   ILE A CG2 1 
ATOM   351  C  CD1 . ILE A 1 41  ? 19.909 17.839 78.728  1.00 6.36  ? 42   ILE A CD1 1 
ATOM   352  N  N   . VAL A 1 42  ? 19.352 21.066 83.518  1.00 12.05 ? 43   VAL A N   1 
ATOM   353  C  CA  . VAL A 1 42  ? 19.870 22.072 84.437  1.00 12.84 ? 43   VAL A CA  1 
ATOM   354  C  C   . VAL A 1 42  ? 19.500 21.699 85.882  1.00 13.43 ? 43   VAL A C   1 
ATOM   355  O  O   . VAL A 1 42  ? 20.389 21.548 86.712  1.00 12.93 ? 43   VAL A O   1 
ATOM   356  C  CB  . VAL A 1 42  ? 19.290 23.485 83.947  1.00 12.57 ? 43   VAL A CB  1 
ATOM   357  C  CG1 . VAL A 1 42  ? 19.455 24.541 85.032  1.00 11.38 ? 43   VAL A CG1 1 
ATOM   358  C  CG2 . VAL A 1 42  ? 20.058 23.998 82.732  1.00 8.90  ? 43   VAL A CG2 1 
ATOM   359  N  N   . TYR A 1 43  ? 18.233 21.452 86.191  1.00 14.34 ? 44   TYR A N   1 
ATOM   360  C  CA  . TYR A 1 43  ? 17.833 21.126 87.558  1.00 16.42 ? 44   TYR A CA  1 
ATOM   361  C  C   . TYR A 1 43  ? 18.319 19.737 87.994  1.00 16.97 ? 44   TYR A C   1 
ATOM   362  O  O   . TYR A 1 43  ? 18.511 19.555 89.204  1.00 17.65 ? 44   TYR A O   1 
ATOM   363  C  CB  . TYR A 1 43  ? 16.284 21.162 87.751  1.00 16.51 ? 44   TYR A CB  1 
ATOM   364  C  CG  . TYR A 1 43  ? 15.574 22.464 87.333  1.00 17.43 ? 44   TYR A CG  1 
ATOM   365  C  CD1 . TYR A 1 43  ? 16.276 23.695 87.242  1.00 17.70 ? 44   TYR A CD1 1 
ATOM   366  C  CD2 . TYR A 1 43  ? 14.216 22.431 86.953  1.00 16.54 ? 44   TYR A CD2 1 
ATOM   367  C  CE1 . TYR A 1 43  ? 15.639 24.858 86.763  1.00 15.79 ? 44   TYR A CE1 1 
ATOM   368  C  CE2 . TYR A 1 43  ? 13.583 23.592 86.487  1.00 14.96 ? 44   TYR A CE2 1 
ATOM   369  C  CZ  . TYR A 1 43  ? 14.296 24.794 86.383  1.00 15.06 ? 44   TYR A CZ  1 
ATOM   370  O  OH  . TYR A 1 43  ? 13.693 25.916 85.816  1.00 14.50 ? 44   TYR A OH  1 
ATOM   371  N  N   . GLY A 1 44  ? 18.563 18.759 87.083  1.00 16.11 ? 45   GLY A N   1 
ATOM   372  C  CA  . GLY A 1 44  ? 19.137 17.495 87.487  1.00 15.62 ? 45   GLY A CA  1 
ATOM   373  C  C   . GLY A 1 44  ? 20.539 17.721 88.021  1.00 16.26 ? 45   GLY A C   1 
ATOM   374  O  O   . GLY A 1 44  ? 21.025 16.935 88.813  1.00 16.97 ? 45   GLY A O   1 
ATOM   375  N  N   . HIS A 1 45  ? 21.199 18.835 87.655  1.00 16.33 ? 46   HIS A N   1 
ATOM   376  C  CA  . HIS A 1 45  ? 22.529 19.211 88.142  1.00 15.29 ? 46   HIS A CA  1 
ATOM   377  C  C   . HIS A 1 45  ? 22.563 20.185 89.331  1.00 14.92 ? 46   HIS A C   1 
ATOM   378  O  O   . HIS A 1 45  ? 23.609 20.758 89.595  1.00 12.75 ? 46   HIS A O   1 
ATOM   379  C  CB  . HIS A 1 45  ? 23.299 19.782 86.958  1.00 14.09 ? 46   HIS A CB  1 
ATOM   380  C  CG  . HIS A 1 45  ? 23.703 18.781 85.869  1.00 14.15 ? 46   HIS A CG  1 
ATOM   381  N  ND1 . HIS A 1 45  ? 23.093 18.393 84.730  1.00 13.66 ? 46   HIS A ND1 1 
ATOM   382  C  CD2 . HIS A 1 45  ? 24.900 18.116 85.901  1.00 13.98 ? 46   HIS A CD2 1 
ATOM   383  C  CE1 . HIS A 1 45  ? 23.853 17.550 84.092  1.00 12.76 ? 46   HIS A CE1 1 
ATOM   384  N  NE2 . HIS A 1 45  ? 24.935 17.398 84.815  1.00 12.85 ? 46   HIS A NE2 1 
ATOM   385  N  N   . LEU A 1 46  ? 21.503 20.388 90.135  1.00 15.99 ? 47   LEU A N   1 
ATOM   386  C  CA  . LEU A 1 46  ? 21.513 21.359 91.229  1.00 16.18 ? 47   LEU A CA  1 
ATOM   387  C  C   . LEU A 1 46  ? 22.305 20.875 92.436  1.00 16.81 ? 47   LEU A C   1 
ATOM   388  O  O   . LEU A 1 46  ? 22.311 19.696 92.735  1.00 17.11 ? 47   LEU A O   1 
ATOM   389  C  CB  . LEU A 1 46  ? 20.094 21.657 91.671  1.00 16.18 ? 47   LEU A CB  1 
ATOM   390  C  CG  . LEU A 1 46  ? 19.205 22.394 90.679  1.00 17.46 ? 47   LEU A CG  1 
ATOM   391  C  CD1 . LEU A 1 46  ? 17.775 22.543 91.133  1.00 15.11 ? 47   LEU A CD1 1 
ATOM   392  C  CD2 . LEU A 1 46  ? 19.704 23.784 90.595  1.00 18.25 ? 47   LEU A CD2 1 
ATOM   393  N  N   . ASP A 1 47  ? 23.007 21.749 93.168  1.00 17.86 ? 48   ASP A N   1 
ATOM   394  C  CA  . ASP A 1 47  ? 23.728 21.398 94.365  1.00 17.89 ? 48   ASP A CA  1 
ATOM   395  C  C   . ASP A 1 47  ? 22.726 21.066 95.450  1.00 18.05 ? 48   ASP A C   1 
ATOM   396  O  O   . ASP A 1 47  ? 22.925 20.129 96.202  1.00 17.79 ? 48   ASP A O   1 
ATOM   397  C  CB  . ASP A 1 47  ? 24.601 22.575 94.739  1.00 18.97 ? 48   ASP A CB  1 
ATOM   398  C  CG  . ASP A 1 47  ? 25.293 22.427 96.096  1.00 19.97 ? 48   ASP A CG  1 
ATOM   399  O  OD1 . ASP A 1 47  ? 26.015 21.455 96.324  1.00 19.52 ? 48   ASP A OD1 1 
ATOM   400  O  OD2 . ASP A 1 47  ? 25.096 23.319 96.925  1.00 22.78 ? 48   ASP A OD2 1 
ATOM   401  N  N   . ASP A 1 48  ? 21.612 21.750 95.574  1.00 18.84 ? 49   ASP A N   1 
ATOM   402  C  CA  . ASP A 1 48  ? 20.647 21.353 96.574  1.00 20.33 ? 49   ASP A CA  1 
ATOM   403  C  C   . ASP A 1 48  ? 19.220 21.282 95.958  1.00 20.07 ? 49   ASP A C   1 
ATOM   404  O  O   . ASP A 1 48  ? 18.428 22.216 96.089  1.00 19.15 ? 49   ASP A O   1 
ATOM   405  C  CB  . ASP A 1 48  ? 20.754 22.352 97.723  1.00 22.13 ? 49   ASP A CB  1 
ATOM   406  C  CG  . ASP A 1 48  ? 19.991 21.953 98.987  1.00 25.73 ? 49   ASP A CG  1 
ATOM   407  O  OD1 . ASP A 1 48  ? 18.900 21.407 98.878  1.00 27.61 ? 49   ASP A OD1 1 
ATOM   408  O  OD2 . ASP A 1 48  ? 20.459 22.193 100.105 1.00 27.46 ? 49   ASP A OD2 1 
ATOM   409  N  N   . PRO A 1 49  ? 18.793 20.182 95.300  1.00 20.42 ? 50   PRO A N   1 
ATOM   410  C  CA  . PRO A 1 49  ? 17.510 20.065 94.639  1.00 21.16 ? 50   PRO A CA  1 
ATOM   411  C  C   . PRO A 1 49  ? 16.340 20.262 95.560  1.00 22.47 ? 50   PRO A C   1 
ATOM   412  O  O   . PRO A 1 49  ? 15.363 20.859 95.106  1.00 24.08 ? 50   PRO A O   1 
ATOM   413  C  CB  . PRO A 1 49  ? 17.516 18.701 94.010  1.00 20.36 ? 50   PRO A CB  1 
ATOM   414  C  CG  . PRO A 1 49  ? 18.473 17.973 94.864  1.00 19.66 ? 50   PRO A CG  1 
ATOM   415  C  CD  . PRO A 1 49  ? 19.563 18.976 95.042  1.00 19.32 ? 50   PRO A CD  1 
ATOM   416  N  N   . ALA A 1 50  ? 16.455 19.818 96.812  1.00 22.72 ? 51   ALA A N   1 
ATOM   417  C  CA  . ALA A 1 50  ? 15.382 19.945 97.744  1.00 23.48 ? 51   ALA A CA  1 
ATOM   418  C  C   . ALA A 1 50  ? 15.164 21.395 98.108  1.00 25.17 ? 51   ALA A C   1 
ATOM   419  O  O   . ALA A 1 50  ? 14.037 21.854 98.097  1.00 26.29 ? 51   ALA A O   1 
ATOM   420  C  CB  . ALA A 1 50  ? 15.698 19.169 98.989  1.00 22.32 ? 51   ALA A CB  1 
ATOM   421  N  N   . ASN A 1 51  ? 16.183 22.219 98.337  1.00 27.37 ? 52   ASN A N   1 
ATOM   422  C  CA  . ASN A 1 51  ? 15.979 23.583 98.858  1.00 28.57 ? 52   ASN A CA  1 
ATOM   423  C  C   . ASN A 1 51  ? 16.087 24.816 97.952  1.00 28.14 ? 52   ASN A C   1 
ATOM   424  O  O   . ASN A 1 51  ? 15.597 25.895 98.292  1.00 27.63 ? 52   ASN A O   1 
ATOM   425  C  CB  . ASN A 1 51  ? 16.902 23.701 100.063 1.00 30.73 ? 52   ASN A CB  1 
ATOM   426  C  CG  . ASN A 1 51  ? 16.520 22.627 101.095 1.00 33.19 ? 52   ASN A CG  1 
ATOM   427  O  OD1 . ASN A 1 51  ? 15.388 22.598 101.591 1.00 34.70 ? 52   ASN A OD1 1 
ATOM   428  N  ND2 . ASN A 1 51  ? 17.414 21.659 101.363 1.00 33.75 ? 52   ASN A ND2 1 
ATOM   429  N  N   . GLN A 1 52  ? 16.640 24.601 96.762  1.00 27.71 ? 53   GLN A N   1 
ATOM   430  C  CA  . GLN A 1 52  ? 16.789 25.593 95.742  1.00 27.12 ? 53   GLN A CA  1 
ATOM   431  C  C   . GLN A 1 52  ? 15.476 26.230 95.265  1.00 28.81 ? 53   GLN A C   1 
ATOM   432  O  O   . GLN A 1 52  ? 14.596 25.581 94.663  1.00 29.24 ? 53   GLN A O   1 
ATOM   433  C  CB  . GLN A 1 52  ? 17.504 24.943 94.583  1.00 24.12 ? 53   GLN A CB  1 
ATOM   434  C  CG  . GLN A 1 52  ? 17.660 25.838 93.341  1.00 22.76 ? 53   GLN A CG  1 
ATOM   435  C  CD  . GLN A 1 52  ? 18.680 26.937 93.542  1.00 21.80 ? 53   GLN A CD  1 
ATOM   436  O  OE1 . GLN A 1 52  ? 19.855 26.730 93.813  1.00 20.14 ? 53   GLN A OE1 1 
ATOM   437  N  NE2 . GLN A 1 52  ? 18.252 28.173 93.429  1.00 23.25 ? 53   GLN A NE2 1 
ATOM   438  N  N   . GLU A 1 53  ? 15.399 27.553 95.481  1.00 29.32 ? 54   GLU A N   1 
ATOM   439  C  CA  . GLU A 1 53  ? 14.271 28.344 94.993  1.00 30.99 ? 54   GLU A CA  1 
ATOM   440  C  C   . GLU A 1 53  ? 14.384 28.416 93.483  1.00 28.88 ? 54   GLU A C   1 
ATOM   441  O  O   . GLU A 1 53  ? 15.390 28.890 92.973  1.00 28.90 ? 54   GLU A O   1 
ATOM   442  C  CB  . GLU A 1 53  ? 14.274 29.779 95.471  1.00 35.42 ? 54   GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 53  ? 14.366 30.143 96.984  1.00 42.29 ? 54   GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 53  ? 14.675 31.639 97.323  1.00 45.62 ? 54   GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 53  ? 15.652 32.241 96.829  1.00 47.58 ? 54   GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 53  ? 13.924 32.211 98.122  1.00 46.75 ? 54   GLU A OE2 1 
ATOM   447  N  N   . ILE A 1 54  ? 13.370 27.972 92.757  1.00 26.63 ? 55   ILE A N   1 
ATOM   448  C  CA  . ILE A 1 54  ? 13.443 27.905 91.309  1.00 24.92 ? 55   ILE A CA  1 
ATOM   449  C  C   . ILE A 1 54  ? 12.436 28.911 90.730  1.00 25.83 ? 55   ILE A C   1 
ATOM   450  O  O   . ILE A 1 54  ? 11.235 28.751 90.943  1.00 26.44 ? 55   ILE A O   1 
ATOM   451  C  CB  . ILE A 1 54  ? 13.115 26.429 90.829  1.00 22.09 ? 55   ILE A CB  1 
ATOM   452  C  CG1 . ILE A 1 54  ? 14.171 25.396 91.302  1.00 19.44 ? 55   ILE A CG1 1 
ATOM   453  C  CG2 . ILE A 1 54  ? 12.976 26.473 89.307  1.00 19.87 ? 55   ILE A CG2 1 
ATOM   454  C  CD1 . ILE A 1 54  ? 13.972 23.986 90.722  1.00 18.45 ? 55   ILE A CD1 1 
ATOM   455  N  N   . GLU A 1 55  ? 12.835 29.954 89.997  1.00 25.63 ? 56   GLU A N   1 
ATOM   456  C  CA  . GLU A 1 55  ? 11.882 30.857 89.388  1.00 25.74 ? 56   GLU A CA  1 
ATOM   457  C  C   . GLU A 1 55  ? 12.551 31.314 88.112  1.00 23.46 ? 56   GLU A C   1 
ATOM   458  O  O   . GLU A 1 55  ? 13.599 31.962 88.242  1.00 22.37 ? 56   GLU A O   1 
ATOM   459  C  CB  . GLU A 1 55  ? 11.647 32.075 90.241  1.00 29.53 ? 56   GLU A CB  1 
ATOM   460  C  CG  . GLU A 1 55  ? 10.513 31.997 91.236  1.00 34.64 ? 56   GLU A CG  1 
ATOM   461  C  CD  . GLU A 1 55  ? 9.408  32.967 90.902  1.00 38.03 ? 56   GLU A CD  1 
ATOM   462  O  OE1 . GLU A 1 55  ? 8.926  32.901 89.767  1.00 38.88 ? 56   GLU A OE1 1 
ATOM   463  O  OE2 . GLU A 1 55  ? 9.068  33.759 91.790  1.00 40.76 ? 56   GLU A OE2 1 
ATOM   464  N  N   . ARG A 1 56  ? 11.999 31.009 86.919  1.00 21.15 ? 57   ARG A N   1 
ATOM   465  C  CA  . ARG A 1 56  ? 12.632 31.417 85.657  1.00 19.90 ? 57   ARG A CA  1 
ATOM   466  C  C   . ARG A 1 56  ? 12.782 32.939 85.579  1.00 20.16 ? 57   ARG A C   1 
ATOM   467  O  O   . ARG A 1 56  ? 11.855 33.708 85.859  1.00 20.31 ? 57   ARG A O   1 
ATOM   468  C  CB  . ARG A 1 56  ? 11.847 31.028 84.429  1.00 16.96 ? 57   ARG A CB  1 
ATOM   469  C  CG  . ARG A 1 56  ? 11.516 29.555 84.304  1.00 15.97 ? 57   ARG A CG  1 
ATOM   470  C  CD  . ARG A 1 56  ? 10.853 29.285 82.947  1.00 13.54 ? 57   ARG A CD  1 
ATOM   471  N  NE  . ARG A 1 56  ? 10.510 27.884 82.693  1.00 10.94 ? 57   ARG A NE  1 
ATOM   472  C  CZ  . ARG A 1 56  ? 9.718  27.513 81.672  1.00 10.25 ? 57   ARG A CZ  1 
ATOM   473  N  NH1 . ARG A 1 56  ? 9.336  28.288 80.673  1.00 8.95  ? 57   ARG A NH1 1 
ATOM   474  N  NH2 . ARG A 1 56  ? 9.359  26.259 81.594  1.00 9.56  ? 57   ARG A NH2 1 
ATOM   475  N  N   . GLY A 1 57  ? 14.004 33.327 85.234  1.00 20.06 ? 58   GLY A N   1 
ATOM   476  C  CA  . GLY A 1 57  ? 14.423 34.686 85.141  1.00 20.70 ? 58   GLY A CA  1 
ATOM   477  C  C   . GLY A 1 57  ? 14.640 35.331 86.502  1.00 23.03 ? 58   GLY A C   1 
ATOM   478  O  O   . GLY A 1 57  ? 15.079 36.480 86.524  1.00 23.55 ? 58   GLY A O   1 
ATOM   479  N  N   . LYS A 1 58  ? 14.422 34.724 87.673  1.00 24.59 ? 59   LYS A N   1 
ATOM   480  C  CA  . LYS A 1 58  ? 14.593 35.461 88.926  1.00 26.60 ? 59   LYS A CA  1 
ATOM   481  C  C   . LYS A 1 58  ? 15.581 34.990 89.934  1.00 26.27 ? 59   LYS A C   1 
ATOM   482  O  O   . LYS A 1 58  ? 16.322 35.779 90.518  1.00 26.61 ? 59   LYS A O   1 
ATOM   483  C  CB  . LYS A 1 58  ? 13.360 35.584 89.753  1.00 29.48 ? 59   LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 58  ? 12.400 36.649 89.258  1.00 34.34 ? 59   LYS A CG  1 
ATOM   485  C  CD  . LYS A 1 58  ? 11.414 36.756 90.411  1.00 37.47 ? 59   LYS A CD  1 
ATOM   486  C  CE  . LYS A 1 58  ? 10.029 37.060 89.862  1.00 39.20 ? 59   LYS A CE  1 
ATOM   487  N  NZ  . LYS A 1 58  ? 9.030  36.501 90.761  1.00 38.86 ? 59   LYS A NZ  1 
ATOM   488  N  N   . THR A 1 59  ? 15.528 33.698 90.188  1.00 26.31 ? 60   THR A N   1 
ATOM   489  C  CA  . THR A 1 59  ? 16.443 33.114 91.165  1.00 25.57 ? 60   THR A CA  1 
ATOM   490  C  C   . THR A 1 59  ? 17.755 32.700 90.509  1.00 23.72 ? 60   THR A C   1 
ATOM   491  O  O   . THR A 1 59  ? 17.873 32.583 89.289  1.00 22.42 ? 60   THR A O   1 
ATOM   492  C  CB  . THR A 1 59  ? 15.722 31.898 91.865  1.00 26.81 ? 60   THR A CB  1 
ATOM   493  O  OG1 . THR A 1 59  ? 15.237 30.977 90.873  1.00 27.87 ? 60   THR A OG1 1 
ATOM   494  C  CG2 . THR A 1 59  ? 14.488 32.369 92.668  1.00 25.56 ? 60   THR A CG2 1 
ATOM   495  N  N   . TYR A 1 60  ? 18.744 32.541 91.382  1.00 22.93 ? 61   TYR A N   1 
ATOM   496  C  CA  . TYR A 1 60  ? 20.106 32.130 91.030  1.00 21.84 ? 61   TYR A CA  1 
ATOM   497  C  C   . TYR A 1 60  ? 20.238 30.684 91.529  1.00 21.20 ? 61   TYR A C   1 
ATOM   498  O  O   . TYR A 1 60  ? 20.011 30.339 92.697  1.00 22.26 ? 61   TYR A O   1 
ATOM   499  C  CB  . TYR A 1 60  ? 21.227 33.025 91.740  1.00 21.06 ? 61   TYR A CB  1 
ATOM   500  C  CG  . TYR A 1 60  ? 21.556 34.359 91.081  1.00 19.48 ? 61   TYR A CG  1 
ATOM   501  C  CD1 . TYR A 1 60  ? 22.284 34.369 89.879  1.00 20.07 ? 61   TYR A CD1 1 
ATOM   502  C  CD2 . TYR A 1 60  ? 21.129 35.562 91.643  1.00 18.29 ? 61   TYR A CD2 1 
ATOM   503  C  CE1 . TYR A 1 60  ? 22.574 35.573 89.236  1.00 19.62 ? 61   TYR A CE1 1 
ATOM   504  C  CE2 . TYR A 1 60  ? 21.423 36.773 90.999  1.00 18.61 ? 61   TYR A CE2 1 
ATOM   505  C  CZ  . TYR A 1 60  ? 22.146 36.777 89.796  1.00 19.03 ? 61   TYR A CZ  1 
ATOM   506  O  OH  . TYR A 1 60  ? 22.456 37.963 89.133  1.00 18.90 ? 61   TYR A OH  1 
ATOM   507  N  N   . LEU A 1 61  ? 20.633 29.845 90.602  1.00 19.89 ? 62   LEU A N   1 
ATOM   508  C  CA  . LEU A 1 61  ? 20.840 28.443 90.860  1.00 19.20 ? 62   LEU A CA  1 
ATOM   509  C  C   . LEU A 1 61  ? 22.294 28.202 91.196  1.00 19.45 ? 62   LEU A C   1 
ATOM   510  O  O   . LEU A 1 61  ? 23.152 28.835 90.603  1.00 20.36 ? 62   LEU A O   1 
ATOM   511  C  CB  . LEU A 1 61  ? 20.400 27.689 89.608  1.00 17.47 ? 62   LEU A CB  1 
ATOM   512  C  CG  . LEU A 1 61  ? 18.982 27.971 89.024  1.00 15.93 ? 62   LEU A CG  1 
ATOM   513  C  CD1 . LEU A 1 61  ? 18.974 27.292 87.667  1.00 13.57 ? 62   LEU A CD1 1 
ATOM   514  C  CD2 . LEU A 1 61  ? 17.835 27.522 89.938  1.00 11.58 ? 62   LEU A CD2 1 
ATOM   515  N  N   . ARG A 1 62  ? 22.595 27.411 92.220  1.00 21.10 ? 63   ARG A N   1 
ATOM   516  C  CA  . ARG A 1 62  ? 23.941 26.986 92.583  1.00 21.42 ? 63   ARG A CA  1 
ATOM   517  C  C   . ARG A 1 62  ? 24.001 25.567 91.979  1.00 21.46 ? 63   ARG A C   1 
ATOM   518  O  O   . ARG A 1 62  ? 23.307 24.645 92.439  1.00 22.26 ? 63   ARG A O   1 
ATOM   519  C  CB  . ARG A 1 62  ? 24.106 26.903 94.092  1.00 22.84 ? 63   ARG A CB  1 
ATOM   520  C  CG  . ARG A 1 62  ? 23.590 28.086 94.869  1.00 28.14 ? 63   ARG A CG  1 
ATOM   521  C  CD  . ARG A 1 62  ? 24.549 28.592 95.962  1.00 34.34 ? 63   ARG A CD  1 
ATOM   522  N  NE  . ARG A 1 62  ? 25.599 29.506 95.438  1.00 39.75 ? 63   ARG A NE  1 
ATOM   523  C  CZ  . ARG A 1 62  ? 26.850 29.617 95.928  1.00 41.40 ? 63   ARG A CZ  1 
ATOM   524  N  NH1 . ARG A 1 62  ? 27.217 28.930 97.002  1.00 43.06 ? 63   ARG A NH1 1 
ATOM   525  N  NH2 . ARG A 1 62  ? 27.724 30.433 95.324  1.00 41.77 ? 63   ARG A NH2 1 
ATOM   526  N  N   . LEU A 1 63  ? 24.836 25.385 90.933  1.00 19.77 ? 64   LEU A N   1 
ATOM   527  C  CA  . LEU A 1 63  ? 24.961 24.195 90.096  1.00 17.11 ? 64   LEU A CA  1 
ATOM   528  C  C   . LEU A 1 63  ? 26.288 23.492 90.255  1.00 16.99 ? 64   LEU A C   1 
ATOM   529  O  O   . LEU A 1 63  ? 27.255 24.072 90.740  1.00 17.45 ? 64   LEU A O   1 
ATOM   530  C  CB  . LEU A 1 63  ? 24.830 24.569 88.636  1.00 16.52 ? 64   LEU A CB  1 
ATOM   531  C  CG  . LEU A 1 63  ? 23.501 25.038 88.115  1.00 16.31 ? 64   LEU A CG  1 
ATOM   532  C  CD1 . LEU A 1 63  ? 23.651 25.614 86.710  1.00 17.70 ? 64   LEU A CD1 1 
ATOM   533  C  CD2 . LEU A 1 63  ? 22.543 23.848 88.159  1.00 15.39 ? 64   LEU A CD2 1 
ATOM   534  N  N   . ARG A 1 64  ? 26.341 22.240 89.783  1.00 16.25 ? 65   ARG A N   1 
ATOM   535  C  CA  . ARG A 1 64  ? 27.547 21.437 89.736  1.00 15.62 ? 65   ARG A CA  1 
ATOM   536  C  C   . ARG A 1 64  ? 27.770 20.968 88.298  1.00 14.37 ? 65   ARG A C   1 
ATOM   537  O  O   . ARG A 1 64  ? 27.273 19.918 87.901  1.00 13.95 ? 65   ARG A O   1 
ATOM   538  C  CB  . ARG A 1 64  ? 27.437 20.207 90.646  1.00 14.97 ? 65   ARG A CB  1 
ATOM   539  C  CG  . ARG A 1 64  ? 27.199 20.494 92.109  1.00 16.96 ? 65   ARG A CG  1 
ATOM   540  C  CD  . ARG A 1 64  ? 28.362 21.320 92.579  1.00 20.13 ? 65   ARG A CD  1 
ATOM   541  N  NE  . ARG A 1 64  ? 28.325 21.560 94.027  1.00 23.22 ? 65   ARG A NE  1 
ATOM   542  C  CZ  . ARG A 1 64  ? 29.431 21.713 94.761  1.00 22.33 ? 65   ARG A CZ  1 
ATOM   543  N  NH1 . ARG A 1 64  ? 30.644 21.659 94.219  1.00 23.21 ? 65   ARG A NH1 1 
ATOM   544  N  NH2 . ARG A 1 64  ? 29.306 21.904 96.056  1.00 23.06 ? 65   ARG A NH2 1 
ATOM   545  N  N   . PRO A 1 65  ? 28.566 21.678 87.489  1.00 14.09 ? 66   PRO A N   1 
ATOM   546  C  CA  . PRO A 1 65  ? 29.047 21.202 86.176  1.00 13.79 ? 66   PRO A CA  1 
ATOM   547  C  C   . PRO A 1 65  ? 29.919 19.925 86.209  1.00 13.73 ? 66   PRO A C   1 
ATOM   548  O  O   . PRO A 1 65  ? 30.686 19.663 87.143  1.00 13.47 ? 66   PRO A O   1 
ATOM   549  C  CB  . PRO A 1 65  ? 29.789 22.402 85.606  1.00 12.79 ? 66   PRO A CB  1 
ATOM   550  C  CG  . PRO A 1 65  ? 29.277 23.606 86.379  1.00 13.06 ? 66   PRO A CG  1 
ATOM   551  C  CD  . PRO A 1 65  ? 29.129 23.015 87.782  1.00 13.56 ? 66   PRO A CD  1 
ATOM   552  N  N   . ASP A 1 66  ? 29.809 19.140 85.134  1.00 14.21 ? 67   ASP A N   1 
ATOM   553  C  CA  . ASP A 1 66  ? 30.519 17.880 84.941  1.00 14.48 ? 67   ASP A CA  1 
ATOM   554  C  C   . ASP A 1 66  ? 31.947 18.050 84.368  1.00 13.69 ? 67   ASP A C   1 
ATOM   555  O  O   . ASP A 1 66  ? 32.790 17.200 84.616  1.00 12.69 ? 67   ASP A O   1 
ATOM   556  C  CB  . ASP A 1 66  ? 29.689 16.923 83.996  1.00 14.24 ? 67   ASP A CB  1 
ATOM   557  C  CG  . ASP A 1 66  ? 28.263 16.636 84.444  1.00 15.04 ? 67   ASP A CG  1 
ATOM   558  O  OD1 . ASP A 1 66  ? 28.060 16.242 85.581  1.00 15.75 ? 67   ASP A OD1 1 
ATOM   559  O  OD2 . ASP A 1 66  ? 27.341 16.840 83.669  1.00 15.44 ? 67   ASP A OD2 1 
ATOM   560  N  N   . ARG A 1 67  ? 32.298 19.054 83.558  1.00 13.26 ? 68   ARG A N   1 
ATOM   561  C  CA  . ARG A 1 67  ? 33.665 19.239 83.094  1.00 14.05 ? 68   ARG A CA  1 
ATOM   562  C  C   . ARG A 1 67  ? 33.804 20.697 82.657  1.00 14.64 ? 68   ARG A C   1 
ATOM   563  O  O   . ARG A 1 67  ? 32.798 21.404 82.561  1.00 14.69 ? 68   ARG A O   1 
ATOM   564  C  CB  . ARG A 1 67  ? 33.986 18.256 81.940  1.00 13.66 ? 68   ARG A CB  1 
ATOM   565  C  CG  . ARG A 1 67  ? 33.220 18.171 80.641  1.00 13.59 ? 68   ARG A CG  1 
ATOM   566  C  CD  . ARG A 1 67  ? 33.788 17.215 79.602  1.00 15.49 ? 68   ARG A CD  1 
ATOM   567  N  NE  . ARG A 1 67  ? 35.244 17.267 79.628  1.00 17.96 ? 68   ARG A NE  1 
ATOM   568  C  CZ  . ARG A 1 67  ? 36.014 16.212 79.951  1.00 17.67 ? 68   ARG A CZ  1 
ATOM   569  N  NH1 . ARG A 1 67  ? 35.533 14.964 79.953  1.00 18.53 ? 68   ARG A NH1 1 
ATOM   570  N  NH2 . ARG A 1 67  ? 37.313 16.390 80.135  1.00 15.50 ? 68   ARG A NH2 1 
ATOM   571  N  N   . VAL A 1 68  ? 35.067 21.160 82.489  1.00 15.31 ? 69   VAL A N   1 
ATOM   572  C  CA  . VAL A 1 68  ? 35.502 22.544 82.150  1.00 15.18 ? 69   VAL A CA  1 
ATOM   573  C  C   . VAL A 1 68  ? 36.368 22.439 80.884  1.00 15.94 ? 69   VAL A C   1 
ATOM   574  O  O   . VAL A 1 68  ? 37.236 21.562 80.833  1.00 16.48 ? 69   VAL A O   1 
ATOM   575  C  CB  . VAL A 1 68  ? 36.377 23.162 83.332  1.00 15.03 ? 69   VAL A CB  1 
ATOM   576  C  CG1 . VAL A 1 68  ? 37.127 24.419 82.906  1.00 14.31 ? 69   VAL A CG1 1 
ATOM   577  C  CG2 . VAL A 1 68  ? 35.476 23.601 84.474  1.00 11.85 ? 69   VAL A CG2 1 
ATOM   578  N  N   . ALA A 1 69  ? 36.180 23.243 79.834  1.00 14.79 ? 70   ALA A N   1 
ATOM   579  C  CA  . ALA A 1 69  ? 37.103 23.196 78.702  1.00 13.85 ? 70   ALA A CA  1 
ATOM   580  C  C   . ALA A 1 69  ? 37.677 24.624 78.476  1.00 13.51 ? 70   ALA A C   1 
ATOM   581  O  O   . ALA A 1 69  ? 36.937 25.594 78.708  1.00 13.20 ? 70   ALA A O   1 
ATOM   582  C  CB  . ALA A 1 69  ? 36.360 22.717 77.448  1.00 13.45 ? 70   ALA A CB  1 
ATOM   583  N  N   . MET A 1 70  ? 38.975 24.832 78.097  1.00 12.14 ? 71   MET A N   1 
ATOM   584  C  CA  . MET A 1 70  ? 39.571 26.154 77.922  1.00 10.78 ? 71   MET A CA  1 
ATOM   585  C  C   . MET A 1 70  ? 40.244 26.241 76.581  1.00 10.88 ? 71   MET A C   1 
ATOM   586  O  O   . MET A 1 70  ? 40.788 25.239 76.133  1.00 11.35 ? 71   MET A O   1 
ATOM   587  C  CB  . MET A 1 70  ? 40.596 26.417 79.027  1.00 8.80  ? 71   MET A CB  1 
ATOM   588  C  CG  . MET A 1 70  ? 39.892 26.665 80.325  1.00 8.16  ? 71   MET A CG  1 
ATOM   589  S  SD  . MET A 1 70  ? 40.976 26.803 81.765  1.00 10.19 ? 71   MET A SD  1 
ATOM   590  C  CE  . MET A 1 70  ? 41.166 25.075 82.028  1.00 9.79  ? 71   MET A CE  1 
ATOM   591  N  N   . GLN A 1 71  ? 40.193 27.367 75.884  1.00 11.55 ? 72   GLN A N   1 
ATOM   592  C  CA  . GLN A 1 71  ? 40.962 27.511 74.641  1.00 14.06 ? 72   GLN A CA  1 
ATOM   593  C  C   . GLN A 1 71  ? 42.229 28.295 74.967  1.00 13.94 ? 72   GLN A C   1 
ATOM   594  O  O   . GLN A 1 71  ? 42.253 28.895 76.041  1.00 15.41 ? 72   GLN A O   1 
ATOM   595  C  CB  . GLN A 1 71  ? 40.124 28.221 73.551  1.00 15.62 ? 72   GLN A CB  1 
ATOM   596  C  CG  . GLN A 1 71  ? 39.092 29.271 74.005  1.00 17.43 ? 72   GLN A CG  1 
ATOM   597  C  CD  . GLN A 1 71  ? 39.502 30.656 73.568  1.00 17.04 ? 72   GLN A CD  1 
ATOM   598  O  OE1 . GLN A 1 71  ? 40.709 30.930 73.575  1.00 17.17 ? 72   GLN A OE1 1 
ATOM   599  N  NE2 . GLN A 1 71  ? 38.495 31.497 73.271  1.00 16.43 ? 72   GLN A NE2 1 
ATOM   600  N  N   . ASP A 1 72  ? 43.294 28.384 74.174  1.00 12.94 ? 73   ASP A N   1 
ATOM   601  C  CA  . ASP A 1 72  ? 44.508 28.955 74.725  1.00 14.39 ? 73   ASP A CA  1 
ATOM   602  C  C   . ASP A 1 72  ? 44.504 30.479 74.847  1.00 15.60 ? 73   ASP A C   1 
ATOM   603  O  O   . ASP A 1 72  ? 45.379 31.023 75.533  1.00 15.31 ? 73   ASP A O   1 
ATOM   604  C  CB  . ASP A 1 72  ? 45.751 28.514 73.909  1.00 13.39 ? 73   ASP A CB  1 
ATOM   605  C  CG  . ASP A 1 72  ? 45.730 28.729 72.401  1.00 13.34 ? 73   ASP A CG  1 
ATOM   606  O  OD1 . ASP A 1 72  ? 44.716 29.105 71.819  1.00 11.98 ? 73   ASP A OD1 1 
ATOM   607  O  OD2 . ASP A 1 72  ? 46.752 28.485 71.789  1.00 14.29 ? 73   ASP A OD2 1 
ATOM   608  N  N   . ALA A 1 73  ? 43.575 31.174 74.130  1.00 15.84 ? 74   ALA A N   1 
ATOM   609  C  CA  . ALA A 1 73  ? 43.478 32.610 74.271  1.00 13.55 ? 74   ALA A CA  1 
ATOM   610  C  C   . ALA A 1 73  ? 42.811 32.994 75.566  1.00 13.68 ? 74   ALA A C   1 
ATOM   611  O  O   . ALA A 1 73  ? 43.100 34.101 76.010  1.00 14.58 ? 74   ALA A O   1 
ATOM   612  C  CB  . ALA A 1 73  ? 42.713 33.216 73.100  1.00 12.28 ? 74   ALA A CB  1 
ATOM   613  N  N   . THR A 1 74  ? 41.961 32.181 76.242  1.00 13.67 ? 75   THR A N   1 
ATOM   614  C  CA  . THR A 1 74  ? 41.408 32.552 77.564  1.00 12.27 ? 75   THR A CA  1 
ATOM   615  C  C   . THR A 1 74  ? 41.923 31.730 78.728  1.00 12.74 ? 75   THR A C   1 
ATOM   616  O  O   . THR A 1 74  ? 41.739 32.057 79.898  1.00 12.06 ? 75   THR A O   1 
ATOM   617  C  CB  . THR A 1 74  ? 39.892 32.460 77.563  1.00 10.66 ? 75   THR A CB  1 
ATOM   618  O  OG1 . THR A 1 74  ? 39.494 31.183 77.071  1.00 11.35 ? 75   THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 74  ? 39.314 33.583 76.730  1.00 8.25  ? 75   THR A CG2 1 
ATOM   620  N  N   . ALA A 1 75  ? 42.645 30.671 78.393  1.00 12.69 ? 76   ALA A N   1 
ATOM   621  C  CA  . ALA A 1 75  ? 43.181 29.762 79.388  1.00 12.75 ? 76   ALA A CA  1 
ATOM   622  C  C   . ALA A 1 75  ? 44.322 30.344 80.157  1.00 12.91 ? 76   ALA A C   1 
ATOM   623  O  O   . ALA A 1 75  ? 44.552 29.904 81.288  1.00 14.74 ? 76   ALA A O   1 
ATOM   624  C  CB  . ALA A 1 75  ? 43.731 28.470 78.760  1.00 12.59 ? 76   ALA A CB  1 
ATOM   625  N  N   . GLN A 1 76  ? 45.069 31.266 79.548  1.00 12.45 ? 77   GLN A N   1 
ATOM   626  C  CA  . GLN A 1 76  ? 46.252 31.795 80.211  1.00 12.96 ? 77   GLN A CA  1 
ATOM   627  C  C   . GLN A 1 76  ? 45.928 32.515 81.514  1.00 12.58 ? 77   GLN A C   1 
ATOM   628  O  O   . GLN A 1 76  ? 46.426 32.200 82.593  1.00 11.09 ? 77   GLN A O   1 
ATOM   629  C  CB  . GLN A 1 76  ? 46.977 32.707 79.220  1.00 13.64 ? 77   GLN A CB  1 
ATOM   630  C  CG  . GLN A 1 76  ? 47.675 31.938 78.096  1.00 13.66 ? 77   GLN A CG  1 
ATOM   631  C  CD  . GLN A 1 76  ? 48.326 32.843 77.057  1.00 16.50 ? 77   GLN A CD  1 
ATOM   632  O  OE1 . GLN A 1 76  ? 49.249 33.605 77.405  1.00 17.25 ? 77   GLN A OE1 1 
ATOM   633  N  NE2 . GLN A 1 76  ? 47.851 32.798 75.776  1.00 15.78 ? 77   GLN A NE2 1 
ATOM   634  N  N   . MET A 1 77  ? 44.956 33.400 81.370  1.00 13.65 ? 78   MET A N   1 
ATOM   635  C  CA  . MET A 1 77  ? 44.453 34.167 82.471  1.00 14.07 ? 78   MET A CA  1 
ATOM   636  C  C   . MET A 1 77  ? 43.579 33.318 83.359  1.00 14.49 ? 78   MET A C   1 
ATOM   637  O  O   . MET A 1 77  ? 43.611 33.640 84.552  1.00 14.89 ? 78   MET A O   1 
ATOM   638  C  CB  . MET A 1 77  ? 43.703 35.339 81.911  1.00 14.25 ? 78   MET A CB  1 
ATOM   639  C  CG  . MET A 1 77  ? 43.445 36.382 82.961  1.00 14.65 ? 78   MET A CG  1 
ATOM   640  S  SD  . MET A 1 77  ? 44.899 37.212 83.619  1.00 16.24 ? 78   MET A SD  1 
ATOM   641  C  CE  . MET A 1 77  ? 45.466 37.966 82.126  1.00 15.29 ? 78   MET A CE  1 
ATOM   642  N  N   . ALA A 1 78  ? 42.814 32.284 82.919  1.00 14.93 ? 79   ALA A N   1 
ATOM   643  C  CA  . ALA A 1 78  ? 42.101 31.441 83.898  1.00 16.97 ? 79   ALA A CA  1 
ATOM   644  C  C   . ALA A 1 78  ? 43.084 30.692 84.813  1.00 17.20 ? 79   ALA A C   1 
ATOM   645  O  O   . ALA A 1 78  ? 42.898 30.674 86.028  1.00 18.88 ? 79   ALA A O   1 
ATOM   646  C  CB  . ALA A 1 78  ? 41.192 30.387 83.233  1.00 16.18 ? 79   ALA A CB  1 
ATOM   647  N  N   . MET A 1 79  ? 44.150 30.126 84.267  1.00 15.70 ? 80   MET A N   1 
ATOM   648  C  CA  . MET A 1 79  ? 45.202 29.495 85.026  1.00 15.01 ? 80   MET A CA  1 
ATOM   649  C  C   . MET A 1 79  ? 46.041 30.440 85.879  1.00 14.62 ? 80   MET A C   1 
ATOM   650  O  O   . MET A 1 79  ? 46.498 30.038 86.950  1.00 14.55 ? 80   MET A O   1 
ATOM   651  C  CB  . MET A 1 79  ? 46.165 28.752 84.088  1.00 16.18 ? 80   MET A CB  1 
ATOM   652  C  CG  . MET A 1 79  ? 45.599 27.517 83.386  1.00 16.26 ? 80   MET A CG  1 
ATOM   653  S  SD  . MET A 1 79  ? 44.752 26.361 84.528  1.00 21.31 ? 80   MET A SD  1 
ATOM   654  C  CE  . MET A 1 79  ? 46.099 25.712 85.489  1.00 15.77 ? 80   MET A CE  1 
ATOM   655  N  N   . LEU A 1 80  ? 46.406 31.655 85.425  1.00 14.49 ? 81   LEU A N   1 
ATOM   656  C  CA  . LEU A 1 80  ? 47.121 32.593 86.302  1.00 14.34 ? 81   LEU A CA  1 
ATOM   657  C  C   . LEU A 1 80  ? 46.259 32.926 87.504  1.00 14.85 ? 81   LEU A C   1 
ATOM   658  O  O   . LEU A 1 80  ? 46.794 33.047 88.601  1.00 15.32 ? 81   LEU A O   1 
ATOM   659  C  CB  . LEU A 1 80  ? 47.466 33.888 85.628  1.00 11.43 ? 81   LEU A CB  1 
ATOM   660  C  CG  . LEU A 1 80  ? 48.635 33.884 84.690  1.00 11.65 ? 81   LEU A CG  1 
ATOM   661  C  CD1 . LEU A 1 80  ? 48.471 35.017 83.701  1.00 11.00 ? 81   LEU A CD1 1 
ATOM   662  C  CD2 . LEU A 1 80  ? 49.928 34.031 85.467  1.00 10.96 ? 81   LEU A CD2 1 
ATOM   663  N  N   . GLN A 1 81  ? 44.932 33.011 87.361  1.00 15.67 ? 82   GLN A N   1 
ATOM   664  C  CA  . GLN A 1 81  ? 44.084 33.193 88.531  1.00 16.43 ? 82   GLN A CA  1 
ATOM   665  C  C   . GLN A 1 81  ? 43.995 31.904 89.359  1.00 17.36 ? 82   GLN A C   1 
ATOM   666  O  O   . GLN A 1 81  ? 43.900 31.945 90.582  1.00 16.77 ? 82   GLN A O   1 
ATOM   667  C  CB  . GLN A 1 81  ? 42.706 33.637 88.056  1.00 16.89 ? 82   GLN A CB  1 
ATOM   668  C  CG  . GLN A 1 81  ? 42.640 35.028 87.381  1.00 16.11 ? 82   GLN A CG  1 
ATOM   669  C  CD  . GLN A 1 81  ? 41.230 35.483 87.004  1.00 16.41 ? 82   GLN A CD  1 
ATOM   670  O  OE1 . GLN A 1 81  ? 40.532 36.058 87.823  1.00 16.86 ? 82   GLN A OE1 1 
ATOM   671  N  NE2 . GLN A 1 81  ? 40.631 35.277 85.832  1.00 15.23 ? 82   GLN A NE2 1 
ATOM   672  N  N   . PHE A 1 82  ? 44.067 30.710 88.740  1.00 18.95 ? 83   PHE A N   1 
ATOM   673  C  CA  . PHE A 1 82  ? 44.088 29.462 89.477  1.00 20.28 ? 83   PHE A CA  1 
ATOM   674  C  C   . PHE A 1 82  ? 45.343 29.321 90.332  1.00 20.52 ? 83   PHE A C   1 
ATOM   675  O  O   . PHE A 1 82  ? 45.301 28.851 91.463  1.00 19.89 ? 83   PHE A O   1 
ATOM   676  C  CB  . PHE A 1 82  ? 43.994 28.294 88.502  1.00 22.21 ? 83   PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 82  ? 43.672 27.025 89.301  1.00 25.31 ? 83   PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 82  ? 42.381 26.881 89.861  1.00 25.39 ? 83   PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 82  ? 44.659 26.040 89.533  1.00 24.55 ? 83   PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 82  ? 42.102 25.763 90.648  1.00 24.53 ? 83   PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 82  ? 44.356 24.935 90.319  1.00 23.62 ? 83   PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 82  ? 43.087 24.803 90.871  1.00 23.79 ? 83   PHE A CZ  1 
ATOM   683  N  N   . ILE A 1 83  ? 46.494 29.674 89.774  1.00 21.22 ? 84   ILE A N   1 
ATOM   684  C  CA  . ILE A 1 83  ? 47.743 29.739 90.498  1.00 21.63 ? 84   ILE A CA  1 
ATOM   685  C  C   . ILE A 1 83  ? 47.589 30.653 91.704  1.00 21.72 ? 84   ILE A C   1 
ATOM   686  O  O   . ILE A 1 83  ? 48.004 30.263 92.779  1.00 21.83 ? 84   ILE A O   1 
ATOM   687  C  CB  . ILE A 1 83  ? 48.838 30.223 89.502  1.00 22.15 ? 84   ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 83  ? 49.141 29.134 88.464  1.00 21.41 ? 84   ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 83  ? 50.097 30.560 90.267  1.00 22.25 ? 84   ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 83  ? 50.239 29.493 87.446  1.00 19.48 ? 84   ILE A CD1 1 
ATOM   691  N  N   . SER A 1 84  ? 46.957 31.821 91.630  1.00 22.62 ? 85   SER A N   1 
ATOM   692  C  CA  . SER A 1 84  ? 46.805 32.663 92.806  1.00 23.12 ? 85   SER A CA  1 
ATOM   693  C  C   . SER A 1 84  ? 45.907 32.066 93.825  1.00 22.57 ? 85   SER A C   1 
ATOM   694  O  O   . SER A 1 84  ? 46.066 32.443 94.956  1.00 23.25 ? 85   SER A O   1 
ATOM   695  C  CB  . SER A 1 84  ? 46.210 34.027 92.511  1.00 24.36 ? 85   SER A CB  1 
ATOM   696  O  OG  . SER A 1 84  ? 46.799 34.602 91.333  1.00 28.42 ? 85   SER A OG  1 
ATOM   697  N  N   . SER A 1 85  ? 45.007 31.148 93.539  1.00 23.42 ? 86   SER A N   1 
ATOM   698  C  CA  . SER A 1 85  ? 44.120 30.637 94.573  1.00 24.76 ? 86   SER A CA  1 
ATOM   699  C  C   . SER A 1 85  ? 44.839 29.834 95.641  1.00 25.28 ? 86   SER A C   1 
ATOM   700  O  O   . SER A 1 85  ? 44.444 29.756 96.797  1.00 26.02 ? 86   SER A O   1 
ATOM   701  C  CB  . SER A 1 85  ? 43.047 29.750 93.937  1.00 24.28 ? 86   SER A CB  1 
ATOM   702  O  OG  . SER A 1 85  ? 43.605 28.546 93.410  1.00 22.87 ? 86   SER A OG  1 
ATOM   703  N  N   . GLY A 1 86  ? 45.858 29.127 95.176  1.00 26.81 ? 87   GLY A N   1 
ATOM   704  C  CA  . GLY A 1 86  ? 46.697 28.309 96.043  1.00 26.95 ? 87   GLY A CA  1 
ATOM   705  C  C   . GLY A 1 86  ? 46.302 26.839 96.042  1.00 27.61 ? 87   GLY A C   1 
ATOM   706  O  O   . GLY A 1 86  ? 46.995 26.067 96.709  1.00 27.19 ? 87   GLY A O   1 
ATOM   707  N  N   . LEU A 1 87  ? 45.247 26.446 95.292  1.00 27.80 ? 88   LEU A N   1 
ATOM   708  C  CA  . LEU A 1 87  ? 44.770 25.085 95.236  1.00 28.17 ? 88   LEU A CA  1 
ATOM   709  C  C   . LEU A 1 87  ? 45.688 24.181 94.419  1.00 27.86 ? 88   LEU A C   1 
ATOM   710  O  O   . LEU A 1 87  ? 46.201 24.555 93.372  1.00 27.87 ? 88   LEU A O   1 
ATOM   711  C  CB  . LEU A 1 87  ? 43.350 25.031 94.640  1.00 29.09 ? 88   LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 87  ? 42.209 25.793 95.324  1.00 30.27 ? 88   LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 87  ? 40.961 25.086 95.017  1.00 31.48 ? 88   LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 87  ? 42.181 25.667 96.815  1.00 30.79 ? 88   LEU A CD2 1 
ATOM   715  N  N   . PRO A 1 88  ? 45.950 22.971 94.895  1.00 28.34 ? 89   PRO A N   1 
ATOM   716  C  CA  . PRO A 1 88  ? 46.841 22.020 94.273  1.00 28.91 ? 89   PRO A CA  1 
ATOM   717  C  C   . PRO A 1 88  ? 46.391 21.273 93.047  1.00 30.06 ? 89   PRO A C   1 
ATOM   718  O  O   . PRO A 1 88  ? 47.255 20.937 92.234  1.00 31.93 ? 89   PRO A O   1 
ATOM   719  C  CB  . PRO A 1 88  ? 47.195 21.083 95.373  1.00 27.42 ? 89   PRO A CB  1 
ATOM   720  C  CG  . PRO A 1 88  ? 45.900 21.023 96.120  1.00 27.92 ? 89   PRO A CG  1 
ATOM   721  C  CD  . PRO A 1 88  ? 45.553 22.493 96.216  1.00 27.99 ? 89   PRO A CD  1 
ATOM   722  N  N   . LYS A 1 89  ? 45.101 20.997 92.846  1.00 30.22 ? 90   LYS A N   1 
ATOM   723  C  CA  . LYS A 1 89  ? 44.697 20.158 91.711  1.00 29.98 ? 90   LYS A CA  1 
ATOM   724  C  C   . LYS A 1 89  ? 43.330 20.639 91.240  1.00 27.67 ? 90   LYS A C   1 
ATOM   725  O  O   . LYS A 1 89  ? 42.625 21.231 92.056  1.00 29.07 ? 90   LYS A O   1 
ATOM   726  C  CB  . LYS A 1 89  ? 44.725 18.670 92.237  1.00 32.37 ? 90   LYS A CB  1 
ATOM   727  C  CG  . LYS A 1 89  ? 44.060 17.445 91.534  1.00 35.89 ? 90   LYS A CG  1 
ATOM   728  C  CD  . LYS A 1 89  ? 44.518 17.043 90.105  1.00 39.91 ? 90   LYS A CD  1 
ATOM   729  C  CE  . LYS A 1 89  ? 43.554 16.109 89.259  1.00 43.76 ? 90   LYS A CE  1 
ATOM   730  N  NZ  . LYS A 1 89  ? 42.414 16.767 88.584  1.00 45.09 ? 90   LYS A NZ  1 
ATOM   731  N  N   . VAL A 1 90  ? 42.950 20.513 89.961  1.00 24.55 ? 91   VAL A N   1 
ATOM   732  C  CA  . VAL A 1 90  ? 41.598 20.836 89.513  1.00 22.06 ? 91   VAL A CA  1 
ATOM   733  C  C   . VAL A 1 90  ? 40.630 19.746 89.994  1.00 21.81 ? 91   VAL A C   1 
ATOM   734  O  O   . VAL A 1 90  ? 40.986 18.566 90.030  1.00 21.92 ? 91   VAL A O   1 
ATOM   735  C  CB  . VAL A 1 90  ? 41.549 20.960 87.987  1.00 21.10 ? 91   VAL A CB  1 
ATOM   736  C  CG1 . VAL A 1 90  ? 42.553 22.021 87.614  1.00 20.65 ? 91   VAL A CG1 1 
ATOM   737  C  CG2 . VAL A 1 90  ? 41.945 19.719 87.242  1.00 21.43 ? 91   VAL A CG2 1 
ATOM   738  N  N   . ALA A 1 91  ? 39.439 20.108 90.487  1.00 19.62 ? 92   ALA A N   1 
ATOM   739  C  CA  . ALA A 1 91  ? 38.484 19.186 91.068  1.00 16.90 ? 92   ALA A CA  1 
ATOM   740  C  C   . ALA A 1 91  ? 37.506 18.539 90.116  1.00 16.83 ? 92   ALA A C   1 
ATOM   741  O  O   . ALA A 1 91  ? 36.782 17.642 90.535  1.00 16.91 ? 92   ALA A O   1 
ATOM   742  C  CB  . ALA A 1 91  ? 37.696 19.870 92.136  1.00 14.42 ? 92   ALA A CB  1 
ATOM   743  N  N   . VAL A 1 92  ? 37.456 18.900 88.825  1.00 16.40 ? 93   VAL A N   1 
ATOM   744  C  CA  . VAL A 1 92  ? 36.575 18.252 87.857  1.00 15.45 ? 93   VAL A CA  1 
ATOM   745  C  C   . VAL A 1 92  ? 37.406 17.963 86.602  1.00 14.70 ? 93   VAL A C   1 
ATOM   746  O  O   . VAL A 1 92  ? 38.427 18.614 86.448  1.00 16.14 ? 93   VAL A O   1 
ATOM   747  C  CB  . VAL A 1 92  ? 35.349 19.163 87.495  1.00 16.01 ? 93   VAL A CB  1 
ATOM   748  C  CG1 . VAL A 1 92  ? 34.594 19.425 88.792  1.00 14.85 ? 93   VAL A CG1 1 
ATOM   749  C  CG2 . VAL A 1 92  ? 35.744 20.465 86.805  1.00 15.69 ? 93   VAL A CG2 1 
ATOM   750  N  N   . PRO A 1 93  ? 37.139 17.042 85.672  1.00 14.49 ? 94   PRO A N   1 
ATOM   751  C  CA  . PRO A 1 93  ? 37.831 16.904 84.371  1.00 14.45 ? 94   PRO A CA  1 
ATOM   752  C  C   . PRO A 1 93  ? 37.901 18.188 83.567  1.00 13.82 ? 94   PRO A C   1 
ATOM   753  O  O   . PRO A 1 93  ? 36.853 18.747 83.274  1.00 13.11 ? 94   PRO A O   1 
ATOM   754  C  CB  . PRO A 1 93  ? 37.069 15.855 83.618  1.00 15.18 ? 94   PRO A CB  1 
ATOM   755  C  CG  . PRO A 1 93  ? 36.404 15.092 84.724  1.00 16.17 ? 94   PRO A CG  1 
ATOM   756  C  CD  . PRO A 1 93  ? 36.037 16.114 85.768  1.00 14.14 ? 94   PRO A CD  1 
ATOM   757  N  N   . SER A 1 94  ? 39.116 18.676 83.273  1.00 14.49 ? 95   SER A N   1 
ATOM   758  C  CA  . SER A 1 94  ? 39.367 19.927 82.568  1.00 14.21 ? 95   SER A CA  1 
ATOM   759  C  C   . SER A 1 94  ? 40.293 19.800 81.362  1.00 13.49 ? 95   SER A C   1 
ATOM   760  O  O   . SER A 1 94  ? 41.212 18.976 81.406  1.00 13.72 ? 95   SER A O   1 
ATOM   761  C  CB  . SER A 1 94  ? 39.965 20.903 83.563  1.00 15.36 ? 95   SER A CB  1 
ATOM   762  O  OG  . SER A 1 94  ? 39.141 21.103 84.702  1.00 19.87 ? 95   SER A OG  1 
ATOM   763  N  N   . THR A 1 95  ? 40.118 20.606 80.286  1.00 13.15 ? 96   THR A N   1 
ATOM   764  C  CA  . THR A 1 95  ? 41.011 20.566 79.105  1.00 12.99 ? 96   THR A CA  1 
ATOM   765  C  C   . THR A 1 95  ? 41.513 21.964 78.607  1.00 13.00 ? 96   THR A C   1 
ATOM   766  O  O   . THR A 1 95  ? 40.924 23.025 78.876  1.00 13.17 ? 96   THR A O   1 
ATOM   767  C  CB  . THR A 1 95  ? 40.354 19.831 77.831  1.00 12.40 ? 96   THR A CB  1 
ATOM   768  O  OG1 . THR A 1 95  ? 39.078 20.422 77.537  1.00 9.94  ? 96   THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 95  ? 40.228 18.324 78.050  1.00 11.36 ? 96   THR A CG2 1 
ATOM   770  N  N   . ILE A 1 96  ? 42.684 21.994 77.927  1.00 11.61 ? 97   ILE A N   1 
ATOM   771  C  CA  . ILE A 1 96  ? 43.207 23.193 77.286  1.00 8.59  ? 97   ILE A CA  1 
ATOM   772  C  C   . ILE A 1 96  ? 43.312 22.809 75.826  1.00 6.89  ? 97   ILE A C   1 
ATOM   773  O  O   . ILE A 1 96  ? 43.694 21.693 75.505  1.00 5.36  ? 97   ILE A O   1 
ATOM   774  C  CB  . ILE A 1 96  ? 44.592 23.598 77.916  1.00 7.90  ? 97   ILE A CB  1 
ATOM   775  C  CG1 . ILE A 1 96  ? 44.338 24.022 79.343  1.00 7.99  ? 97   ILE A CG1 1 
ATOM   776  C  CG2 . ILE A 1 96  ? 45.256 24.735 77.151  1.00 6.83  ? 97   ILE A CG2 1 
ATOM   777  C  CD1 . ILE A 1 96  ? 45.524 24.414 80.242  1.00 7.80  ? 97   ILE A CD1 1 
ATOM   778  N  N   . HIS A 1 97  ? 42.906 23.727 74.941  1.00 6.61  ? 98   HIS A N   1 
ATOM   779  C  CA  . HIS A 1 97  ? 42.916 23.519 73.500  1.00 7.38  ? 98   HIS A CA  1 
ATOM   780  C  C   . HIS A 1 97  ? 43.716 24.571 72.812  1.00 6.76  ? 98   HIS A C   1 
ATOM   781  O  O   . HIS A 1 97  ? 43.392 25.703 73.001  1.00 7.33  ? 98   HIS A O   1 
ATOM   782  C  CB  . HIS A 1 97  ? 41.500 23.573 72.954  1.00 8.28  ? 98   HIS A CB  1 
ATOM   783  C  CG  . HIS A 1 97  ? 40.690 22.392 73.442  1.00 10.55 ? 98   HIS A CG  1 
ATOM   784  N  ND1 . HIS A 1 97  ? 40.404 21.298 72.768  1.00 12.07 ? 98   HIS A ND1 1 
ATOM   785  C  CD2 . HIS A 1 97  ? 40.133 22.257 74.696  1.00 12.66 ? 98   HIS A CD2 1 
ATOM   786  C  CE1 . HIS A 1 97  ? 39.702 20.509 73.545  1.00 13.51 ? 98   HIS A CE1 1 
ATOM   787  N  NE2 . HIS A 1 97  ? 39.548 21.093 74.704  1.00 13.68 ? 98   HIS A NE2 1 
ATOM   788  N  N   . CYS A 1 98  ? 44.704 24.311 71.994  1.00 7.68  ? 99   CYS A N   1 
ATOM   789  C  CA  . CYS A 1 98  ? 45.525 25.345 71.405  1.00 8.11  ? 99   CYS A CA  1 
ATOM   790  C  C   . CYS A 1 98  ? 45.148 25.558 69.971  1.00 8.83  ? 99   CYS A C   1 
ATOM   791  O  O   . CYS A 1 98  ? 45.754 25.014 69.053  1.00 9.22  ? 99   CYS A O   1 
ATOM   792  C  CB  . CYS A 1 98  ? 46.984 24.944 71.483  1.00 7.67  ? 99   CYS A CB  1 
ATOM   793  S  SG  . CYS A 1 98  ? 47.593 24.761 73.178  1.00 8.63  ? 99   CYS A SG  1 
ATOM   794  N  N   . ASP A 1 99  ? 44.153 26.425 69.827  1.00 9.02  ? 100  ASP A N   1 
ATOM   795  C  CA  . ASP A 1 99  ? 43.536 26.745 68.541  1.00 8.46  ? 100  ASP A CA  1 
ATOM   796  C  C   . ASP A 1 99  ? 43.547 28.186 68.081  1.00 8.86  ? 100  ASP A C   1 
ATOM   797  O  O   . ASP A 1 99  ? 43.365 28.434 66.911  1.00 8.30  ? 100  ASP A O   1 
ATOM   798  C  CB  . ASP A 1 99  ? 42.086 26.280 68.572  1.00 7.81  ? 100  ASP A CB  1 
ATOM   799  C  CG  . ASP A 1 99  ? 41.252 26.825 69.728  1.00 9.87  ? 100  ASP A CG  1 
ATOM   800  O  OD1 . ASP A 1 99  ? 41.712 27.406 70.744  1.00 7.88  ? 100  ASP A OD1 1 
ATOM   801  O  OD2 . ASP A 1 99  ? 40.055 26.664 69.564  1.00 11.88 ? 100  ASP A OD2 1 
ATOM   802  N  N   . HIS A 1 100 ? 43.758 29.157 68.975  1.00 11.83 ? 101  HIS A N   1 
ATOM   803  C  CA  . HIS A 1 100 ? 43.576 30.581 68.728  1.00 14.68 ? 101  HIS A CA  1 
ATOM   804  C  C   . HIS A 1 100 ? 44.791 31.348 68.258  1.00 17.01 ? 101  HIS A C   1 
ATOM   805  O  O   . HIS A 1 100 ? 44.657 32.397 67.590  1.00 18.83 ? 101  HIS A O   1 
ATOM   806  C  CB  . HIS A 1 100 ? 43.022 31.232 70.009  1.00 15.24 ? 101  HIS A CB  1 
ATOM   807  C  CG  . HIS A 1 100 ? 41.512 31.071 70.158  1.00 16.91 ? 101  HIS A CG  1 
ATOM   808  N  ND1 . HIS A 1 100 ? 40.684 30.027 70.324  1.00 17.45 ? 101  HIS A ND1 1 
ATOM   809  C  CD2 . HIS A 1 100 ? 40.700 32.145 69.959  1.00 18.74 ? 101  HIS A CD2 1 
ATOM   810  C  CE1 . HIS A 1 100 ? 39.436 30.416 70.193  1.00 16.51 ? 101  HIS A CE1 1 
ATOM   811  N  NE2 . HIS A 1 100 ? 39.478 31.702 69.971  1.00 18.59 ? 101  HIS A NE2 1 
ATOM   812  N  N   . LEU A 1 101 ? 45.984 30.815 68.562  1.00 16.99 ? 102  LEU A N   1 
ATOM   813  C  CA  . LEU A 1 101 ? 47.227 31.513 68.264  1.00 16.72 ? 102  LEU A CA  1 
ATOM   814  C  C   . LEU A 1 101 ? 48.007 31.155 67.001  1.00 17.38 ? 102  LEU A C   1 
ATOM   815  O  O   . LEU A 1 101 ? 49.189 31.492 66.840  1.00 17.22 ? 102  LEU A O   1 
ATOM   816  C  CB  . LEU A 1 101 ? 48.057 31.348 69.546  1.00 15.18 ? 102  LEU A CB  1 
ATOM   817  C  CG  . LEU A 1 101 ? 47.453 31.966 70.841  1.00 14.41 ? 102  LEU A CG  1 
ATOM   818  C  CD1 . LEU A 1 101 ? 48.493 31.928 71.918  1.00 12.05 ? 102  LEU A CD1 1 
ATOM   819  C  CD2 . LEU A 1 101 ? 47.021 33.436 70.630  1.00 12.67 ? 102  LEU A CD2 1 
ATOM   820  N  N   . ILE A 1 102 ? 47.320 30.530 66.052  1.00 17.36 ? 103  ILE A N   1 
ATOM   821  C  CA  . ILE A 1 102 ? 47.998 30.062 64.864  1.00 17.99 ? 103  ILE A CA  1 
ATOM   822  C  C   . ILE A 1 102 ? 47.533 30.908 63.682  1.00 19.52 ? 103  ILE A C   1 
ATOM   823  O  O   . ILE A 1 102 ? 46.456 30.732 63.103  1.00 19.80 ? 103  ILE A O   1 
ATOM   824  C  CB  . ILE A 1 102 ? 47.685 28.537 64.610  1.00 18.52 ? 103  ILE A CB  1 
ATOM   825  C  CG1 . ILE A 1 102 ? 48.070 27.718 65.850  1.00 17.77 ? 103  ILE A CG1 1 
ATOM   826  C  CG2 . ILE A 1 102 ? 48.436 28.029 63.359  1.00 16.31 ? 103  ILE A CG2 1 
ATOM   827  C  CD1 . ILE A 1 102 ? 47.665 26.254 65.772  1.00 17.23 ? 103  ILE A CD1 1 
ATOM   828  N  N   . GLU A 1 103 ? 48.423 31.841 63.329  1.00 21.15 ? 104  GLU A N   1 
ATOM   829  C  CA  . GLU A 1 103 ? 48.240 32.813 62.258  1.00 21.64 ? 104  GLU A CA  1 
ATOM   830  C  C   . GLU A 1 103 ? 48.325 32.323 60.839  1.00 21.77 ? 104  GLU A C   1 
ATOM   831  O  O   . GLU A 1 103 ? 49.331 31.722 60.466  1.00 22.96 ? 104  GLU A O   1 
ATOM   832  C  CB  . GLU A 1 103 ? 49.259 33.896 62.426  1.00 21.44 ? 104  GLU A CB  1 
ATOM   833  C  CG  . GLU A 1 103 ? 48.842 35.074 61.584  1.00 21.83 ? 104  GLU A CG  1 
ATOM   834  C  CD  . GLU A 1 103 ? 49.942 35.986 61.177  1.00 21.08 ? 104  GLU A CD  1 
ATOM   835  O  OE1 . GLU A 1 103 ? 50.542 35.680 60.176  1.00 24.43 ? 104  GLU A OE1 1 
ATOM   836  O  OE2 . GLU A 1 103 ? 50.184 36.982 61.820  1.00 19.39 ? 104  GLU A OE2 1 
ATOM   837  N  N   . ALA A 1 104 ? 47.359 32.773 60.046  1.00 21.68 ? 105  ALA A N   1 
ATOM   838  C  CA  . ALA A 1 104 ? 47.257 32.407 58.646  1.00 23.51 ? 105  ALA A CA  1 
ATOM   839  C  C   . ALA A 1 104 ? 48.070 33.279 57.708  1.00 24.59 ? 105  ALA A C   1 
ATOM   840  O  O   . ALA A 1 104 ? 47.976 34.503 57.676  1.00 25.11 ? 105  ALA A O   1 
ATOM   841  C  CB  . ALA A 1 104 ? 45.840 32.483 58.144  1.00 22.87 ? 105  ALA A CB  1 
ATOM   842  N  N   . GLN A 1 105 ? 48.964 32.630 56.970  1.00 25.28 ? 106  GLN A N   1 
ATOM   843  C  CA  . GLN A 1 105 ? 49.805 33.328 56.012  1.00 25.51 ? 106  GLN A CA  1 
ATOM   844  C  C   . GLN A 1 105 ? 50.188 32.504 54.788  1.00 25.28 ? 106  GLN A C   1 
ATOM   845  O  O   . GLN A 1 105 ? 49.932 32.866 53.644  1.00 25.19 ? 106  GLN A O   1 
ATOM   846  C  CB  . GLN A 1 105 ? 51.059 33.780 56.749  1.00 26.98 ? 106  GLN A CB  1 
ATOM   847  C  CG  . GLN A 1 105 ? 52.019 34.638 55.946  1.00 28.71 ? 106  GLN A CG  1 
ATOM   848  C  CD  . GLN A 1 105 ? 53.313 34.872 56.692  1.00 30.81 ? 106  GLN A CD  1 
ATOM   849  O  OE1 . GLN A 1 105 ? 54.082 33.958 57.002  1.00 31.41 ? 106  GLN A OE1 1 
ATOM   850  N  NE2 . GLN A 1 105 ? 53.536 36.147 56.992  1.00 32.72 ? 106  GLN A NE2 1 
ATOM   851  N  N   . LEU A 1 106 ? 50.767 31.354 55.074  1.00 25.09 ? 107  LEU A N   1 
ATOM   852  C  CA  . LEU A 1 106 ? 51.362 30.457 54.114  1.00 26.21 ? 107  LEU A CA  1 
ATOM   853  C  C   . LEU A 1 106 ? 50.503 29.223 53.846  1.00 26.96 ? 107  LEU A C   1 
ATOM   854  O  O   . LEU A 1 106 ? 50.682 28.525 52.842  1.00 28.29 ? 107  LEU A O   1 
ATOM   855  C  CB  . LEU A 1 106 ? 52.721 30.058 54.693  1.00 27.22 ? 107  LEU A CB  1 
ATOM   856  C  CG  . LEU A 1 106 ? 54.113 30.456 54.201  1.00 27.75 ? 107  LEU A CG  1 
ATOM   857  C  CD1 . LEU A 1 106 ? 54.153 31.910 53.811  1.00 27.79 ? 107  LEU A CD1 1 
ATOM   858  C  CD2 . LEU A 1 106 ? 55.113 30.127 55.307  1.00 28.31 ? 107  LEU A CD2 1 
ATOM   859  N  N   . GLY A 1 107 ? 49.625 28.884 54.791  1.00 26.34 ? 108  GLY A N   1 
ATOM   860  C  CA  . GLY A 1 107 ? 48.771 27.719 54.682  1.00 26.04 ? 108  GLY A CA  1 
ATOM   861  C  C   . GLY A 1 107 ? 49.339 26.568 55.491  1.00 26.41 ? 108  GLY A C   1 
ATOM   862  O  O   . GLY A 1 107 ? 50.519 26.606 55.855  1.00 27.28 ? 108  GLY A O   1 
ATOM   863  N  N   . GLY A 1 108 ? 48.440 25.640 55.844  1.00 25.59 ? 109  GLY A N   1 
ATOM   864  C  CA  . GLY A 1 108 ? 48.706 24.356 56.460  1.00 26.70 ? 109  GLY A CA  1 
ATOM   865  C  C   . GLY A 1 108 ? 49.800 24.124 57.493  1.00 28.15 ? 109  GLY A C   1 
ATOM   866  O  O   . GLY A 1 108 ? 49.727 24.564 58.643  1.00 28.25 ? 109  GLY A O   1 
ATOM   867  N  N   . GLU A 1 109 ? 50.797 23.308 57.104  1.00 29.54 ? 110  GLU A N   1 
ATOM   868  C  CA  . GLU A 1 109 ? 51.861 22.936 58.020  1.00 31.10 ? 110  GLU A CA  1 
ATOM   869  C  C   . GLU A 1 109 ? 52.972 23.959 58.129  1.00 29.33 ? 110  GLU A C   1 
ATOM   870  O  O   . GLU A 1 109 ? 53.676 23.895 59.129  1.00 29.23 ? 110  GLU A O   1 
ATOM   871  C  CB  . GLU A 1 109 ? 52.400 21.525 57.627  1.00 35.53 ? 110  GLU A CB  1 
ATOM   872  C  CG  . GLU A 1 109 ? 52.741 21.139 56.210  1.00 42.91 ? 110  GLU A CG  1 
ATOM   873  C  CD  . GLU A 1 109 ? 54.156 21.467 55.744  1.00 47.90 ? 110  GLU A CD  1 
ATOM   874  O  OE1 . GLU A 1 109 ? 54.472 22.650 55.545  1.00 51.13 ? 110  GLU A OE1 1 
ATOM   875  O  OE2 . GLU A 1 109 ? 54.929 20.515 55.585  1.00 50.11 ? 110  GLU A OE2 1 
ATOM   876  N  N   . LYS A 1 110 ? 53.178 24.874 57.149  1.00 27.84 ? 111  LYS A N   1 
ATOM   877  C  CA  . LYS A 1 110 ? 54.093 26.007 57.294  1.00 26.52 ? 111  LYS A CA  1 
ATOM   878  C  C   . LYS A 1 110 ? 53.723 26.934 58.451  1.00 25.72 ? 111  LYS A C   1 
ATOM   879  O  O   . LYS A 1 110 ? 54.587 27.217 59.294  1.00 26.17 ? 111  LYS A O   1 
ATOM   880  C  CB  . LYS A 1 110 ? 54.114 26.843 56.076  1.00 26.44 ? 111  LYS A CB  1 
ATOM   881  C  CG  . LYS A 1 110 ? 55.026 26.238 55.091  1.00 28.17 ? 111  LYS A CG  1 
ATOM   882  C  CD  . LYS A 1 110 ? 54.760 26.865 53.740  1.00 29.29 ? 111  LYS A CD  1 
ATOM   883  C  CE  . LYS A 1 110 ? 55.628 26.164 52.713  1.00 31.02 ? 111  LYS A CE  1 
ATOM   884  N  NZ  . LYS A 1 110 ? 56.994 26.452 53.095  1.00 34.08 ? 111  LYS A NZ  1 
ATOM   885  N  N   . ASP A 1 111 ? 52.452 27.410 58.477  1.00 23.47 ? 112  ASP A N   1 
ATOM   886  C  CA  . ASP A 1 111 ? 51.933 28.217 59.577  1.00 21.27 ? 112  ASP A CA  1 
ATOM   887  C  C   . ASP A 1 111 ? 51.963 27.517 60.902  1.00 20.45 ? 112  ASP A C   1 
ATOM   888  O  O   . ASP A 1 111 ? 52.247 28.186 61.881  1.00 20.68 ? 112  ASP A O   1 
ATOM   889  C  CB  . ASP A 1 111 ? 50.505 28.642 59.354  1.00 19.65 ? 112  ASP A CB  1 
ATOM   890  C  CG  . ASP A 1 111 ? 50.366 29.487 58.120  1.00 18.75 ? 112  ASP A CG  1 
ATOM   891  O  OD1 . ASP A 1 111 ? 51.301 30.160 57.722  1.00 18.90 ? 112  ASP A OD1 1 
ATOM   892  O  OD2 . ASP A 1 111 ? 49.312 29.478 57.526  1.00 19.23 ? 112  ASP A OD2 1 
ATOM   893  N  N   . LEU A 1 112 ? 51.697 26.216 60.973  1.00 20.00 ? 113  LEU A N   1 
ATOM   894  C  CA  . LEU A 1 112 ? 51.792 25.498 62.231  1.00 20.47 ? 113  LEU A CA  1 
ATOM   895  C  C   . LEU A 1 112 ? 53.187 25.494 62.829  1.00 21.00 ? 113  LEU A C   1 
ATOM   896  O  O   . LEU A 1 112 ? 53.346 25.791 64.022  1.00 19.81 ? 113  LEU A O   1 
ATOM   897  C  CB  . LEU A 1 112 ? 51.301 24.055 62.044  1.00 20.47 ? 113  LEU A CB  1 
ATOM   898  C  CG  . LEU A 1 112 ? 51.272 23.207 63.304  1.00 20.49 ? 113  LEU A CG  1 
ATOM   899  C  CD1 . LEU A 1 112 ? 50.395 23.868 64.366  1.00 21.13 ? 113  LEU A CD1 1 
ATOM   900  C  CD2 . LEU A 1 112 ? 50.733 21.843 62.941  1.00 20.77 ? 113  LEU A CD2 1 
ATOM   901  N  N   . ARG A 1 113 ? 54.166 25.188 61.967  1.00 22.03 ? 114  ARG A N   1 
ATOM   902  C  CA  . ARG A 1 113 ? 55.604 25.233 62.288  1.00 23.74 ? 114  ARG A CA  1 
ATOM   903  C  C   . ARG A 1 113 ? 56.109 26.558 62.876  1.00 23.68 ? 114  ARG A C   1 
ATOM   904  O  O   . ARG A 1 113 ? 56.839 26.588 63.886  1.00 22.84 ? 114  ARG A O   1 
ATOM   905  C  CB  . ARG A 1 113 ? 56.437 24.973 61.054  1.00 25.12 ? 114  ARG A CB  1 
ATOM   906  C  CG  . ARG A 1 113 ? 56.330 23.550 60.596  1.00 28.41 ? 114  ARG A CG  1 
ATOM   907  C  CD  . ARG A 1 113 ? 57.664 23.109 59.925  1.00 31.27 ? 114  ARG A CD  1 
ATOM   908  N  NE  . ARG A 1 113 ? 57.679 23.468 58.520  1.00 33.31 ? 114  ARG A NE  1 
ATOM   909  C  CZ  . ARG A 1 113 ? 57.049 22.741 57.586  1.00 34.46 ? 114  ARG A CZ  1 
ATOM   910  N  NH1 . ARG A 1 113 ? 56.410 21.610 57.883  1.00 33.98 ? 114  ARG A NH1 1 
ATOM   911  N  NH2 . ARG A 1 113 ? 57.059 23.167 56.314  1.00 35.71 ? 114  ARG A NH2 1 
ATOM   912  N  N   . ARG A 1 114 ? 55.710 27.644 62.157  1.00 23.13 ? 115  ARG A N   1 
ATOM   913  C  CA  . ARG A 1 114 ? 55.962 29.025 62.544  1.00 22.34 ? 115  ARG A CA  1 
ATOM   914  C  C   . ARG A 1 114 ? 55.254 29.372 63.861  1.00 20.69 ? 115  ARG A C   1 
ATOM   915  O  O   . ARG A 1 114 ? 55.893 29.943 64.740  1.00 20.27 ? 115  ARG A O   1 
ATOM   916  C  CB  . ARG A 1 114 ? 55.497 29.902 61.388  1.00 24.30 ? 115  ARG A CB  1 
ATOM   917  C  CG  . ARG A 1 114 ? 55.806 31.396 61.534  1.00 29.23 ? 115  ARG A CG  1 
ATOM   918  C  CD  . ARG A 1 114 ? 55.091 32.168 60.430  1.00 33.50 ? 115  ARG A CD  1 
ATOM   919  N  NE  . ARG A 1 114 ? 54.705 33.531 60.802  1.00 37.75 ? 115  ARG A NE  1 
ATOM   920  C  CZ  . ARG A 1 114 ? 53.479 34.008 60.548  1.00 40.92 ? 115  ARG A CZ  1 
ATOM   921  N  NH1 . ARG A 1 114 ? 52.434 33.306 60.011  1.00 42.22 ? 115  ARG A NH1 1 
ATOM   922  N  NH2 . ARG A 1 114 ? 53.283 35.266 60.894  1.00 42.30 ? 115  ARG A NH2 1 
ATOM   923  N  N   . ALA A 1 115 ? 53.969 29.051 64.066  1.00 18.99 ? 116  ALA A N   1 
ATOM   924  C  CA  . ALA A 1 115 ? 53.275 29.219 65.339  1.00 18.59 ? 116  ALA A CA  1 
ATOM   925  C  C   . ALA A 1 115 ? 53.946 28.527 66.533  1.00 19.02 ? 116  ALA A C   1 
ATOM   926  O  O   . ALA A 1 115 ? 53.972 28.984 67.689  1.00 19.87 ? 116  ALA A O   1 
ATOM   927  C  CB  . ALA A 1 115 ? 51.833 28.675 65.221  1.00 17.04 ? 116  ALA A CB  1 
ATOM   928  N  N   . LYS A 1 116 ? 54.536 27.370 66.285  1.00 19.08 ? 117  LYS A N   1 
ATOM   929  C  CA  . LYS A 1 116 ? 55.157 26.677 67.371  1.00 19.87 ? 117  LYS A CA  1 
ATOM   930  C  C   . LYS A 1 116 ? 56.428 27.312 67.825  1.00 21.11 ? 117  LYS A C   1 
ATOM   931  O  O   . LYS A 1 116 ? 56.810 27.154 68.977  1.00 21.69 ? 117  LYS A O   1 
ATOM   932  C  CB  . LYS A 1 116 ? 55.425 25.262 66.979  1.00 20.20 ? 117  LYS A CB  1 
ATOM   933  C  CG  . LYS A 1 116 ? 54.136 24.453 66.984  1.00 20.32 ? 117  LYS A CG  1 
ATOM   934  C  CD  . LYS A 1 116 ? 54.551 23.018 66.960  1.00 19.09 ? 117  LYS A CD  1 
ATOM   935  C  CE  . LYS A 1 116 ? 53.325 22.333 66.489  1.00 22.08 ? 117  LYS A CE  1 
ATOM   936  N  NZ  . LYS A 1 116 ? 53.725 21.122 65.788  1.00 25.99 ? 117  LYS A NZ  1 
ATOM   937  N  N   . ASP A 1 117 ? 57.100 28.007 66.909  1.00 22.56 ? 118  ASP A N   1 
ATOM   938  C  CA  . ASP A 1 117 ? 58.311 28.744 67.248  1.00 23.23 ? 118  ASP A CA  1 
ATOM   939  C  C   . ASP A 1 117 ? 57.946 30.004 68.027  1.00 22.04 ? 118  ASP A C   1 
ATOM   940  O  O   . ASP A 1 117 ? 58.312 30.150 69.188  1.00 23.13 ? 118  ASP A O   1 
ATOM   941  C  CB  . ASP A 1 117 ? 59.074 29.118 65.946  1.00 25.33 ? 118  ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 117 ? 60.344 29.964 66.064  1.00 27.48 ? 118  ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 117 ? 61.056 29.864 67.077  1.00 27.13 ? 118  ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 117 ? 60.607 30.715 65.110  1.00 29.94 ? 118  ASP A OD2 1 
ATOM   945  N  N   . ILE A 1 118 ? 57.270 30.929 67.352  1.00 20.92 ? 119  ILE A N   1 
ATOM   946  C  CA  . ILE A 1 118 ? 56.811 32.213 67.874  1.00 20.68 ? 119  ILE A CA  1 
ATOM   947  C  C   . ILE A 1 118 ? 56.119 32.215 69.240  1.00 21.38 ? 119  ILE A C   1 
ATOM   948  O  O   . ILE A 1 118 ? 56.327 33.125 70.042  1.00 19.63 ? 119  ILE A O   1 
ATOM   949  C  CB  . ILE A 1 118 ? 55.912 32.807 66.703  1.00 20.54 ? 119  ILE A CB  1 
ATOM   950  C  CG1 . ILE A 1 118 ? 56.839 33.339 65.643  1.00 21.35 ? 119  ILE A CG1 1 
ATOM   951  C  CG2 . ILE A 1 118 ? 54.983 33.923 67.133  1.00 18.64 ? 119  ILE A CG2 1 
ATOM   952  C  CD1 . ILE A 1 118 ? 56.055 33.754 64.369  1.00 22.97 ? 119  ILE A CD1 1 
ATOM   953  N  N   . ASN A 1 119 ? 55.266 31.192 69.475  1.00 22.99 ? 120  ASN A N   1 
ATOM   954  C  CA  . ASN A 1 119 ? 54.440 31.128 70.671  1.00 23.09 ? 120  ASN A CA  1 
ATOM   955  C  C   . ASN A 1 119 ? 54.899 30.108 71.676  1.00 23.37 ? 120  ASN A C   1 
ATOM   956  O  O   . ASN A 1 119 ? 54.165 29.829 72.605  1.00 23.08 ? 120  ASN A O   1 
ATOM   957  C  CB  . ASN A 1 119 ? 53.018 30.791 70.306  1.00 22.41 ? 120  ASN A CB  1 
ATOM   958  C  CG  . ASN A 1 119 ? 52.288 31.779 69.425  1.00 21.72 ? 120  ASN A CG  1 
ATOM   959  O  OD1 . ASN A 1 119 ? 51.968 32.889 69.833  1.00 22.33 ? 120  ASN A OD1 1 
ATOM   960  N  ND2 . ASN A 1 119 ? 52.034 31.396 68.176  1.00 21.45 ? 120  ASN A ND2 1 
ATOM   961  N  N   . GLN A 1 120 ? 56.075 29.510 71.513  1.00 25.36 ? 121  GLN A N   1 
ATOM   962  C  CA  . GLN A 1 120 ? 56.603 28.492 72.422  1.00 27.24 ? 121  GLN A CA  1 
ATOM   963  C  C   . GLN A 1 120 ? 56.543 28.804 73.933  1.00 27.07 ? 121  GLN A C   1 
ATOM   964  O  O   . GLN A 1 120 ? 56.207 27.955 74.764  1.00 26.60 ? 121  GLN A O   1 
ATOM   965  C  CB  . GLN A 1 120 ? 58.009 28.254 72.041  1.00 29.87 ? 121  GLN A CB  1 
ATOM   966  C  CG  . GLN A 1 120 ? 58.224 26.811 72.315  1.00 36.13 ? 121  GLN A CG  1 
ATOM   967  C  CD  . GLN A 1 120 ? 59.677 26.497 72.614  1.00 40.22 ? 121  GLN A CD  1 
ATOM   968  O  OE1 . GLN A 1 120 ? 60.561 26.532 71.741  1.00 42.94 ? 121  GLN A OE1 1 
ATOM   969  N  NE2 . GLN A 1 120 ? 59.911 26.209 73.906  1.00 42.48 ? 121  GLN A NE2 1 
ATOM   970  N  N   . GLU A 1 121 ? 56.821 30.071 74.267  1.00 26.15 ? 122  GLU A N   1 
ATOM   971  C  CA  . GLU A 1 121 ? 56.760 30.567 75.628  1.00 24.87 ? 122  GLU A CA  1 
ATOM   972  C  C   . GLU A 1 121 ? 55.379 30.281 76.252  1.00 24.94 ? 122  GLU A C   1 
ATOM   973  O  O   . GLU A 1 121 ? 55.267 29.792 77.380  1.00 26.05 ? 122  GLU A O   1 
ATOM   974  C  CB  . GLU A 1 121 ? 57.011 32.043 75.578  1.00 23.90 ? 122  GLU A CB  1 
ATOM   975  C  CG  . GLU A 1 121 ? 57.313 32.534 76.980  1.00 22.84 ? 122  GLU A CG  1 
ATOM   976  C  CD  . GLU A 1 121 ? 57.272 34.056 77.179  1.00 22.85 ? 122  GLU A CD  1 
ATOM   977  O  OE1 . GLU A 1 121 ? 57.374 34.852 76.220  1.00 22.38 ? 122  GLU A OE1 1 
ATOM   978  O  OE2 . GLU A 1 121 ? 57.156 34.427 78.343  1.00 20.96 ? 122  GLU A OE2 1 
ATOM   979  N  N   . VAL A 1 122 ? 54.334 30.499 75.454  1.00 23.20 ? 123  VAL A N   1 
ATOM   980  C  CA  . VAL A 1 122 ? 52.966 30.401 75.883  1.00 22.81 ? 123  VAL A CA  1 
ATOM   981  C  C   . VAL A 1 122 ? 52.429 28.960 75.999  1.00 21.88 ? 123  VAL A C   1 
ATOM   982  O  O   . VAL A 1 122 ? 51.768 28.630 77.011  1.00 19.22 ? 123  VAL A O   1 
ATOM   983  C  CB  . VAL A 1 122 ? 52.235 31.329 74.878  1.00 23.20 ? 123  VAL A CB  1 
ATOM   984  C  CG1 . VAL A 1 122 ? 50.808 30.907 74.670  1.00 24.10 ? 123  VAL A CG1 1 
ATOM   985  C  CG2 . VAL A 1 122 ? 52.200 32.753 75.470  1.00 23.80 ? 123  VAL A CG2 1 
ATOM   986  N  N   . TYR A 1 123 ? 52.758 28.159 74.951  1.00 21.21 ? 124  TYR A N   1 
ATOM   987  C  CA  . TYR A 1 123 ? 52.363 26.763 74.869  1.00 22.29 ? 124  TYR A CA  1 
ATOM   988  C  C   . TYR A 1 123 ? 53.099 25.995 75.950  1.00 23.09 ? 124  TYR A C   1 
ATOM   989  O  O   . TYR A 1 123 ? 52.576 25.034 76.534  1.00 24.13 ? 124  TYR A O   1 
ATOM   990  C  CB  . TYR A 1 123 ? 52.710 26.117 73.545  1.00 21.95 ? 124  TYR A CB  1 
ATOM   991  C  CG  . TYR A 1 123 ? 52.035 26.694 72.298  1.00 22.82 ? 124  TYR A CG  1 
ATOM   992  C  CD1 . TYR A 1 123 ? 50.736 27.239 72.322  1.00 23.47 ? 124  TYR A CD1 1 
ATOM   993  C  CD2 . TYR A 1 123 ? 52.735 26.640 71.084  1.00 22.78 ? 124  TYR A CD2 1 
ATOM   994  C  CE1 . TYR A 1 123 ? 50.137 27.735 71.141  1.00 23.52 ? 124  TYR A CE1 1 
ATOM   995  C  CE2 . TYR A 1 123 ? 52.164 27.116 69.902  1.00 23.58 ? 124  TYR A CE2 1 
ATOM   996  C  CZ  . TYR A 1 123 ? 50.857 27.666 69.931  1.00 24.71 ? 124  TYR A CZ  1 
ATOM   997  O  OH  . TYR A 1 123 ? 50.287 28.141 68.748  1.00 24.67 ? 124  TYR A OH  1 
ATOM   998  N  N   . ASN A 1 124 ? 54.304 26.479 76.245  1.00 23.17 ? 125  ASN A N   1 
ATOM   999  C  CA  . ASN A 1 124 ? 55.073 25.938 77.341  1.00 22.96 ? 125  ASN A CA  1 
ATOM   1000 C  C   . ASN A 1 124 ? 54.486 26.172 78.714  1.00 21.99 ? 125  ASN A C   1 
ATOM   1001 O  O   . ASN A 1 124 ? 54.600 25.336 79.613  1.00 20.70 ? 125  ASN A O   1 
ATOM   1002 C  CB  . ASN A 1 124 ? 56.429 26.527 77.371  1.00 26.00 ? 125  ASN A CB  1 
ATOM   1003 C  CG  . ASN A 1 124 ? 57.317 25.424 77.850  1.00 28.03 ? 125  ASN A CG  1 
ATOM   1004 O  OD1 . ASN A 1 124 ? 57.654 24.545 77.058  1.00 31.42 ? 125  ASN A OD1 1 
ATOM   1005 N  ND2 . ASN A 1 124 ? 57.664 25.413 79.131  1.00 28.71 ? 125  ASN A ND2 1 
ATOM   1006 N  N   . PHE A 1 125 ? 53.960 27.386 78.877  1.00 20.79 ? 126  PHE A N   1 
ATOM   1007 C  CA  . PHE A 1 125 ? 53.318 27.736 80.108  1.00 20.32 ? 126  PHE A CA  1 
ATOM   1008 C  C   . PHE A 1 125 ? 52.081 26.832 80.338  1.00 20.66 ? 126  PHE A C   1 
ATOM   1009 O  O   . PHE A 1 125 ? 51.926 26.227 81.420  1.00 20.22 ? 126  PHE A O   1 
ATOM   1010 C  CB  . PHE A 1 125 ? 52.913 29.213 80.039  1.00 19.78 ? 126  PHE A CB  1 
ATOM   1011 C  CG  . PHE A 1 125 ? 51.973 29.608 81.180  1.00 18.34 ? 126  PHE A CG  1 
ATOM   1012 C  CD1 . PHE A 1 125 ? 52.477 29.776 82.467  1.00 16.94 ? 126  PHE A CD1 1 
ATOM   1013 C  CD2 . PHE A 1 125 ? 50.612 29.764 80.939  1.00 17.15 ? 126  PHE A CD2 1 
ATOM   1014 C  CE1 . PHE A 1 125 ? 51.619 30.101 83.518  1.00 16.82 ? 126  PHE A CE1 1 
ATOM   1015 C  CE2 . PHE A 1 125 ? 49.760 30.089 82.000  1.00 16.97 ? 126  PHE A CE2 1 
ATOM   1016 C  CZ  . PHE A 1 125 ? 50.260 30.258 83.288  1.00 16.72 ? 126  PHE A CZ  1 
ATOM   1017 N  N   . LEU A 1 126 ? 51.207 26.776 79.302  1.00 19.35 ? 127  LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 126 ? 49.962 26.010 79.364  1.00 18.15 ? 127  LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 126 ? 50.264 24.527 79.545  1.00 18.69 ? 127  LEU A C   1 
ATOM   1020 O  O   . LEU A 1 126 ? 49.733 23.907 80.466  1.00 19.71 ? 127  LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 126 ? 49.172 26.254 78.073  1.00 15.38 ? 127  LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 126 ? 48.573 27.662 78.040  1.00 13.74 ? 127  LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 126 ? 47.966 27.942 76.704  1.00 11.10 ? 127  LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 126 ? 47.590 27.808 79.205  1.00 13.24 ? 127  LEU A CD2 1 
ATOM   1025 N  N   . ALA A 1 127 ? 51.153 23.933 78.739  1.00 17.76 ? 128  ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 127 ? 51.554 22.548 78.943  1.00 17.23 ? 128  ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 127 ? 52.014 22.184 80.361  1.00 17.24 ? 128  ALA A C   1 
ATOM   1028 O  O   . ALA A 1 127 ? 51.519 21.195 80.910  1.00 17.03 ? 128  ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 127 ? 52.642 22.247 77.943  1.00 15.37 ? 128  ALA A CB  1 
ATOM   1030 N  N   . THR A 1 128 ? 52.855 23.022 81.002  1.00 17.61 ? 129  THR A N   1 
ATOM   1031 C  CA  . THR A 1 128 ? 53.411 22.772 82.337  1.00 18.12 ? 129  THR A CA  1 
ATOM   1032 C  C   . THR A 1 128 ? 52.430 22.997 83.453  1.00 18.81 ? 129  THR A C   1 
ATOM   1033 O  O   . THR A 1 128 ? 52.481 22.327 84.478  1.00 19.85 ? 129  THR A O   1 
ATOM   1034 C  CB  . THR A 1 128 ? 54.627 23.687 82.541  1.00 18.93 ? 129  THR A CB  1 
ATOM   1035 O  OG1 . THR A 1 128 ? 55.486 23.416 81.417  1.00 20.25 ? 129  THR A OG1 1 
ATOM   1036 C  CG2 . THR A 1 128 ? 55.349 23.477 83.856  1.00 18.15 ? 129  THR A CG2 1 
ATOM   1037 N  N   . ALA A 1 129 ? 51.574 24.012 83.298  1.00 19.13 ? 130  ALA A N   1 
ATOM   1038 C  CA  . ALA A 1 129 ? 50.532 24.266 84.266  1.00 20.01 ? 130  ALA A CA  1 
ATOM   1039 C  C   . ALA A 1 129 ? 49.510 23.118 84.167  1.00 20.68 ? 130  ALA A C   1 
ATOM   1040 O  O   . ALA A 1 129 ? 48.952 22.628 85.151  1.00 20.02 ? 130  ALA A O   1 
ATOM   1041 C  CB  . ALA A 1 129 ? 49.891 25.589 83.927  1.00 20.83 ? 130  ALA A CB  1 
ATOM   1042 N  N   . GLY A 1 130 ? 49.324 22.671 82.928  1.00 20.44 ? 131  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 130 ? 48.498 21.553 82.608  1.00 21.67 ? 131  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 130 ? 48.997 20.331 83.346  1.00 21.82 ? 131  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 130 ? 48.229 19.891 84.202  1.00 24.33 ? 131  GLY A O   1 
ATOM   1046 N  N   . ALA A 1 131 ? 50.229 19.831 83.110  1.00 20.81 ? 132  ALA A N   1 
ATOM   1047 C  CA  . ALA A 1 131 ? 50.758 18.656 83.813  1.00 19.97 ? 132  ALA A CA  1 
ATOM   1048 C  C   . ALA A 1 131 ? 50.717 18.750 85.328  1.00 19.54 ? 132  ALA A C   1 
ATOM   1049 O  O   . ALA A 1 131 ? 50.462 17.727 85.967  1.00 19.95 ? 132  ALA A O   1 
ATOM   1050 C  CB  . ALA A 1 131 ? 52.204 18.373 83.497  1.00 17.93 ? 132  ALA A CB  1 
ATOM   1051 N  N   . LYS A 1 132 ? 50.952 19.949 85.893  1.00 19.05 ? 133  LYS A N   1 
ATOM   1052 C  CA  . LYS A 1 132 ? 50.947 20.184 87.335  1.00 19.01 ? 133  LYS A CA  1 
ATOM   1053 C  C   . LYS A 1 132 ? 49.603 20.156 88.077  1.00 19.10 ? 133  LYS A C   1 
ATOM   1054 O  O   . LYS A 1 132 ? 49.538 19.644 89.196  1.00 19.15 ? 133  LYS A O   1 
ATOM   1055 C  CB  . LYS A 1 132 ? 51.654 21.518 87.565  1.00 18.98 ? 133  LYS A CB  1 
ATOM   1056 C  CG  . LYS A 1 132 ? 51.672 21.853 89.022  1.00 18.50 ? 133  LYS A CG  1 
ATOM   1057 C  CD  . LYS A 1 132 ? 52.264 23.174 89.368  1.00 19.59 ? 133  LYS A CD  1 
ATOM   1058 C  CE  . LYS A 1 132 ? 52.443 23.142 90.871  1.00 19.99 ? 133  LYS A CE  1 
ATOM   1059 N  NZ  . LYS A 1 132 ? 53.346 22.031 91.177  1.00 23.87 ? 133  LYS A NZ  1 
ATOM   1060 N  N   . TYR A 1 133 ? 48.505 20.715 87.534  1.00 19.57 ? 134  TYR A N   1 
ATOM   1061 C  CA  . TYR A 1 133 ? 47.211 20.749 88.236  1.00 19.30 ? 134  TYR A CA  1 
ATOM   1062 C  C   . TYR A 1 133 ? 46.222 19.689 87.715  1.00 18.87 ? 134  TYR A C   1 
ATOM   1063 O  O   . TYR A 1 133 ? 45.057 19.649 88.103  1.00 18.88 ? 134  TYR A O   1 
ATOM   1064 C  CB  . TYR A 1 133 ? 46.584 22.165 88.116  1.00 18.79 ? 134  TYR A CB  1 
ATOM   1065 C  CG  . TYR A 1 133 ? 47.470 23.270 88.657  1.00 20.03 ? 134  TYR A CG  1 
ATOM   1066 C  CD1 . TYR A 1 133 ? 47.503 23.476 90.039  1.00 19.78 ? 134  TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A 1 133 ? 48.293 24.062 87.806  1.00 21.10 ? 134  TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A 1 133 ? 48.362 24.459 90.569  1.00 20.20 ? 134  TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A 1 133 ? 49.155 25.048 88.346  1.00 20.35 ? 134  TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A 1 133 ? 49.187 25.238 89.735  1.00 20.50 ? 134  TYR A CZ  1 
ATOM   1071 O  OH  . TYR A 1 133 ? 50.038 26.175 90.325  1.00 20.60 ? 134  TYR A OH  1 
ATOM   1072 N  N   . GLY A 1 134 ? 46.625 18.863 86.749  1.00 18.53 ? 135  GLY A N   1 
ATOM   1073 C  CA  . GLY A 1 134 ? 45.813 17.733 86.306  1.00 17.81 ? 135  GLY A CA  1 
ATOM   1074 C  C   . GLY A 1 134 ? 44.856 18.102 85.194  1.00 18.34 ? 135  GLY A C   1 
ATOM   1075 O  O   . GLY A 1 134 ? 43.700 17.721 85.275  1.00 18.74 ? 135  GLY A O   1 
ATOM   1076 N  N   . VAL A 1 135 ? 45.289 18.826 84.148  1.00 17.58 ? 136  VAL A N   1 
ATOM   1077 C  CA  . VAL A 1 135 ? 44.421 19.281 83.089  1.00 16.50 ? 136  VAL A CA  1 
ATOM   1078 C  C   . VAL A 1 135 ? 45.032 18.714 81.836  1.00 17.20 ? 136  VAL A C   1 
ATOM   1079 O  O   . VAL A 1 135 ? 46.249 18.785 81.653  1.00 17.02 ? 136  VAL A O   1 
ATOM   1080 C  CB  . VAL A 1 135 ? 44.399 20.820 83.072  1.00 16.14 ? 136  VAL A CB  1 
ATOM   1081 C  CG1 . VAL A 1 135 ? 43.606 21.291 81.895  1.00 13.84 ? 136  VAL A CG1 1 
ATOM   1082 C  CG2 . VAL A 1 135 ? 43.825 21.353 84.379  1.00 15.36 ? 136  VAL A CG2 1 
ATOM   1083 N  N   . GLY A 1 136 ? 44.172 18.147 80.981  1.00 17.20 ? 137  GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 136 ? 44.601 17.518 79.738  1.00 17.39 ? 137  GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 136 ? 44.883 18.603 78.704  1.00 17.25 ? 137  GLY A C   1 
ATOM   1086 O  O   . GLY A 1 136 ? 44.228 19.651 78.751  1.00 17.51 ? 137  GLY A O   1 
ATOM   1087 N  N   . PHE A 1 137 ? 45.776 18.328 77.753  1.00 16.01 ? 138  PHE A N   1 
ATOM   1088 C  CA  . PHE A 1 137 ? 46.239 19.376 76.889  1.00 16.72 ? 138  PHE A CA  1 
ATOM   1089 C  C   . PHE A 1 137 ? 46.162 18.952 75.446  1.00 17.55 ? 138  PHE A C   1 
ATOM   1090 O  O   . PHE A 1 137 ? 46.773 17.957 75.086  1.00 19.09 ? 138  PHE A O   1 
ATOM   1091 C  CB  . PHE A 1 137 ? 47.712 19.742 77.311  1.00 16.13 ? 138  PHE A CB  1 
ATOM   1092 C  CG  . PHE A 1 137 ? 48.523 20.758 76.484  1.00 15.52 ? 138  PHE A CG  1 
ATOM   1093 C  CD1 . PHE A 1 137 ? 48.417 22.132 76.757  1.00 15.19 ? 138  PHE A CD1 1 
ATOM   1094 C  CD2 . PHE A 1 137 ? 49.345 20.317 75.434  1.00 13.65 ? 138  PHE A CD2 1 
ATOM   1095 C  CE1 . PHE A 1 137 ? 49.129 23.046 75.969  1.00 15.41 ? 138  PHE A CE1 1 
ATOM   1096 C  CE2 . PHE A 1 137 ? 50.046 21.236 74.665  1.00 12.73 ? 138  PHE A CE2 1 
ATOM   1097 C  CZ  . PHE A 1 137 ? 49.942 22.591 74.923  1.00 14.09 ? 138  PHE A CZ  1 
ATOM   1098 N  N   . TRP A 1 138 ? 45.498 19.696 74.570  1.00 16.86 ? 139  TRP A N   1 
ATOM   1099 C  CA  . TRP A 1 138 ? 45.476 19.322 73.178  1.00 15.94 ? 139  TRP A CA  1 
ATOM   1100 C  C   . TRP A 1 138 ? 46.431 20.259 72.480  1.00 16.04 ? 139  TRP A C   1 
ATOM   1101 O  O   . TRP A 1 138 ? 46.197 21.460 72.475  1.00 16.04 ? 139  TRP A O   1 
ATOM   1102 C  CB  . TRP A 1 138 ? 44.048 19.457 72.689  1.00 16.18 ? 139  TRP A CB  1 
ATOM   1103 C  CG  . TRP A 1 138 ? 43.183 18.291 73.177  1.00 15.95 ? 139  TRP A CG  1 
ATOM   1104 C  CD1 . TRP A 1 138 ? 42.587 18.312 74.420  1.00 15.92 ? 139  TRP A CD1 1 
ATOM   1105 C  CD2 . TRP A 1 138 ? 42.819 17.176 72.427  1.00 15.13 ? 139  TRP A CD2 1 
ATOM   1106 N  NE1 . TRP A 1 138 ? 41.818 17.237 74.458  1.00 16.64 ? 139  TRP A NE1 1 
ATOM   1107 C  CE2 . TRP A 1 138 ? 41.906 16.532 73.290  1.00 15.05 ? 139  TRP A CE2 1 
ATOM   1108 C  CE3 . TRP A 1 138 ? 43.102 16.624 71.169  1.00 12.55 ? 139  TRP A CE3 1 
ATOM   1109 C  CZ2 . TRP A 1 138 ? 41.265 15.347 72.876  1.00 11.44 ? 139  TRP A CZ2 1 
ATOM   1110 C  CZ3 . TRP A 1 138 ? 42.458 15.452 70.782  1.00 11.66 ? 139  TRP A CZ3 1 
ATOM   1111 C  CH2 . TRP A 1 138 ? 41.541 14.820 71.619  1.00 10.30 ? 139  TRP A CH2 1 
ATOM   1112 N  N   . ARG A 1 139 ? 47.517 19.738 71.908  1.00 17.55 ? 140  ARG A N   1 
ATOM   1113 C  CA  . ARG A 1 139 ? 48.609 20.520 71.298  1.00 19.66 ? 140  ARG A CA  1 
ATOM   1114 C  C   . ARG A 1 139 ? 48.157 21.307 70.079  1.00 19.35 ? 140  ARG A C   1 
ATOM   1115 O  O   . ARG A 1 139 ? 47.120 20.943 69.515  1.00 18.78 ? 140  ARG A O   1 
ATOM   1116 C  CB  . ARG A 1 139 ? 49.810 19.597 70.866  1.00 21.79 ? 140  ARG A CB  1 
ATOM   1117 C  CG  . ARG A 1 139 ? 50.362 18.888 72.096  1.00 28.89 ? 140  ARG A CG  1 
ATOM   1118 C  CD  . ARG A 1 139 ? 51.526 17.909 72.006  1.00 33.91 ? 140  ARG A CD  1 
ATOM   1119 N  NE  . ARG A 1 139 ? 51.235 16.704 71.236  1.00 40.31 ? 140  ARG A NE  1 
ATOM   1120 C  CZ  . ARG A 1 139 ? 51.412 15.453 71.717  1.00 42.49 ? 140  ARG A CZ  1 
ATOM   1121 N  NH1 . ARG A 1 139 ? 51.702 15.215 72.998  1.00 42.87 ? 140  ARG A NH1 1 
ATOM   1122 N  NH2 . ARG A 1 139 ? 51.229 14.417 70.899  1.00 41.72 ? 140  ARG A NH2 1 
ATOM   1123 N  N   . PRO A 1 140 ? 48.877 22.374 69.644  1.00 18.77 ? 141  PRO A N   1 
ATOM   1124 C  CA  . PRO A 1 140 ? 48.661 23.100 68.392  1.00 17.50 ? 141  PRO A CA  1 
ATOM   1125 C  C   . PRO A 1 140 ? 48.577 22.208 67.204  1.00 16.30 ? 141  PRO A C   1 
ATOM   1126 O  O   . PRO A 1 140 ? 49.437 21.360 67.008  1.00 15.82 ? 141  PRO A O   1 
ATOM   1127 C  CB  . PRO A 1 140 ? 49.814 24.084 68.316  1.00 17.84 ? 141  PRO A CB  1 
ATOM   1128 C  CG  . PRO A 1 140 ? 50.775 23.648 69.415  1.00 17.54 ? 141  PRO A CG  1 
ATOM   1129 C  CD  . PRO A 1 140 ? 49.881 23.070 70.465  1.00 18.37 ? 141  PRO A CD  1 
ATOM   1130 N  N   . GLY A 1 141 ? 47.481 22.380 66.474  1.00 16.12 ? 142  GLY A N   1 
ATOM   1131 C  CA  . GLY A 1 141 ? 47.245 21.564 65.289  1.00 15.93 ? 142  GLY A CA  1 
ATOM   1132 C  C   . GLY A 1 141 ? 46.046 20.653 65.487  1.00 15.82 ? 142  GLY A C   1 
ATOM   1133 O  O   . GLY A 1 141 ? 45.351 20.373 64.521  1.00 14.91 ? 142  GLY A O   1 
ATOM   1134 N  N   . SER A 1 142 ? 45.787 20.266 66.748  1.00 16.11 ? 143  SER A N   1 
ATOM   1135 C  CA  . SER A 1 142 ? 44.706 19.365 67.131  1.00 16.85 ? 143  SER A CA  1 
ATOM   1136 C  C   . SER A 1 142 ? 43.354 19.733 66.542  1.00 16.90 ? 143  SER A C   1 
ATOM   1137 O  O   . SER A 1 142 ? 42.684 18.844 66.008  1.00 17.14 ? 143  SER A O   1 
ATOM   1138 C  CB  . SER A 1 142 ? 44.599 19.296 68.696  1.00 16.17 ? 143  SER A CB  1 
ATOM   1139 O  OG  . SER A 1 142 ? 44.398 20.540 69.370  1.00 15.67 ? 143  SER A OG  1 
ATOM   1140 N  N   . GLY A 1 143 ? 42.962 21.028 66.643  1.00 17.37 ? 144  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 143 ? 41.699 21.521 66.072  1.00 16.48 ? 144  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 143 ? 41.085 22.627 66.900  1.00 15.30 ? 144  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 143 ? 41.604 22.951 67.974  1.00 15.96 ? 144  GLY A O   1 
ATOM   1144 N  N   . ILE A 1 144 ? 39.954 23.201 66.412  1.00 14.94 ? 145  ILE A N   1 
ATOM   1145 C  CA  . ILE A 1 144 ? 39.151 24.254 67.073  1.00 13.22 ? 145  ILE A CA  1 
ATOM   1146 C  C   . ILE A 1 144 ? 38.414 23.604 68.254  1.00 11.77 ? 145  ILE A C   1 
ATOM   1147 O  O   . ILE A 1 144 ? 37.843 22.558 68.008  1.00 13.59 ? 145  ILE A O   1 
ATOM   1148 C  CB  . ILE A 1 144 ? 38.147 24.834 66.053  1.00 12.50 ? 145  ILE A CB  1 
ATOM   1149 C  CG1 . ILE A 1 144 ? 38.860 25.382 64.871  1.00 11.54 ? 145  ILE A CG1 1 
ATOM   1150 C  CG2 . ILE A 1 144 ? 37.359 25.939 66.711  1.00 11.77 ? 145  ILE A CG2 1 
ATOM   1151 C  CD1 . ILE A 1 144 ? 37.987 25.604 63.637  1.00 10.75 ? 145  ILE A CD1 1 
ATOM   1152 N  N   . ILE A 1 145 ? 38.418 24.168 69.477  1.00 9.03  ? 146  ILE A N   1 
ATOM   1153 C  CA  . ILE A 1 145 ? 37.863 23.606 70.695  1.00 7.39  ? 146  ILE A CA  1 
ATOM   1154 C  C   . ILE A 1 145 ? 36.513 22.926 70.650  1.00 8.46  ? 146  ILE A C   1 
ATOM   1155 O  O   . ILE A 1 145 ? 36.358 21.902 71.299  1.00 8.65  ? 146  ILE A O   1 
ATOM   1156 C  CB  . ILE A 1 145 ? 37.885 24.742 71.854  1.00 6.22  ? 146  ILE A CB  1 
ATOM   1157 C  CG1 . ILE A 1 145 ? 37.170 24.282 73.089  1.00 5.67  ? 146  ILE A CG1 1 
ATOM   1158 C  CG2 . ILE A 1 145 ? 37.196 26.006 71.449  1.00 4.53  ? 146  ILE A CG2 1 
ATOM   1159 C  CD1 . ILE A 1 145 ? 37.214 25.318 74.202  1.00 6.77  ? 146  ILE A CD1 1 
ATOM   1160 N  N   . HIS A 1 146 ? 35.642 23.375 69.755  1.00 8.85  ? 147  HIS A N   1 
ATOM   1161 C  CA  . HIS A 1 146 ? 34.275 22.939 69.725  1.00 9.70  ? 147  HIS A CA  1 
ATOM   1162 C  C   . HIS A 1 146 ? 34.142 21.714 68.861  1.00 9.29  ? 147  HIS A C   1 
ATOM   1163 O  O   . HIS A 1 146 ? 33.306 20.880 69.181  1.00 8.19  ? 147  HIS A O   1 
ATOM   1164 C  CB  . HIS A 1 146 ? 33.390 24.099 69.225  1.00 11.54 ? 147  HIS A CB  1 
ATOM   1165 C  CG  . HIS A 1 146 ? 33.429 25.277 70.196  1.00 12.25 ? 147  HIS A CG  1 
ATOM   1166 N  ND1 . HIS A 1 146 ? 33.426 25.226 71.538  1.00 11.90 ? 147  HIS A ND1 1 
ATOM   1167 C  CD2 . HIS A 1 146 ? 33.562 26.594 69.819  1.00 11.73 ? 147  HIS A CD2 1 
ATOM   1168 C  CE1 . HIS A 1 146 ? 33.577 26.455 71.978  1.00 12.57 ? 147  HIS A CE1 1 
ATOM   1169 N  NE2 . HIS A 1 146 ? 33.656 27.271 70.943  1.00 12.89 ? 147  HIS A NE2 1 
ATOM   1170 N  N   . GLN A 1 147 ? 34.951 21.545 67.806  1.00 10.16 ? 148  GLN A N   1 
ATOM   1171 C  CA  . GLN A 1 147 ? 34.972 20.305 67.052  1.00 10.20 ? 148  GLN A CA  1 
ATOM   1172 C  C   . GLN A 1 147 ? 35.566 19.175 67.894  1.00 9.21  ? 148  GLN A C   1 
ATOM   1173 O  O   . GLN A 1 147 ? 34.973 18.114 67.997  1.00 8.16  ? 148  GLN A O   1 
ATOM   1174 C  CB  . GLN A 1 147 ? 35.778 20.536 65.839  1.00 12.04 ? 148  GLN A CB  1 
ATOM   1175 C  CG  . GLN A 1 147 ? 35.222 19.725 64.685  1.00 15.31 ? 148  GLN A CG  1 
ATOM   1176 C  CD  . GLN A 1 147 ? 33.859 20.184 64.211  1.00 16.54 ? 148  GLN A CD  1 
ATOM   1177 O  OE1 . GLN A 1 147 ? 33.749 21.198 63.528  1.00 17.03 ? 148  GLN A OE1 1 
ATOM   1178 N  NE2 . GLN A 1 147 ? 32.793 19.431 64.522  1.00 17.14 ? 148  GLN A NE2 1 
ATOM   1179 N  N   . ILE A 1 148 ? 36.707 19.378 68.555  1.00 9.11  ? 149  ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 148 ? 37.255 18.419 69.539  1.00 10.52 ? 149  ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 148 ? 36.320 18.054 70.721  1.00 11.23 ? 149  ILE A C   1 
ATOM   1182 O  O   . ILE A 1 148 ? 36.332 16.955 71.296  1.00 12.69 ? 149  ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 148 ? 38.612 18.999 70.106  1.00 10.36 ? 149  ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 148 ? 39.640 19.152 68.983  1.00 8.54  ? 149  ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 148 ? 39.152 18.117 71.212  1.00 9.95  ? 149  ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 148 ? 39.829 18.053 67.966  1.00 6.40  ? 149  ILE A CD1 1 
ATOM   1187 N  N   . ILE A 1 149 ? 35.530 18.990 71.206  1.00 10.57 ? 150  ILE A N   1 
ATOM   1188 C  CA  . ILE A 1 149 ? 34.593 18.649 72.235  1.00 10.77 ? 150  ILE A CA  1 
ATOM   1189 C  C   . ILE A 1 149 ? 33.471 17.841 71.593  1.00 11.64 ? 150  ILE A C   1 
ATOM   1190 O  O   . ILE A 1 149 ? 33.259 16.757 72.104  1.00 12.73 ? 150  ILE A O   1 
ATOM   1191 C  CB  . ILE A 1 149 ? 34.089 19.926 72.895  1.00 9.87  ? 150  ILE A CB  1 
ATOM   1192 C  CG1 . ILE A 1 149 ? 35.188 20.389 73.826  1.00 9.03  ? 150  ILE A CG1 1 
ATOM   1193 C  CG2 . ILE A 1 149 ? 32.783 19.695 73.656  1.00 10.69 ? 150  ILE A CG2 1 
ATOM   1194 C  CD1 . ILE A 1 149 ? 34.719 21.675 74.539  1.00 9.41  ? 150  ILE A CD1 1 
ATOM   1195 N  N   . LEU A 1 150 ? 32.779 18.203 70.491  1.00 11.69 ? 151  LEU A N   1 
ATOM   1196 C  CA  . LEU A 1 150 ? 31.665 17.416 69.966  1.00 12.09 ? 151  LEU A CA  1 
ATOM   1197 C  C   . LEU A 1 150 ? 32.190 16.022 69.608  1.00 13.01 ? 151  LEU A C   1 
ATOM   1198 O  O   . LEU A 1 150 ? 31.535 15.033 69.934  1.00 14.97 ? 151  LEU A O   1 
ATOM   1199 C  CB  . LEU A 1 150 ? 31.008 18.113 68.692  1.00 10.34 ? 151  LEU A CB  1 
ATOM   1200 C  CG  . LEU A 1 150 ? 29.563 17.701 68.284  1.00 9.11  ? 151  LEU A CG  1 
ATOM   1201 C  CD1 . LEU A 1 150 ? 28.504 18.593 68.917  1.00 7.30  ? 151  LEU A CD1 1 
ATOM   1202 C  CD2 . LEU A 1 150 ? 29.416 17.823 66.771  1.00 8.44  ? 151  LEU A CD2 1 
ATOM   1203 N  N   . GLU A 1 151 ? 33.376 15.932 69.006  1.00 12.38 ? 152  GLU A N   1 
ATOM   1204 C  CA  . GLU A 1 151 ? 33.996 14.664 68.688  1.00 11.87 ? 152  GLU A CA  1 
ATOM   1205 C  C   . GLU A 1 151 ? 34.425 13.810 69.842  1.00 11.22 ? 152  GLU A C   1 
ATOM   1206 O  O   . GLU A 1 151 ? 34.475 12.613 69.609  1.00 11.82 ? 152  GLU A O   1 
ATOM   1207 C  CB  . GLU A 1 151 ? 35.220 14.856 67.796  1.00 12.23 ? 152  GLU A CB  1 
ATOM   1208 C  CG  . GLU A 1 151 ? 34.902 15.359 66.355  1.00 14.21 ? 152  GLU A CG  1 
ATOM   1209 C  CD  . GLU A 1 151 ? 36.100 15.679 65.468  1.00 15.61 ? 152  GLU A CD  1 
ATOM   1210 O  OE1 . GLU A 1 151 ? 37.244 15.574 65.893  1.00 18.40 ? 152  GLU A OE1 1 
ATOM   1211 O  OE2 . GLU A 1 151 ? 35.936 16.051 64.323  1.00 16.37 ? 152  GLU A OE2 1 
ATOM   1212 N  N   . ASN A 1 152 ? 34.660 14.319 71.059  1.00 10.81 ? 153  ASN A N   1 
ATOM   1213 C  CA  . ASN A 1 152 ? 35.236 13.545 72.166  1.00 10.41 ? 153  ASN A CA  1 
ATOM   1214 C  C   . ASN A 1 152 ? 34.655 13.652 73.570  1.00 10.38 ? 153  ASN A C   1 
ATOM   1215 O  O   . ASN A 1 152 ? 34.813 12.736 74.384  1.00 10.08 ? 153  ASN A O   1 
ATOM   1216 C  CB  . ASN A 1 152 ? 36.696 13.878 72.381  1.00 12.27 ? 153  ASN A CB  1 
ATOM   1217 C  CG  . ASN A 1 152 ? 37.579 13.764 71.157  1.00 14.93 ? 153  ASN A CG  1 
ATOM   1218 O  OD1 . ASN A 1 152 ? 38.505 12.968 71.149  1.00 17.28 ? 153  ASN A OD1 1 
ATOM   1219 N  ND2 . ASN A 1 152 ? 37.425 14.551 70.101  1.00 16.53 ? 153  ASN A ND2 1 
ATOM   1220 N  N   . TYR A 1 153 ? 34.073 14.808 73.934  1.00 10.53 ? 154  TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 153 ? 33.607 15.100 75.284  1.00 9.96  ? 154  TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 153 ? 32.123 15.386 75.537  1.00 9.41  ? 154  TYR A C   1 
ATOM   1223 O  O   . TYR A 1 153 ? 31.607 15.244 76.652  1.00 8.26  ? 154  TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 153 ? 34.449 16.258 75.768  1.00 10.27 ? 154  TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 153 ? 35.946 15.983 75.763  1.00 11.41 ? 154  TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 153 ? 36.503 15.122 76.725  1.00 12.54 ? 154  TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 153 ? 36.757 16.672 74.856  1.00 10.68 ? 154  TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 153 ? 37.883 14.982 76.773  1.00 12.17 ? 154  TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 153 ? 38.137 16.545 74.900  1.00 11.19 ? 154  TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 153 ? 38.668 15.697 75.867  1.00 13.19 ? 154  TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 153 ? 40.023 15.519 75.972  1.00 16.12 ? 154  TYR A OH  1 
ATOM   1232 N  N   . ALA A 1 154 ? 31.416 15.822 74.494  1.00 9.61  ? 155  ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 154 ? 29.966 16.133 74.517  1.00 9.99  ? 155  ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 154 ? 29.054 14.904 74.535  1.00 9.97  ? 155  ALA A C   1 
ATOM   1235 O  O   . ALA A 1 154 ? 29.205 13.995 73.705  1.00 9.44  ? 155  ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 154 ? 29.554 16.907 73.268  1.00 8.81  ? 155  ALA A CB  1 
ATOM   1237 N  N   . TYR A 1 155 ? 28.099 14.853 75.447  1.00 10.35 ? 156  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 155 ? 27.173 13.723 75.404  1.00 11.00 ? 156  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 155 ? 25.782 14.126 75.920  1.00 11.95 ? 156  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 155 ? 25.691 15.088 76.678  1.00 12.20 ? 156  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 155 ? 27.764 12.514 76.226  1.00 8.61  ? 156  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 155 ? 28.006 12.660 77.729  1.00 5.91  ? 156  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 155 ? 26.948 12.662 78.652  1.00 6.60  ? 156  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 155 ? 29.309 12.883 78.166  1.00 3.97  ? 156  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 155 ? 27.193 12.905 80.012  1.00 6.41  ? 156  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 155 ? 29.572 13.116 79.507  1.00 3.98  ? 156  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 155 ? 28.519 13.138 80.420  1.00 5.52  ? 156  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 155 ? 28.795 13.473 81.730  1.00 7.22  ? 156  TYR A OH  1 
ATOM   1249 N  N   . PRO A 1 156 ? 24.672 13.472 75.559  1.00 13.03 ? 157  PRO A N   1 
ATOM   1250 C  CA  . PRO A 1 156 ? 23.335 13.704 76.108  1.00 12.73 ? 157  PRO A CA  1 
ATOM   1251 C  C   . PRO A 1 156 ? 23.266 13.951 77.593  1.00 12.27 ? 157  PRO A C   1 
ATOM   1252 O  O   . PRO A 1 156 ? 23.764 13.077 78.301  1.00 13.99 ? 157  PRO A O   1 
ATOM   1253 C  CB  . PRO A 1 156 ? 22.561 12.463 75.684  1.00 12.95 ? 157  PRO A CB  1 
ATOM   1254 C  CG  . PRO A 1 156 ? 23.135 12.187 74.300  1.00 12.74 ? 157  PRO A CG  1 
ATOM   1255 C  CD  . PRO A 1 156 ? 24.638 12.420 74.528  1.00 13.85 ? 157  PRO A CD  1 
ATOM   1256 N  N   . GLY A 1 157 ? 22.742 15.073 78.120  1.00 11.51 ? 158  GLY A N   1 
ATOM   1257 C  CA  . GLY A 1 157 ? 22.632 15.220 79.558  1.00 10.82 ? 158  GLY A CA  1 
ATOM   1258 C  C   . GLY A 1 157 ? 23.848 15.747 80.280  1.00 11.83 ? 158  GLY A C   1 
ATOM   1259 O  O   . GLY A 1 157 ? 23.799 15.889 81.518  1.00 12.09 ? 158  GLY A O   1 
ATOM   1260 N  N   . VAL A 1 158 ? 24.939 16.036 79.557  1.00 11.47 ? 159  VAL A N   1 
ATOM   1261 C  CA  . VAL A 1 158 ? 26.107 16.662 80.196  1.00 12.46 ? 159  VAL A CA  1 
ATOM   1262 C  C   . VAL A 1 158 ? 25.811 18.153 80.512  1.00 12.80 ? 159  VAL A C   1 
ATOM   1263 O  O   . VAL A 1 158 ? 24.936 18.735 79.863  1.00 11.90 ? 159  VAL A O   1 
ATOM   1264 C  CB  . VAL A 1 158 ? 27.396 16.555 79.269  1.00 11.21 ? 159  VAL A CB  1 
ATOM   1265 C  CG1 . VAL A 1 158 ? 27.383 17.534 78.117  1.00 9.32  ? 159  VAL A CG1 1 
ATOM   1266 C  CG2 . VAL A 1 158 ? 28.628 16.827 80.154  1.00 7.21  ? 159  VAL A CG2 1 
ATOM   1267 N  N   . LEU A 1 159 ? 26.438 18.713 81.577  1.00 13.30 ? 160  LEU A N   1 
ATOM   1268 C  CA  . LEU A 1 159 ? 26.406 20.146 81.905  1.00 13.77 ? 160  LEU A CA  1 
ATOM   1269 C  C   . LEU A 1 159 ? 27.865 20.533 81.853  1.00 15.11 ? 160  LEU A C   1 
ATOM   1270 O  O   . LEU A 1 159 ? 28.669 20.138 82.705  1.00 15.63 ? 160  LEU A O   1 
ATOM   1271 C  CB  . LEU A 1 159 ? 25.926 20.481 83.320  1.00 12.34 ? 160  LEU A CB  1 
ATOM   1272 C  CG  . LEU A 1 159 ? 25.979 21.972 83.815  1.00 12.20 ? 160  LEU A CG  1 
ATOM   1273 C  CD1 . LEU A 1 159 ? 25.200 22.840 82.846  1.00 9.90  ? 160  LEU A CD1 1 
ATOM   1274 C  CD2 . LEU A 1 159 ? 25.445 22.116 85.243  1.00 10.39 ? 160  LEU A CD2 1 
ATOM   1275 N  N   . LEU A 1 160 ? 28.227 21.290 80.832  1.00 15.67 ? 161  LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 160 ? 29.655 21.578 80.586  1.00 15.38 ? 161  LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 160 ? 29.835 23.074 80.487  1.00 14.63 ? 161  LEU A C   1 
ATOM   1278 O  O   . LEU A 1 160 ? 28.998 23.700 79.825  1.00 14.61 ? 161  LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 160 ? 30.003 20.890 79.280  1.00 14.18 ? 161  LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 160 ? 31.340 20.774 78.633  1.00 14.71 ? 161  LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 160 ? 31.091 19.845 77.505  1.00 15.50 ? 161  LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 160 ? 31.939 22.083 78.101  1.00 12.58 ? 161  LEU A CD2 1 
ATOM   1283 N  N   . ILE A 1 161 ? 30.837 23.676 81.144  1.00 14.36 ? 162  ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 161 ? 31.037 25.111 80.966  1.00 13.39 ? 162  ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 161 ? 32.359 25.309 80.245  1.00 12.97 ? 162  ILE A C   1 
ATOM   1286 O  O   . ILE A 1 161 ? 33.317 24.564 80.456  1.00 12.97 ? 162  ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 161 ? 31.004 25.838 82.332  1.00 13.78 ? 162  ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 161 ? 32.167 25.443 83.268  1.00 16.70 ? 162  ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 161 ? 29.628 25.534 82.938  1.00 12.08 ? 162  ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 161 ? 32.289 26.292 84.619  1.00 17.02 ? 162  ILE A CD1 1 
ATOM   1291 N  N   . GLY A 1 162 ? 32.442 26.261 79.318  1.00 13.65 ? 163  GLY A N   1 
ATOM   1292 C  CA  . GLY A 1 162 ? 33.697 26.438 78.593  1.00 14.91 ? 163  GLY A CA  1 
ATOM   1293 C  C   . GLY A 1 162 ? 34.167 27.884 78.597  1.00 14.76 ? 163  GLY A C   1 
ATOM   1294 O  O   . GLY A 1 162 ? 33.304 28.765 78.558  1.00 16.12 ? 163  GLY A O   1 
ATOM   1295 N  N   . THR A 1 163 ? 35.475 28.232 78.624  1.00 13.46 ? 164  THR A N   1 
ATOM   1296 C  CA  . THR A 1 163 ? 35.830 29.660 78.589  1.00 11.47 ? 164  THR A CA  1 
ATOM   1297 C  C   . THR A 1 163 ? 35.864 30.095 77.111  1.00 12.30 ? 164  THR A C   1 
ATOM   1298 O  O   . THR A 1 163 ? 36.940 30.233 76.520  1.00 13.86 ? 164  THR A O   1 
ATOM   1299 C  CB  . THR A 1 163 ? 37.218 29.948 79.342  1.00 8.52  ? 164  THR A CB  1 
ATOM   1300 O  OG1 . THR A 1 163 ? 38.256 29.177 78.779  1.00 8.41  ? 164  THR A OG1 1 
ATOM   1301 C  CG2 . THR A 1 163 ? 37.111 29.633 80.805  1.00 4.77  ? 164  THR A CG2 1 
ATOM   1302 N  N   . ASP A 1 164 ? 34.670 30.271 76.484  1.00 11.48 ? 165  ASP A N   1 
ATOM   1303 C  CA  . ASP A 1 164 ? 34.483 30.676 75.078  1.00 9.74  ? 165  ASP A CA  1 
ATOM   1304 C  C   . ASP A 1 164 ? 32.966 30.767 74.900  1.00 10.98 ? 165  ASP A C   1 
ATOM   1305 O  O   . ASP A 1 164 ? 32.197 29.917 75.351  1.00 12.06 ? 165  ASP A O   1 
ATOM   1306 C  CB  . ASP A 1 164 ? 34.931 29.666 74.029  1.00 5.73  ? 165  ASP A CB  1 
ATOM   1307 C  CG  . ASP A 1 164 ? 35.017 30.204 72.592  1.00 5.32  ? 165  ASP A CG  1 
ATOM   1308 O  OD1 . ASP A 1 164 ? 34.073 30.202 71.788  1.00 2.35  ? 165  ASP A OD1 1 
ATOM   1309 O  OD2 . ASP A 1 164 ? 36.109 30.609 72.238  1.00 2.74  ? 165  ASP A OD2 1 
ATOM   1310 N  N   . SER A 1 165 ? 32.519 31.802 74.208  1.00 11.94 ? 166  SER A N   1 
ATOM   1311 C  CA  . SER A 1 165 ? 31.104 32.044 74.122  1.00 12.56 ? 166  SER A CA  1 
ATOM   1312 C  C   . SER A 1 165 ? 30.465 31.125 73.120  1.00 12.88 ? 166  SER A C   1 
ATOM   1313 O  O   . SER A 1 165 ? 29.247 30.989 73.120  1.00 15.13 ? 166  SER A O   1 
ATOM   1314 C  CB  . SER A 1 165 ? 30.854 33.494 73.741  1.00 12.23 ? 166  SER A CB  1 
ATOM   1315 O  OG  . SER A 1 165 ? 30.965 33.649 72.311  1.00 10.77 ? 166  SER A OG  1 
ATOM   1316 N  N   . HIS A 1 166 ? 31.199 30.523 72.218  1.00 11.70 ? 167  HIS A N   1 
ATOM   1317 C  CA  . HIS A 1 166 ? 30.562 29.606 71.323  1.00 12.01 ? 167  HIS A CA  1 
ATOM   1318 C  C   . HIS A 1 166 ? 30.440 28.205 71.912  1.00 13.08 ? 167  HIS A C   1 
ATOM   1319 O  O   . HIS A 1 166 ? 30.155 27.301 71.121  1.00 13.47 ? 167  HIS A O   1 
ATOM   1320 C  CB  . HIS A 1 166 ? 31.346 29.604 70.044  1.00 14.00 ? 167  HIS A CB  1 
ATOM   1321 C  CG  . HIS A 1 166 ? 30.944 30.806 69.185  1.00 15.15 ? 167  HIS A CG  1 
ATOM   1322 N  ND1 . HIS A 1 166 ? 31.670 31.873 68.861  1.00 15.68 ? 167  HIS A ND1 1 
ATOM   1323 C  CD2 . HIS A 1 166 ? 29.692 31.007 68.635  1.00 14.90 ? 167  HIS A CD2 1 
ATOM   1324 C  CE1 . HIS A 1 166 ? 30.894 32.687 68.175  1.00 16.29 ? 167  HIS A CE1 1 
ATOM   1325 N  NE2 . HIS A 1 166 ? 29.704 32.162 68.038  1.00 14.71 ? 167  HIS A NE2 1 
ATOM   1326 N  N   . THR A 1 167 ? 30.586 27.986 73.256  1.00 12.09 ? 168  THR A N   1 
ATOM   1327 C  CA  . THR A 1 167 ? 30.450 26.677 73.858  1.00 10.95 ? 168  THR A CA  1 
ATOM   1328 C  C   . THR A 1 167 ? 29.105 25.965 73.719  1.00 11.85 ? 168  THR A C   1 
ATOM   1329 O  O   . THR A 1 167 ? 29.131 24.713 73.660  1.00 9.91  ? 168  THR A O   1 
ATOM   1330 C  CB  . THR A 1 167 ? 30.827 26.787 75.331  1.00 11.16 ? 168  THR A CB  1 
ATOM   1331 O  OG1 . THR A 1 167 ? 32.215 27.218 75.361  1.00 11.60 ? 168  THR A OG1 1 
ATOM   1332 C  CG2 . THR A 1 167 ? 30.682 25.475 76.085  1.00 8.96  ? 168  THR A CG2 1 
ATOM   1333 N  N   . PRO A 1 168 ? 27.939 26.671 73.573  1.00 12.28 ? 169  PRO A N   1 
ATOM   1334 C  CA  . PRO A 1 168 ? 26.629 26.115 73.159  1.00 12.35 ? 169  PRO A CA  1 
ATOM   1335 C  C   . PRO A 1 168 ? 26.598 25.142 72.010  1.00 12.74 ? 169  PRO A C   1 
ATOM   1336 O  O   . PRO A 1 168 ? 25.642 24.380 71.996  1.00 14.50 ? 169  PRO A O   1 
ATOM   1337 C  CB  . PRO A 1 168 ? 25.747 27.285 72.853  1.00 11.91 ? 169  PRO A CB  1 
ATOM   1338 C  CG  . PRO A 1 168 ? 26.187 28.247 73.934  1.00 12.18 ? 169  PRO A CG  1 
ATOM   1339 C  CD  . PRO A 1 168 ? 27.710 28.035 74.049  1.00 12.20 ? 169  PRO A CD  1 
ATOM   1340 N  N   . ASN A 1 169 ? 27.610 25.107 71.109  1.00 12.36 ? 170  ASN A N   1 
ATOM   1341 C  CA  . ASN A 1 169 ? 27.756 24.141 70.029  1.00 11.02 ? 170  ASN A CA  1 
ATOM   1342 C  C   . ASN A 1 169 ? 27.432 22.741 70.515  1.00 11.87 ? 170  ASN A C   1 
ATOM   1343 O  O   . ASN A 1 169 ? 26.819 22.001 69.754  1.00 11.47 ? 170  ASN A O   1 
ATOM   1344 C  CB  . ASN A 1 169 ? 29.202 24.182 69.499  1.00 9.24  ? 170  ASN A CB  1 
ATOM   1345 C  CG  . ASN A 1 169 ? 29.677 23.384 68.255  1.00 8.97  ? 170  ASN A CG  1 
ATOM   1346 O  OD1 . ASN A 1 169 ? 29.548 23.840 67.136  1.00 7.76  ? 170  ASN A OD1 1 
ATOM   1347 N  ND2 . ASN A 1 169 ? 30.382 22.252 68.278  1.00 5.73  ? 170  ASN A ND2 1 
ATOM   1348 N  N   . GLY A 1 170 ? 27.827 22.418 71.767  1.00 12.48 ? 171  GLY A N   1 
ATOM   1349 C  CA  . GLY A 1 170 ? 27.658 21.106 72.412  1.00 12.17 ? 171  GLY A CA  1 
ATOM   1350 C  C   . GLY A 1 170 ? 26.196 20.672 72.513  1.00 12.73 ? 171  GLY A C   1 
ATOM   1351 O  O   . GLY A 1 170 ? 25.922 19.459 72.620  1.00 13.44 ? 171  GLY A O   1 
ATOM   1352 N  N   . GLY A 1 171 ? 25.256 21.647 72.486  1.00 11.37 ? 172  GLY A N   1 
ATOM   1353 C  CA  . GLY A 1 171 ? 23.832 21.342 72.465  1.00 10.51 ? 172  GLY A CA  1 
ATOM   1354 C  C   . GLY A 1 171 ? 23.371 20.467 71.296  1.00 10.13 ? 172  GLY A C   1 
ATOM   1355 O  O   . GLY A 1 171 ? 22.272 19.897 71.369  1.00 10.62 ? 172  GLY A O   1 
ATOM   1356 N  N   . GLY A 1 172 ? 24.164 20.439 70.200  1.00 8.58  ? 173  GLY A N   1 
ATOM   1357 C  CA  . GLY A 1 172 ? 23.974 19.557 69.067  1.00 8.34  ? 173  GLY A CA  1 
ATOM   1358 C  C   . GLY A 1 172 ? 24.039 18.057 69.427  1.00 9.89  ? 173  GLY A C   1 
ATOM   1359 O  O   . GLY A 1 172 ? 23.558 17.218 68.659  1.00 10.39 ? 173  GLY A O   1 
ATOM   1360 N  N   . LEU A 1 173 ? 24.617 17.673 70.588  1.00 10.94 ? 174  LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 173 ? 24.598 16.300 71.052  1.00 11.42 ? 174  LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 173 ? 23.851 16.139 72.396  1.00 12.24 ? 174  LEU A C   1 
ATOM   1363 O  O   . LEU A 1 173 ? 24.160 15.228 73.182  1.00 13.21 ? 174  LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 173 ? 26.063 15.880 71.089  1.00 10.83 ? 174  LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 173 ? 26.469 14.437 70.762  1.00 11.38 ? 174  LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 173 ? 25.823 13.961 69.485  1.00 12.56 ? 174  LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 173 ? 27.955 14.373 70.453  1.00 10.12 ? 174  LEU A CD2 1 
ATOM   1368 N  N   . GLY A 1 174 ? 22.855 17.037 72.647  1.00 11.43 ? 175  GLY A N   1 
ATOM   1369 C  CA  . GLY A 1 174 ? 21.863 16.967 73.735  1.00 10.52 ? 175  GLY A CA  1 
ATOM   1370 C  C   . GLY A 1 174 ? 22.215 17.388 75.128  1.00 9.63  ? 175  GLY A C   1 
ATOM   1371 O  O   . GLY A 1 174 ? 21.481 17.083 76.067  1.00 7.65  ? 175  GLY A O   1 
ATOM   1372 N  N   . GLY A 1 175 ? 23.320 18.164 75.226  1.00 11.47 ? 176  GLY A N   1 
ATOM   1373 C  CA  . GLY A 1 175 ? 23.836 18.686 76.504  1.00 9.63  ? 176  GLY A CA  1 
ATOM   1374 C  C   . GLY A 1 175 ? 23.619 20.168 76.708  1.00 9.33  ? 176  GLY A C   1 
ATOM   1375 O  O   . GLY A 1 175 ? 23.342 20.939 75.779  1.00 9.37  ? 176  GLY A O   1 
ATOM   1376 N  N   . ILE A 1 176 ? 23.730 20.533 77.968  1.00 7.73  ? 177  ILE A N   1 
ATOM   1377 C  CA  . ILE A 1 176 ? 23.727 21.925 78.308  1.00 9.08  ? 177  ILE A CA  1 
ATOM   1378 C  C   . ILE A 1 176 ? 25.187 22.420 78.434  1.00 9.49  ? 177  ILE A C   1 
ATOM   1379 O  O   . ILE A 1 176 ? 25.889 22.190 79.434  1.00 8.82  ? 177  ILE A O   1 
ATOM   1380 C  CB  . ILE A 1 176 ? 22.889 22.061 79.628  1.00 9.75  ? 177  ILE A CB  1 
ATOM   1381 C  CG1 . ILE A 1 176 ? 21.423 21.771 79.324  1.00 9.28  ? 177  ILE A CG1 1 
ATOM   1382 C  CG2 . ILE A 1 176 ? 22.884 23.501 80.191  1.00 10.29 ? 177  ILE A CG2 1 
ATOM   1383 C  CD1 . ILE A 1 176 ? 20.818 22.630 78.195  1.00 8.02  ? 177  ILE A CD1 1 
ATOM   1384 N  N   . CYS A 1 177 ? 25.665 23.070 77.359  1.00 9.47  ? 178  CYS A N   1 
ATOM   1385 C  CA  . CYS A 1 177 ? 27.039 23.609 77.269  1.00 9.69  ? 178  CYS A CA  1 
ATOM   1386 C  C   . CYS A 1 177 ? 26.969 25.149 77.295  1.00 10.05 ? 178  CYS A C   1 
ATOM   1387 O  O   . CYS A 1 177 ? 26.404 25.724 76.362  1.00 9.56  ? 178  CYS A O   1 
ATOM   1388 C  CB  . CYS A 1 177 ? 27.627 23.138 75.977  1.00 9.11  ? 178  CYS A CB  1 
ATOM   1389 S  SG  . CYS A 1 177 ? 27.590 21.315 75.910  1.00 9.37  ? 178  CYS A SG  1 
ATOM   1390 N  N   . ILE A 1 178 ? 27.507 25.805 78.334  1.00 8.61  ? 179  ILE A N   1 
ATOM   1391 C  CA  . ILE A 1 178 ? 27.359 27.239 78.560  1.00 6.96  ? 179  ILE A CA  1 
ATOM   1392 C  C   . ILE A 1 178 ? 28.671 28.009 78.590  1.00 5.98  ? 179  ILE A C   1 
ATOM   1393 O  O   . ILE A 1 178 ? 29.593 27.547 79.249  1.00 3.95  ? 179  ILE A O   1 
ATOM   1394 C  CB  . ILE A 1 178 ? 26.581 27.478 79.903  1.00 6.83  ? 179  ILE A CB  1 
ATOM   1395 C  CG1 . ILE A 1 178 ? 25.094 27.188 79.709  1.00 5.21  ? 179  ILE A CG1 1 
ATOM   1396 C  CG2 . ILE A 1 178 ? 26.639 28.921 80.348  1.00 3.61  ? 179  ILE A CG2 1 
ATOM   1397 C  CD1 . ILE A 1 178 ? 24.332 27.048 81.072  1.00 3.95  ? 179  ILE A CD1 1 
ATOM   1398 N  N   . GLY A 1 179 ? 28.744 29.193 77.926  1.00 5.23  ? 180  GLY A N   1 
ATOM   1399 C  CA  . GLY A 1 179 ? 29.975 29.939 77.869  1.00 5.94  ? 180  GLY A CA  1 
ATOM   1400 C  C   . GLY A 1 179 ? 30.170 30.730 79.146  1.00 7.72  ? 180  GLY A C   1 
ATOM   1401 O  O   . GLY A 1 179 ? 29.199 31.298 79.682  1.00 8.95  ? 180  GLY A O   1 
ATOM   1402 N  N   . VAL A 1 180 ? 31.397 30.766 79.673  1.00 8.09  ? 181  VAL A N   1 
ATOM   1403 C  CA  . VAL A 1 180 ? 31.693 31.559 80.868  1.00 10.49 ? 181  VAL A CA  1 
ATOM   1404 C  C   . VAL A 1 180 ? 33.038 32.281 80.684  1.00 12.43 ? 181  VAL A C   1 
ATOM   1405 O  O   . VAL A 1 180 ? 33.682 32.150 79.630  1.00 13.35 ? 181  VAL A O   1 
ATOM   1406 C  CB  . VAL A 1 180 ? 31.814 30.707 82.149  1.00 9.74  ? 181  VAL A CB  1 
ATOM   1407 C  CG1 . VAL A 1 180 ? 30.452 30.275 82.588  1.00 11.39 ? 181  VAL A CG1 1 
ATOM   1408 C  CG2 . VAL A 1 180 ? 32.657 29.477 81.935  1.00 10.33 ? 181  VAL A CG2 1 
ATOM   1409 N  N   . GLY A 1 181 ? 33.442 33.029 81.738  1.00 13.33 ? 182  GLY A N   1 
ATOM   1410 C  CA  . GLY A 1 181 ? 34.697 33.762 81.794  1.00 13.25 ? 182  GLY A CA  1 
ATOM   1411 C  C   . GLY A 1 181 ? 35.607 33.009 82.744  1.00 13.48 ? 182  GLY A C   1 
ATOM   1412 O  O   . GLY A 1 181 ? 35.160 32.223 83.587  1.00 12.59 ? 182  GLY A O   1 
ATOM   1413 N  N   . GLY A 1 182 ? 36.913 33.251 82.582  1.00 13.58 ? 183  GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 182 ? 37.944 32.619 83.386  1.00 12.91 ? 183  GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 182 ? 37.671 32.532 84.887  1.00 12.95 ? 183  GLY A C   1 
ATOM   1416 O  O   . GLY A 1 182 ? 37.936 31.483 85.463  1.00 14.08 ? 183  GLY A O   1 
ATOM   1417 N  N   . ALA A 1 183 ? 37.149 33.544 85.579  1.00 12.50 ? 184  ALA A N   1 
ATOM   1418 C  CA  . ALA A 1 183 ? 36.871 33.425 87.017  1.00 12.15 ? 184  ALA A CA  1 
ATOM   1419 C  C   . ALA A 1 183 ? 35.707 32.468 87.357  1.00 13.45 ? 184  ALA A C   1 
ATOM   1420 O  O   . ALA A 1 183 ? 35.644 31.890 88.462  1.00 13.95 ? 184  ALA A O   1 
ATOM   1421 C  CB  . ALA A 1 183 ? 36.551 34.801 87.573  1.00 10.36 ? 184  ALA A CB  1 
ATOM   1422 N  N   . ASP A 1 184 ? 34.781 32.257 86.406  1.00 14.78 ? 185  ASP A N   1 
ATOM   1423 C  CA  . ASP A 1 184 ? 33.724 31.307 86.600  1.00 16.46 ? 185  ASP A CA  1 
ATOM   1424 C  C   . ASP A 1 184 ? 34.251 29.887 86.568  1.00 16.00 ? 185  ASP A C   1 
ATOM   1425 O  O   . ASP A 1 184 ? 33.854 29.163 87.485  1.00 16.41 ? 185  ASP A O   1 
ATOM   1426 C  CB  . ASP A 1 184 ? 32.681 31.482 85.548  1.00 19.02 ? 185  ASP A CB  1 
ATOM   1427 C  CG  . ASP A 1 184 ? 31.587 32.488 85.905  1.00 22.49 ? 185  ASP A CG  1 
ATOM   1428 O  OD1 . ASP A 1 184 ? 31.713 33.235 86.873  1.00 23.95 ? 185  ASP A OD1 1 
ATOM   1429 O  OD2 . ASP A 1 184 ? 30.571 32.516 85.205  1.00 25.41 ? 185  ASP A OD2 1 
ATOM   1430 N  N   . ALA A 1 185 ? 35.121 29.546 85.568  1.00 14.90 ? 186  ALA A N   1 
ATOM   1431 C  CA  . ALA A 1 185 ? 35.839 28.272 85.451  1.00 14.04 ? 186  ALA A CA  1 
ATOM   1432 C  C   . ALA A 1 185 ? 36.725 27.977 86.658  1.00 14.27 ? 186  ALA A C   1 
ATOM   1433 O  O   . ALA A 1 185 ? 36.766 26.822 87.044  1.00 13.42 ? 186  ALA A O   1 
ATOM   1434 C  CB  . ALA A 1 185 ? 36.789 28.203 84.221  1.00 12.61 ? 186  ALA A CB  1 
ATOM   1435 N  N   . VAL A 1 186 ? 37.493 28.938 87.222  1.00 14.39 ? 187  VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 186 ? 38.240 28.793 88.489  1.00 14.99 ? 187  VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 186 ? 37.356 28.290 89.649  1.00 16.86 ? 187  VAL A C   1 
ATOM   1438 O  O   . VAL A 1 186 ? 37.744 27.383 90.376  1.00 17.45 ? 187  VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 186 ? 38.905 30.185 88.870  1.00 13.31 ? 187  VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 186 ? 39.590 30.227 90.232  1.00 11.57 ? 187  VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 186 ? 39.971 30.443 87.857  1.00 12.22 ? 187  VAL A CG2 1 
ATOM   1442 N  N   . ASP A 1 187 ? 36.151 28.815 89.883  1.00 18.36 ? 188  ASP A N   1 
ATOM   1443 C  CA  . ASP A 1 187 ? 35.248 28.330 90.932  1.00 19.05 ? 188  ASP A CA  1 
ATOM   1444 C  C   . ASP A 1 187 ? 35.007 26.817 90.827  1.00 18.77 ? 188  ASP A C   1 
ATOM   1445 O  O   . ASP A 1 187 ? 35.098 26.064 91.796  1.00 20.33 ? 188  ASP A O   1 
ATOM   1446 C  CB  . ASP A 1 187 ? 33.882 28.979 90.829  1.00 20.35 ? 188  ASP A CB  1 
ATOM   1447 C  CG  . ASP A 1 187 ? 33.684 30.460 91.165  1.00 21.62 ? 188  ASP A CG  1 
ATOM   1448 O  OD1 . ASP A 1 187 ? 34.457 31.039 91.944  1.00 22.08 ? 188  ASP A OD1 1 
ATOM   1449 O  OD2 . ASP A 1 187 ? 32.706 31.013 90.634  1.00 21.81 ? 188  ASP A OD2 1 
ATOM   1450 N  N   . VAL A 1 188 ? 34.703 26.357 89.627  1.00 17.67 ? 189  VAL A N   1 
ATOM   1451 C  CA  . VAL A 1 188 ? 34.407 24.957 89.390  1.00 17.94 ? 189  VAL A CA  1 
ATOM   1452 C  C   . VAL A 1 188 ? 35.685 24.090 89.404  1.00 17.84 ? 189  VAL A C   1 
ATOM   1453 O  O   . VAL A 1 188 ? 35.669 22.952 89.910  1.00 18.38 ? 189  VAL A O   1 
ATOM   1454 C  CB  . VAL A 1 188 ? 33.598 24.912 88.030  1.00 18.23 ? 189  VAL A CB  1 
ATOM   1455 C  CG1 . VAL A 1 188 ? 33.305 23.482 87.566  1.00 18.74 ? 189  VAL A CG1 1 
ATOM   1456 C  CG2 . VAL A 1 188 ? 32.232 25.567 88.242  1.00 17.18 ? 189  VAL A CG2 1 
ATOM   1457 N  N   . MET A 1 189 ? 36.822 24.611 88.897  1.00 16.85 ? 190  MET A N   1 
ATOM   1458 C  CA  . MET A 1 189 ? 38.105 23.945 89.003  1.00 16.38 ? 190  MET A CA  1 
ATOM   1459 C  C   . MET A 1 189 ? 38.480 23.814 90.446  1.00 17.60 ? 190  MET A C   1 
ATOM   1460 O  O   . MET A 1 189 ? 39.074 22.853 90.839  1.00 17.68 ? 190  MET A O   1 
ATOM   1461 C  CB  . MET A 1 189 ? 39.167 24.729 88.300  1.00 14.24 ? 190  MET A CB  1 
ATOM   1462 C  CG  . MET A 1 189 ? 38.943 24.448 86.849  1.00 12.95 ? 190  MET A CG  1 
ATOM   1463 S  SD  . MET A 1 189 ? 40.315 24.908 85.797  1.00 14.27 ? 190  MET A SD  1 
ATOM   1464 C  CE  . MET A 1 189 ? 40.858 26.460 86.415  1.00 14.52 ? 190  MET A CE  1 
ATOM   1465 N  N   . ALA A 1 190 ? 38.084 24.748 91.283  1.00 19.76 ? 191  ALA A N   1 
ATOM   1466 C  CA  . ALA A 1 190 ? 38.359 24.745 92.702  1.00 20.80 ? 191  ALA A CA  1 
ATOM   1467 C  C   . ALA A 1 190 ? 37.364 23.965 93.569  1.00 22.56 ? 191  ALA A C   1 
ATOM   1468 O  O   . ALA A 1 190 ? 37.588 23.807 94.777  1.00 23.26 ? 191  ALA A O   1 
ATOM   1469 C  CB  . ALA A 1 190 ? 38.387 26.185 93.174  1.00 19.36 ? 191  ALA A CB  1 
ATOM   1470 N  N   . GLY A 1 191 ? 36.219 23.519 93.044  1.00 23.73 ? 192  GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 191 ? 35.276 22.764 93.845  1.00 24.21 ? 192  GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 191 ? 34.142 23.575 94.470  1.00 25.27 ? 192  GLY A C   1 
ATOM   1473 O  O   . GLY A 1 191 ? 33.444 23.048 95.343  1.00 24.80 ? 192  GLY A O   1 
ATOM   1474 N  N   . ILE A 1 192 ? 33.884 24.849 94.125  1.00 26.01 ? 193  ILE A N   1 
ATOM   1475 C  CA  . ILE A 1 192 ? 32.736 25.487 94.751  1.00 25.36 ? 193  ILE A CA  1 
ATOM   1476 C  C   . ILE A 1 192 ? 31.515 25.482 93.796  1.00 24.79 ? 193  ILE A C   1 
ATOM   1477 O  O   . ILE A 1 192 ? 31.617 25.191 92.587  1.00 23.95 ? 193  ILE A O   1 
ATOM   1478 C  CB  . ILE A 1 192 ? 33.114 26.943 95.240  1.00 25.64 ? 193  ILE A CB  1 
ATOM   1479 C  CG1 . ILE A 1 192 ? 33.519 27.896 94.194  1.00 26.26 ? 193  ILE A CG1 1 
ATOM   1480 C  CG2 . ILE A 1 192 ? 34.285 26.778 96.168  1.00 25.03 ? 193  ILE A CG2 1 
ATOM   1481 C  CD1 . ILE A 1 192 ? 33.501 29.303 94.802  1.00 26.97 ? 193  ILE A CD1 1 
ATOM   1482 N  N   . PRO A 1 193 ? 30.303 25.646 94.364  1.00 24.26 ? 194  PRO A N   1 
ATOM   1483 C  CA  . PRO A 1 193 ? 29.053 25.761 93.619  1.00 23.51 ? 194  PRO A CA  1 
ATOM   1484 C  C   . PRO A 1 193 ? 29.061 26.855 92.526  1.00 22.78 ? 194  PRO A C   1 
ATOM   1485 O  O   . PRO A 1 193 ? 29.429 27.989 92.827  1.00 23.72 ? 194  PRO A O   1 
ATOM   1486 C  CB  . PRO A 1 193 ? 28.055 25.976 94.745  1.00 23.89 ? 194  PRO A CB  1 
ATOM   1487 C  CG  . PRO A 1 193 ? 28.605 25.225 95.931  1.00 24.29 ? 194  PRO A CG  1 
ATOM   1488 C  CD  . PRO A 1 193 ? 30.057 25.588 95.816  1.00 23.67 ? 194  PRO A CD  1 
ATOM   1489 N  N   . TRP A 1 194 ? 28.676 26.606 91.260  1.00 20.66 ? 195  TRP A N   1 
ATOM   1490 C  CA  . TRP A 1 194 ? 28.689 27.654 90.236  1.00 18.39 ? 195  TRP A CA  1 
ATOM   1491 C  C   . TRP A 1 194 ? 27.350 28.424 90.195  1.00 17.79 ? 195  TRP A C   1 
ATOM   1492 O  O   . TRP A 1 194 ? 26.324 27.779 90.269  1.00 19.57 ? 195  TRP A O   1 
ATOM   1493 C  CB  . TRP A 1 194 ? 29.019 26.967 88.916  1.00 15.12 ? 195  TRP A CB  1 
ATOM   1494 C  CG  . TRP A 1 194 ? 28.991 27.889 87.706  1.00 14.38 ? 195  TRP A CG  1 
ATOM   1495 C  CD1 . TRP A 1 194 ? 29.716 29.049 87.672  1.00 13.07 ? 195  TRP A CD1 1 
ATOM   1496 C  CD2 . TRP A 1 194 ? 28.215 27.711 86.586  1.00 11.86 ? 195  TRP A CD2 1 
ATOM   1497 N  NE1 . TRP A 1 194 ? 29.375 29.589 86.535  1.00 11.66 ? 195  TRP A NE1 1 
ATOM   1498 C  CE2 . TRP A 1 194 ? 28.497 28.849 85.863  1.00 10.24 ? 195  TRP A CE2 1 
ATOM   1499 C  CE3 . TRP A 1 194 ? 27.326 26.761 86.109  1.00 11.33 ? 195  TRP A CE3 1 
ATOM   1500 C  CZ2 . TRP A 1 194 ? 27.897 29.093 84.645  1.00 10.61 ? 195  TRP A CZ2 1 
ATOM   1501 C  CZ3 . TRP A 1 194 ? 26.709 26.995 84.876  1.00 12.45 ? 195  TRP A CZ3 1 
ATOM   1502 C  CH2 . TRP A 1 194 ? 26.994 28.156 84.148  1.00 12.21 ? 195  TRP A CH2 1 
ATOM   1503 N  N   . GLU A 1 195 ? 27.148 29.736 90.152  1.00 16.45 ? 196  GLU A N   1 
ATOM   1504 C  CA  . GLU A 1 195 ? 25.787 30.230 90.119  1.00 15.43 ? 196  GLU A CA  1 
ATOM   1505 C  C   . GLU A 1 195 ? 25.389 30.654 88.720  1.00 15.23 ? 196  GLU A C   1 
ATOM   1506 O  O   . GLU A 1 195 ? 26.191 31.297 88.023  1.00 13.35 ? 196  GLU A O   1 
ATOM   1507 C  CB  . GLU A 1 195 ? 25.619 31.406 90.977  1.00 16.17 ? 196  GLU A CB  1 
ATOM   1508 C  CG  . GLU A 1 195 ? 25.901 31.210 92.460  1.00 18.99 ? 196  GLU A CG  1 
ATOM   1509 C  CD  . GLU A 1 195 ? 25.618 32.493 93.268  1.00 20.96 ? 196  GLU A CD  1 
ATOM   1510 O  OE1 . GLU A 1 195 ? 25.966 33.593 92.787  1.00 21.02 ? 196  GLU A OE1 1 
ATOM   1511 O  OE2 . GLU A 1 195 ? 25.066 32.391 94.376  1.00 22.24 ? 196  GLU A OE2 1 
ATOM   1512 N  N   . LEU A 1 196 ? 24.167 30.283 88.291  1.00 14.48 ? 197  LEU A N   1 
ATOM   1513 C  CA  . LEU A 1 196 ? 23.637 30.800 87.036  1.00 14.36 ? 197  LEU A CA  1 
ATOM   1514 C  C   . LEU A 1 196 ? 22.202 31.348 87.258  1.00 14.57 ? 197  LEU A C   1 
ATOM   1515 O  O   . LEU A 1 196 ? 21.384 30.730 87.939  1.00 15.88 ? 197  LEU A O   1 
ATOM   1516 C  CB  . LEU A 1 196 ? 23.622 29.701 86.014  1.00 12.85 ? 197  LEU A CB  1 
ATOM   1517 C  CG  . LEU A 1 196 ? 23.016 29.991 84.653  1.00 12.43 ? 197  LEU A CG  1 
ATOM   1518 C  CD1 . LEU A 1 196 ? 23.868 30.956 83.831  1.00 11.35 ? 197  LEU A CD1 1 
ATOM   1519 C  CD2 . LEU A 1 196 ? 22.836 28.649 83.972  1.00 13.25 ? 197  LEU A CD2 1 
ATOM   1520 N  N   . LYS A 1 197 ? 21.834 32.488 86.678  1.00 14.49 ? 198  LYS A N   1 
ATOM   1521 C  CA  . LYS A 1 197 ? 20.498 33.039 86.781  1.00 14.77 ? 198  LYS A CA  1 
ATOM   1522 C  C   . LYS A 1 197 ? 19.577 32.076 86.056  1.00 14.53 ? 198  LYS A C   1 
ATOM   1523 O  O   . LYS A 1 197 ? 19.877 31.713 84.922  1.00 14.22 ? 198  LYS A O   1 
ATOM   1524 C  CB  . LYS A 1 197 ? 20.506 34.389 86.137  1.00 14.52 ? 198  LYS A CB  1 
ATOM   1525 C  CG  . LYS A 1 197 ? 19.150 35.002 85.948  1.00 16.66 ? 198  LYS A CG  1 
ATOM   1526 C  CD  . LYS A 1 197 ? 18.555 35.535 87.218  1.00 18.19 ? 198  LYS A CD  1 
ATOM   1527 C  CE  . LYS A 1 197 ? 18.675 37.043 87.172  1.00 20.52 ? 198  LYS A CE  1 
ATOM   1528 N  NZ  . LYS A 1 197 ? 17.875 37.594 86.086  1.00 22.67 ? 198  LYS A NZ  1 
ATOM   1529 N  N   . CYS A 1 198 ? 18.473 31.658 86.697  1.00 14.84 ? 199  CYS A N   1 
ATOM   1530 C  CA  . CYS A 1 198 ? 17.554 30.658 86.160  1.00 16.04 ? 199  CYS A CA  1 
ATOM   1531 C  C   . CYS A 1 198 ? 16.989 31.105 84.825  1.00 15.93 ? 199  CYS A C   1 
ATOM   1532 O  O   . CYS A 1 198 ? 16.492 32.215 84.737  1.00 16.96 ? 199  CYS A O   1 
ATOM   1533 C  CB  . CYS A 1 198 ? 16.405 30.398 87.161  1.00 15.75 ? 199  CYS A CB  1 
ATOM   1534 S  SG  . CYS A 1 198 ? 15.321 28.992 86.718  1.00 17.33 ? 199  CYS A SG  1 
ATOM   1535 N  N   . PRO A 1 199 ? 17.131 30.402 83.706  1.00 16.81 ? 200  PRO A N   1 
ATOM   1536 C  CA  . PRO A 1 199 ? 16.686 30.994 82.453  1.00 16.49 ? 200  PRO A CA  1 
ATOM   1537 C  C   . PRO A 1 199 ? 15.215 30.871 82.081  1.00 16.36 ? 200  PRO A C   1 
ATOM   1538 O  O   . PRO A 1 199 ? 14.505 30.042 82.630  1.00 18.64 ? 200  PRO A O   1 
ATOM   1539 C  CB  . PRO A 1 199 ? 17.651 30.371 81.467  1.00 17.08 ? 200  PRO A CB  1 
ATOM   1540 C  CG  . PRO A 1 199 ? 18.007 29.030 82.079  1.00 17.39 ? 200  PRO A CG  1 
ATOM   1541 C  CD  . PRO A 1 199 ? 18.037 29.240 83.563  1.00 16.69 ? 200  PRO A CD  1 
ATOM   1542 N  N   . LYS A 1 200 ? 14.740 31.681 81.147  1.00 14.97 ? 201  LYS A N   1 
ATOM   1543 C  CA  . LYS A 1 200 ? 13.447 31.512 80.539  1.00 14.02 ? 201  LYS A CA  1 
ATOM   1544 C  C   . LYS A 1 200 ? 13.675 30.480 79.418  1.00 13.13 ? 201  LYS A C   1 
ATOM   1545 O  O   . LYS A 1 200 ? 14.810 30.048 79.185  1.00 13.32 ? 201  LYS A O   1 
ATOM   1546 C  CB  . LYS A 1 200 ? 13.015 32.805 79.940  1.00 15.91 ? 201  LYS A CB  1 
ATOM   1547 C  CG  . LYS A 1 200 ? 13.191 33.986 80.819  1.00 17.00 ? 201  LYS A CG  1 
ATOM   1548 C  CD  . LYS A 1 200 ? 12.355 33.892 82.061  1.00 22.71 ? 201  LYS A CD  1 
ATOM   1549 C  CE  . LYS A 1 200 ? 11.075 34.719 81.931  1.00 25.63 ? 201  LYS A CE  1 
ATOM   1550 N  NZ  . LYS A 1 200 ? 10.168 34.037 81.038  1.00 31.73 ? 201  LYS A NZ  1 
ATOM   1551 N  N   . VAL A 1 201 ? 12.685 30.021 78.643  1.00 11.24 ? 202  VAL A N   1 
ATOM   1552 C  CA  . VAL A 1 201 ? 12.909 28.990 77.634  1.00 8.66  ? 202  VAL A CA  1 
ATOM   1553 C  C   . VAL A 1 201 ? 12.114 29.425 76.441  1.00 9.07  ? 202  VAL A C   1 
ATOM   1554 O  O   . VAL A 1 201 ? 10.931 29.676 76.504  1.00 8.99  ? 202  VAL A O   1 
ATOM   1555 C  CB  . VAL A 1 201 ? 12.420 27.582 78.109  1.00 7.87  ? 202  VAL A CB  1 
ATOM   1556 C  CG1 . VAL A 1 201 ? 12.807 26.677 76.970  1.00 6.01  ? 202  VAL A CG1 1 
ATOM   1557 C  CG2 . VAL A 1 201 ? 13.031 27.069 79.433  1.00 5.25  ? 202  VAL A CG2 1 
ATOM   1558 N  N   . ILE A 1 202 ? 12.758 29.538 75.315  1.00 9.36  ? 203  ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 202 ? 12.108 29.976 74.102  1.00 8.98  ? 203  ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 202 ? 11.985 28.649 73.365  1.00 9.48  ? 203  ILE A C   1 
ATOM   1561 O  O   . ILE A 1 202 ? 12.988 27.953 73.323  1.00 8.64  ? 203  ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 202 ? 13.041 30.980 73.350  1.00 8.34  ? 203  ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 202 ? 13.005 32.253 74.133  1.00 5.84  ? 203  ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 202 ? 12.678 31.189 71.888  1.00 4.97  ? 203  ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 202 ? 14.211 33.123 73.724  1.00 6.59  ? 203  ILE A CD1 1 
ATOM   1566 N  N   . GLY A 1 203 ? 10.864 28.208 72.791  1.00 10.40 ? 204  GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 203 ? 10.884 26.971 72.068  1.00 12.62 ? 204  GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 203 ? 10.872 27.266 70.592  1.00 14.27 ? 204  GLY A C   1 
ATOM   1569 O  O   . GLY A 1 203 ? 10.083 28.118 70.201  1.00 15.70 ? 204  GLY A O   1 
ATOM   1570 N  N   . VAL A 1 204 ? 11.691 26.664 69.726  1.00 16.29 ? 205  VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 204 ? 11.519 26.854 68.278  1.00 18.39 ? 205  VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 204 ? 10.962 25.518 67.751  1.00 19.96 ? 205  VAL A C   1 
ATOM   1573 O  O   . VAL A 1 204 ? 11.548 24.445 67.991  1.00 19.87 ? 205  VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 204 ? 12.894 27.191 67.630  1.00 18.58 ? 205  VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 204 ? 12.803 27.382 66.122  1.00 17.28 ? 205  VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 204 ? 13.398 28.506 68.233  1.00 19.13 ? 205  VAL A CG2 1 
ATOM   1577 N  N   . LYS A 1 205 ? 9.818  25.528 67.046  1.00 21.28 ? 206  LYS A N   1 
ATOM   1578 C  CA  . LYS A 1 205 ? 9.282  24.313 66.475  1.00 22.09 ? 206  LYS A CA  1 
ATOM   1579 C  C   . LYS A 1 205 ? 9.702  24.268 65.016  1.00 22.09 ? 206  LYS A C   1 
ATOM   1580 O  O   . LYS A 1 205 ? 9.462  25.160 64.201  1.00 20.84 ? 206  LYS A O   1 
ATOM   1581 C  CB  . LYS A 1 205 ? 7.767  24.307 66.618  1.00 24.71 ? 206  LYS A CB  1 
ATOM   1582 C  CG  . LYS A 1 205 ? 7.098  23.116 65.931  1.00 28.04 ? 206  LYS A CG  1 
ATOM   1583 C  CD  . LYS A 1 205 ? 5.656  22.946 66.437  1.00 33.20 ? 206  LYS A CD  1 
ATOM   1584 C  CE  . LYS A 1 205 ? 4.682  22.302 65.389  1.00 37.15 ? 206  LYS A CE  1 
ATOM   1585 N  NZ  . LYS A 1 205 ? 4.474  23.123 64.187  1.00 41.13 ? 206  LYS A NZ  1 
ATOM   1586 N  N   . LEU A 1 206 ? 10.422 23.199 64.700  1.00 22.64 ? 207  LEU A N   1 
ATOM   1587 C  CA  . LEU A 1 206 ? 10.869 22.978 63.346  1.00 23.78 ? 207  LEU A CA  1 
ATOM   1588 C  C   . LEU A 1 206 ? 9.905  22.007 62.685  1.00 24.71 ? 207  LEU A C   1 
ATOM   1589 O  O   . LEU A 1 206 ? 9.431  21.049 63.300  1.00 25.31 ? 207  LEU A O   1 
ATOM   1590 C  CB  . LEU A 1 206 ? 12.235 22.408 63.360  1.00 23.50 ? 207  LEU A CB  1 
ATOM   1591 C  CG  . LEU A 1 206 ? 13.398 23.237 63.879  1.00 22.82 ? 207  LEU A CG  1 
ATOM   1592 C  CD1 . LEU A 1 206 ? 14.594 22.315 63.799  1.00 23.13 ? 207  LEU A CD1 1 
ATOM   1593 C  CD2 . LEU A 1 206 ? 13.677 24.472 63.074  1.00 20.46 ? 207  LEU A CD2 1 
ATOM   1594 N  N   . THR A 1 207 ? 9.620  22.321 61.427  1.00 24.78 ? 208  THR A N   1 
ATOM   1595 C  CA  . THR A 1 207 ? 8.629  21.668 60.613  1.00 25.94 ? 208  THR A CA  1 
ATOM   1596 C  C   . THR A 1 207 ? 9.140  21.415 59.196  1.00 28.67 ? 208  THR A C   1 
ATOM   1597 O  O   . THR A 1 207 ? 9.967  22.183 58.707  1.00 29.82 ? 208  THR A O   1 
ATOM   1598 C  CB  . THR A 1 207 ? 7.469  22.600 60.661  1.00 24.51 ? 208  THR A CB  1 
ATOM   1599 O  OG1 . THR A 1 207 ? 6.719  22.085 61.721  1.00 23.85 ? 208  THR A OG1 1 
ATOM   1600 C  CG2 . THR A 1 207 ? 6.599  22.660 59.478  1.00 24.62 ? 208  THR A CG2 1 
ATOM   1601 N  N   . GLY A 1 208 ? 8.695  20.400 58.445  1.00 29.82 ? 209  GLY A N   1 
ATOM   1602 C  CA  . GLY A 1 208 ? 9.151  20.209 57.064  1.00 30.02 ? 209  GLY A CA  1 
ATOM   1603 C  C   . GLY A 1 208 ? 10.482 19.497 57.040  1.00 30.84 ? 209  GLY A C   1 
ATOM   1604 O  O   . GLY A 1 208 ? 10.847 18.805 57.995  1.00 31.17 ? 209  GLY A O   1 
ATOM   1605 N  N   . SER A 1 209 ? 11.175 19.604 55.915  1.00 31.90 ? 210  SER A N   1 
ATOM   1606 C  CA  . SER A 1 209 ? 12.533 19.116 55.824  1.00 33.50 ? 210  SER A CA  1 
ATOM   1607 C  C   . SER A 1 209 ? 13.294 20.043 54.875  1.00 33.99 ? 210  SER A C   1 
ATOM   1608 O  O   . SER A 1 209 ? 12.744 20.586 53.913  1.00 35.11 ? 210  SER A O   1 
ATOM   1609 C  CB  . SER A 1 209 ? 12.587 17.667 55.292  1.00 33.94 ? 210  SER A CB  1 
ATOM   1610 O  OG  . SER A 1 209 ? 11.963 17.506 54.026  1.00 36.08 ? 210  SER A OG  1 
ATOM   1611 N  N   . LEU A 1 210 ? 14.568 20.278 55.208  1.00 34.24 ? 211  LEU A N   1 
ATOM   1612 C  CA  . LEU A 1 210 ? 15.500 21.068 54.403  1.00 33.46 ? 211  LEU A CA  1 
ATOM   1613 C  C   . LEU A 1 210 ? 15.626 20.572 52.963  1.00 33.12 ? 211  LEU A C   1 
ATOM   1614 O  O   . LEU A 1 210 ? 15.756 19.371 52.764  1.00 32.89 ? 211  LEU A O   1 
ATOM   1615 C  CB  . LEU A 1 210 ? 16.870 21.036 55.102  1.00 31.56 ? 211  LEU A CB  1 
ATOM   1616 C  CG  . LEU A 1 210 ? 16.955 21.720 56.449  1.00 30.58 ? 211  LEU A CG  1 
ATOM   1617 C  CD1 . LEU A 1 210 ? 18.246 21.416 57.143  1.00 28.97 ? 211  LEU A CD1 1 
ATOM   1618 C  CD2 . LEU A 1 210 ? 16.870 23.207 56.224  1.00 31.41 ? 211  LEU A CD2 1 
ATOM   1619 N  N   . SER A 1 211 ? 15.537 21.415 51.937  1.00 33.28 ? 212  SER A N   1 
ATOM   1620 C  CA  . SER A 1 211 ? 15.694 20.933 50.564  1.00 33.91 ? 212  SER A CA  1 
ATOM   1621 C  C   . SER A 1 211 ? 16.608 21.755 49.636  1.00 33.39 ? 212  SER A C   1 
ATOM   1622 O  O   . SER A 1 211 ? 16.550 22.994 49.573  1.00 33.17 ? 212  SER A O   1 
ATOM   1623 C  CB  . SER A 1 211 ? 14.263 20.789 49.914  1.00 34.58 ? 212  SER A CB  1 
ATOM   1624 O  OG  . SER A 1 211 ? 13.253 21.760 50.257  1.00 35.91 ? 212  SER A OG  1 
ATOM   1625 N  N   . GLY A 1 212 ? 17.485 21.043 48.918  1.00 32.15 ? 213  GLY A N   1 
ATOM   1626 C  CA  . GLY A 1 212 ? 18.318 21.674 47.909  1.00 30.77 ? 213  GLY A CA  1 
ATOM   1627 C  C   . GLY A 1 212 ? 19.458 22.488 48.493  1.00 29.98 ? 213  GLY A C   1 
ATOM   1628 O  O   . GLY A 1 212 ? 20.306 21.990 49.238  1.00 30.76 ? 213  GLY A O   1 
ATOM   1629 N  N   . TRP A 1 213 ? 19.495 23.768 48.137  1.00 29.40 ? 214  TRP A N   1 
ATOM   1630 C  CA  . TRP A 1 213 ? 20.500 24.694 48.661  1.00 29.18 ? 214  TRP A CA  1 
ATOM   1631 C  C   . TRP A 1 213 ? 20.397 25.114 50.124  1.00 28.66 ? 214  TRP A C   1 
ATOM   1632 O  O   . TRP A 1 213 ? 21.416 25.468 50.719  1.00 28.79 ? 214  TRP A O   1 
ATOM   1633 C  CB  . TRP A 1 213 ? 20.503 25.913 47.794  1.00 30.02 ? 214  TRP A CB  1 
ATOM   1634 C  CG  . TRP A 1 213 ? 21.315 25.713 46.519  1.00 31.54 ? 214  TRP A CG  1 
ATOM   1635 C  CD1 . TRP A 1 213 ? 20.696 25.505 45.318  1.00 31.94 ? 214  TRP A CD1 1 
ATOM   1636 C  CD2 . TRP A 1 213 ? 22.685 25.777 46.413  1.00 32.26 ? 214  TRP A CD2 1 
ATOM   1637 N  NE1 . TRP A 1 213 ? 21.663 25.459 44.443  1.00 32.99 ? 214  TRP A NE1 1 
ATOM   1638 C  CE2 . TRP A 1 213 ? 22.863 25.616 45.029  1.00 32.19 ? 214  TRP A CE2 1 
ATOM   1639 C  CE3 . TRP A 1 213 ? 23.792 25.953 47.255  1.00 32.29 ? 214  TRP A CE3 1 
ATOM   1640 C  CZ2 . TRP A 1 213 ? 24.143 25.626 44.466  1.00 31.67 ? 214  TRP A CZ2 1 
ATOM   1641 C  CZ3 . TRP A 1 213 ? 25.070 25.969 46.683  1.00 32.38 ? 214  TRP A CZ3 1 
ATOM   1642 C  CH2 . TRP A 1 213 ? 25.246 25.804 45.308  1.00 31.23 ? 214  TRP A CH2 1 
ATOM   1643 N  N   . THR A 1 214 ? 19.194 25.046 50.736  1.00 27.96 ? 215  THR A N   1 
ATOM   1644 C  CA  . THR A 1 214 ? 19.019 25.303 52.165  1.00 26.21 ? 215  THR A CA  1 
ATOM   1645 C  C   . THR A 1 214 ? 19.706 24.242 53.027  1.00 24.81 ? 215  THR A C   1 
ATOM   1646 O  O   . THR A 1 214 ? 19.748 23.042 52.705  1.00 24.62 ? 215  THR A O   1 
ATOM   1647 C  CB  . THR A 1 214 ? 17.512 25.384 52.498  1.00 25.99 ? 215  THR A CB  1 
ATOM   1648 O  OG1 . THR A 1 214 ? 16.899 26.242 51.550  1.00 26.47 ? 215  THR A OG1 1 
ATOM   1649 C  CG2 . THR A 1 214 ? 17.263 26.072 53.812  1.00 25.83 ? 215  THR A CG2 1 
ATOM   1650 N  N   . SER A 1 215 ? 20.285 24.749 54.123  1.00 22.88 ? 216  SER A N   1 
ATOM   1651 C  CA  . SER A 1 215 ? 21.085 23.926 55.003  1.00 21.75 ? 216  SER A CA  1 
ATOM   1652 C  C   . SER A 1 215 ? 20.871 24.322 56.465  1.00 20.81 ? 216  SER A C   1 
ATOM   1653 O  O   . SER A 1 215 ? 20.058 25.215 56.729  1.00 19.93 ? 216  SER A O   1 
ATOM   1654 C  CB  . SER A 1 215 ? 22.556 24.089 54.559  1.00 23.34 ? 216  SER A CB  1 
ATOM   1655 O  OG  . SER A 1 215 ? 23.157 25.401 54.578  1.00 23.91 ? 216  SER A OG  1 
ATOM   1656 N  N   . PRO A 1 216 ? 21.531 23.692 57.462  1.00 19.70 ? 217  PRO A N   1 
ATOM   1657 C  CA  . PRO A 1 216 ? 21.444 24.094 58.867  1.00 19.05 ? 217  PRO A CA  1 
ATOM   1658 C  C   . PRO A 1 216 ? 21.727 25.554 59.242  1.00 18.65 ? 217  PRO A C   1 
ATOM   1659 O  O   . PRO A 1 216 ? 21.064 26.114 60.117  1.00 18.13 ? 217  PRO A O   1 
ATOM   1660 C  CB  . PRO A 1 216 ? 22.375 23.115 59.520  1.00 19.05 ? 217  PRO A CB  1 
ATOM   1661 C  CG  . PRO A 1 216 ? 22.177 21.883 58.709  1.00 18.76 ? 217  PRO A CG  1 
ATOM   1662 C  CD  . PRO A 1 216 ? 22.277 22.448 57.334  1.00 17.51 ? 217  PRO A CD  1 
ATOM   1663 N  N   . LYS A 1 217 ? 22.695 26.178 58.558  1.00 18.40 ? 218  LYS A N   1 
ATOM   1664 C  CA  . LYS A 1 217 ? 23.056 27.554 58.810  1.00 17.66 ? 218  LYS A CA  1 
ATOM   1665 C  C   . LYS A 1 217 ? 21.894 28.499 58.562  1.00 17.81 ? 218  LYS A C   1 
ATOM   1666 O  O   . LYS A 1 217 ? 21.636 29.337 59.421  1.00 18.78 ? 218  LYS A O   1 
ATOM   1667 C  CB  . LYS A 1 217 ? 24.235 27.884 57.936  1.00 15.63 ? 218  LYS A CB  1 
ATOM   1668 C  CG  . LYS A 1 217 ? 24.892 29.249 58.179  1.00 14.38 ? 218  LYS A CG  1 
ATOM   1669 C  CD  . LYS A 1 217 ? 25.522 29.455 59.544  1.00 12.23 ? 218  LYS A CD  1 
ATOM   1670 C  CE  . LYS A 1 217 ? 26.508 30.632 59.688  1.00 12.45 ? 218  LYS A CE  1 
ATOM   1671 N  NZ  . LYS A 1 217 ? 27.840 30.397 59.110  1.00 8.77  ? 218  LYS A NZ  1 
ATOM   1672 N  N   . ASP A 1 218 ? 21.158 28.350 57.469  1.00 17.01 ? 219  ASP A N   1 
ATOM   1673 C  CA  . ASP A 1 218 ? 20.024 29.178 57.183  1.00 16.88 ? 219  ASP A CA  1 
ATOM   1674 C  C   . ASP A 1 218 ? 18.992 29.285 58.281  1.00 17.46 ? 219  ASP A C   1 
ATOM   1675 O  O   . ASP A 1 218 ? 18.322 30.301 58.366  1.00 19.19 ? 219  ASP A O   1 
ATOM   1676 C  CB  . ASP A 1 218 ? 19.379 28.646 55.957  1.00 17.47 ? 219  ASP A CB  1 
ATOM   1677 C  CG  . ASP A 1 218 ? 20.253 28.709 54.716  1.00 18.33 ? 219  ASP A CG  1 
ATOM   1678 O  OD1 . ASP A 1 218 ? 20.868 29.737 54.470  1.00 18.01 ? 219  ASP A OD1 1 
ATOM   1679 O  OD2 . ASP A 1 218 ? 20.315 27.728 53.987  1.00 19.96 ? 219  ASP A OD2 1 
ATOM   1680 N  N   . VAL A 1 219 ? 18.805 28.253 59.102  1.00 17.08 ? 220  VAL A N   1 
ATOM   1681 C  CA  . VAL A 1 219 ? 17.845 28.252 60.196  1.00 16.11 ? 220  VAL A CA  1 
ATOM   1682 C  C   . VAL A 1 219 ? 18.322 29.189 61.264  1.00 15.55 ? 220  VAL A C   1 
ATOM   1683 O  O   . VAL A 1 219 ? 17.522 29.912 61.830  1.00 15.99 ? 220  VAL A O   1 
ATOM   1684 C  CB  . VAL A 1 219 ? 17.711 26.850 60.787  1.00 16.37 ? 220  VAL A CB  1 
ATOM   1685 C  CG1 . VAL A 1 219 ? 16.731 26.874 61.912  1.00 15.09 ? 220  VAL A CG1 1 
ATOM   1686 C  CG2 . VAL A 1 219 ? 17.284 25.878 59.707  1.00 16.21 ? 220  VAL A CG2 1 
ATOM   1687 N  N   . ILE A 1 220 ? 19.606 29.224 61.569  1.00 15.57 ? 221  ILE A N   1 
ATOM   1688 C  CA  . ILE A 1 220 ? 20.003 30.115 62.638  1.00 16.14 ? 221  ILE A CA  1 
ATOM   1689 C  C   . ILE A 1 220 ? 20.191 31.512 62.006  1.00 16.46 ? 221  ILE A C   1 
ATOM   1690 O  O   . ILE A 1 220 ? 19.929 32.484 62.707  1.00 16.40 ? 221  ILE A O   1 
ATOM   1691 C  CB  . ILE A 1 220 ? 21.304 29.499 63.410  1.00 14.62 ? 221  ILE A CB  1 
ATOM   1692 C  CG1 . ILE A 1 220 ? 21.620 30.405 64.578  1.00 12.22 ? 221  ILE A CG1 1 
ATOM   1693 C  CG2 . ILE A 1 220 ? 22.534 29.322 62.534  1.00 14.66 ? 221  ILE A CG2 1 
ATOM   1694 C  CD1 . ILE A 1 220 ? 20.669 30.329 65.783  1.00 9.94  ? 221  ILE A CD1 1 
ATOM   1695 N  N   . LEU A 1 221 ? 20.554 31.697 60.721  1.00 16.79 ? 222  LEU A N   1 
ATOM   1696 C  CA  . LEU A 1 221 ? 20.613 33.023 60.131  1.00 17.01 ? 222  LEU A CA  1 
ATOM   1697 C  C   . LEU A 1 221 ? 19.207 33.639 60.167  1.00 17.96 ? 222  LEU A C   1 
ATOM   1698 O  O   . LEU A 1 221 ? 19.073 34.800 60.518  1.00 18.85 ? 222  LEU A O   1 
ATOM   1699 C  CB  . LEU A 1 221 ? 21.141 32.938 58.683  1.00 15.25 ? 222  LEU A CB  1 
ATOM   1700 C  CG  . LEU A 1 221 ? 22.648 32.561 58.461  1.00 14.43 ? 222  LEU A CG  1 
ATOM   1701 C  CD1 . LEU A 1 221 ? 22.996 32.609 56.956  1.00 12.91 ? 222  LEU A CD1 1 
ATOM   1702 C  CD2 . LEU A 1 221 ? 23.568 33.536 59.204  1.00 11.11 ? 222  LEU A CD2 1 
ATOM   1703 N  N   . LYS A 1 222 ? 18.133 32.897 59.895  1.00 18.53 ? 223  LYS A N   1 
ATOM   1704 C  CA  . LYS A 1 222 ? 16.792 33.388 60.010  1.00 19.20 ? 223  LYS A CA  1 
ATOM   1705 C  C   . LYS A 1 222 ? 16.349 33.620 61.450  1.00 19.14 ? 223  LYS A C   1 
ATOM   1706 O  O   . LYS A 1 222 ? 15.701 34.627 61.632  1.00 20.12 ? 223  LYS A O   1 
ATOM   1707 C  CB  . LYS A 1 222 ? 15.929 32.384 59.310  1.00 21.36 ? 223  LYS A CB  1 
ATOM   1708 C  CG  . LYS A 1 222 ? 14.430 32.685 59.299  1.00 23.59 ? 223  LYS A CG  1 
ATOM   1709 C  CD  . LYS A 1 222 ? 14.011 33.495 58.062  1.00 26.41 ? 223  LYS A CD  1 
ATOM   1710 C  CE  . LYS A 1 222 ? 12.487 33.650 58.021  1.00 27.89 ? 223  LYS A CE  1 
ATOM   1711 N  NZ  . LYS A 1 222 ? 11.778 32.425 58.433  1.00 28.73 ? 223  LYS A NZ  1 
ATOM   1712 N  N   . VAL A 1 223 ? 16.595 32.776 62.464  1.00 18.09 ? 224  VAL A N   1 
ATOM   1713 C  CA  . VAL A 1 223 ? 16.238 33.001 63.863  1.00 17.31 ? 224  VAL A CA  1 
ATOM   1714 C  C   . VAL A 1 223 ? 16.957 34.247 64.377  1.00 18.33 ? 224  VAL A C   1 
ATOM   1715 O  O   . VAL A 1 223 ? 16.380 35.032 65.104  1.00 18.29 ? 224  VAL A O   1 
ATOM   1716 C  CB  . VAL A 1 223 ? 16.654 31.749 64.686  1.00 17.45 ? 224  VAL A CB  1 
ATOM   1717 C  CG1 . VAL A 1 223 ? 16.449 31.879 66.182  1.00 16.18 ? 224  VAL A CG1 1 
ATOM   1718 C  CG2 . VAL A 1 223 ? 15.799 30.636 64.228  1.00 15.97 ? 224  VAL A CG2 1 
ATOM   1719 N  N   . ALA A 1 224 ? 18.226 34.498 64.039  1.00 19.40 ? 225  ALA A N   1 
ATOM   1720 C  CA  . ALA A 1 224 ? 18.955 35.722 64.414  1.00 20.42 ? 225  ALA A CA  1 
ATOM   1721 C  C   . ALA A 1 224 ? 18.265 36.982 63.827  1.00 22.13 ? 225  ALA A C   1 
ATOM   1722 O  O   . ALA A 1 224 ? 18.047 37.977 64.537  1.00 22.73 ? 225  ALA A O   1 
ATOM   1723 C  CB  . ALA A 1 224 ? 20.370 35.682 63.864  1.00 18.76 ? 225  ALA A CB  1 
ATOM   1724 N  N   . GLY A 1 225 ? 17.932 36.981 62.516  1.00 21.92 ? 226  GLY A N   1 
ATOM   1725 C  CA  . GLY A 1 225 ? 17.211 38.073 61.901  1.00 21.54 ? 226  GLY A CA  1 
ATOM   1726 C  C   . GLY A 1 225 ? 15.899 38.334 62.633  1.00 22.34 ? 226  GLY A C   1 
ATOM   1727 O  O   . GLY A 1 225 ? 15.601 39.488 62.925  1.00 23.90 ? 226  GLY A O   1 
ATOM   1728 N  N   . ILE A 1 226 ? 15.151 37.280 62.994  1.00 21.60 ? 227  ILE A N   1 
ATOM   1729 C  CA  . ILE A 1 226 ? 13.866 37.378 63.665  1.00 20.50 ? 227  ILE A CA  1 
ATOM   1730 C  C   . ILE A 1 226 ? 13.972 37.893 65.083  1.00 20.08 ? 227  ILE A C   1 
ATOM   1731 O  O   . ILE A 1 226 ? 13.338 38.889 65.377  1.00 20.24 ? 227  ILE A O   1 
ATOM   1732 C  CB  . ILE A 1 226 ? 13.151 35.973 63.691  1.00 21.88 ? 227  ILE A CB  1 
ATOM   1733 C  CG1 . ILE A 1 226 ? 12.750 35.553 62.304  1.00 21.43 ? 227  ILE A CG1 1 
ATOM   1734 C  CG2 . ILE A 1 226 ? 11.888 36.003 64.577  1.00 22.03 ? 227  ILE A CG2 1 
ATOM   1735 C  CD1 . ILE A 1 226 ? 12.477 34.024 62.337  1.00 23.68 ? 227  ILE A CD1 1 
ATOM   1736 N  N   . LEU A 1 227 ? 14.758 37.253 65.963  1.00 19.67 ? 228  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 227 ? 14.848 37.534 67.404  1.00 18.01 ? 228  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 227 ? 15.847 38.652 67.775  1.00 16.85 ? 228  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 227 ? 15.759 39.297 68.820  1.00 15.81 ? 228  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 227 ? 15.176 36.160 68.024  1.00 18.54 ? 228  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 227 ? 14.565 35.544 69.289  1.00 19.24 ? 228  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 227 ? 13.081 35.767 69.455  1.00 18.53 ? 228  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 227 ? 14.755 34.059 69.149  1.00 18.53 ? 228  LEU A CD2 1 
ATOM   1744 N  N   . THR A 1 228 ? 16.755 38.984 66.856  1.00 16.55 ? 229  THR A N   1 
ATOM   1745 C  CA  . THR A 1 228 ? 17.812 40.017 66.930  1.00 17.24 ? 229  THR A CA  1 
ATOM   1746 C  C   . THR A 1 228 ? 18.924 39.748 67.947  1.00 17.84 ? 229  THR A C   1 
ATOM   1747 O  O   . THR A 1 228 ? 18.793 38.830 68.765  1.00 18.46 ? 229  THR A O   1 
ATOM   1748 C  CB  . THR A 1 228 ? 17.223 41.492 67.211  1.00 17.81 ? 229  THR A CB  1 
ATOM   1749 O  OG1 . THR A 1 228 ? 17.280 41.742 68.624  1.00 16.99 ? 229  THR A OG1 1 
ATOM   1750 C  CG2 . THR A 1 228 ? 15.802 41.695 66.658  1.00 16.14 ? 229  THR A CG2 1 
ATOM   1751 N  N   . VAL A 1 229 ? 20.056 40.478 67.929  1.00 17.25 ? 230  VAL A N   1 
ATOM   1752 C  CA  . VAL A 1 229 ? 21.149 40.182 68.852  1.00 17.92 ? 230  VAL A CA  1 
ATOM   1753 C  C   . VAL A 1 229 ? 20.866 40.359 70.333  1.00 18.19 ? 230  VAL A C   1 
ATOM   1754 O  O   . VAL A 1 229 ? 21.631 39.885 71.178  1.00 18.85 ? 230  VAL A O   1 
ATOM   1755 C  CB  . VAL A 1 229 ? 22.412 41.004 68.473  1.00 17.58 ? 230  VAL A CB  1 
ATOM   1756 C  CG1 . VAL A 1 229 ? 22.872 40.630 67.079  1.00 16.70 ? 230  VAL A CG1 1 
ATOM   1757 C  CG2 . VAL A 1 229 ? 22.114 42.486 68.646  1.00 18.60 ? 230  VAL A CG2 1 
ATOM   1758 N  N   . LYS A 1 230 ? 19.763 40.983 70.686  1.00 18.10 ? 231  LYS A N   1 
ATOM   1759 C  CA  . LYS A 1 230 ? 19.522 41.077 72.096  1.00 19.98 ? 231  LYS A CA  1 
ATOM   1760 C  C   . LYS A 1 230 ? 18.277 40.270 72.447  1.00 20.53 ? 231  LYS A C   1 
ATOM   1761 O  O   . LYS A 1 230 ? 17.896 40.244 73.613  1.00 21.45 ? 231  LYS A O   1 
ATOM   1762 C  CB  . LYS A 1 230 ? 19.380 42.571 72.529  1.00 20.69 ? 231  LYS A CB  1 
ATOM   1763 C  CG  . LYS A 1 230 ? 18.159 43.432 72.127  1.00 23.10 ? 231  LYS A CG  1 
ATOM   1764 C  CD  . LYS A 1 230 ? 18.058 44.719 73.008  1.00 26.30 ? 231  LYS A CD  1 
ATOM   1765 C  CE  . LYS A 1 230 ? 16.608 45.263 73.055  1.00 28.03 ? 231  LYS A CE  1 
ATOM   1766 N  NZ  . LYS A 1 230 ? 16.427 46.366 73.979  1.00 27.81 ? 231  LYS A NZ  1 
ATOM   1767 N  N   . GLY A 1 231 ? 17.705 39.494 71.500  1.00 21.02 ? 232  GLY A N   1 
ATOM   1768 C  CA  . GLY A 1 231 ? 16.462 38.785 71.715  1.00 20.51 ? 232  GLY A CA  1 
ATOM   1769 C  C   . GLY A 1 231 ? 16.580 37.624 72.672  1.00 21.26 ? 232  GLY A C   1 
ATOM   1770 O  O   . GLY A 1 231 ? 15.689 37.420 73.493  1.00 22.28 ? 232  GLY A O   1 
ATOM   1771 N  N   . GLY A 1 232 ? 17.659 36.832 72.639  1.00 21.07 ? 233  GLY A N   1 
ATOM   1772 C  CA  . GLY A 1 232 ? 17.756 35.645 73.502  1.00 19.85 ? 233  GLY A CA  1 
ATOM   1773 C  C   . GLY A 1 232 ? 18.348 35.848 74.891  1.00 18.62 ? 233  GLY A C   1 
ATOM   1774 O  O   . GLY A 1 232 ? 18.476 34.858 75.600  1.00 18.55 ? 233  GLY A O   1 
ATOM   1775 N  N   . THR A 1 233 ? 18.722 37.075 75.296  1.00 17.57 ? 234  THR A N   1 
ATOM   1776 C  CA  . THR A 1 233 ? 19.280 37.362 76.618  1.00 16.56 ? 234  THR A CA  1 
ATOM   1777 C  C   . THR A 1 233 ? 18.396 36.735 77.715  1.00 17.16 ? 234  THR A C   1 
ATOM   1778 O  O   . THR A 1 233 ? 17.156 36.855 77.668  1.00 17.03 ? 234  THR A O   1 
ATOM   1779 C  CB  . THR A 1 233 ? 19.350 38.893 76.837  1.00 15.63 ? 234  THR A CB  1 
ATOM   1780 O  OG1 . THR A 1 233 ? 19.957 39.458 75.695  1.00 15.25 ? 234  THR A OG1 1 
ATOM   1781 C  CG2 . THR A 1 233 ? 20.095 39.255 78.106  1.00 13.74 ? 234  THR A CG2 1 
ATOM   1782 N  N   . GLY A 1 234 ? 19.061 35.981 78.625  1.00 16.55 ? 235  GLY A N   1 
ATOM   1783 C  CA  . GLY A 1 234 ? 18.440 35.350 79.788  1.00 14.13 ? 235  GLY A CA  1 
ATOM   1784 C  C   . GLY A 1 234 ? 17.567 34.148 79.515  1.00 13.02 ? 235  GLY A C   1 
ATOM   1785 O  O   . GLY A 1 234 ? 16.812 33.798 80.394  1.00 13.35 ? 235  GLY A O   1 
ATOM   1786 N  N   . ALA A 1 235 ? 17.627 33.561 78.328  1.00 12.25 ? 236  ALA A N   1 
ATOM   1787 C  CA  . ALA A 1 235 ? 16.834 32.408 77.921  1.00 12.65 ? 236  ALA A CA  1 
ATOM   1788 C  C   . ALA A 1 235 ? 17.655 31.257 77.305  1.00 13.33 ? 236  ALA A C   1 
ATOM   1789 O  O   . ALA A 1 235 ? 18.659 31.499 76.612  1.00 14.57 ? 236  ALA A O   1 
ATOM   1790 C  CB  . ALA A 1 235 ? 15.815 32.806 76.852  1.00 10.68 ? 236  ALA A CB  1 
ATOM   1791 N  N   . ILE A 1 236 ? 17.266 29.980 77.487  1.00 13.01 ? 237  ILE A N   1 
ATOM   1792 C  CA  . ILE A 1 236 ? 17.835 28.897 76.680  1.00 10.73 ? 237  ILE A CA  1 
ATOM   1793 C  C   . ILE A 1 236 ? 16.897 28.673 75.481  1.00 11.60 ? 237  ILE A C   1 
ATOM   1794 O  O   . ILE A 1 236 ? 15.681 28.662 75.657  1.00 11.46 ? 237  ILE A O   1 
ATOM   1795 C  CB  . ILE A 1 236 ? 17.965 27.634 77.551  1.00 8.58  ? 237  ILE A CB  1 
ATOM   1796 C  CG1 . ILE A 1 236 ? 18.945 27.891 78.676  1.00 6.69  ? 237  ILE A CG1 1 
ATOM   1797 C  CG2 . ILE A 1 236 ? 18.403 26.433 76.662  1.00 8.24  ? 237  ILE A CG2 1 
ATOM   1798 C  CD1 . ILE A 1 236 ? 19.323 26.707 79.587  1.00 6.25  ? 237  ILE A CD1 1 
ATOM   1799 N  N   . VAL A 1 237 ? 17.412 28.520 74.246  1.00 11.61 ? 238  VAL A N   1 
ATOM   1800 C  CA  . VAL A 1 237 ? 16.599 28.212 73.081  1.00 11.90 ? 238  VAL A CA  1 
ATOM   1801 C  C   . VAL A 1 237 ? 16.437 26.680 73.026  1.00 13.82 ? 238  VAL A C   1 
ATOM   1802 O  O   . VAL A 1 237 ? 17.440 25.974 72.931  1.00 15.04 ? 238  VAL A O   1 
ATOM   1803 C  CB  . VAL A 1 237 ? 17.270 28.686 71.797  1.00 9.92  ? 238  VAL A CB  1 
ATOM   1804 C  CG1 . VAL A 1 237 ? 16.409 28.383 70.617  1.00 9.45  ? 238  VAL A CG1 1 
ATOM   1805 C  CG2 . VAL A 1 237 ? 17.429 30.158 71.829  1.00 9.70  ? 238  VAL A CG2 1 
ATOM   1806 N  N   . GLU A 1 238 ? 15.230 26.102 73.123  1.00 14.67 ? 239  GLU A N   1 
ATOM   1807 C  CA  . GLU A 1 238 ? 15.024 24.670 73.085  1.00 15.33 ? 239  GLU A CA  1 
ATOM   1808 C  C   . GLU A 1 238 ? 14.374 24.288 71.751  1.00 16.26 ? 239  GLU A C   1 
ATOM   1809 O  O   . GLU A 1 238 ? 13.235 24.620 71.426  1.00 17.25 ? 239  GLU A O   1 
ATOM   1810 C  CB  . GLU A 1 238 ? 14.156 24.272 74.290  1.00 15.21 ? 239  GLU A CB  1 
ATOM   1811 C  CG  . GLU A 1 238 ? 14.039 22.768 74.398  1.00 16.65 ? 239  GLU A CG  1 
ATOM   1812 C  CD  . GLU A 1 238 ? 13.405 22.306 75.695  1.00 19.98 ? 239  GLU A CD  1 
ATOM   1813 O  OE1 . GLU A 1 238 ? 13.944 22.630 76.746  1.00 21.23 ? 239  GLU A OE1 1 
ATOM   1814 O  OE2 . GLU A 1 238 ? 12.369 21.628 75.663  1.00 22.64 ? 239  GLU A OE2 1 
ATOM   1815 N  N   . TYR A 1 239 ? 15.097 23.570 70.902  1.00 16.58 ? 240  TYR A N   1 
ATOM   1816 C  CA  . TYR A 1 239 ? 14.544 23.150 69.628  1.00 16.82 ? 240  TYR A CA  1 
ATOM   1817 C  C   . TYR A 1 239 ? 13.745 21.850 69.773  1.00 17.92 ? 240  TYR A C   1 
ATOM   1818 O  O   . TYR A 1 239 ? 14.015 21.017 70.642  1.00 18.83 ? 240  TYR A O   1 
ATOM   1819 C  CB  . TYR A 1 239 ? 15.666 22.974 68.669  1.00 15.78 ? 240  TYR A CB  1 
ATOM   1820 C  CG  . TYR A 1 239 ? 16.361 24.270 68.247  1.00 16.09 ? 240  TYR A CG  1 
ATOM   1821 C  CD1 . TYR A 1 239 ? 17.357 24.854 69.043  1.00 15.79 ? 240  TYR A CD1 1 
ATOM   1822 C  CD2 . TYR A 1 239 ? 15.949 24.902 67.059  1.00 15.85 ? 240  TYR A CD2 1 
ATOM   1823 C  CE1 . TYR A 1 239 ? 17.931 26.079 68.651  1.00 16.67 ? 240  TYR A CE1 1 
ATOM   1824 C  CE2 . TYR A 1 239 ? 16.522 26.110 66.672  1.00 17.90 ? 240  TYR A CE2 1 
ATOM   1825 C  CZ  . TYR A 1 239 ? 17.503 26.706 67.482  1.00 17.95 ? 240  TYR A CZ  1 
ATOM   1826 O  OH  . TYR A 1 239 ? 17.983 27.968 67.145  1.00 19.01 ? 240  TYR A OH  1 
ATOM   1827 N  N   . HIS A 1 240 ? 12.702 21.708 68.953  1.00 18.89 ? 241  HIS A N   1 
ATOM   1828 C  CA  . HIS A 1 240 ? 11.801 20.562 68.970  1.00 20.00 ? 241  HIS A CA  1 
ATOM   1829 C  C   . HIS A 1 240 ? 10.946 20.646 67.708  1.00 21.27 ? 241  HIS A C   1 
ATOM   1830 O  O   . HIS A 1 240 ? 11.041 21.634 66.978  1.00 20.66 ? 241  HIS A O   1 
ATOM   1831 C  CB  . HIS A 1 240 ? 10.896 20.599 70.211  1.00 19.13 ? 241  HIS A CB  1 
ATOM   1832 C  CG  . HIS A 1 240 ? 9.999  21.838 70.271  1.00 20.21 ? 241  HIS A CG  1 
ATOM   1833 N  ND1 . HIS A 1 240 ? 10.320 23.044 70.729  1.00 19.99 ? 241  HIS A ND1 1 
ATOM   1834 C  CD2 . HIS A 1 240 ? 8.703  21.880 69.789  1.00 19.38 ? 241  HIS A CD2 1 
ATOM   1835 C  CE1 . HIS A 1 240 ? 9.279  23.815 70.522  1.00 20.93 ? 241  HIS A CE1 1 
ATOM   1836 N  NE2 . HIS A 1 240 ? 8.323  23.108 69.968  1.00 20.77 ? 241  HIS A NE2 1 
ATOM   1837 N  N   . GLY A 1 241 ? 10.094 19.627 67.453  1.00 22.51 ? 242  GLY A N   1 
ATOM   1838 C  CA  . GLY A 1 241 ? 9.191  19.642 66.312  1.00 23.78 ? 242  GLY A CA  1 
ATOM   1839 C  C   . GLY A 1 241 ? 9.508  18.476 65.379  1.00 25.43 ? 242  GLY A C   1 
ATOM   1840 O  O   . GLY A 1 241 ? 10.605 17.907 65.472  1.00 26.30 ? 242  GLY A O   1 
ATOM   1841 N  N   . PRO A 1 242 ? 8.635  18.064 64.445  1.00 26.01 ? 243  PRO A N   1 
ATOM   1842 C  CA  . PRO A 1 242 ? 8.933  17.036 63.460  1.00 25.47 ? 243  PRO A CA  1 
ATOM   1843 C  C   . PRO A 1 242 ? 10.106 17.327 62.567  1.00 25.83 ? 243  PRO A C   1 
ATOM   1844 O  O   . PRO A 1 242 ? 10.791 16.378 62.243  1.00 28.05 ? 243  PRO A O   1 
ATOM   1845 C  CB  . PRO A 1 242 ? 7.632  16.885 62.721  1.00 25.31 ? 243  PRO A CB  1 
ATOM   1846 C  CG  . PRO A 1 242 ? 6.965  18.236 62.855  1.00 24.70 ? 243  PRO A CG  1 
ATOM   1847 C  CD  . PRO A 1 242 ? 7.262  18.562 64.300  1.00 25.79 ? 243  PRO A CD  1 
ATOM   1848 N  N   . GLY A 1 243 ? 10.424 18.553 62.156  1.00 26.32 ? 244  GLY A N   1 
ATOM   1849 C  CA  . GLY A 1 243 ? 11.537 18.847 61.256  1.00 25.78 ? 244  GLY A CA  1 
ATOM   1850 C  C   . GLY A 1 243 ? 12.922 18.602 61.857  1.00 26.14 ? 244  GLY A C   1 
ATOM   1851 O  O   . GLY A 1 243 ? 13.893 18.560 61.090  1.00 25.34 ? 244  GLY A O   1 
ATOM   1852 N  N   . VAL A 1 244 ? 13.049 18.439 63.201  1.00 26.69 ? 245  VAL A N   1 
ATOM   1853 C  CA  . VAL A 1 244 ? 14.336 18.123 63.856  1.00 27.60 ? 245  VAL A CA  1 
ATOM   1854 C  C   . VAL A 1 244 ? 15.052 16.876 63.264  1.00 28.69 ? 245  VAL A C   1 
ATOM   1855 O  O   . VAL A 1 244 ? 16.244 16.869 62.928  1.00 29.44 ? 245  VAL A O   1 
ATOM   1856 C  CB  . VAL A 1 244 ? 14.100 17.906 65.378  1.00 26.67 ? 245  VAL A CB  1 
ATOM   1857 C  CG1 . VAL A 1 244 ? 15.379 17.435 66.045  1.00 28.36 ? 245  VAL A CG1 1 
ATOM   1858 C  CG2 . VAL A 1 244 ? 13.679 19.182 66.030  1.00 26.16 ? 245  VAL A CG2 1 
ATOM   1859 N  N   . ASP A 1 245 ? 14.323 15.781 63.120  1.00 29.33 ? 246  ASP A N   1 
ATOM   1860 C  CA  . ASP A 1 245 ? 14.859 14.581 62.556  1.00 29.55 ? 246  ASP A CA  1 
ATOM   1861 C  C   . ASP A 1 245 ? 15.334 14.751 61.132  1.00 27.37 ? 246  ASP A C   1 
ATOM   1862 O  O   . ASP A 1 245 ? 16.007 13.837 60.682  1.00 28.07 ? 246  ASP A O   1 
ATOM   1863 C  CB  . ASP A 1 245 ? 13.770 13.503 62.707  1.00 34.00 ? 246  ASP A CB  1 
ATOM   1864 C  CG  . ASP A 1 245 ? 13.715 12.952 64.161  1.00 38.58 ? 246  ASP A CG  1 
ATOM   1865 O  OD1 . ASP A 1 245 ? 14.472 12.016 64.465  1.00 41.71 ? 246  ASP A OD1 1 
ATOM   1866 O  OD2 . ASP A 1 245 ? 12.932 13.450 64.994  1.00 40.20 ? 246  ASP A OD2 1 
ATOM   1867 N  N   . SER A 1 246 ? 15.110 15.815 60.364  1.00 24.78 ? 247  SER A N   1 
ATOM   1868 C  CA  . SER A 1 246 ? 15.753 15.872 59.057  1.00 23.11 ? 247  SER A CA  1 
ATOM   1869 C  C   . SER A 1 246 ? 17.142 16.545 59.098  1.00 22.67 ? 247  SER A C   1 
ATOM   1870 O  O   . SER A 1 246 ? 17.744 16.708 58.045  1.00 22.95 ? 247  SER A O   1 
ATOM   1871 C  CB  . SER A 1 246 ? 14.903 16.632 58.069  1.00 22.98 ? 247  SER A CB  1 
ATOM   1872 O  OG  . SER A 1 246 ? 14.982 18.049 58.223  1.00 21.98 ? 247  SER A OG  1 
ATOM   1873 N  N   . ILE A 1 247 ? 17.683 16.989 60.253  1.00 21.38 ? 248  ILE A N   1 
ATOM   1874 C  CA  . ILE A 1 247 ? 18.947 17.720 60.380  1.00 19.89 ? 248  ILE A CA  1 
ATOM   1875 C  C   . ILE A 1 247 ? 20.077 16.820 60.901  1.00 20.12 ? 248  ILE A C   1 
ATOM   1876 O  O   . ILE A 1 247 ? 19.885 16.120 61.905  1.00 21.96 ? 248  ILE A O   1 
ATOM   1877 C  CB  . ILE A 1 247 ? 18.694 18.910 61.362  1.00 19.24 ? 248  ILE A CB  1 
ATOM   1878 C  CG1 . ILE A 1 247 ? 17.623 19.800 60.788  1.00 16.92 ? 248  ILE A CG1 1 
ATOM   1879 C  CG2 . ILE A 1 247 ? 19.966 19.667 61.643  1.00 16.95 ? 248  ILE A CG2 1 
ATOM   1880 C  CD1 . ILE A 1 247 ? 17.026 20.599 61.894  1.00 17.35 ? 248  ILE A CD1 1 
ATOM   1881 N  N   . SER A 1 248 ? 21.303 16.847 60.346  1.00 19.49 ? 249  SER A N   1 
ATOM   1882 C  CA  . SER A 1 248 ? 22.416 16.001 60.830  1.00 19.10 ? 249  SER A CA  1 
ATOM   1883 C  C   . SER A 1 248 ? 22.897 16.391 62.221  1.00 17.48 ? 249  SER A C   1 
ATOM   1884 O  O   . SER A 1 248 ? 22.543 17.443 62.719  1.00 16.18 ? 249  SER A O   1 
ATOM   1885 C  CB  . SER A 1 248 ? 23.590 16.082 59.850  1.00 19.60 ? 249  SER A CB  1 
ATOM   1886 O  OG  . SER A 1 248 ? 24.199 17.350 60.020  1.00 22.38 ? 249  SER A OG  1 
ATOM   1887 N  N   . CYS A 1 249 ? 23.666 15.575 62.908  1.00 17.51 ? 250  CYS A N   1 
ATOM   1888 C  CA  . CYS A 1 249 ? 24.143 15.950 64.222  1.00 17.91 ? 250  CYS A CA  1 
ATOM   1889 C  C   . CYS A 1 249 ? 25.096 17.160 64.227  1.00 18.26 ? 250  CYS A C   1 
ATOM   1890 O  O   . CYS A 1 249 ? 25.049 17.979 65.157  1.00 18.66 ? 250  CYS A O   1 
ATOM   1891 C  CB  . CYS A 1 249 ? 24.808 14.746 64.822  1.00 16.89 ? 250  CYS A CB  1 
ATOM   1892 S  SG  . CYS A 1 249 ? 25.559 15.073 66.435  1.00 18.91 ? 250  CYS A SG  1 
ATOM   1893 N  N   . THR A 1 250 ? 25.918 17.334 63.179  1.00 17.65 ? 251  THR A N   1 
ATOM   1894 C  CA  . THR A 1 250 ? 26.813 18.461 63.111  1.00 16.57 ? 251  THR A CA  1 
ATOM   1895 C  C   . THR A 1 250 ? 26.003 19.657 62.628  1.00 16.17 ? 251  THR A C   1 
ATOM   1896 O  O   . THR A 1 250 ? 26.400 20.779 62.890  1.00 17.17 ? 251  THR A O   1 
ATOM   1897 C  CB  . THR A 1 250 ? 27.946 18.070 62.179  1.00 16.73 ? 251  THR A CB  1 
ATOM   1898 O  OG1 . THR A 1 250 ? 27.420 17.574 60.945  1.00 17.97 ? 251  THR A OG1 1 
ATOM   1899 C  CG2 . THR A 1 250 ? 28.787 16.998 62.866  1.00 15.20 ? 251  THR A CG2 1 
ATOM   1900 N  N   . GLY A 1 251 ? 24.869 19.491 61.931  1.00 15.31 ? 252  GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 251 ? 23.992 20.595 61.580  1.00 13.59 ? 252  GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 251 ? 23.349 21.238 62.776  1.00 13.85 ? 252  GLY A C   1 
ATOM   1903 O  O   . GLY A 1 251 ? 23.176 22.441 62.785  1.00 14.94 ? 252  GLY A O   1 
ATOM   1904 N  N   . MET A 1 252 ? 22.992 20.448 63.783  1.00 13.93 ? 253  MET A N   1 
ATOM   1905 C  CA  . MET A 1 252 ? 22.350 20.878 65.014  1.00 14.15 ? 253  MET A CA  1 
ATOM   1906 C  C   . MET A 1 252 ? 23.366 21.631 65.851  1.00 14.92 ? 253  MET A C   1 
ATOM   1907 O  O   . MET A 1 252 ? 23.066 22.621 66.555  1.00 15.81 ? 253  MET A O   1 
ATOM   1908 C  CB  . MET A 1 252 ? 21.818 19.664 65.838  1.00 13.82 ? 253  MET A CB  1 
ATOM   1909 C  CG  . MET A 1 252 ? 20.717 18.841 65.080  1.00 14.77 ? 253  MET A CG  1 
ATOM   1910 S  SD  . MET A 1 252 ? 19.876 17.447 65.905  1.00 15.42 ? 253  MET A SD  1 
ATOM   1911 C  CE  . MET A 1 252 ? 21.081 16.185 65.930  1.00 11.45 ? 253  MET A CE  1 
ATOM   1912 N  N   . ALA A 1 253 ? 24.634 21.163 65.767  1.00 14.38 ? 254  ALA A N   1 
ATOM   1913 C  CA  . ALA A 1 253 ? 25.747 21.861 66.436  1.00 12.33 ? 254  ALA A CA  1 
ATOM   1914 C  C   . ALA A 1 253 ? 25.822 23.269 65.849  1.00 11.48 ? 254  ALA A C   1 
ATOM   1915 O  O   . ALA A 1 253 ? 25.835 24.157 66.679  1.00 11.47 ? 254  ALA A O   1 
ATOM   1916 C  CB  . ALA A 1 253 ? 27.058 21.099 66.182  1.00 9.76  ? 254  ALA A CB  1 
ATOM   1917 N  N   . THR A 1 254 ? 25.758 23.462 64.497  1.00 10.69 ? 255  THR A N   1 
ATOM   1918 C  CA  . THR A 1 254 ? 25.787 24.731 63.767  1.00 10.75 ? 255  THR A CA  1 
ATOM   1919 C  C   . THR A 1 254 ? 24.771 25.708 64.306  1.00 11.13 ? 255  THR A C   1 
ATOM   1920 O  O   . THR A 1 254 ? 25.125 26.806 64.729  1.00 13.38 ? 255  THR A O   1 
ATOM   1921 C  CB  . THR A 1 254 ? 25.537 24.466 62.243  1.00 11.06 ? 255  THR A CB  1 
ATOM   1922 O  OG1 . THR A 1 254 ? 26.765 23.883 61.797  1.00 9.56  ? 255  THR A OG1 1 
ATOM   1923 C  CG2 . THR A 1 254 ? 25.201 25.680 61.388  1.00 9.24  ? 255  THR A CG2 1 
ATOM   1924 N  N   . ILE A 1 255 ? 23.501 25.309 64.328  1.00 11.15 ? 256  ILE A N   1 
ATOM   1925 C  CA  . ILE A 1 255 ? 22.405 26.074 64.928  1.00 9.89  ? 256  ILE A CA  1 
ATOM   1926 C  C   . ILE A 1 255 ? 22.592 26.305 66.433  1.00 11.89 ? 256  ILE A C   1 
ATOM   1927 O  O   . ILE A 1 255 ? 22.198 27.383 66.836  1.00 13.92 ? 256  ILE A O   1 
ATOM   1928 C  CB  . ILE A 1 255 ? 21.098 25.290 64.643  1.00 8.23  ? 256  ILE A CB  1 
ATOM   1929 C  CG1 . ILE A 1 255 ? 20.870 25.150 63.129  1.00 6.51  ? 256  ILE A CG1 1 
ATOM   1930 C  CG2 . ILE A 1 255 ? 19.926 25.990 65.240  1.00 5.89  ? 256  ILE A CG2 1 
ATOM   1931 C  CD1 . ILE A 1 255 ? 19.723 24.164 62.893  1.00 3.61  ? 256  ILE A CD1 1 
ATOM   1932 N  N   . CYS A 1 256 ? 23.091 25.433 67.336  1.00 11.65 ? 257  CYS A N   1 
ATOM   1933 C  CA  . CYS A 1 256 ? 23.176 25.791 68.740  1.00 11.18 ? 257  CYS A CA  1 
ATOM   1934 C  C   . CYS A 1 256 ? 24.319 26.745 68.934  1.00 12.20 ? 257  CYS A C   1 
ATOM   1935 O  O   . CYS A 1 256 ? 24.182 27.691 69.712  1.00 11.24 ? 257  CYS A O   1 
ATOM   1936 C  CB  . CYS A 1 256 ? 23.374 24.557 69.626  1.00 10.53 ? 257  CYS A CB  1 
ATOM   1937 S  SG  . CYS A 1 256 ? 21.964 23.395 69.507  1.00 9.56  ? 257  CYS A SG  1 
ATOM   1938 N  N   . ASN A 1 257 ? 25.379 26.582 68.126  1.00 12.12 ? 258  ASN A N   1 
ATOM   1939 C  CA  . ASN A 1 257 ? 26.572 27.433 68.157  1.00 13.18 ? 258  ASN A CA  1 
ATOM   1940 C  C   . ASN A 1 257 ? 26.318 28.965 68.042  1.00 14.15 ? 258  ASN A C   1 
ATOM   1941 O  O   . ASN A 1 257 ? 26.707 29.798 68.879  1.00 12.01 ? 258  ASN A O   1 
ATOM   1942 C  CB  . ASN A 1 257 ? 27.463 26.905 67.017  1.00 12.74 ? 258  ASN A CB  1 
ATOM   1943 C  CG  . ASN A 1 257 ? 28.768 27.650 66.799  1.00 13.78 ? 258  ASN A CG  1 
ATOM   1944 O  OD1 . ASN A 1 257 ? 28.744 28.842 66.488  1.00 13.49 ? 258  ASN A OD1 1 
ATOM   1945 N  ND2 . ASN A 1 257 ? 29.948 27.024 66.924  1.00 13.25 ? 258  ASN A ND2 1 
ATOM   1946 N  N   . MET A 1 258 ? 25.647 29.282 66.930  1.00 14.60 ? 259  MET A N   1 
ATOM   1947 C  CA  . MET A 1 258 ? 25.367 30.637 66.581  1.00 16.36 ? 259  MET A CA  1 
ATOM   1948 C  C   . MET A 1 258 ? 24.182 31.211 67.346  1.00 16.93 ? 259  MET A C   1 
ATOM   1949 O  O   . MET A 1 258 ? 23.792 32.375 67.163  1.00 18.62 ? 259  MET A O   1 
ATOM   1950 C  CB  . MET A 1 258 ? 25.146 30.697 65.076  1.00 16.90 ? 259  MET A CB  1 
ATOM   1951 C  CG  . MET A 1 258 ? 25.550 32.067 64.614  1.00 18.27 ? 259  MET A CG  1 
ATOM   1952 S  SD  . MET A 1 258 ? 25.508 32.431 62.827  1.00 22.94 ? 259  MET A SD  1 
ATOM   1953 C  CE  . MET A 1 258 ? 25.062 34.143 63.000  1.00 21.15 ? 259  MET A CE  1 
ATOM   1954 N  N   . GLY A 1 259 ? 23.596 30.454 68.270  1.00 16.27 ? 260  GLY A N   1 
ATOM   1955 C  CA  . GLY A 1 259 ? 22.585 31.021 69.168  1.00 14.67 ? 260  GLY A CA  1 
ATOM   1956 C  C   . GLY A 1 259 ? 23.219 32.030 70.104  1.00 14.82 ? 260  GLY A C   1 
ATOM   1957 O  O   . GLY A 1 259 ? 22.537 32.850 70.723  1.00 13.78 ? 260  GLY A O   1 
ATOM   1958 N  N   . ALA A 1 260 ? 24.560 31.960 70.214  1.00 15.23 ? 261  ALA A N   1 
ATOM   1959 C  CA  . ALA A 1 260 ? 25.320 32.952 70.959  1.00 15.60 ? 261  ALA A CA  1 
ATOM   1960 C  C   . ALA A 1 260 ? 25.142 34.379 70.470  1.00 15.44 ? 261  ALA A C   1 
ATOM   1961 O  O   . ALA A 1 260 ? 25.222 35.286 71.294  1.00 16.22 ? 261  ALA A O   1 
ATOM   1962 C  CB  . ALA A 1 260 ? 26.775 32.624 70.874  1.00 15.20 ? 261  ALA A CB  1 
ATOM   1963 N  N   . GLU A 1 261 ? 24.929 34.563 69.153  1.00 15.26 ? 262  GLU A N   1 
ATOM   1964 C  CA  . GLU A 1 261 ? 24.785 35.866 68.499  1.00 14.85 ? 262  GLU A CA  1 
ATOM   1965 C  C   . GLU A 1 261 ? 23.429 36.515 68.732  1.00 14.76 ? 262  GLU A C   1 
ATOM   1966 O  O   . GLU A 1 261 ? 23.102 37.522 68.106  1.00 14.67 ? 262  GLU A O   1 
ATOM   1967 C  CB  . GLU A 1 261 ? 25.021 35.736 66.956  1.00 15.77 ? 262  GLU A CB  1 
ATOM   1968 C  CG  . GLU A 1 261 ? 26.430 35.643 66.302  1.00 15.92 ? 262  GLU A CG  1 
ATOM   1969 C  CD  . GLU A 1 261 ? 27.388 34.888 67.198  1.00 17.74 ? 262  GLU A CD  1 
ATOM   1970 O  OE1 . GLU A 1 261 ? 27.994 35.521 68.082  1.00 18.06 ? 262  GLU A OE1 1 
ATOM   1971 O  OE2 . GLU A 1 261 ? 27.488 33.666 67.040  1.00 18.95 ? 262  GLU A OE2 1 
ATOM   1972 N  N   . ILE A 1 262 ? 22.575 35.900 69.553  1.00 15.11 ? 263  ILE A N   1 
ATOM   1973 C  CA  . ILE A 1 262 ? 21.342 36.542 69.986  1.00 15.40 ? 263  ILE A CA  1 
ATOM   1974 C  C   . ILE A 1 262 ? 21.366 36.629 71.522  1.00 14.42 ? 263  ILE A C   1 
ATOM   1975 O  O   . ILE A 1 262 ? 20.478 37.158 72.148  1.00 14.71 ? 263  ILE A O   1 
ATOM   1976 C  CB  . ILE A 1 262 ? 20.057 35.784 69.489  1.00 15.98 ? 263  ILE A CB  1 
ATOM   1977 C  CG1 . ILE A 1 262 ? 19.825 34.477 70.190  1.00 16.73 ? 263  ILE A CG1 1 
ATOM   1978 C  CG2 . ILE A 1 262 ? 20.201 35.487 68.008  1.00 16.45 ? 263  ILE A CG2 1 
ATOM   1979 C  CD1 . ILE A 1 262 ? 18.378 34.049 69.891  1.00 18.03 ? 263  ILE A CD1 1 
ATOM   1980 N  N   . GLY A 1 263 ? 22.463 36.236 72.159  1.00 14.15 ? 264  GLY A N   1 
ATOM   1981 C  CA  . GLY A 1 263 ? 22.684 36.362 73.565  1.00 13.37 ? 264  GLY A CA  1 
ATOM   1982 C  C   . GLY A 1 263 ? 22.031 35.229 74.321  1.00 13.85 ? 264  GLY A C   1 
ATOM   1983 O  O   . GLY A 1 263 ? 21.918 35.407 75.539  1.00 16.56 ? 264  GLY A O   1 
ATOM   1984 N  N   . ALA A 1 264 ? 21.650 34.091 73.724  1.00 11.58 ? 265  ALA A N   1 
ATOM   1985 C  CA  . ALA A 1 264 ? 20.964 33.059 74.466  1.00 10.53 ? 265  ALA A CA  1 
ATOM   1986 C  C   . ALA A 1 264 ? 21.822 32.491 75.606  1.00 10.99 ? 265  ALA A C   1 
ATOM   1987 O  O   . ALA A 1 264 ? 23.011 32.442 75.351  1.00 11.03 ? 265  ALA A O   1 
ATOM   1988 C  CB  . ALA A 1 264 ? 20.610 31.985 73.445  1.00 10.08 ? 265  ALA A CB  1 
ATOM   1989 N  N   . THR A 1 265 ? 21.466 32.082 76.853  1.00 10.41 ? 266  THR A N   1 
ATOM   1990 C  CA  . THR A 1 265 ? 22.400 31.362 77.727  1.00 10.46 ? 266  THR A CA  1 
ATOM   1991 C  C   . THR A 1 265 ? 23.033 30.056 77.147  1.00 12.03 ? 266  THR A C   1 
ATOM   1992 O  O   . THR A 1 265 ? 24.161 29.712 77.508  1.00 12.82 ? 266  THR A O   1 
ATOM   1993 C  CB  . THR A 1 265 ? 21.634 31.099 79.064  1.00 9.96  ? 266  THR A CB  1 
ATOM   1994 O  OG1 . THR A 1 265 ? 21.295 32.399 79.522  1.00 9.07  ? 266  THR A OG1 1 
ATOM   1995 C  CG2 . THR A 1 265 ? 22.411 30.444 80.178  1.00 6.89  ? 266  THR A CG2 1 
ATOM   1996 N  N   . THR A 1 266 ? 22.326 29.330 76.253  1.00 12.57 ? 267  THR A N   1 
ATOM   1997 C  CA  . THR A 1 266 ? 22.735 28.194 75.429  1.00 13.09 ? 267  THR A CA  1 
ATOM   1998 C  C   . THR A 1 266 ? 21.514 27.767 74.554  1.00 13.74 ? 267  THR A C   1 
ATOM   1999 O  O   . THR A 1 266 ? 20.492 28.482 74.445  1.00 13.06 ? 267  THR A O   1 
ATOM   2000 C  CB  . THR A 1 266 ? 23.333 26.995 76.365  1.00 13.80 ? 267  THR A CB  1 
ATOM   2001 O  OG1 . THR A 1 266 ? 23.779 26.012 75.441  1.00 15.34 ? 267  THR A OG1 1 
ATOM   2002 C  CG2 . THR A 1 266 ? 22.444 26.330 77.350  1.00 12.67 ? 267  THR A CG2 1 
ATOM   2003 N  N   . SER A 1 267 ? 21.636 26.622 73.850  1.00 12.91 ? 268  SER A N   1 
ATOM   2004 C  CA  . SER A 1 267 ? 20.627 26.034 72.962  1.00 12.71 ? 268  SER A CA  1 
ATOM   2005 C  C   . SER A 1 267 ? 20.810 24.492 72.971  1.00 12.32 ? 268  SER A C   1 
ATOM   2006 O  O   . SER A 1 267 ? 21.939 24.009 73.143  1.00 13.38 ? 268  SER A O   1 
ATOM   2007 C  CB  . SER A 1 267 ? 20.810 26.563 71.538  1.00 12.56 ? 268  SER A CB  1 
ATOM   2008 O  OG  . SER A 1 267 ? 20.844 27.997 71.461  1.00 13.35 ? 268  SER A OG  1 
ATOM   2009 N  N   . VAL A 1 268 ? 19.763 23.674 72.776  1.00 11.14 ? 269  VAL A N   1 
ATOM   2010 C  CA  . VAL A 1 268 ? 19.825 22.229 72.922  1.00 10.45 ? 269  VAL A CA  1 
ATOM   2011 C  C   . VAL A 1 268 ? 18.696 21.639 72.073  1.00 11.47 ? 269  VAL A C   1 
ATOM   2012 O  O   . VAL A 1 268 ? 17.626 22.208 71.823  1.00 8.95  ? 269  VAL A O   1 
ATOM   2013 C  CB  . VAL A 1 268 ? 19.668 21.850 74.454  1.00 9.95  ? 269  VAL A CB  1 
ATOM   2014 C  CG1 . VAL A 1 268 ? 18.242 22.037 74.942  1.00 9.10  ? 269  VAL A CG1 1 
ATOM   2015 C  CG2 . VAL A 1 268 ? 20.007 20.402 74.662  1.00 7.62  ? 269  VAL A CG2 1 
ATOM   2016 N  N   . PHE A 1 269 ? 19.076 20.465 71.563  1.00 13.02 ? 270  PHE A N   1 
ATOM   2017 C  CA  . PHE A 1 269 ? 18.219 19.630 70.743  1.00 13.65 ? 270  PHE A CA  1 
ATOM   2018 C  C   . PHE A 1 269 ? 17.885 18.410 71.581  1.00 14.05 ? 270  PHE A C   1 
ATOM   2019 O  O   . PHE A 1 269 ? 18.712 18.061 72.432  1.00 14.87 ? 270  PHE A O   1 
ATOM   2020 C  CB  . PHE A 1 269 ? 18.966 19.242 69.525  1.00 12.78 ? 270  PHE A CB  1 
ATOM   2021 C  CG  . PHE A 1 269 ? 18.710 20.205 68.367  1.00 14.45 ? 270  PHE A CG  1 
ATOM   2022 C  CD1 . PHE A 1 269 ? 19.531 21.322 68.172  1.00 12.73 ? 270  PHE A CD1 1 
ATOM   2023 C  CD2 . PHE A 1 269 ? 17.651 19.942 67.465  1.00 13.80 ? 270  PHE A CD2 1 
ATOM   2024 C  CE1 . PHE A 1 269 ? 19.286 22.153 67.071  1.00 12.96 ? 270  PHE A CE1 1 
ATOM   2025 C  CE2 . PHE A 1 269 ? 17.426 20.797 66.375  1.00 13.80 ? 270  PHE A CE2 1 
ATOM   2026 C  CZ  . PHE A 1 269 ? 18.250 21.903 66.177  1.00 11.86 ? 270  PHE A CZ  1 
ATOM   2027 N  N   . PRO A 1 270 ? 16.762 17.701 71.455  1.00 13.93 ? 271  PRO A N   1 
ATOM   2028 C  CA  . PRO A 1 270 ? 16.520 16.448 72.196  1.00 14.65 ? 271  PRO A CA  1 
ATOM   2029 C  C   . PRO A 1 270 ? 17.202 15.235 71.555  1.00 15.63 ? 271  PRO A C   1 
ATOM   2030 O  O   . PRO A 1 270 ? 17.378 15.161 70.327  1.00 15.91 ? 271  PRO A O   1 
ATOM   2031 C  CB  . PRO A 1 270 ? 15.030 16.287 72.243  1.00 13.01 ? 271  PRO A CB  1 
ATOM   2032 C  CG  . PRO A 1 270 ? 14.614 16.972 70.955  1.00 14.35 ? 271  PRO A CG  1 
ATOM   2033 C  CD  . PRO A 1 270 ? 15.614 18.084 70.645  1.00 13.84 ? 271  PRO A CD  1 
ATOM   2034 N  N   . TYR A 1 271 ? 17.570 14.260 72.404  1.00 16.59 ? 272  TYR A N   1 
ATOM   2035 C  CA  . TYR A 1 271 ? 18.223 13.053 71.946  1.00 16.38 ? 272  TYR A CA  1 
ATOM   2036 C  C   . TYR A 1 271 ? 17.350 12.293 70.965  1.00 16.43 ? 272  TYR A C   1 
ATOM   2037 O  O   . TYR A 1 271 ? 16.185 12.006 71.214  1.00 16.29 ? 272  TYR A O   1 
ATOM   2038 C  CB  . TYR A 1 271 ? 18.543 12.231 73.154  1.00 17.06 ? 272  TYR A CB  1 
ATOM   2039 C  CG  . TYR A 1 271 ? 19.222 10.914 72.807  1.00 18.35 ? 272  TYR A CG  1 
ATOM   2040 C  CD1 . TYR A 1 271 ? 20.375 10.917 72.011  1.00 18.77 ? 272  TYR A CD1 1 
ATOM   2041 C  CD2 . TYR A 1 271 ? 18.741 9.724  73.345  1.00 17.31 ? 272  TYR A CD2 1 
ATOM   2042 C  CE1 . TYR A 1 271 ? 21.039 9.732  71.757  1.00 18.19 ? 272  TYR A CE1 1 
ATOM   2043 C  CE2 . TYR A 1 271 ? 19.415 8.543  73.077  1.00 17.07 ? 272  TYR A CE2 1 
ATOM   2044 C  CZ  . TYR A 1 271 ? 20.557 8.566  72.307  1.00 17.04 ? 272  TYR A CZ  1 
ATOM   2045 O  OH  . TYR A 1 271 ? 21.271 7.420  72.076  1.00 18.44 ? 272  TYR A OH  1 
ATOM   2046 N  N   . ASN A 1 272 ? 17.949 12.076 69.808  1.00 17.54 ? 273  ASN A N   1 
ATOM   2047 C  CA  . ASN A 1 272 ? 17.310 11.404 68.711  1.00 18.60 ? 273  ASN A CA  1 
ATOM   2048 C  C   . ASN A 1 272 ? 18.349 10.475 68.078  1.00 19.85 ? 273  ASN A C   1 
ATOM   2049 O  O   . ASN A 1 272 ? 19.517 10.403 68.469  1.00 18.66 ? 273  ASN A O   1 
ATOM   2050 C  CB  . ASN A 1 272 ? 16.780 12.452 67.687  1.00 19.31 ? 273  ASN A CB  1 
ATOM   2051 C  CG  . ASN A 1 272 ? 17.780 13.380 66.970  1.00 19.75 ? 273  ASN A CG  1 
ATOM   2052 O  OD1 . ASN A 1 272 ? 18.931 13.040 66.718  1.00 18.84 ? 273  ASN A OD1 1 
ATOM   2053 N  ND2 . ASN A 1 272 ? 17.344 14.565 66.540  1.00 22.48 ? 273  ASN A ND2 1 
ATOM   2054 N  N   . HIS A 1 273 ? 17.905 9.792  67.027  1.00 21.75 ? 274  HIS A N   1 
ATOM   2055 C  CA  . HIS A 1 273 ? 18.753 8.857  66.368  1.00 23.60 ? 274  HIS A CA  1 
ATOM   2056 C  C   . HIS A 1 273 ? 19.875 9.490  65.552  1.00 22.92 ? 274  HIS A C   1 
ATOM   2057 O  O   . HIS A 1 273 ? 20.837 8.773  65.307  1.00 23.19 ? 274  HIS A O   1 
ATOM   2058 C  CB  . HIS A 1 273 ? 17.858 7.948  65.520  1.00 27.95 ? 274  HIS A CB  1 
ATOM   2059 C  CG  . HIS A 1 273 ? 17.229 8.601  64.300  1.00 33.75 ? 274  HIS A CG  1 
ATOM   2060 N  ND1 . HIS A 1 273 ? 16.199 9.467  64.182  1.00 36.15 ? 274  HIS A ND1 1 
ATOM   2061 C  CD2 . HIS A 1 273 ? 17.702 8.341  63.024  1.00 35.51 ? 274  HIS A CD2 1 
ATOM   2062 C  CE1 . HIS A 1 273 ? 16.040 9.734  62.892  1.00 36.84 ? 274  HIS A CE1 1 
ATOM   2063 N  NE2 . HIS A 1 273 ? 16.939 9.055  62.211  1.00 37.48 ? 274  HIS A NE2 1 
ATOM   2064 N  N   . ARG A 1 274 ? 19.902 10.758 65.121  1.00 22.37 ? 275  ARG A N   1 
ATOM   2065 C  CA  . ARG A 1 274 ? 21.056 11.287 64.381  1.00 21.26 ? 275  ARG A CA  1 
ATOM   2066 C  C   . ARG A 1 274 ? 22.224 11.433 65.326  1.00 20.09 ? 275  ARG A C   1 
ATOM   2067 O  O   . ARG A 1 274 ? 23.363 11.249 64.877  1.00 19.06 ? 275  ARG A O   1 
ATOM   2068 C  CB  . ARG A 1 274 ? 20.810 12.641 63.802  1.00 22.39 ? 275  ARG A CB  1 
ATOM   2069 C  CG  . ARG A 1 274 ? 19.595 12.687 62.890  1.00 25.55 ? 275  ARG A CG  1 
ATOM   2070 C  CD  . ARG A 1 274 ? 19.779 11.788 61.692  1.00 26.72 ? 275  ARG A CD  1 
ATOM   2071 N  NE  . ARG A 1 274 ? 20.526 12.419 60.615  1.00 28.61 ? 275  ARG A NE  1 
ATOM   2072 C  CZ  . ARG A 1 274 ? 19.892 12.966 59.563  1.00 30.19 ? 275  ARG A CZ  1 
ATOM   2073 N  NH1 . ARG A 1 274 ? 18.578 13.197 59.561  1.00 30.18 ? 275  ARG A NH1 1 
ATOM   2074 N  NH2 . ARG A 1 274 ? 20.599 13.423 58.528  1.00 30.63 ? 275  ARG A NH2 1 
ATOM   2075 N  N   . MET A 1 275 ? 21.917 11.804 66.600  1.00 19.14 ? 276  MET A N   1 
ATOM   2076 C  CA  . MET A 1 275 ? 22.897 11.837 67.674  1.00 18.22 ? 276  MET A CA  1 
ATOM   2077 C  C   . MET A 1 275 ? 23.457 10.441 67.961  1.00 18.66 ? 276  MET A C   1 
ATOM   2078 O  O   . MET A 1 275 ? 24.666 10.264 67.920  1.00 17.42 ? 276  MET A O   1 
ATOM   2079 C  CB  . MET A 1 275 ? 22.302 12.358 68.975  1.00 16.78 ? 276  MET A CB  1 
ATOM   2080 C  CG  . MET A 1 275 ? 21.868 13.788 68.854  1.00 15.71 ? 276  MET A CG  1 
ATOM   2081 S  SD  . MET A 1 275 ? 21.407 14.474 70.462  1.00 15.27 ? 276  MET A SD  1 
ATOM   2082 C  CE  . MET A 1 275 ? 20.639 16.008 70.041  1.00 15.91 ? 276  MET A CE  1 
ATOM   2083 N  N   . LYS A 1 276 ? 22.604 9.436  68.165  1.00 19.14 ? 277  LYS A N   1 
ATOM   2084 C  CA  . LYS A 1 276 ? 23.026 8.059  68.385  1.00 21.51 ? 277  LYS A CA  1 
ATOM   2085 C  C   . LYS A 1 276 ? 24.038 7.587  67.361  1.00 21.63 ? 277  LYS A C   1 
ATOM   2086 O  O   . LYS A 1 276 ? 25.075 7.038  67.715  1.00 21.35 ? 277  LYS A O   1 
ATOM   2087 C  CB  . LYS A 1 276 ? 21.831 7.077  68.326  1.00 23.31 ? 277  LYS A CB  1 
ATOM   2088 C  CG  . LYS A 1 276 ? 22.227 5.616  68.569  1.00 25.07 ? 277  LYS A CG  1 
ATOM   2089 C  CD  . LYS A 1 276 ? 21.115 4.619  68.286  1.00 27.79 ? 277  LYS A CD  1 
ATOM   2090 C  CE  . LYS A 1 276 ? 21.429 3.180  68.795  1.00 29.27 ? 277  LYS A CE  1 
ATOM   2091 N  NZ  . LYS A 1 276 ? 21.478 3.172  70.242  1.00 31.59 ? 277  LYS A NZ  1 
ATOM   2092 N  N   . LYS A 1 277 ? 23.687 7.874  66.115  1.00 22.74 ? 278  LYS A N   1 
ATOM   2093 C  CA  . LYS A 1 277 ? 24.429 7.487  64.950  1.00 24.33 ? 278  LYS A CA  1 
ATOM   2094 C  C   . LYS A 1 277 ? 25.814 8.092  64.964  1.00 24.48 ? 278  LYS A C   1 
ATOM   2095 O  O   . LYS A 1 277 ? 26.762 7.342  64.680  1.00 25.23 ? 278  LYS A O   1 
ATOM   2096 C  CB  . LYS A 1 277 ? 23.683 7.951  63.760  1.00 26.99 ? 278  LYS A CB  1 
ATOM   2097 C  CG  . LYS A 1 277 ? 24.167 7.362  62.472  1.00 30.64 ? 278  LYS A CG  1 
ATOM   2098 C  CD  . LYS A 1 277 ? 23.570 8.147  61.285  1.00 35.39 ? 278  LYS A CD  1 
ATOM   2099 C  CE  . LYS A 1 277 ? 22.023 8.191  60.942  1.00 36.68 ? 278  LYS A CE  1 
ATOM   2100 N  NZ  . LYS A 1 277 ? 21.869 8.935  59.689  1.00 37.39 ? 278  LYS A NZ  1 
ATOM   2101 N  N   . TYR A 1 278 ? 25.914 9.419  65.278  1.00 23.03 ? 279  TYR A N   1 
ATOM   2102 C  CA  . TYR A 1 278 ? 27.209 10.140 65.377  1.00 21.57 ? 279  TYR A CA  1 
ATOM   2103 C  C   . TYR A 1 278 ? 28.095 9.666  66.570  1.00 21.02 ? 279  TYR A C   1 
ATOM   2104 O  O   . TYR A 1 278 ? 29.319 9.518  66.447  1.00 20.75 ? 279  TYR A O   1 
ATOM   2105 C  CB  . TYR A 1 278 ? 26.900 11.664 65.465  1.00 19.04 ? 279  TYR A CB  1 
ATOM   2106 C  CG  . TYR A 1 278 ? 28.090 12.589 65.656  1.00 16.20 ? 279  TYR A CG  1 
ATOM   2107 C  CD1 . TYR A 1 278 ? 28.736 13.020 64.511  1.00 16.08 ? 279  TYR A CD1 1 
ATOM   2108 C  CD2 . TYR A 1 278 ? 28.554 13.007 66.921  1.00 14.71 ? 279  TYR A CD2 1 
ATOM   2109 C  CE1 . TYR A 1 278 ? 29.847 13.859 64.612  1.00 14.86 ? 279  TYR A CE1 1 
ATOM   2110 C  CE2 . TYR A 1 278 ? 29.665 13.840 67.031  1.00 12.41 ? 279  TYR A CE2 1 
ATOM   2111 C  CZ  . TYR A 1 278 ? 30.305 14.257 65.872  1.00 13.67 ? 279  TYR A CZ  1 
ATOM   2112 O  OH  . TYR A 1 278 ? 31.452 15.022 65.899  1.00 12.73 ? 279  TYR A OH  1 
ATOM   2113 N  N   . LEU A 1 279 ? 27.504 9.383  67.745  1.00 20.41 ? 280  LEU A N   1 
ATOM   2114 C  CA  . LEU A 1 279 ? 28.222 8.831  68.893  1.00 19.25 ? 280  LEU A CA  1 
ATOM   2115 C  C   . LEU A 1 279 ? 28.882 7.528  68.512  1.00 19.67 ? 280  LEU A C   1 
ATOM   2116 O  O   . LEU A 1 279 ? 30.038 7.348  68.820  1.00 20.29 ? 280  LEU A O   1 
ATOM   2117 C  CB  . LEU A 1 279 ? 27.263 8.582  70.066  1.00 16.81 ? 280  LEU A CB  1 
ATOM   2118 C  CG  . LEU A 1 279 ? 26.981 9.818  70.954  1.00 16.41 ? 280  LEU A CG  1 
ATOM   2119 C  CD1 . LEU A 1 279 ? 25.769 9.559  71.909  1.00 14.14 ? 280  LEU A CD1 1 
ATOM   2120 C  CD2 . LEU A 1 279 ? 28.274 10.182 71.680  1.00 12.73 ? 280  LEU A CD2 1 
ATOM   2121 N  N   . SER A 1 280 ? 28.197 6.656  67.769  1.00 20.86 ? 281  SER A N   1 
ATOM   2122 C  CA  . SER A 1 280 ? 28.720 5.360  67.349  1.00 20.83 ? 281  SER A CA  1 
ATOM   2123 C  C   . SER A 1 280 ? 29.837 5.518  66.316  1.00 20.69 ? 281  SER A C   1 
ATOM   2124 O  O   . SER A 1 280 ? 30.805 4.745  66.356  1.00 23.16 ? 281  SER A O   1 
ATOM   2125 C  CB  . SER A 1 280 ? 27.608 4.506  66.739  1.00 21.29 ? 281  SER A CB  1 
ATOM   2126 O  OG  . SER A 1 280 ? 26.577 4.421  67.709  1.00 23.89 ? 281  SER A OG  1 
ATOM   2127 N  N   . LYS A 1 281 ? 29.740 6.471  65.385  1.00 18.44 ? 282  LYS A N   1 
ATOM   2128 C  CA  . LYS A 1 281 ? 30.800 6.712  64.448  1.00 17.39 ? 282  LYS A CA  1 
ATOM   2129 C  C   . LYS A 1 281 ? 31.922 7.418  65.179  1.00 16.04 ? 282  LYS A C   1 
ATOM   2130 O  O   . LYS A 1 281 ? 32.981 7.438  64.613  1.00 15.88 ? 282  LYS A O   1 
ATOM   2131 C  CB  . LYS A 1 281 ? 30.245 7.544  63.263  1.00 18.51 ? 282  LYS A CB  1 
ATOM   2132 C  CG  . LYS A 1 281 ? 31.131 7.939  62.053  1.00 23.36 ? 282  LYS A CG  1 
ATOM   2133 C  CD  . LYS A 1 281 ? 31.648 6.870  61.053  1.00 25.53 ? 282  LYS A CD  1 
ATOM   2134 C  CE  . LYS A 1 281 ? 30.605 6.165  60.142  1.00 27.78 ? 282  LYS A CE  1 
ATOM   2135 N  NZ  . LYS A 1 281 ? 31.282 5.321  59.144  1.00 29.19 ? 282  LYS A NZ  1 
ATOM   2136 N  N   . THR A 1 282 ? 31.851 8.011  66.367  1.00 16.13 ? 283  THR A N   1 
ATOM   2137 C  CA  . THR A 1 282 ? 33.008 8.604  67.012  1.00 16.30 ? 283  THR A CA  1 
ATOM   2138 C  C   . THR A 1 282 ? 33.448 7.759  68.190  1.00 17.55 ? 283  THR A C   1 
ATOM   2139 O  O   . THR A 1 282 ? 33.956 8.241  69.203  1.00 19.47 ? 283  THR A O   1 
ATOM   2140 C  CB  . THR A 1 282 ? 32.720 10.094 67.477  1.00 17.11 ? 283  THR A CB  1 
ATOM   2141 O  OG1 . THR A 1 282 ? 31.474 10.231 68.196  1.00 15.09 ? 283  THR A OG1 1 
ATOM   2142 C  CG2 . THR A 1 282 ? 32.726 10.998 66.219  1.00 17.58 ? 283  THR A CG2 1 
ATOM   2143 N  N   . GLY A 1 283 ? 33.271 6.426  68.031  1.00 18.51 ? 284  GLY A N   1 
ATOM   2144 C  CA  . GLY A 1 283 ? 33.649 5.393  68.989  1.00 16.35 ? 284  GLY A CA  1 
ATOM   2145 C  C   . GLY A 1 283 ? 32.999 5.466  70.364  1.00 17.40 ? 284  GLY A C   1 
ATOM   2146 O  O   . GLY A 1 283 ? 33.611 5.001  71.340  1.00 18.99 ? 284  GLY A O   1 
ATOM   2147 N  N   . ARG A 1 284 ? 31.794 6.024  70.540  1.00 15.37 ? 285  ARG A N   1 
ATOM   2148 C  CA  . ARG A 1 284 ? 31.146 6.134  71.849  1.00 13.18 ? 285  ARG A CA  1 
ATOM   2149 C  C   . ARG A 1 284 ? 29.722 5.507  71.869  1.00 13.80 ? 285  ARG A C   1 
ATOM   2150 O  O   . ARG A 1 284 ? 28.765 5.965  72.526  1.00 13.78 ? 285  ARG A O   1 
ATOM   2151 C  CB  . ARG A 1 284 ? 31.077 7.608  72.228  1.00 11.27 ? 285  ARG A CB  1 
ATOM   2152 C  CG  . ARG A 1 284 ? 32.430 8.179  72.537  1.00 10.80 ? 285  ARG A CG  1 
ATOM   2153 C  CD  . ARG A 1 284 ? 32.206 9.649  72.785  1.00 11.25 ? 285  ARG A CD  1 
ATOM   2154 N  NE  . ARG A 1 284 ? 31.920 10.376 71.544  1.00 12.26 ? 285  ARG A NE  1 
ATOM   2155 C  CZ  . ARG A 1 284 ? 31.443 11.639 71.483  1.00 11.18 ? 285  ARG A CZ  1 
ATOM   2156 N  NH1 . ARG A 1 284 ? 31.179 12.316 72.579  1.00 10.60 ? 285  ARG A NH1 1 
ATOM   2157 N  NH2 . ARG A 1 284 ? 31.188 12.197 70.303  1.00 11.54 ? 285  ARG A NH2 1 
ATOM   2158 N  N   . ALA A 1 285 ? 29.592 4.375  71.169  1.00 13.95 ? 286  ALA A N   1 
ATOM   2159 C  CA  . ALA A 1 285 ? 28.360 3.635  71.106  1.00 14.57 ? 286  ALA A CA  1 
ATOM   2160 C  C   . ALA A 1 285 ? 27.899 3.101  72.463  1.00 15.47 ? 286  ALA A C   1 
ATOM   2161 O  O   . ALA A 1 285 ? 26.693 2.993  72.623  1.00 17.56 ? 286  ALA A O   1 
ATOM   2162 C  CB  . ALA A 1 285 ? 28.556 2.505  70.135  1.00 15.37 ? 286  ALA A CB  1 
ATOM   2163 N  N   . ASP A 1 286 ? 28.763 2.731  73.427  1.00 15.67 ? 287  ASP A N   1 
ATOM   2164 C  CA  . ASP A 1 286 ? 28.357 2.470  74.821  1.00 16.52 ? 287  ASP A CA  1 
ATOM   2165 C  C   . ASP A 1 286 ? 27.558 3.602  75.508  1.00 14.78 ? 287  ASP A C   1 
ATOM   2166 O  O   . ASP A 1 286 ? 26.543 3.400  76.157  1.00 13.81 ? 287  ASP A O   1 
ATOM   2167 C  CB  . ASP A 1 286 ? 29.632 2.133  75.611  1.00 18.03 ? 287  ASP A CB  1 
ATOM   2168 C  CG  . ASP A 1 286 ? 30.735 3.187  75.707  1.00 20.70 ? 287  ASP A CG  1 
ATOM   2169 O  OD1 . ASP A 1 286 ? 31.019 3.916  74.750  1.00 21.52 ? 287  ASP A OD1 1 
ATOM   2170 O  OD2 . ASP A 1 286 ? 31.343 3.284  76.772  1.00 23.80 ? 287  ASP A OD2 1 
ATOM   2171 N  N   . ILE A 1 287 ? 27.938 4.840  75.214  1.00 15.37 ? 288  ILE A N   1 
ATOM   2172 C  CA  . ILE A 1 287 ? 27.219 6.058  75.641  1.00 15.89 ? 288  ILE A CA  1 
ATOM   2173 C  C   . ILE A 1 287 ? 25.884 6.133  74.892  1.00 15.14 ? 288  ILE A C   1 
ATOM   2174 O  O   . ILE A 1 287 ? 24.872 6.302  75.563  1.00 15.13 ? 288  ILE A O   1 
ATOM   2175 C  CB  . ILE A 1 287 ? 28.123 7.345  75.387  1.00 15.38 ? 288  ILE A CB  1 
ATOM   2176 C  CG1 . ILE A 1 287 ? 29.355 7.388  76.299  1.00 14.57 ? 288  ILE A CG1 1 
ATOM   2177 C  CG2 . ILE A 1 287 ? 27.334 8.567  75.771  1.00 15.18 ? 288  ILE A CG2 1 
ATOM   2178 C  CD1 . ILE A 1 287 ? 30.314 8.576  76.112  1.00 15.26 ? 288  ILE A CD1 1 
ATOM   2179 N  N   . ALA A 1 288 ? 25.841 5.969  73.562  1.00 14.77 ? 289  ALA A N   1 
ATOM   2180 C  CA  . ALA A 1 288 ? 24.612 5.877  72.783  1.00 15.36 ? 289  ALA A CA  1 
ATOM   2181 C  C   . ALA A 1 288 ? 23.703 4.865  73.424  1.00 16.43 ? 289  ALA A C   1 
ATOM   2182 O  O   . ALA A 1 288 ? 22.529 5.151  73.571  1.00 17.34 ? 289  ALA A O   1 
ATOM   2183 C  CB  . ALA A 1 288 ? 24.822 5.354  71.352  1.00 14.70 ? 289  ALA A CB  1 
ATOM   2184 N  N   . ASN A 1 289 ? 24.231 3.715  73.892  1.00 17.34 ? 290  ASN A N   1 
ATOM   2185 C  CA  . ASN A 1 289 ? 23.403 2.643  74.408  1.00 17.15 ? 290  ASN A CA  1 
ATOM   2186 C  C   . ASN A 1 289 ? 22.838 2.985  75.744  1.00 17.70 ? 290  ASN A C   1 
ATOM   2187 O  O   . ASN A 1 289 ? 21.661 2.709  75.927  1.00 16.93 ? 290  ASN A O   1 
ATOM   2188 C  CB  . ASN A 1 289 ? 24.190 1.351  74.505  1.00 16.88 ? 290  ASN A CB  1 
ATOM   2189 C  CG  . ASN A 1 289 ? 24.378 0.591  73.185  1.00 18.02 ? 290  ASN A CG  1 
ATOM   2190 O  OD1 . ASN A 1 289 ? 23.587 0.686  72.221  1.00 17.26 ? 290  ASN A OD1 1 
ATOM   2191 N  ND2 . ASN A 1 289 ? 25.460 -0.197 73.165  1.00 16.25 ? 290  ASN A ND2 1 
ATOM   2192 N  N   . LEU A 1 290 ? 23.627 3.641  76.617  1.00 18.71 ? 291  LEU A N   1 
ATOM   2193 C  CA  . LEU A 1 290 ? 23.134 4.107  77.920  1.00 20.47 ? 291  LEU A CA  1 
ATOM   2194 C  C   . LEU A 1 290 ? 22.139 5.281  77.892  1.00 21.26 ? 291  LEU A C   1 
ATOM   2195 O  O   . LEU A 1 290 ? 21.306 5.376  78.782  1.00 21.76 ? 291  LEU A O   1 
ATOM   2196 C  CB  . LEU A 1 290 ? 24.283 4.530  78.812  1.00 20.33 ? 291  LEU A CB  1 
ATOM   2197 C  CG  . LEU A 1 290 ? 23.889 4.978  80.209  1.00 19.59 ? 291  LEU A CG  1 
ATOM   2198 C  CD1 . LEU A 1 290 ? 23.220 3.817  80.920  1.00 20.35 ? 291  LEU A CD1 1 
ATOM   2199 C  CD2 . LEU A 1 290 ? 25.112 5.460  80.959  1.00 18.64 ? 291  LEU A CD2 1 
ATOM   2200 N  N   . ALA A 1 291 ? 22.262 6.208  76.934  1.00 21.70 ? 292  ALA A N   1 
ATOM   2201 C  CA  . ALA A 1 291 ? 21.329 7.297  76.731  1.00 21.51 ? 292  ALA A CA  1 
ATOM   2202 C  C   . ALA A 1 291 ? 20.041 6.690  76.232  1.00 22.94 ? 292  ALA A C   1 
ATOM   2203 O  O   . ALA A 1 291 ? 19.011 7.212  76.644  1.00 24.95 ? 292  ALA A O   1 
ATOM   2204 C  CB  . ALA A 1 291 ? 21.800 8.288  75.675  1.00 20.45 ? 292  ALA A CB  1 
ATOM   2205 N  N   . ASP A 1 292 ? 19.971 5.668  75.355  1.00 22.86 ? 293  ASP A N   1 
ATOM   2206 C  CA  . ASP A 1 292 ? 18.680 5.011  75.106  1.00 22.45 ? 293  ASP A CA  1 
ATOM   2207 C  C   . ASP A 1 292 ? 17.996 4.431  76.342  1.00 20.96 ? 293  ASP A C   1 
ATOM   2208 O  O   . ASP A 1 292 ? 16.789 4.368  76.398  1.00 19.17 ? 293  ASP A O   1 
ATOM   2209 C  CB  . ASP A 1 292 ? 18.823 3.876  74.164  1.00 23.68 ? 293  ASP A CB  1 
ATOM   2210 C  CG  . ASP A 1 292 ? 19.123 4.255  72.727  1.00 26.57 ? 293  ASP A CG  1 
ATOM   2211 O  OD1 . ASP A 1 292 ? 18.937 5.411  72.319  1.00 28.04 ? 293  ASP A OD1 1 
ATOM   2212 O  OD2 . ASP A 1 292 ? 19.555 3.351  72.014  1.00 27.35 ? 293  ASP A OD2 1 
ATOM   2213 N  N   . GLU A 1 293 ? 18.751 3.896  77.292  1.00 22.05 ? 294  GLU A N   1 
ATOM   2214 C  CA  . GLU A 1 293 ? 18.168 3.448  78.542  1.00 23.56 ? 294  GLU A CA  1 
ATOM   2215 C  C   . GLU A 1 293 ? 17.730 4.638  79.359  1.00 22.81 ? 294  GLU A C   1 
ATOM   2216 O  O   . GLU A 1 293 ? 16.956 4.411  80.279  1.00 23.52 ? 294  GLU A O   1 
ATOM   2217 C  CB  . GLU A 1 293 ? 19.129 2.638  79.466  1.00 24.93 ? 294  GLU A CB  1 
ATOM   2218 C  CG  . GLU A 1 293 ? 19.351 1.151  79.130  1.00 28.72 ? 294  GLU A CG  1 
ATOM   2219 C  CD  . GLU A 1 293 ? 19.892 0.236  80.249  1.00 30.76 ? 294  GLU A CD  1 
ATOM   2220 O  OE1 . GLU A 1 293 ? 19.991 0.651  81.414  1.00 32.91 ? 294  GLU A OE1 1 
ATOM   2221 O  OE2 . GLU A 1 293 ? 20.202 -0.927 79.959  1.00 33.75 ? 294  GLU A OE2 1 
ATOM   2222 N  N   . PHE A 1 294 ? 18.173 5.886  79.135  1.00 21.68 ? 295  PHE A N   1 
ATOM   2223 C  CA  . PHE A 1 294 ? 17.696 6.967  79.976  1.00 20.84 ? 295  PHE A CA  1 
ATOM   2224 C  C   . PHE A 1 294 ? 16.922 8.075  79.281  1.00 21.45 ? 295  PHE A C   1 
ATOM   2225 O  O   . PHE A 1 294 ? 16.560 9.082  79.882  1.00 22.29 ? 295  PHE A O   1 
ATOM   2226 C  CB  . PHE A 1 294 ? 18.863 7.526  80.718  1.00 18.63 ? 295  PHE A CB  1 
ATOM   2227 C  CG  . PHE A 1 294 ? 19.211 6.745  81.971  1.00 16.23 ? 295  PHE A CG  1 
ATOM   2228 C  CD1 . PHE A 1 294 ? 18.615 7.115  83.183  1.00 16.96 ? 295  PHE A CD1 1 
ATOM   2229 C  CD2 . PHE A 1 294 ? 20.171 5.720  81.956  1.00 15.69 ? 295  PHE A CD2 1 
ATOM   2230 C  CE1 . PHE A 1 294 ? 18.987 6.470  84.382  1.00 14.55 ? 295  PHE A CE1 1 
ATOM   2231 C  CE2 . PHE A 1 294 ? 20.547 5.071  83.151  1.00 14.30 ? 295  PHE A CE2 1 
ATOM   2232 C  CZ  . PHE A 1 294 ? 19.949 5.459  84.358  1.00 15.22 ? 295  PHE A CZ  1 
ATOM   2233 N  N   . LYS A 1 295 ? 16.561 7.750  78.047  1.00 22.06 ? 296  LYS A N   1 
ATOM   2234 C  CA  . LYS A 1 295 ? 15.777 8.532  77.104  1.00 23.19 ? 296  LYS A CA  1 
ATOM   2235 C  C   . LYS A 1 295 ? 14.708 9.532  77.516  1.00 23.89 ? 296  LYS A C   1 
ATOM   2236 O  O   . LYS A 1 295 ? 14.642 10.608 76.920  1.00 23.01 ? 296  LYS A O   1 
ATOM   2237 C  CB  . LYS A 1 295 ? 15.235 7.488  76.204  1.00 24.14 ? 296  LYS A CB  1 
ATOM   2238 C  CG  . LYS A 1 295 ? 14.451 7.906  75.027  1.00 28.28 ? 296  LYS A CG  1 
ATOM   2239 C  CD  . LYS A 1 295 ? 15.318 8.541  73.967  1.00 31.11 ? 296  LYS A CD  1 
ATOM   2240 C  CE  . LYS A 1 295 ? 14.429 8.734  72.746  1.00 33.21 ? 296  LYS A CE  1 
ATOM   2241 N  NZ  . LYS A 1 295 ? 15.140 9.324  71.619  1.00 35.62 ? 296  LYS A NZ  1 
ATOM   2242 N  N   . ASP A 1 296 ? 13.893 9.218  78.543  1.00 25.13 ? 297  ASP A N   1 
ATOM   2243 C  CA  . ASP A 1 296 ? 12.813 10.088 79.026  1.00 25.97 ? 297  ASP A CA  1 
ATOM   2244 C  C   . ASP A 1 296 ? 13.275 11.364 79.633  1.00 24.93 ? 297  ASP A C   1 
ATOM   2245 O  O   . ASP A 1 296 ? 12.559 12.351 79.599  1.00 24.93 ? 297  ASP A O   1 
ATOM   2246 C  CB  . ASP A 1 296 ? 11.930 9.510  80.140  1.00 28.41 ? 297  ASP A CB  1 
ATOM   2247 C  CG  . ASP A 1 296 ? 11.331 8.123  79.900  1.00 31.75 ? 297  ASP A CG  1 
ATOM   2248 O  OD1 . ASP A 1 296 ? 11.056 7.724  78.752  1.00 29.97 ? 297  ASP A OD1 1 
ATOM   2249 O  OD2 . ASP A 1 296 ? 11.157 7.434  80.915  1.00 34.76 ? 297  ASP A OD2 1 
ATOM   2250 N  N   . HIS A 1 297 ? 14.468 11.296 80.221  1.00 24.77 ? 298  HIS A N   1 
ATOM   2251 C  CA  . HIS A 1 297 ? 15.105 12.458 80.832  1.00 23.15 ? 298  HIS A CA  1 
ATOM   2252 C  C   . HIS A 1 297 ? 15.972 13.220 79.849  1.00 20.66 ? 298  HIS A C   1 
ATOM   2253 O  O   . HIS A 1 297 ? 16.525 14.233 80.262  1.00 20.29 ? 298  HIS A O   1 
ATOM   2254 C  CB  . HIS A 1 297 ? 15.969 12.054 81.980  1.00 24.37 ? 298  HIS A CB  1 
ATOM   2255 C  CG  . HIS A 1 297 ? 15.272 11.132 82.941  1.00 25.77 ? 298  HIS A CG  1 
ATOM   2256 N  ND1 . HIS A 1 297 ? 14.340 11.406 83.847  1.00 26.99 ? 298  HIS A ND1 1 
ATOM   2257 C  CD2 . HIS A 1 297 ? 15.584 9.801  83.009  1.00 26.82 ? 298  HIS A CD2 1 
ATOM   2258 C  CE1 . HIS A 1 297 ? 14.071 10.295 84.487  1.00 27.76 ? 298  HIS A CE1 1 
ATOM   2259 N  NE2 . HIS A 1 297 ? 14.830 9.340  83.969  1.00 28.69 ? 298  HIS A NE2 1 
ATOM   2260 N  N   . LEU A 1 298 ? 16.047 12.783 78.573  1.00 18.64 ? 299  LEU A N   1 
ATOM   2261 C  CA  . LEU A 1 298 ? 16.837 13.427 77.525  1.00 15.92 ? 299  LEU A CA  1 
ATOM   2262 C  C   . LEU A 1 298 ? 15.915 13.972 76.415  1.00 16.53 ? 299  LEU A C   1 
ATOM   2263 O  O   . LEU A 1 298 ? 16.356 14.412 75.347  1.00 17.33 ? 299  LEU A O   1 
ATOM   2264 C  CB  . LEU A 1 298 ? 17.842 12.394 77.012  1.00 12.80 ? 299  LEU A CB  1 
ATOM   2265 C  CG  . LEU A 1 298 ? 18.684 11.681 78.149  1.00 12.05 ? 299  LEU A CG  1 
ATOM   2266 C  CD1 . LEU A 1 298 ? 19.600 10.577 77.675  1.00 10.93 ? 299  LEU A CD1 1 
ATOM   2267 C  CD2 . LEU A 1 298 ? 19.582 12.723 78.771  1.00 10.03 ? 299  LEU A CD2 1 
ATOM   2268 N  N   . VAL A 1 299 ? 14.607 14.096 76.723  1.00 15.95 ? 300  VAL A N   1 
ATOM   2269 C  CA  . VAL A 1 299 ? 13.591 14.659 75.847  1.00 15.75 ? 300  VAL A CA  1 
ATOM   2270 C  C   . VAL A 1 299 ? 12.704 15.601 76.691  1.00 16.75 ? 300  VAL A C   1 
ATOM   2271 O  O   . VAL A 1 299 ? 12.758 15.467 77.923  1.00 17.17 ? 300  VAL A O   1 
ATOM   2272 C  CB  . VAL A 1 299 ? 12.701 13.541 75.221  1.00 16.80 ? 300  VAL A CB  1 
ATOM   2273 C  CG1 . VAL A 1 299 ? 13.526 12.715 74.229  1.00 16.76 ? 300  VAL A CG1 1 
ATOM   2274 C  CG2 . VAL A 1 299 ? 12.118 12.646 76.317  1.00 13.96 ? 300  VAL A CG2 1 
ATOM   2275 N  N   . PRO A 1 300 ? 11.891 16.580 76.207  1.00 16.29 ? 301  PRO A N   1 
ATOM   2276 C  CA  . PRO A 1 300 ? 11.052 17.386 77.079  1.00 16.53 ? 301  PRO A CA  1 
ATOM   2277 C  C   . PRO A 1 300 ? 9.827  16.602 77.564  1.00 18.90 ? 301  PRO A C   1 
ATOM   2278 O  O   . PRO A 1 300 ? 9.347  15.672 76.887  1.00 18.93 ? 301  PRO A O   1 
ATOM   2279 C  CB  . PRO A 1 300 ? 10.702 18.588 76.252  1.00 16.25 ? 301  PRO A CB  1 
ATOM   2280 C  CG  . PRO A 1 300 ? 10.794 18.132 74.805  1.00 15.42 ? 301  PRO A CG  1 
ATOM   2281 C  CD  . PRO A 1 300 ? 11.904 17.090 74.836  1.00 16.04 ? 301  PRO A CD  1 
ATOM   2282 N  N   . ASP A 1 301 ? 9.314  16.995 78.753  1.00 20.24 ? 302  ASP A N   1 
ATOM   2283 C  CA  . ASP A 1 301 ? 8.092  16.424 79.260  1.00 22.30 ? 302  ASP A CA  1 
ATOM   2284 C  C   . ASP A 1 301 ? 6.947  16.823 78.344  1.00 24.37 ? 302  ASP A C   1 
ATOM   2285 O  O   . ASP A 1 301 ? 6.976  17.958 77.849  1.00 24.78 ? 302  ASP A O   1 
ATOM   2286 C  CB  . ASP A 1 301 ? 7.782  16.942 80.608  1.00 20.84 ? 302  ASP A CB  1 
ATOM   2287 C  CG  . ASP A 1 301 ? 8.450  16.213 81.723  1.00 21.28 ? 302  ASP A CG  1 
ATOM   2288 O  OD1 . ASP A 1 301 ? 9.006  15.129 81.537  1.00 20.98 ? 302  ASP A OD1 1 
ATOM   2289 O  OD2 . ASP A 1 301 ? 8.390  16.760 82.808  1.00 21.16 ? 302  ASP A OD2 1 
ATOM   2290 N  N   . PRO A 1 302 ? 5.911  15.988 78.091  1.00 26.28 ? 303  PRO A N   1 
ATOM   2291 C  CA  . PRO A 1 302 ? 4.820  16.275 77.140  1.00 26.58 ? 303  PRO A CA  1 
ATOM   2292 C  C   . PRO A 1 302 ? 4.082  17.505 77.659  1.00 26.58 ? 303  PRO A C   1 
ATOM   2293 O  O   . PRO A 1 302 ? 3.838  17.549 78.872  1.00 26.85 ? 303  PRO A O   1 
ATOM   2294 C  CB  . PRO A 1 302 ? 3.982  14.991 77.149  1.00 27.09 ? 303  PRO A CB  1 
ATOM   2295 C  CG  . PRO A 1 302 ? 4.900  13.952 77.769  1.00 27.61 ? 303  PRO A CG  1 
ATOM   2296 C  CD  . PRO A 1 302 ? 5.606  14.768 78.847  1.00 27.03 ? 303  PRO A CD  1 
ATOM   2297 N  N   . GLY A 1 303 ? 3.801  18.517 76.818  1.00 26.23 ? 304  GLY A N   1 
ATOM   2298 C  CA  . GLY A 1 303 ? 3.036  19.680 77.235  1.00 26.16 ? 304  GLY A CA  1 
ATOM   2299 C  C   . GLY A 1 303 ? 3.812  20.652 78.125  1.00 27.48 ? 304  GLY A C   1 
ATOM   2300 O  O   . GLY A 1 303 ? 3.243  21.230 79.062  1.00 27.62 ? 304  GLY A O   1 
ATOM   2301 N  N   . CYS A 1 304 ? 5.127  20.843 77.915  1.00 27.53 ? 305  CYS A N   1 
ATOM   2302 C  CA  . CYS A 1 304 ? 5.885  21.783 78.735  1.00 27.47 ? 305  CYS A CA  1 
ATOM   2303 C  C   . CYS A 1 304 ? 5.651  23.247 78.276  1.00 27.56 ? 305  CYS A C   1 
ATOM   2304 O  O   . CYS A 1 304 ? 5.316  23.485 77.096  1.00 26.93 ? 305  CYS A O   1 
ATOM   2305 C  CB  . CYS A 1 304 ? 7.353  21.368 78.650  1.00 26.16 ? 305  CYS A CB  1 
ATOM   2306 S  SG  . CYS A 1 304 ? 7.996  21.393 76.969  1.00 26.46 ? 305  CYS A SG  1 
ATOM   2307 N  N   . HIS A 1 305 ? 5.786  24.236 79.186  1.00 27.38 ? 306  HIS A N   1 
ATOM   2308 C  CA  . HIS A 1 305 ? 5.558  25.611 78.771  1.00 26.96 ? 306  HIS A CA  1 
ATOM   2309 C  C   . HIS A 1 305 ? 6.831  26.337 78.405  1.00 25.03 ? 306  HIS A C   1 
ATOM   2310 O  O   . HIS A 1 305 ? 7.776  26.462 79.192  1.00 24.64 ? 306  HIS A O   1 
ATOM   2311 C  CB  . HIS A 1 305 ? 4.896  26.440 79.862  1.00 30.45 ? 306  HIS A CB  1 
ATOM   2312 C  CG  . HIS A 1 305 ? 4.496  27.881 79.438  1.00 34.46 ? 306  HIS A CG  1 
ATOM   2313 N  ND1 . HIS A 1 305 ? 5.089  29.049 79.737  1.00 35.32 ? 306  HIS A ND1 1 
ATOM   2314 C  CD2 . HIS A 1 305 ? 3.387  28.184 78.658  1.00 34.94 ? 306  HIS A CD2 1 
ATOM   2315 C  CE1 . HIS A 1 305 ? 4.407  30.028 79.192  1.00 35.99 ? 306  HIS A CE1 1 
ATOM   2316 N  NE2 . HIS A 1 305 ? 3.392  29.488 78.545  1.00 36.11 ? 306  HIS A NE2 1 
ATOM   2317 N  N   . TYR A 1 306 ? 6.803  26.802 77.172  1.00 22.58 ? 307  TYR A N   1 
ATOM   2318 C  CA  . TYR A 1 306 ? 7.836  27.713 76.685  1.00 22.03 ? 307  TYR A CA  1 
ATOM   2319 C  C   . TYR A 1 306 ? 7.421  29.184 76.940  1.00 22.67 ? 307  TYR A C   1 
ATOM   2320 O  O   . TYR A 1 306 ? 6.218  29.472 76.912  1.00 22.94 ? 307  TYR A O   1 
ATOM   2321 C  CB  . TYR A 1 306 ? 8.028  27.481 75.208  1.00 18.84 ? 307  TYR A CB  1 
ATOM   2322 C  CG  . TYR A 1 306 ? 8.492  26.068 74.909  1.00 16.96 ? 307  TYR A CG  1 
ATOM   2323 C  CD1 . TYR A 1 306 ? 9.572  25.519 75.606  1.00 16.35 ? 307  TYR A CD1 1 
ATOM   2324 C  CD2 . TYR A 1 306 ? 7.879  25.331 73.896  1.00 15.94 ? 307  TYR A CD2 1 
ATOM   2325 C  CE1 . TYR A 1 306 ? 10.048 24.246 75.287  1.00 16.43 ? 307  TYR A CE1 1 
ATOM   2326 C  CE2 . TYR A 1 306 ? 8.355  24.056 73.570  1.00 15.67 ? 307  TYR A CE2 1 
ATOM   2327 C  CZ  . TYR A 1 306 ? 9.442  23.507 74.258  1.00 16.58 ? 307  TYR A CZ  1 
ATOM   2328 O  OH  . TYR A 1 306 ? 9.948  22.248 73.882  1.00 16.31 ? 307  TYR A OH  1 
ATOM   2329 N  N   . ASP A 1 307 ? 8.290  30.169 77.253  1.00 22.55 ? 308  ASP A N   1 
ATOM   2330 C  CA  . ASP A 1 307 ? 7.846  31.551 77.441  1.00 22.28 ? 308  ASP A CA  1 
ATOM   2331 C  C   . ASP A 1 307 ? 7.612  32.291 76.117  1.00 23.52 ? 308  ASP A C   1 
ATOM   2332 O  O   . ASP A 1 307 ? 6.946  33.327 76.066  1.00 23.28 ? 308  ASP A O   1 
ATOM   2333 C  CB  . ASP A 1 307 ? 8.847  32.332 78.287  1.00 21.22 ? 308  ASP A CB  1 
ATOM   2334 C  CG  . ASP A 1 307 ? 9.020  31.691 79.652  1.00 22.39 ? 308  ASP A CG  1 
ATOM   2335 O  OD1 . ASP A 1 307 ? 8.250  31.970 80.571  1.00 23.12 ? 308  ASP A OD1 1 
ATOM   2336 O  OD2 . ASP A 1 307 ? 9.961  30.922 79.827  1.00 21.61 ? 308  ASP A OD2 1 
ATOM   2337 N  N   . GLN A 1 308 ? 8.142  31.716 75.047  1.00 24.23 ? 309  GLN A N   1 
ATOM   2338 C  CA  . GLN A 1 308 ? 7.899  32.195 73.721  1.00 25.70 ? 309  GLN A CA  1 
ATOM   2339 C  C   . GLN A 1 308 ? 8.046  30.952 72.872  1.00 25.31 ? 309  GLN A C   1 
ATOM   2340 O  O   . GLN A 1 308 ? 8.664  29.976 73.278  1.00 24.82 ? 309  GLN A O   1 
ATOM   2341 C  CB  . GLN A 1 308 ? 8.930  33.244 73.349  1.00 29.48 ? 309  GLN A CB  1 
ATOM   2342 C  CG  . GLN A 1 308 ? 8.662  33.686 71.928  1.00 34.72 ? 309  GLN A CG  1 
ATOM   2343 C  CD  . GLN A 1 308 ? 9.464  34.845 71.371  1.00 39.04 ? 309  GLN A CD  1 
ATOM   2344 O  OE1 . GLN A 1 308 ? 10.417 35.323 71.993  1.00 40.16 ? 309  GLN A OE1 1 
ATOM   2345 N  NE2 . GLN A 1 308 ? 9.072  35.265 70.145  1.00 39.62 ? 309  GLN A NE2 1 
ATOM   2346 N  N   . VAL A 1 309 ? 7.425  30.957 71.700  1.00 25.43 ? 310  VAL A N   1 
ATOM   2347 C  CA  . VAL A 1 309 ? 7.509  29.882 70.738  1.00 25.34 ? 310  VAL A CA  1 
ATOM   2348 C  C   . VAL A 1 309 ? 7.641  30.535 69.393  1.00 24.88 ? 310  VAL A C   1 
ATOM   2349 O  O   . VAL A 1 309 ? 7.016  31.556 69.131  1.00 26.01 ? 310  VAL A O   1 
ATOM   2350 C  CB  . VAL A 1 309 ? 6.247  29.033 70.804  1.00 26.18 ? 310  VAL A CB  1 
ATOM   2351 C  CG1 . VAL A 1 309 ? 6.032  28.226 69.543  1.00 25.31 ? 310  VAL A CG1 1 
ATOM   2352 C  CG2 . VAL A 1 309 ? 6.435  28.037 71.960  1.00 26.83 ? 310  VAL A CG2 1 
ATOM   2353 N  N   . ILE A 1 310 ? 8.467  29.972 68.538  1.00 23.84 ? 311  ILE A N   1 
ATOM   2354 C  CA  . ILE A 1 310 ? 8.641  30.463 67.197  1.00 24.17 ? 311  ILE A CA  1 
ATOM   2355 C  C   . ILE A 1 310 ? 8.446  29.177 66.417  1.00 25.03 ? 311  ILE A C   1 
ATOM   2356 O  O   . ILE A 1 310 ? 8.711  28.111 66.968  1.00 25.88 ? 311  ILE A O   1 
ATOM   2357 C  CB  . ILE A 1 310 ? 10.103 31.074 66.994  1.00 25.31 ? 311  ILE A CB  1 
ATOM   2358 C  CG1 . ILE A 1 310 ? 10.211 32.461 67.610  1.00 25.86 ? 311  ILE A CG1 1 
ATOM   2359 C  CG2 . ILE A 1 310 ? 10.452 31.228 65.498  1.00 24.64 ? 311  ILE A CG2 1 
ATOM   2360 C  CD1 . ILE A 1 310 ? 10.840 32.424 68.991  1.00 27.50 ? 311  ILE A CD1 1 
ATOM   2361 N  N   . GLU A 1 311 ? 7.979  29.199 65.164  1.00 25.16 ? 312  GLU A N   1 
ATOM   2362 C  CA  . GLU A 1 311 ? 7.838  27.999 64.368  1.00 25.74 ? 312  GLU A CA  1 
ATOM   2363 C  C   . GLU A 1 311 ? 8.508  28.320 63.055  1.00 25.77 ? 312  GLU A C   1 
ATOM   2364 O  O   . GLU A 1 311 ? 8.312  29.423 62.559  1.00 25.39 ? 312  GLU A O   1 
ATOM   2365 C  CB  . GLU A 1 311 ? 6.375  27.634 64.095  1.00 26.25 ? 312  GLU A CB  1 
ATOM   2366 C  CG  . GLU A 1 311 ? 6.279  26.441 63.131  1.00 28.93 ? 312  GLU A CG  1 
ATOM   2367 C  CD  . GLU A 1 311 ? 4.887  26.056 62.631  1.00 30.24 ? 312  GLU A CD  1 
ATOM   2368 O  OE1 . GLU A 1 311 ? 3.946  25.966 63.439  1.00 31.42 ? 312  GLU A OE1 1 
ATOM   2369 O  OE2 . GLU A 1 311 ? 4.774  25.826 61.416  1.00 31.39 ? 312  GLU A OE2 1 
ATOM   2370 N  N   . ILE A 1 312 ? 9.312  27.390 62.501  1.00 26.56 ? 313  ILE A N   1 
ATOM   2371 C  CA  . ILE A 1 312 ? 9.964  27.554 61.202  1.00 26.87 ? 313  ILE A CA  1 
ATOM   2372 C  C   . ILE A 1 312 ? 9.672  26.303 60.398  1.00 26.32 ? 313  ILE A C   1 
ATOM   2373 O  O   . ILE A 1 312 ? 9.662  25.177 60.876  1.00 25.72 ? 313  ILE A O   1 
ATOM   2374 C  CB  . ILE A 1 312 ? 11.512 27.742 61.297  1.00 27.91 ? 313  ILE A CB  1 
ATOM   2375 C  CG1 . ILE A 1 312 ? 11.736 29.063 62.042  1.00 28.68 ? 313  ILE A CG1 1 
ATOM   2376 C  CG2 . ILE A 1 312 ? 12.217 27.848 59.913  1.00 24.80 ? 313  ILE A CG2 1 
ATOM   2377 C  CD1 . ILE A 1 312 ? 13.180 29.216 62.532  1.00 31.05 ? 313  ILE A CD1 1 
ATOM   2378 N  N   . ASN A 1 313 ? 9.269  26.616 59.183  1.00 26.53 ? 314  ASN A N   1 
ATOM   2379 C  CA  . ASN A 1 313 ? 8.977  25.588 58.227  1.00 26.54 ? 314  ASN A CA  1 
ATOM   2380 C  C   . ASN A 1 313 ? 10.189 25.497 57.321  1.00 26.20 ? 314  ASN A C   1 
ATOM   2381 O  O   . ASN A 1 313 ? 10.389 26.339 56.437  1.00 26.00 ? 314  ASN A O   1 
ATOM   2382 C  CB  . ASN A 1 313 ? 7.737  25.928 57.396  1.00 26.56 ? 314  ASN A CB  1 
ATOM   2383 C  CG  . ASN A 1 313 ? 7.324  24.785 56.495  1.00 27.04 ? 314  ASN A CG  1 
ATOM   2384 O  OD1 . ASN A 1 313 ? 7.434  23.597 56.762  1.00 27.41 ? 314  ASN A OD1 1 
ATOM   2385 N  ND2 . ASN A 1 313 ? 6.870  25.171 55.336  1.00 27.95 ? 314  ASN A ND2 1 
ATOM   2386 N  N   . LEU A 1 314 ? 10.991 24.477 57.671  1.00 25.32 ? 315  LEU A N   1 
ATOM   2387 C  CA  . LEU A 1 314 ? 12.180 24.067 56.958  1.00 24.63 ? 315  LEU A CA  1 
ATOM   2388 C  C   . LEU A 1 314 ? 11.977 23.916 55.462  1.00 25.75 ? 315  LEU A C   1 
ATOM   2389 O  O   . LEU A 1 314 ? 12.851 24.348 54.708  1.00 24.62 ? 315  LEU A O   1 
ATOM   2390 C  CB  . LEU A 1 314 ? 12.657 22.763 57.536  1.00 22.84 ? 315  LEU A CB  1 
ATOM   2391 C  CG  . LEU A 1 314 ? 13.785 22.770 58.527  1.00 22.58 ? 315  LEU A CG  1 
ATOM   2392 C  CD1 . LEU A 1 314 ? 13.627 23.923 59.490  1.00 22.42 ? 315  LEU A CD1 1 
ATOM   2393 C  CD2 . LEU A 1 314 ? 13.858 21.400 59.155  1.00 20.73 ? 315  LEU A CD2 1 
ATOM   2394 N  N   . SER A 1 315 ? 10.828 23.349 55.037  1.00 27.50 ? 316  SER A N   1 
ATOM   2395 C  CA  . SER A 1 315 ? 10.530 23.196 53.622  1.00 29.46 ? 316  SER A CA  1 
ATOM   2396 C  C   . SER A 1 315 ? 10.298 24.534 52.946  1.00 31.14 ? 316  SER A C   1 
ATOM   2397 O  O   . SER A 1 315 ? 10.500 24.589 51.736  1.00 31.99 ? 316  SER A O   1 
ATOM   2398 C  CB  . SER A 1 315 ? 9.301  22.328 53.422  1.00 29.53 ? 316  SER A CB  1 
ATOM   2399 O  OG  . SER A 1 315 ? 9.501  21.033 53.988  1.00 29.09 ? 316  SER A OG  1 
ATOM   2400 N  N   . GLU A 1 316 ? 9.844  25.610 53.617  1.00 32.99 ? 317  GLU A N   1 
ATOM   2401 C  CA  . GLU A 1 316 ? 9.820  26.930 52.991  1.00 34.44 ? 317  GLU A CA  1 
ATOM   2402 C  C   . GLU A 1 316 ? 11.097 27.795 53.153  1.00 33.35 ? 317  GLU A C   1 
ATOM   2403 O  O   . GLU A 1 316 ? 11.300 28.719 52.358  1.00 32.78 ? 317  GLU A O   1 
ATOM   2404 C  CB  . GLU A 1 316 ? 8.641  27.719 53.525  1.00 37.93 ? 317  GLU A CB  1 
ATOM   2405 C  CG  . GLU A 1 316 ? 7.491  27.701 52.550  1.00 44.75 ? 317  GLU A CG  1 
ATOM   2406 C  CD  . GLU A 1 316 ? 6.395  26.679 52.853  1.00 49.59 ? 317  GLU A CD  1 
ATOM   2407 O  OE1 . GLU A 1 316 ? 5.487  27.030 53.627  1.00 51.52 ? 317  GLU A OE1 1 
ATOM   2408 O  OE2 . GLU A 1 316 ? 6.459  25.550 52.333  1.00 51.03 ? 317  GLU A OE2 1 
ATOM   2409 N  N   . LEU A 1 317 ? 12.015 27.562 54.116  1.00 32.61 ? 318  LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 317 ? 13.206 28.378 54.287  1.00 31.76 ? 318  LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 317 ? 14.122 28.304 53.070  1.00 32.02 ? 318  LEU A C   1 
ATOM   2412 O  O   . LEU A 1 317 ? 14.330 27.255 52.461  1.00 32.39 ? 318  LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 317 ? 13.911 27.911 55.569  1.00 32.36 ? 318  LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 317 ? 15.283 28.515 55.962  1.00 31.57 ? 318  LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 317 ? 15.239 30.042 56.099  1.00 31.12 ? 318  LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 317 ? 15.688 27.883 57.246  1.00 31.25 ? 318  LEU A CD2 1 
ATOM   2417 N  N   . LYS A 1 318 ? 14.664 29.454 52.676  1.00 32.01 ? 319  LYS A N   1 
ATOM   2418 C  CA  . LYS A 1 318 ? 15.507 29.517 51.494  1.00 31.65 ? 319  LYS A CA  1 
ATOM   2419 C  C   . LYS A 1 318 ? 16.889 30.026 51.922  1.00 29.72 ? 319  LYS A C   1 
ATOM   2420 O  O   . LYS A 1 318 ? 16.996 30.531 53.028  1.00 28.79 ? 319  LYS A O   1 
ATOM   2421 C  CB  . LYS A 1 318 ? 14.731 30.431 50.522  1.00 34.51 ? 319  LYS A CB  1 
ATOM   2422 C  CG  . LYS A 1 318 ? 14.531 29.892 49.096  1.00 38.02 ? 319  LYS A CG  1 
ATOM   2423 C  CD  . LYS A 1 318 ? 13.887 28.478 49.091  1.00 42.34 ? 319  LYS A CD  1 
ATOM   2424 C  CE  . LYS A 1 318 ? 14.094 27.634 47.796  1.00 43.49 ? 319  LYS A CE  1 
ATOM   2425 N  NZ  . LYS A 1 318 ? 15.489 27.279 47.516  1.00 45.75 ? 319  LYS A NZ  1 
ATOM   2426 N  N   . PRO A 1 319 ? 18.003 29.942 51.191  1.00 28.75 ? 320  PRO A N   1 
ATOM   2427 C  CA  . PRO A 1 319 ? 19.325 30.522 51.548  1.00 27.59 ? 320  PRO A CA  1 
ATOM   2428 C  C   . PRO A 1 319 ? 19.409 31.991 51.998  1.00 27.06 ? 320  PRO A C   1 
ATOM   2429 O  O   . PRO A 1 319 ? 18.779 32.877 51.427  1.00 26.96 ? 320  PRO A O   1 
ATOM   2430 C  CB  . PRO A 1 319 ? 20.181 30.279 50.324  1.00 26.48 ? 320  PRO A CB  1 
ATOM   2431 C  CG  . PRO A 1 319 ? 19.567 29.074 49.676  1.00 26.55 ? 320  PRO A CG  1 
ATOM   2432 C  CD  . PRO A 1 319 ? 18.072 29.244 49.912  1.00 27.73 ? 320  PRO A CD  1 
ATOM   2433 N  N   . HIS A 1 320 ? 20.227 32.254 53.022  1.00 26.84 ? 321  HIS A N   1 
ATOM   2434 C  CA  . HIS A 1 320 ? 20.422 33.553 53.636  1.00 26.11 ? 321  HIS A CA  1 
ATOM   2435 C  C   . HIS A 1 320 ? 21.886 33.932 53.704  1.00 24.87 ? 321  HIS A C   1 
ATOM   2436 O  O   . HIS A 1 320 ? 22.766 33.092 53.612  1.00 26.03 ? 321  HIS A O   1 
ATOM   2437 C  CB  . HIS A 1 320 ? 19.807 33.528 55.062  1.00 27.64 ? 321  HIS A CB  1 
ATOM   2438 C  CG  . HIS A 1 320 ? 18.303 33.845 55.087  1.00 30.01 ? 321  HIS A CG  1 
ATOM   2439 N  ND1 . HIS A 1 320 ? 17.714 35.014 55.400  1.00 30.78 ? 321  HIS A ND1 1 
ATOM   2440 C  CD2 . HIS A 1 320 ? 17.300 32.970 54.719  1.00 29.87 ? 321  HIS A CD2 1 
ATOM   2441 C  CE1 . HIS A 1 320 ? 16.423 34.881 55.223  1.00 31.18 ? 321  HIS A CE1 1 
ATOM   2442 N  NE2 . HIS A 1 320 ? 16.187 33.649 54.811  1.00 30.53 ? 321  HIS A NE2 1 
ATOM   2443 N  N   . ILE A 1 321 ? 22.182 35.212 53.847  1.00 23.62 ? 322  ILE A N   1 
ATOM   2444 C  CA  . ILE A 1 321 ? 23.532 35.727 54.079  1.00 21.74 ? 322  ILE A CA  1 
ATOM   2445 C  C   . ILE A 1 321 ? 23.318 36.943 54.988  1.00 20.84 ? 322  ILE A C   1 
ATOM   2446 O  O   . ILE A 1 321 ? 22.485 37.783 54.672  1.00 20.33 ? 322  ILE A O   1 
ATOM   2447 C  CB  . ILE A 1 321 ? 24.189 36.093 52.708  1.00 21.89 ? 322  ILE A CB  1 
ATOM   2448 C  CG1 . ILE A 1 321 ? 25.637 36.623 52.916  1.00 19.50 ? 322  ILE A CG1 1 
ATOM   2449 C  CG2 . ILE A 1 321 ? 23.225 37.037 51.954  1.00 20.23 ? 322  ILE A CG2 1 
ATOM   2450 C  CD1 . ILE A 1 321 ? 26.370 36.765 51.585  1.00 19.11 ? 322  ILE A CD1 1 
ATOM   2451 N  N   . ASN A 1 322 ? 23.954 37.001 56.165  1.00 20.19 ? 323  ASN A N   1 
ATOM   2452 C  CA  . ASN A 1 322 ? 23.766 38.075 57.151  1.00 20.11 ? 323  ASN A CA  1 
ATOM   2453 C  C   . ASN A 1 322 ? 24.929 39.051 57.287  1.00 20.70 ? 323  ASN A C   1 
ATOM   2454 O  O   . ASN A 1 322 ? 26.103 38.752 57.051  1.00 20.96 ? 323  ASN A O   1 
ATOM   2455 C  CB  . ASN A 1 322 ? 23.462 37.495 58.574  1.00 18.26 ? 323  ASN A CB  1 
ATOM   2456 C  CG  . ASN A 1 322 ? 22.095 36.834 58.629  1.00 16.35 ? 323  ASN A CG  1 
ATOM   2457 O  OD1 . ASN A 1 322 ? 21.539 36.429 57.607  1.00 18.12 ? 323  ASN A OD1 1 
ATOM   2458 N  ND2 . ASN A 1 322 ? 21.431 36.708 59.761  1.00 14.13 ? 323  ASN A ND2 1 
ATOM   2459 N  N   . GLY A 1 323 ? 24.531 40.276 57.631  1.00 21.43 ? 324  GLY A N   1 
ATOM   2460 C  CA  . GLY A 1 323 ? 25.448 41.382 57.816  1.00 22.77 ? 324  GLY A CA  1 
ATOM   2461 C  C   . GLY A 1 323 ? 25.181 42.414 56.728  1.00 24.57 ? 324  GLY A C   1 
ATOM   2462 O  O   . GLY A 1 323 ? 24.196 42.259 55.990  1.00 24.44 ? 324  GLY A O   1 
ATOM   2463 N  N   . PRO A 1 324 ? 25.990 43.463 56.537  1.00 25.21 ? 325  PRO A N   1 
ATOM   2464 C  CA  . PRO A 1 324 ? 27.350 43.641 56.947  1.00 26.54 ? 325  PRO A CA  1 
ATOM   2465 C  C   . PRO A 1 324 ? 27.933 44.065 58.264  1.00 27.12 ? 325  PRO A C   1 
ATOM   2466 O  O   . PRO A 1 324 ? 29.158 44.079 58.195  1.00 29.52 ? 325  PRO A O   1 
ATOM   2467 C  CB  . PRO A 1 324 ? 27.900 44.527 55.870  1.00 27.22 ? 325  PRO A CB  1 
ATOM   2468 C  CG  . PRO A 1 324 ? 26.831 45.561 55.808  1.00 26.35 ? 325  PRO A CG  1 
ATOM   2469 C  CD  . PRO A 1 324 ? 25.668 44.578 55.670  1.00 26.31 ? 325  PRO A CD  1 
ATOM   2470 N  N   . PHE A 1 325 ? 27.450 44.478 59.425  1.00 26.53 ? 326  PHE A N   1 
ATOM   2471 C  CA  . PHE A 1 325 ? 28.419 44.649 60.525  1.00 25.65 ? 326  PHE A CA  1 
ATOM   2472 C  C   . PHE A 1 325 ? 27.833 44.123 61.838  1.00 25.97 ? 326  PHE A C   1 
ATOM   2473 O  O   . PHE A 1 325 ? 28.372 44.370 62.928  1.00 26.71 ? 326  PHE A O   1 
ATOM   2474 C  CB  . PHE A 1 325 ? 28.820 46.144 60.663  1.00 26.74 ? 326  PHE A CB  1 
ATOM   2475 C  CG  . PHE A 1 325 ? 29.790 46.741 59.632  1.00 26.75 ? 326  PHE A CG  1 
ATOM   2476 C  CD1 . PHE A 1 325 ? 29.355 47.077 58.337  1.00 26.47 ? 326  PHE A CD1 1 
ATOM   2477 C  CD2 . PHE A 1 325 ? 31.126 46.951 60.004  1.00 26.91 ? 326  PHE A CD2 1 
ATOM   2478 C  CE1 . PHE A 1 325 ? 30.244 47.614 57.427  1.00 25.35 ? 326  PHE A CE1 1 
ATOM   2479 C  CE2 . PHE A 1 325 ? 32.008 47.494 59.081  1.00 26.94 ? 326  PHE A CE2 1 
ATOM   2480 C  CZ  . PHE A 1 325 ? 31.562 47.822 57.803  1.00 26.54 ? 326  PHE A CZ  1 
ATOM   2481 N  N   . THR A 1 326 ? 26.729 43.359 61.672  1.00 24.42 ? 327  THR A N   1 
ATOM   2482 C  CA  . THR A 1 326 ? 25.964 42.678 62.714  1.00 24.86 ? 327  THR A CA  1 
ATOM   2483 C  C   . THR A 1 326 ? 25.521 41.366 62.080  1.00 24.81 ? 327  THR A C   1 
ATOM   2484 O  O   . THR A 1 326 ? 25.234 41.327 60.878  1.00 23.51 ? 327  THR A O   1 
ATOM   2485 C  CB  . THR A 1 326 ? 24.597 43.204 63.130  1.00 25.39 ? 327  THR A CB  1 
ATOM   2486 O  OG1 . THR A 1 326 ? 24.382 44.461 62.485  1.00 26.48 ? 327  THR A OG1 1 
ATOM   2487 C  CG2 . THR A 1 326 ? 24.482 43.236 64.635  1.00 24.49 ? 327  THR A CG2 1 
ATOM   2488 N  N   . PRO A 1 327 ? 25.446 40.264 62.841  1.00 24.45 ? 328  PRO A N   1 
ATOM   2489 C  CA  . PRO A 1 327 ? 24.988 39.001 62.300  1.00 24.43 ? 328  PRO A CA  1 
ATOM   2490 C  C   . PRO A 1 327 ? 23.470 38.836 62.313  1.00 24.73 ? 328  PRO A C   1 
ATOM   2491 O  O   . PRO A 1 327 ? 23.022 37.762 61.947  1.00 24.57 ? 328  PRO A O   1 
ATOM   2492 C  CB  . PRO A 1 327 ? 25.734 38.002 63.133  1.00 23.68 ? 328  PRO A CB  1 
ATOM   2493 C  CG  . PRO A 1 327 ? 25.815 38.649 64.489  1.00 23.65 ? 328  PRO A CG  1 
ATOM   2494 C  CD  . PRO A 1 327 ? 26.041 40.109 64.172  1.00 23.48 ? 328  PRO A CD  1 
ATOM   2495 N  N   . ASP A 1 328 ? 22.652 39.794 62.781  1.00 25.10 ? 329  ASP A N   1 
ATOM   2496 C  CA  . ASP A 1 328 ? 21.196 39.662 62.744  1.00 25.56 ? 329  ASP A CA  1 
ATOM   2497 C  C   . ASP A 1 328 ? 20.546 40.499 61.640  1.00 25.57 ? 329  ASP A C   1 
ATOM   2498 O  O   . ASP A 1 328 ? 19.319 40.651 61.629  1.00 25.27 ? 329  ASP A O   1 
ATOM   2499 C  CB  . ASP A 1 328 ? 20.603 40.069 64.098  1.00 25.32 ? 329  ASP A CB  1 
ATOM   2500 C  CG  . ASP A 1 328 ? 20.763 41.537 64.457  1.00 25.57 ? 329  ASP A CG  1 
ATOM   2501 O  OD1 . ASP A 1 328 ? 21.530 42.260 63.822  1.00 27.00 ? 329  ASP A OD1 1 
ATOM   2502 O  OD2 . ASP A 1 328 ? 20.122 41.972 65.399  1.00 24.96 ? 329  ASP A OD2 1 
ATOM   2503 N  N   . LEU A 1 329 ? 21.382 41.107 60.770  1.00 25.49 ? 330  LEU A N   1 
ATOM   2504 C  CA  . LEU A 1 329 ? 20.862 41.829 59.624  1.00 24.86 ? 330  LEU A CA  1 
ATOM   2505 C  C   . LEU A 1 329 ? 20.715 40.798 58.524  1.00 25.27 ? 330  LEU A C   1 
ATOM   2506 O  O   . LEU A 1 329 ? 21.659 40.597 57.769  1.00 25.91 ? 330  LEU A O   1 
ATOM   2507 C  CB  . LEU A 1 329 ? 21.829 42.901 59.165  1.00 25.27 ? 330  LEU A CB  1 
ATOM   2508 C  CG  . LEU A 1 329 ? 21.335 44.204 58.496  1.00 26.11 ? 330  LEU A CG  1 
ATOM   2509 C  CD1 . LEU A 1 329 ? 22.133 44.360 57.220  1.00 26.91 ? 330  LEU A CD1 1 
ATOM   2510 C  CD2 . LEU A 1 329 ? 19.844 44.205 58.174  1.00 23.83 ? 330  LEU A CD2 1 
ATOM   2511 N  N   . ALA A 1 330 ? 19.558 40.124 58.381  1.00 25.04 ? 331  ALA A N   1 
ATOM   2512 C  CA  . ALA A 1 330 ? 19.413 39.032 57.440  1.00 24.19 ? 331  ALA A CA  1 
ATOM   2513 C  C   . ALA A 1 330 ? 18.924 39.336 56.064  1.00 25.15 ? 331  ALA A C   1 
ATOM   2514 O  O   . ALA A 1 330 ? 17.933 40.035 55.922  1.00 26.37 ? 331  ALA A O   1 
ATOM   2515 C  CB  . ALA A 1 330 ? 18.494 38.012 58.057  1.00 24.42 ? 331  ALA A CB  1 
ATOM   2516 N  N   . HIS A 1 331 ? 19.563 38.876 55.002  1.00 25.30 ? 332  HIS A N   1 
ATOM   2517 C  CA  . HIS A 1 331 ? 18.979 39.072 53.670  1.00 26.41 ? 332  HIS A CA  1 
ATOM   2518 C  C   . HIS A 1 331 ? 18.862 37.671 53.095  1.00 27.97 ? 332  HIS A C   1 
ATOM   2519 O  O   . HIS A 1 331 ? 19.578 36.781 53.558  1.00 29.06 ? 332  HIS A O   1 
ATOM   2520 C  CB  . HIS A 1 331 ? 19.854 39.831 52.680  1.00 25.72 ? 332  HIS A CB  1 
ATOM   2521 C  CG  . HIS A 1 331 ? 20.409 41.023 53.372  1.00 25.57 ? 332  HIS A CG  1 
ATOM   2522 N  ND1 . HIS A 1 331 ? 19.743 42.081 53.787  1.00 25.10 ? 332  HIS A ND1 1 
ATOM   2523 C  CD2 . HIS A 1 331 ? 21.695 41.120 53.775  1.00 25.79 ? 332  HIS A CD2 1 
ATOM   2524 C  CE1 . HIS A 1 331 ? 20.571 42.832 54.449  1.00 24.96 ? 332  HIS A CE1 1 
ATOM   2525 N  NE2 . HIS A 1 331 ? 21.729 42.237 54.433  1.00 26.70 ? 332  HIS A NE2 1 
ATOM   2526 N  N   . PRO A 1 332 ? 17.997 37.362 52.122  1.00 28.17 ? 333  PRO A N   1 
ATOM   2527 C  CA  . PRO A 1 332 ? 18.154 36.150 51.312  1.00 27.61 ? 333  PRO A CA  1 
ATOM   2528 C  C   . PRO A 1 332 ? 19.169 36.346 50.223  1.00 27.45 ? 333  PRO A C   1 
ATOM   2529 O  O   . PRO A 1 332 ? 19.268 37.426 49.661  1.00 27.06 ? 333  PRO A O   1 
ATOM   2530 C  CB  . PRO A 1 332 ? 16.807 35.890 50.779  1.00 27.82 ? 333  PRO A CB  1 
ATOM   2531 C  CG  . PRO A 1 332 ? 15.945 36.558 51.844  1.00 28.32 ? 333  PRO A CG  1 
ATOM   2532 C  CD  . PRO A 1 332 ? 16.645 37.891 52.053  1.00 26.74 ? 333  PRO A CD  1 
ATOM   2533 N  N   . VAL A 1 333 ? 19.848 35.276 49.854  1.00 28.59 ? 334  VAL A N   1 
ATOM   2534 C  CA  . VAL A 1 333 ? 20.865 35.329 48.824  1.00 30.30 ? 334  VAL A CA  1 
ATOM   2535 C  C   . VAL A 1 333 ? 20.297 35.819 47.487  1.00 32.49 ? 334  VAL A C   1 
ATOM   2536 O  O   . VAL A 1 333 ? 21.046 36.324 46.661  1.00 32.59 ? 334  VAL A O   1 
ATOM   2537 C  CB  . VAL A 1 333 ? 21.500 33.908 48.744  1.00 29.06 ? 334  VAL A CB  1 
ATOM   2538 C  CG1 . VAL A 1 333 ? 22.536 33.839 47.636  1.00 26.54 ? 334  VAL A CG1 1 
ATOM   2539 C  CG2 . VAL A 1 333 ? 22.172 33.587 50.090  1.00 27.04 ? 334  VAL A CG2 1 
ATOM   2540 N  N   . ALA A 1 334 ? 18.972 35.730 47.300  1.00 34.65 ? 335  ALA A N   1 
ATOM   2541 C  CA  . ALA A 1 334 ? 18.257 36.254 46.138  1.00 36.78 ? 335  ALA A CA  1 
ATOM   2542 C  C   . ALA A 1 334 ? 18.184 37.789 45.995  1.00 38.54 ? 335  ALA A C   1 
ATOM   2543 O  O   . ALA A 1 334 ? 18.170 38.295 44.861  1.00 39.55 ? 335  ALA A O   1 
ATOM   2544 C  CB  . ALA A 1 334 ? 16.830 35.744 46.139  1.00 36.11 ? 335  ALA A CB  1 
ATOM   2545 N  N   . GLU A 1 335 ? 18.054 38.600 47.061  1.00 40.17 ? 336  GLU A N   1 
ATOM   2546 C  CA  . GLU A 1 335 ? 18.147 40.055 46.900  1.00 41.10 ? 336  GLU A CA  1 
ATOM   2547 C  C   . GLU A 1 335 ? 19.392 40.679 47.517  1.00 39.31 ? 336  GLU A C   1 
ATOM   2548 O  O   . GLU A 1 335 ? 19.496 41.910 47.443  1.00 39.48 ? 336  GLU A O   1 
ATOM   2549 C  CB  . GLU A 1 335 ? 16.987 40.866 47.522  1.00 43.88 ? 336  GLU A CB  1 
ATOM   2550 C  CG  . GLU A 1 335 ? 15.606 40.283 47.554  1.00 48.24 ? 336  GLU A CG  1 
ATOM   2551 C  CD  . GLU A 1 335 ? 15.475 39.521 48.850  1.00 50.87 ? 336  GLU A CD  1 
ATOM   2552 O  OE1 . GLU A 1 335 ? 15.273 40.175 49.887  1.00 51.23 ? 336  GLU A OE1 1 
ATOM   2553 O  OE2 . GLU A 1 335 ? 15.608 38.290 48.792  1.00 53.15 ? 336  GLU A OE2 1 
ATOM   2554 N  N   . VAL A 1 336 ? 20.308 39.931 48.159  1.00 36.86 ? 337  VAL A N   1 
ATOM   2555 C  CA  . VAL A 1 336 ? 21.493 40.583 48.706  1.00 35.05 ? 337  VAL A CA  1 
ATOM   2556 C  C   . VAL A 1 336 ? 22.253 41.426 47.651  1.00 34.20 ? 337  VAL A C   1 
ATOM   2557 O  O   . VAL A 1 336 ? 22.637 42.551 47.984  1.00 31.62 ? 337  VAL A O   1 
ATOM   2558 C  CB  . VAL A 1 336 ? 22.434 39.515 49.373  1.00 34.26 ? 337  VAL A CB  1 
ATOM   2559 C  CG1 . VAL A 1 336 ? 23.179 38.612 48.379  1.00 32.94 ? 337  VAL A CG1 1 
ATOM   2560 C  CG2 . VAL A 1 336 ? 23.376 40.327 50.266  1.00 33.79 ? 337  VAL A CG2 1 
ATOM   2561 N  N   . GLY A 1 337 ? 22.302 40.974 46.373  1.00 34.11 ? 338  GLY A N   1 
ATOM   2562 C  CA  . GLY A 1 337 ? 22.944 41.684 45.279  1.00 34.93 ? 338  GLY A CA  1 
ATOM   2563 C  C   . GLY A 1 337 ? 22.302 43.043 44.976  1.00 36.49 ? 338  GLY A C   1 
ATOM   2564 O  O   . GLY A 1 337 ? 22.964 43.963 44.498  1.00 36.35 ? 338  GLY A O   1 
ATOM   2565 N  N   . SER A 1 338 ? 21.009 43.208 45.282  1.00 38.03 ? 339  SER A N   1 
ATOM   2566 C  CA  . SER A 1 338 ? 20.293 44.450 45.092  1.00 39.56 ? 339  SER A CA  1 
ATOM   2567 C  C   . SER A 1 338 ? 20.368 45.384 46.268  1.00 40.66 ? 339  SER A C   1 
ATOM   2568 O  O   . SER A 1 338 ? 20.435 46.590 46.003  1.00 42.05 ? 339  SER A O   1 
ATOM   2569 C  CB  . SER A 1 338 ? 18.835 44.205 44.826  1.00 39.98 ? 339  SER A CB  1 
ATOM   2570 O  OG  . SER A 1 338 ? 18.805 43.334 43.698  1.00 43.05 ? 339  SER A OG  1 
ATOM   2571 N  N   . VAL A 1 339 ? 20.340 44.854 47.522  1.00 41.30 ? 340  VAL A N   1 
ATOM   2572 C  CA  . VAL A 1 339 ? 20.392 45.657 48.737  1.00 41.29 ? 340  VAL A CA  1 
ATOM   2573 C  C   . VAL A 1 339 ? 21.788 46.231 48.904  1.00 42.96 ? 340  VAL A C   1 
ATOM   2574 O  O   . VAL A 1 339 ? 21.860 47.339 49.413  1.00 43.46 ? 340  VAL A O   1 
ATOM   2575 C  CB  . VAL A 1 339 ? 20.002 44.802 49.968  1.00 39.69 ? 340  VAL A CB  1 
ATOM   2576 C  CG1 . VAL A 1 339 ? 20.114 45.555 51.277  1.00 38.49 ? 340  VAL A CG1 1 
ATOM   2577 C  CG2 . VAL A 1 339 ? 18.537 44.476 49.855  1.00 39.07 ? 340  VAL A CG2 1 
ATOM   2578 N  N   . ALA A 1 340 ? 22.887 45.546 48.501  1.00 44.81 ? 341  ALA A N   1 
ATOM   2579 C  CA  . ALA A 1 340 ? 24.275 46.061 48.534  1.00 46.23 ? 341  ALA A CA  1 
ATOM   2580 C  C   . ALA A 1 340 ? 24.456 47.246 47.602  1.00 47.21 ? 341  ALA A C   1 
ATOM   2581 O  O   . ALA A 1 340 ? 24.962 48.289 47.977  1.00 47.24 ? 341  ALA A O   1 
ATOM   2582 C  CB  . ALA A 1 340 ? 25.288 44.977 48.102  1.00 45.95 ? 341  ALA A CB  1 
ATOM   2583 N  N   . GLU A 1 341 ? 23.972 47.059 46.377  1.00 48.96 ? 342  GLU A N   1 
ATOM   2584 C  CA  . GLU A 1 341 ? 23.907 48.071 45.318  1.00 50.80 ? 342  GLU A CA  1 
ATOM   2585 C  C   . GLU A 1 341 ? 23.270 49.431 45.700  1.00 50.69 ? 342  GLU A C   1 
ATOM   2586 O  O   . GLU A 1 341 ? 23.844 50.518 45.544  1.00 49.73 ? 342  GLU A O   1 
ATOM   2587 C  CB  . GLU A 1 341 ? 23.173 47.364 44.248  1.00 52.29 ? 342  GLU A CB  1 
ATOM   2588 C  CG  . GLU A 1 341 ? 22.809 48.176 43.080  1.00 54.98 ? 342  GLU A CG  1 
ATOM   2589 C  CD  . GLU A 1 341 ? 22.909 47.266 41.911  1.00 56.85 ? 342  GLU A CD  1 
ATOM   2590 O  OE1 . GLU A 1 341 ? 24.057 47.010 41.532  1.00 57.90 ? 342  GLU A OE1 1 
ATOM   2591 O  OE2 . GLU A 1 341 ? 21.854 46.815 41.449  1.00 57.89 ? 342  GLU A OE2 1 
ATOM   2592 N  N   . LYS A 1 342 ? 22.038 49.288 46.212  1.00 50.98 ? 343  LYS A N   1 
ATOM   2593 C  CA  . LYS A 1 342 ? 21.292 50.363 46.835  1.00 50.95 ? 343  LYS A CA  1 
ATOM   2594 C  C   . LYS A 1 342 ? 22.095 50.919 48.034  1.00 50.38 ? 343  LYS A C   1 
ATOM   2595 O  O   . LYS A 1 342 ? 22.432 52.105 48.017  1.00 50.30 ? 343  LYS A O   1 
ATOM   2596 C  CB  . LYS A 1 342 ? 19.936 49.763 47.235  1.00 51.65 ? 343  LYS A CB  1 
ATOM   2597 C  CG  . LYS A 1 342 ? 19.096 50.484 48.283  1.00 53.90 ? 343  LYS A CG  1 
ATOM   2598 C  CD  . LYS A 1 342 ? 18.065 49.490 48.822  1.00 55.78 ? 343  LYS A CD  1 
ATOM   2599 C  CE  . LYS A 1 342 ? 17.373 49.862 50.153  1.00 56.71 ? 343  LYS A CE  1 
ATOM   2600 N  NZ  . LYS A 1 342 ? 18.242 49.669 51.304  1.00 56.85 ? 343  LYS A NZ  1 
ATOM   2601 N  N   . GLU A 1 343 ? 22.510 50.080 49.018  1.00 49.94 ? 344  GLU A N   1 
ATOM   2602 C  CA  . GLU A 1 343 ? 23.173 50.497 50.265  1.00 48.30 ? 344  GLU A CA  1 
ATOM   2603 C  C   . GLU A 1 343 ? 24.651 50.889 50.250  1.00 46.25 ? 344  GLU A C   1 
ATOM   2604 O  O   . GLU A 1 343 ? 25.194 51.302 51.283  1.00 46.05 ? 344  GLU A O   1 
ATOM   2605 C  CB  . GLU A 1 343 ? 23.013 49.421 51.309  1.00 49.26 ? 344  GLU A CB  1 
ATOM   2606 C  CG  . GLU A 1 343 ? 22.487 49.957 52.608  1.00 53.24 ? 344  GLU A CG  1 
ATOM   2607 C  CD  . GLU A 1 343 ? 20.989 50.106 52.670  1.00 55.59 ? 344  GLU A CD  1 
ATOM   2608 O  OE1 . GLU A 1 343 ? 20.521 51.174 52.271  1.00 57.28 ? 344  GLU A OE1 1 
ATOM   2609 O  OE2 . GLU A 1 343 ? 20.326 49.157 53.117  1.00 57.66 ? 344  GLU A OE2 1 
ATOM   2610 N  N   . GLY A 1 344 ? 25.310 50.812 49.084  1.00 43.98 ? 345  GLY A N   1 
ATOM   2611 C  CA  . GLY A 1 344 ? 26.687 51.236 48.948  1.00 40.97 ? 345  GLY A CA  1 
ATOM   2612 C  C   . GLY A 1 344 ? 27.687 50.268 49.559  1.00 39.46 ? 345  GLY A C   1 
ATOM   2613 O  O   . GLY A 1 344 ? 28.773 50.707 49.959  1.00 39.33 ? 345  GLY A O   1 
ATOM   2614 N  N   . TRP A 1 345 ? 27.305 48.979 49.612  1.00 36.63 ? 346  TRP A N   1 
ATOM   2615 C  CA  . TRP A 1 345 ? 28.190 47.927 50.056  1.00 35.30 ? 346  TRP A CA  1 
ATOM   2616 C  C   . TRP A 1 345 ? 28.930 47.408 48.808  1.00 34.09 ? 346  TRP A C   1 
ATOM   2617 O  O   . TRP A 1 345 ? 28.285 47.178 47.783  1.00 35.13 ? 346  TRP A O   1 
ATOM   2618 C  CB  . TRP A 1 345 ? 27.401 46.777 50.706  1.00 33.94 ? 346  TRP A CB  1 
ATOM   2619 C  CG  . TRP A 1 345 ? 26.515 47.159 51.883  1.00 31.76 ? 346  TRP A CG  1 
ATOM   2620 C  CD1 . TRP A 1 345 ? 26.743 48.248 52.703  1.00 30.21 ? 346  TRP A CD1 1 
ATOM   2621 C  CD2 . TRP A 1 345 ? 25.401 46.451 52.230  1.00 30.44 ? 346  TRP A CD2 1 
ATOM   2622 N  NE1 . TRP A 1 345 ? 25.769 48.242 53.567  1.00 28.65 ? 346  TRP A NE1 1 
ATOM   2623 C  CE2 . TRP A 1 345 ? 24.942 47.193 53.330  1.00 29.63 ? 346  TRP A CE2 1 
ATOM   2624 C  CE3 . TRP A 1 345 ? 24.722 45.310 51.798  1.00 29.87 ? 346  TRP A CE3 1 
ATOM   2625 C  CZ2 . TRP A 1 345 ? 23.776 46.789 53.998  1.00 28.77 ? 346  TRP A CZ2 1 
ATOM   2626 C  CZ3 . TRP A 1 345 ? 23.567 44.911 52.474  1.00 29.03 ? 346  TRP A CZ3 1 
ATOM   2627 C  CH2 . TRP A 1 345 ? 23.098 45.647 53.559  1.00 28.86 ? 346  TRP A CH2 1 
ATOM   2628 N  N   . PRO A 1 346 ? 30.260 47.209 48.811  1.00 32.40 ? 347  PRO A N   1 
ATOM   2629 C  CA  . PRO A 1 346 ? 31.065 46.756 47.669  1.00 30.99 ? 347  PRO A CA  1 
ATOM   2630 C  C   . PRO A 1 346 ? 30.564 45.468 47.036  1.00 30.61 ? 347  PRO A C   1 
ATOM   2631 O  O   . PRO A 1 346 ? 30.337 44.489 47.760  1.00 30.76 ? 347  PRO A O   1 
ATOM   2632 C  CB  . PRO A 1 346 ? 32.447 46.617 48.254  1.00 30.57 ? 347  PRO A CB  1 
ATOM   2633 C  CG  . PRO A 1 346 ? 32.509 47.535 49.437  1.00 30.03 ? 347  PRO A CG  1 
ATOM   2634 C  CD  . PRO A 1 346 ? 31.109 47.396 49.999  1.00 32.01 ? 347  PRO A CD  1 
ATOM   2635 N  N   . LEU A 1 347 ? 30.376 45.398 45.720  1.00 30.22 ? 348  LEU A N   1 
ATOM   2636 C  CA  . LEU A 1 347 ? 29.852 44.150 45.147  1.00 30.12 ? 348  LEU A CA  1 
ATOM   2637 C  C   . LEU A 1 347 ? 30.817 43.009 44.825  1.00 30.76 ? 348  LEU A C   1 
ATOM   2638 O  O   . LEU A 1 347 ? 30.457 41.835 44.877  1.00 30.51 ? 348  LEU A O   1 
ATOM   2639 C  CB  . LEU A 1 347 ? 29.027 44.455 43.870  1.00 27.98 ? 348  LEU A CB  1 
ATOM   2640 C  CG  . LEU A 1 347 ? 27.533 44.878 44.011  1.00 26.95 ? 348  LEU A CG  1 
ATOM   2641 C  CD1 . LEU A 1 347 ? 26.765 43.794 44.806  1.00 25.32 ? 348  LEU A CD1 1 
ATOM   2642 C  CD2 . LEU A 1 347 ? 27.442 46.274 44.633  1.00 24.49 ? 348  LEU A CD2 1 
ATOM   2643 N  N   . ASP A 1 348 ? 32.078 43.333 44.569  1.00 31.53 ? 349  ASP A N   1 
ATOM   2644 C  CA  . ASP A 1 348 ? 33.067 42.351 44.217  1.00 32.09 ? 349  ASP A CA  1 
ATOM   2645 C  C   . ASP A 1 348 ? 33.683 41.769 45.477  1.00 30.89 ? 349  ASP A C   1 
ATOM   2646 O  O   . ASP A 1 348 ? 34.006 42.493 46.431  1.00 30.35 ? 349  ASP A O   1 
ATOM   2647 C  CB  . ASP A 1 348 ? 34.089 43.045 43.315  1.00 35.49 ? 349  ASP A CB  1 
ATOM   2648 C  CG  . ASP A 1 348 ? 34.820 44.244 43.938  1.00 38.55 ? 349  ASP A CG  1 
ATOM   2649 O  OD1 . ASP A 1 348 ? 34.193 45.269 44.268  1.00 39.44 ? 349  ASP A OD1 1 
ATOM   2650 O  OD2 . ASP A 1 348 ? 36.039 44.117 44.105  1.00 40.98 ? 349  ASP A OD2 1 
ATOM   2651 N  N   . ILE A 1 349 ? 33.770 40.427 45.422  1.00 29.73 ? 350  ILE A N   1 
ATOM   2652 C  CA  . ILE A 1 349 ? 34.275 39.608 46.525  1.00 28.87 ? 350  ILE A CA  1 
ATOM   2653 C  C   . ILE A 1 349 ? 35.753 39.287 46.326  1.00 28.92 ? 350  ILE A C   1 
ATOM   2654 O  O   . ILE A 1 349 ? 36.193 38.708 45.335  1.00 28.92 ? 350  ILE A O   1 
ATOM   2655 C  CB  . ILE A 1 349 ? 33.461 38.276 46.665  1.00 27.46 ? 350  ILE A CB  1 
ATOM   2656 C  CG1 . ILE A 1 349 ? 31.982 38.538 46.828  1.00 25.57 ? 350  ILE A CG1 1 
ATOM   2657 C  CG2 . ILE A 1 349 ? 33.861 37.558 47.952  1.00 27.51 ? 350  ILE A CG2 1 
ATOM   2658 C  CD1 . ILE A 1 349 ? 31.155 37.273 46.607  1.00 24.26 ? 350  ILE A CD1 1 
ATOM   2659 N  N   . ARG A 1 350 ? 36.501 39.665 47.361  1.00 29.14 ? 351  ARG A N   1 
ATOM   2660 C  CA  . ARG A 1 350 ? 37.943 39.586 47.334  1.00 28.93 ? 351  ARG A CA  1 
ATOM   2661 C  C   . ARG A 1 350 ? 38.377 38.257 47.879  1.00 27.29 ? 351  ARG A C   1 
ATOM   2662 O  O   . ARG A 1 350 ? 39.230 37.649 47.236  1.00 26.64 ? 351  ARG A O   1 
ATOM   2663 C  CB  . ARG A 1 350 ? 38.586 40.696 48.168  1.00 31.30 ? 351  ARG A CB  1 
ATOM   2664 C  CG  . ARG A 1 350 ? 38.244 42.133 47.794  1.00 36.21 ? 351  ARG A CG  1 
ATOM   2665 C  CD  . ARG A 1 350 ? 38.732 42.613 46.416  1.00 41.38 ? 351  ARG A CD  1 
ATOM   2666 N  NE  . ARG A 1 350 ? 39.455 43.876 46.615  1.00 47.56 ? 351  ARG A NE  1 
ATOM   2667 C  CZ  . ARG A 1 350 ? 38.919 45.093 46.481  1.00 49.65 ? 351  ARG A CZ  1 
ATOM   2668 N  NH1 . ARG A 1 350 ? 37.700 45.274 46.013  1.00 51.90 ? 351  ARG A NH1 1 
ATOM   2669 N  NH2 . ARG A 1 350 ? 39.640 46.158 46.767  1.00 51.18 ? 351  ARG A NH2 1 
ATOM   2670 N  N   . VAL A 1 351 ? 37.800 37.812 49.017  1.00 25.27 ? 352  VAL A N   1 
ATOM   2671 C  CA  . VAL A 1 351 ? 38.153 36.537 49.609  1.00 23.23 ? 352  VAL A CA  1 
ATOM   2672 C  C   . VAL A 1 351 ? 36.830 35.922 50.074  1.00 23.46 ? 352  VAL A C   1 
ATOM   2673 O  O   . VAL A 1 351 ? 35.882 36.605 50.486  1.00 23.35 ? 352  VAL A O   1 
ATOM   2674 C  CB  . VAL A 1 351 ? 39.072 36.623 50.867  1.00 21.69 ? 352  VAL A CB  1 
ATOM   2675 C  CG1 . VAL A 1 351 ? 39.633 35.265 51.077  1.00 19.28 ? 352  VAL A CG1 1 
ATOM   2676 C  CG2 . VAL A 1 351 ? 40.229 37.574 50.726  1.00 20.84 ? 352  VAL A CG2 1 
ATOM   2677 N  N   . GLY A 1 352 ? 36.825 34.571 49.984  1.00 23.46 ? 353  GLY A N   1 
ATOM   2678 C  CA  . GLY A 1 352 ? 35.778 33.654 50.439  1.00 21.18 ? 353  GLY A CA  1 
ATOM   2679 C  C   . GLY A 1 352 ? 36.469 32.732 51.421  1.00 20.22 ? 353  GLY A C   1 
ATOM   2680 O  O   . GLY A 1 352 ? 37.528 32.166 51.110  1.00 18.89 ? 353  GLY A O   1 
ATOM   2681 N  N   . LEU A 1 353 ? 35.877 32.650 52.620  1.00 19.01 ? 354  LEU A N   1 
ATOM   2682 C  CA  . LEU A 1 353 ? 36.446 31.869 53.703  1.00 19.15 ? 354  LEU A CA  1 
ATOM   2683 C  C   . LEU A 1 353 ? 35.576 30.809 54.419  1.00 18.61 ? 354  LEU A C   1 
ATOM   2684 O  O   . LEU A 1 353 ? 34.810 31.177 55.308  1.00 18.31 ? 354  LEU A O   1 
ATOM   2685 C  CB  . LEU A 1 353 ? 37.002 32.861 54.751  1.00 19.70 ? 354  LEU A CB  1 
ATOM   2686 C  CG  . LEU A 1 353 ? 38.053 33.930 54.363  1.00 20.93 ? 354  LEU A CG  1 
ATOM   2687 C  CD1 . LEU A 1 353 ? 37.471 35.352 54.354  1.00 21.61 ? 354  LEU A CD1 1 
ATOM   2688 C  CD2 . LEU A 1 353 ? 39.130 33.957 55.439  1.00 21.07 ? 354  LEU A CD2 1 
ATOM   2689 N  N   . ILE A 1 354 ? 35.712 29.482 54.155  1.00 17.55 ? 355  ILE A N   1 
ATOM   2690 C  CA  . ILE A 1 354 ? 34.916 28.453 54.845  1.00 17.25 ? 355  ILE A CA  1 
ATOM   2691 C  C   . ILE A 1 354 ? 35.691 27.915 56.027  1.00 17.24 ? 355  ILE A C   1 
ATOM   2692 O  O   . ILE A 1 354 ? 36.894 27.743 55.984  1.00 17.36 ? 355  ILE A O   1 
ATOM   2693 C  CB  . ILE A 1 354 ? 34.488 27.246 53.923  1.00 16.26 ? 355  ILE A CB  1 
ATOM   2694 C  CG1 . ILE A 1 354 ? 35.578 26.475 53.260  1.00 16.61 ? 355  ILE A CG1 1 
ATOM   2695 C  CG2 . ILE A 1 354 ? 33.664 27.893 52.833  1.00 15.21 ? 355  ILE A CG2 1 
ATOM   2696 C  CD1 . ILE A 1 354 ? 35.185 25.723 51.955  1.00 16.26 ? 355  ILE A CD1 1 
ATOM   2697 N  N   . GLY A 1 355 ? 35.022 27.744 57.160  1.00 17.93 ? 356  GLY A N   1 
ATOM   2698 C  CA  . GLY A 1 355 ? 35.704 27.384 58.366  1.00 17.31 ? 356  GLY A CA  1 
ATOM   2699 C  C   . GLY A 1 355 ? 34.930 27.832 59.572  1.00 18.15 ? 356  GLY A C   1 
ATOM   2700 O  O   . GLY A 1 355 ? 33.714 28.053 59.529  1.00 18.20 ? 356  GLY A O   1 
ATOM   2701 N  N   . SER A 1 356 ? 35.734 27.987 60.637  1.00 18.94 ? 357  SER A N   1 
ATOM   2702 C  CA  . SER A 1 356 ? 35.360 28.263 62.038  1.00 19.66 ? 357  SER A CA  1 
ATOM   2703 C  C   . SER A 1 356 ? 34.493 27.166 62.661  1.00 20.91 ? 357  SER A C   1 
ATOM   2704 O  O   . SER A 1 356 ? 33.985 26.261 61.984  1.00 21.97 ? 357  SER A O   1 
ATOM   2705 C  CB  . SER A 1 356 ? 34.599 29.589 62.220  1.00 19.40 ? 357  SER A CB  1 
ATOM   2706 O  OG  . SER A 1 356 ? 33.205 29.656 61.906  1.00 19.55 ? 357  SER A OG  1 
ATOM   2707 N  N   . CYS A 1 357 ? 34.407 27.209 63.990  1.00 20.52 ? 358  CYS A N   1 
ATOM   2708 C  CA  . CYS A 1 357 ? 33.664 26.205 64.681  1.00 21.38 ? 358  CYS A CA  1 
ATOM   2709 C  C   . CYS A 1 357 ? 32.192 26.077 64.301  1.00 21.09 ? 358  CYS A C   1 
ATOM   2710 O  O   . CYS A 1 357 ? 31.677 24.985 64.536  1.00 22.65 ? 358  CYS A O   1 
ATOM   2711 C  CB  . CYS A 1 357 ? 33.821 26.458 66.194  1.00 23.09 ? 358  CYS A CB  1 
ATOM   2712 S  SG  . CYS A 1 357 ? 33.352 28.118 66.831  1.00 25.70 ? 358  CYS A SG  1 
ATOM   2713 N  N   . THR A 1 358 ? 31.575 27.067 63.621  1.00 19.58 ? 359  THR A N   1 
ATOM   2714 C  CA  . THR A 1 358 ? 30.190 27.034 63.182  1.00 19.07 ? 359  THR A CA  1 
ATOM   2715 C  C   . THR A 1 358 ? 30.039 26.209 61.925  1.00 18.74 ? 359  THR A C   1 
ATOM   2716 O  O   . THR A 1 358 ? 28.980 25.659 61.703  1.00 19.54 ? 359  THR A O   1 
ATOM   2717 C  CB  . THR A 1 358 ? 29.646 28.446 62.849  1.00 19.48 ? 359  THR A CB  1 
ATOM   2718 O  OG1 . THR A 1 358 ? 30.030 29.285 63.937  1.00 20.35 ? 359  THR A OG1 1 
ATOM   2719 C  CG2 . THR A 1 358 ? 28.124 28.540 62.752  1.00 17.83 ? 359  THR A CG2 1 
ATOM   2720 N  N   . ASN A 1 359 ? 31.045 26.073 61.065  1.00 18.63 ? 360  ASN A N   1 
ATOM   2721 C  CA  . ASN A 1 359 ? 30.903 25.379 59.809  1.00 17.29 ? 360  ASN A CA  1 
ATOM   2722 C  C   . ASN A 1 359 ? 32.189 24.769 59.326  1.00 17.69 ? 360  ASN A C   1 
ATOM   2723 O  O   . ASN A 1 359 ? 32.651 25.035 58.210  1.00 17.16 ? 360  ASN A O   1 
ATOM   2724 C  CB  . ASN A 1 359 ? 30.370 26.331 58.735  1.00 16.61 ? 360  ASN A CB  1 
ATOM   2725 C  CG  . ASN A 1 359 ? 28.845 26.491 58.705  1.00 15.36 ? 360  ASN A CG  1 
ATOM   2726 O  OD1 . ASN A 1 359 ? 28.329 27.534 59.058  1.00 14.55 ? 360  ASN A OD1 1 
ATOM   2727 N  ND2 . ASN A 1 359 ? 28.054 25.525 58.248  1.00 13.15 ? 360  ASN A ND2 1 
ATOM   2728 N  N   . SER A 1 360 ? 32.759 23.893 60.167  1.00 18.39 ? 361  SER A N   1 
ATOM   2729 C  CA  . SER A 1 360 ? 34.007 23.236 59.777  1.00 19.66 ? 361  SER A CA  1 
ATOM   2730 C  C   . SER A 1 360 ? 34.044 21.702 59.722  1.00 20.22 ? 361  SER A C   1 
ATOM   2731 O  O   . SER A 1 360 ? 35.149 21.134 59.733  1.00 21.30 ? 361  SER A O   1 
ATOM   2732 C  CB  . SER A 1 360 ? 35.129 23.713 60.691  1.00 18.31 ? 361  SER A CB  1 
ATOM   2733 O  OG  . SER A 1 360 ? 34.782 23.701 62.071  1.00 19.08 ? 361  SER A OG  1 
ATOM   2734 N  N   . SER A 1 361 ? 32.888 21.054 59.463  1.00 19.69 ? 362  SER A N   1 
ATOM   2735 C  CA  . SER A 1 361 ? 32.789 19.614 59.551  1.00 19.14 ? 362  SER A CA  1 
ATOM   2736 C  C   . SER A 1 361 ? 32.919 18.865 58.291  1.00 19.69 ? 362  SER A C   1 
ATOM   2737 O  O   . SER A 1 361 ? 32.837 19.462 57.240  1.00 20.75 ? 362  SER A O   1 
ATOM   2738 C  CB  . SER A 1 361 ? 31.488 19.189 60.143  1.00 18.37 ? 362  SER A CB  1 
ATOM   2739 O  OG  . SER A 1 361 ? 30.375 19.529 59.327  1.00 19.51 ? 362  SER A OG  1 
ATOM   2740 N  N   . TYR A 1 362 ? 33.077 17.544 58.404  1.00 21.33 ? 363  TYR A N   1 
ATOM   2741 C  CA  . TYR A 1 362 ? 33.086 16.628 57.250  1.00 22.11 ? 363  TYR A CA  1 
ATOM   2742 C  C   . TYR A 1 362 ? 31.935 16.933 56.249  1.00 22.26 ? 363  TYR A C   1 
ATOM   2743 O  O   . TYR A 1 362 ? 32.191 16.948 55.043  1.00 21.27 ? 363  TYR A O   1 
ATOM   2744 C  CB  . TYR A 1 362 ? 32.975 15.172 57.819  1.00 22.55 ? 363  TYR A CB  1 
ATOM   2745 C  CG  . TYR A 1 362 ? 33.101 14.078 56.761  1.00 24.56 ? 363  TYR A CG  1 
ATOM   2746 C  CD1 . TYR A 1 362 ? 31.995 13.688 55.981  1.00 24.07 ? 363  TYR A CD1 1 
ATOM   2747 C  CD2 . TYR A 1 362 ? 34.366 13.556 56.492  1.00 24.42 ? 363  TYR A CD2 1 
ATOM   2748 C  CE1 . TYR A 1 362 ? 32.170 12.802 54.923  1.00 24.69 ? 363  TYR A CE1 1 
ATOM   2749 C  CE2 . TYR A 1 362 ? 34.538 12.667 55.431  1.00 25.07 ? 363  TYR A CE2 1 
ATOM   2750 C  CZ  . TYR A 1 362 ? 33.444 12.308 54.646  1.00 25.94 ? 363  TYR A CZ  1 
ATOM   2751 O  OH  . TYR A 1 362 ? 33.630 11.526 53.509  1.00 27.97 ? 363  TYR A OH  1 
ATOM   2752 N  N   . GLU A 1 363 ? 30.673 17.152 56.744  1.00 21.90 ? 364  GLU A N   1 
ATOM   2753 C  CA  . GLU A 1 363 ? 29.513 17.458 55.918  1.00 22.16 ? 364  GLU A CA  1 
ATOM   2754 C  C   . GLU A 1 363 ? 29.667 18.792 55.243  1.00 21.86 ? 364  GLU A C   1 
ATOM   2755 O  O   . GLU A 1 363 ? 29.425 18.886 54.046  1.00 22.13 ? 364  GLU A O   1 
ATOM   2756 C  CB  . GLU A 1 363 ? 28.216 17.498 56.729  1.00 22.76 ? 364  GLU A CB  1 
ATOM   2757 C  CG  . GLU A 1 363 ? 27.013 17.657 55.811  1.00 23.36 ? 364  GLU A CG  1 
ATOM   2758 C  CD  . GLU A 1 363 ? 25.620 17.517 56.444  1.00 25.86 ? 364  GLU A CD  1 
ATOM   2759 O  OE1 . GLU A 1 363 ? 25.451 17.859 57.600  1.00 26.63 ? 364  GLU A OE1 1 
ATOM   2760 O  OE2 . GLU A 1 363 ? 24.672 17.076 55.782  1.00 28.51 ? 364  GLU A OE2 1 
ATOM   2761 N  N   . ASP A 1 364 ? 30.054 19.816 55.994  1.00 21.53 ? 365  ASP A N   1 
ATOM   2762 C  CA  . ASP A 1 364 ? 30.343 21.117 55.407  1.00 22.13 ? 365  ASP A CA  1 
ATOM   2763 C  C   . ASP A 1 364 ? 31.418 21.132 54.322  1.00 21.45 ? 365  ASP A C   1 
ATOM   2764 O  O   . ASP A 1 364 ? 31.250 21.750 53.286  1.00 21.02 ? 365  ASP A O   1 
ATOM   2765 C  CB  . ASP A 1 364 ? 30.725 22.052 56.537  1.00 23.52 ? 365  ASP A CB  1 
ATOM   2766 C  CG  . ASP A 1 364 ? 29.619 22.358 57.558  1.00 24.02 ? 365  ASP A CG  1 
ATOM   2767 O  OD1 . ASP A 1 364 ? 28.472 22.651 57.191  1.00 24.52 ? 365  ASP A OD1 1 
ATOM   2768 O  OD2 . ASP A 1 364 ? 29.928 22.314 58.747  1.00 25.27 ? 365  ASP A OD2 1 
ATOM   2769 N  N   . MET A 1 365 ? 32.547 20.485 54.518  1.00 22.16 ? 366  MET A N   1 
ATOM   2770 C  CA  . MET A 1 365 ? 33.569 20.315 53.497  1.00 23.93 ? 366  MET A CA  1 
ATOM   2771 C  C   . MET A 1 365 ? 33.046 19.515 52.303  1.00 24.64 ? 366  MET A C   1 
ATOM   2772 O  O   . MET A 1 365 ? 33.476 19.792 51.190  1.00 24.44 ? 366  MET A O   1 
ATOM   2773 C  CB  . MET A 1 365 ? 34.764 19.566 54.044  1.00 24.03 ? 366  MET A CB  1 
ATOM   2774 C  CG  . MET A 1 365 ? 35.461 20.213 55.242  1.00 27.36 ? 366  MET A CG  1 
ATOM   2775 S  SD  . MET A 1 365 ? 36.204 21.842 54.849  1.00 29.65 ? 366  MET A SD  1 
ATOM   2776 C  CE  . MET A 1 365 ? 35.165 22.939 55.785  1.00 28.57 ? 366  MET A CE  1 
ATOM   2777 N  N   . GLY A 1 366 ? 32.160 18.516 52.452  1.00 25.66 ? 367  GLY A N   1 
ATOM   2778 C  CA  . GLY A 1 366 ? 31.712 17.704 51.336  1.00 27.63 ? 367  GLY A CA  1 
ATOM   2779 C  C   . GLY A 1 366 ? 30.677 18.409 50.465  1.00 29.46 ? 367  GLY A C   1 
ATOM   2780 O  O   . GLY A 1 366 ? 30.681 18.245 49.237  1.00 29.68 ? 367  GLY A O   1 
ATOM   2781 N  N   . ARG A 1 367 ? 29.753 19.160 51.115  1.00 30.02 ? 368  ARG A N   1 
ATOM   2782 C  CA  . ARG A 1 367 ? 28.732 19.928 50.422  1.00 29.98 ? 368  ARG A CA  1 
ATOM   2783 C  C   . ARG A 1 367 ? 29.506 20.987 49.649  1.00 29.00 ? 368  ARG A C   1 
ATOM   2784 O  O   . ARG A 1 367 ? 29.186 21.198 48.483  1.00 29.11 ? 368  ARG A O   1 
ATOM   2785 C  CB  . ARG A 1 367 ? 27.748 20.537 51.442  1.00 31.59 ? 368  ARG A CB  1 
ATOM   2786 C  CG  . ARG A 1 367 ? 26.721 19.486 51.926  1.00 34.21 ? 368  ARG A CG  1 
ATOM   2787 C  CD  . ARG A 1 367 ? 25.518 19.946 52.788  1.00 37.22 ? 368  ARG A CD  1 
ATOM   2788 N  NE  . ARG A 1 367 ? 24.787 21.125 52.281  1.00 40.97 ? 368  ARG A NE  1 
ATOM   2789 C  CZ  . ARG A 1 367 ? 23.725 21.105 51.456  1.00 41.89 ? 368  ARG A CZ  1 
ATOM   2790 N  NH1 . ARG A 1 367 ? 23.285 19.969 50.949  1.00 42.80 ? 368  ARG A NH1 1 
ATOM   2791 N  NH2 . ARG A 1 367 ? 23.118 22.244 51.066  1.00 42.10 ? 368  ARG A NH2 1 
ATOM   2792 N  N   . SER A 1 368 ? 30.523 21.626 50.258  1.00 27.45 ? 369  SER A N   1 
ATOM   2793 C  CA  . SER A 1 368 ? 31.430 22.526 49.563  1.00 26.39 ? 369  SER A CA  1 
ATOM   2794 C  C   . SER A 1 368 ? 32.120 21.935 48.345  1.00 26.02 ? 369  SER A C   1 
ATOM   2795 O  O   . SER A 1 368 ? 31.984 22.485 47.247  1.00 24.52 ? 369  SER A O   1 
ATOM   2796 C  CB  . SER A 1 368 ? 32.500 23.023 50.538  1.00 25.87 ? 369  SER A CB  1 
ATOM   2797 O  OG  . SER A 1 368 ? 31.832 23.843 51.500  1.00 25.04 ? 369  SER A OG  1 
ATOM   2798 N  N   . ALA A 1 369 ? 32.809 20.795 48.547  1.00 25.82 ? 370  ALA A N   1 
ATOM   2799 C  CA  . ALA A 1 369 ? 33.506 20.121 47.469  1.00 26.89 ? 370  ALA A CA  1 
ATOM   2800 C  C   . ALA A 1 369 ? 32.575 19.848 46.300  1.00 27.65 ? 370  ALA A C   1 
ATOM   2801 O  O   . ALA A 1 369 ? 32.996 19.943 45.156  1.00 27.84 ? 370  ALA A O   1 
ATOM   2802 C  CB  . ALA A 1 369 ? 34.085 18.782 47.931  1.00 26.12 ? 370  ALA A CB  1 
ATOM   2803 N  N   . ALA A 1 370 ? 31.300 19.557 46.590  1.00 28.74 ? 371  ALA A N   1 
ATOM   2804 C  CA  . ALA A 1 370 ? 30.298 19.283 45.573  1.00 29.61 ? 371  ALA A CA  1 
ATOM   2805 C  C   . ALA A 1 370 ? 29.916 20.493 44.730  1.00 29.86 ? 371  ALA A C   1 
ATOM   2806 O  O   . ALA A 1 370 ? 29.458 20.274 43.630  1.00 30.53 ? 371  ALA A O   1 
ATOM   2807 C  CB  . ALA A 1 370 ? 29.033 18.723 46.226  1.00 29.83 ? 371  ALA A CB  1 
ATOM   2808 N  N   . VAL A 1 371 ? 30.028 21.766 45.125  1.00 30.16 ? 372  VAL A N   1 
ATOM   2809 C  CA  . VAL A 1 371 ? 29.786 22.896 44.224  1.00 30.12 ? 372  VAL A CA  1 
ATOM   2810 C  C   . VAL A 1 371 ? 31.080 23.027 43.386  1.00 29.82 ? 372  VAL A C   1 
ATOM   2811 O  O   . VAL A 1 371 ? 31.104 23.111 42.155  1.00 30.55 ? 372  VAL A O   1 
ATOM   2812 C  CB  . VAL A 1 371 ? 29.476 24.122 45.129  1.00 30.35 ? 372  VAL A CB  1 
ATOM   2813 C  CG1 . VAL A 1 371 ? 29.265 25.404 44.352  1.00 29.88 ? 372  VAL A CG1 1 
ATOM   2814 C  CG2 . VAL A 1 371 ? 28.192 23.823 45.866  1.00 30.18 ? 372  VAL A CG2 1 
ATOM   2815 N  N   . ALA A 1 372 ? 32.205 22.953 44.083  1.00 28.73 ? 373  ALA A N   1 
ATOM   2816 C  CA  . ALA A 1 372 ? 33.511 23.001 43.485  1.00 27.86 ? 373  ALA A CA  1 
ATOM   2817 C  C   . ALA A 1 372 ? 33.754 22.054 42.329  1.00 27.56 ? 373  ALA A C   1 
ATOM   2818 O  O   . ALA A 1 372 ? 34.304 22.536 41.337  1.00 27.45 ? 373  ALA A O   1 
ATOM   2819 C  CB  . ALA A 1 372 ? 34.526 22.732 44.574  1.00 27.94 ? 373  ALA A CB  1 
ATOM   2820 N  N   . LYS A 1 373 ? 33.414 20.754 42.393  1.00 27.74 ? 374  LYS A N   1 
ATOM   2821 C  CA  . LYS A 1 373 ? 33.621 19.889 41.223  1.00 29.40 ? 374  LYS A CA  1 
ATOM   2822 C  C   . LYS A 1 373 ? 32.707 20.197 40.046  1.00 28.65 ? 374  LYS A C   1 
ATOM   2823 O  O   . LYS A 1 373 ? 33.068 19.852 38.928  1.00 29.50 ? 374  LYS A O   1 
ATOM   2824 C  CB  . LYS A 1 373 ? 33.448 18.350 41.469  1.00 30.43 ? 374  LYS A CB  1 
ATOM   2825 C  CG  . LYS A 1 373 ? 32.209 17.684 42.109  1.00 34.31 ? 374  LYS A CG  1 
ATOM   2826 C  CD  . LYS A 1 373 ? 30.761 18.159 41.714  1.00 35.29 ? 374  LYS A CD  1 
ATOM   2827 C  CE  . LYS A 1 373 ? 29.567 17.481 42.410  1.00 35.81 ? 374  LYS A CE  1 
ATOM   2828 N  NZ  . LYS A 1 373 ? 28.327 18.239 42.230  1.00 36.53 ? 374  LYS A NZ  1 
ATOM   2829 N  N   . GLN A 1 374 ? 31.573 20.864 40.220  1.00 27.91 ? 375  GLN A N   1 
ATOM   2830 C  CA  . GLN A 1 374 ? 30.693 21.156 39.111  1.00 28.43 ? 375  GLN A CA  1 
ATOM   2831 C  C   . GLN A 1 374 ? 31.383 22.205 38.277  1.00 29.09 ? 375  GLN A C   1 
ATOM   2832 O  O   . GLN A 1 374 ? 31.394 22.130 37.044  1.00 29.46 ? 375  GLN A O   1 
ATOM   2833 C  CB  . GLN A 1 374 ? 29.381 21.765 39.526  1.00 29.20 ? 375  GLN A CB  1 
ATOM   2834 C  CG  . GLN A 1 374 ? 28.782 21.033 40.722  1.00 30.99 ? 375  GLN A CG  1 
ATOM   2835 C  CD  . GLN A 1 374 ? 27.372 21.412 41.107  1.00 30.65 ? 375  GLN A CD  1 
ATOM   2836 O  OE1 . GLN A 1 374 ? 26.563 21.646 40.215  1.00 29.91 ? 375  GLN A OE1 1 
ATOM   2837 N  NE2 . GLN A 1 374 ? 27.049 21.464 42.409  1.00 30.85 ? 375  GLN A NE2 1 
ATOM   2838 N  N   . ALA A 1 375 ? 31.999 23.156 39.008  1.00 28.58 ? 376  ALA A N   1 
ATOM   2839 C  CA  . ALA A 1 375 ? 32.702 24.244 38.375  1.00 27.90 ? 376  ALA A CA  1 
ATOM   2840 C  C   . ALA A 1 375 ? 33.908 23.689 37.631  1.00 27.73 ? 376  ALA A C   1 
ATOM   2841 O  O   . ALA A 1 375 ? 34.051 24.054 36.461  1.00 28.22 ? 376  ALA A O   1 
ATOM   2842 C  CB  . ALA A 1 375 ? 33.141 25.219 39.420  1.00 27.50 ? 376  ALA A CB  1 
ATOM   2843 N  N   . LEU A 1 376 ? 34.736 22.829 38.280  1.00 26.79 ? 377  LEU A N   1 
ATOM   2844 C  CA  . LEU A 1 376 ? 35.860 22.133 37.659  1.00 26.22 ? 377  LEU A CA  1 
ATOM   2845 C  C   . LEU A 1 376 ? 35.560 21.347 36.405  1.00 26.04 ? 377  LEU A C   1 
ATOM   2846 O  O   . LEU A 1 376 ? 36.325 21.408 35.447  1.00 25.21 ? 377  LEU A O   1 
ATOM   2847 C  CB  . LEU A 1 376 ? 36.496 21.165 38.600  1.00 26.18 ? 377  LEU A CB  1 
ATOM   2848 C  CG  . LEU A 1 376 ? 37.447 21.731 39.634  1.00 27.80 ? 377  LEU A CG  1 
ATOM   2849 C  CD1 . LEU A 1 376 ? 37.787 20.600 40.578  1.00 27.59 ? 377  LEU A CD1 1 
ATOM   2850 C  CD2 . LEU A 1 376 ? 38.721 22.314 38.995  1.00 26.79 ? 377  LEU A CD2 1 
ATOM   2851 N  N   . ALA A 1 377 ? 34.447 20.619 36.410  1.00 26.23 ? 378  ALA A N   1 
ATOM   2852 C  CA  . ALA A 1 377 ? 34.002 19.896 35.242  1.00 27.89 ? 378  ALA A CA  1 
ATOM   2853 C  C   . ALA A 1 377 ? 33.815 20.804 34.028  1.00 29.48 ? 378  ALA A C   1 
ATOM   2854 O  O   . ALA A 1 377 ? 33.984 20.355 32.901  1.00 28.86 ? 378  ALA A O   1 
ATOM   2855 C  CB  . ALA A 1 377 ? 32.691 19.198 35.564  1.00 25.35 ? 378  ALA A CB  1 
ATOM   2856 N  N   . HIS A 1 378 ? 33.532 22.097 34.193  1.00 31.92 ? 379  HIS A N   1 
ATOM   2857 C  CA  . HIS A 1 378 ? 33.425 22.974 33.032  1.00 34.54 ? 379  HIS A CA  1 
ATOM   2858 C  C   . HIS A 1 378 ? 34.684 23.817 32.828  1.00 35.21 ? 379  HIS A C   1 
ATOM   2859 O  O   . HIS A 1 378 ? 34.668 24.747 32.019  1.00 35.37 ? 379  HIS A O   1 
ATOM   2860 C  CB  . HIS A 1 378 ? 32.241 23.880 33.194  1.00 36.18 ? 379  HIS A CB  1 
ATOM   2861 C  CG  . HIS A 1 378 ? 30.955 23.076 33.184  1.00 39.14 ? 379  HIS A CG  1 
ATOM   2862 N  ND1 . HIS A 1 378 ? 30.333 22.523 34.218  1.00 40.69 ? 379  HIS A ND1 1 
ATOM   2863 C  CD2 . HIS A 1 378 ? 30.205 22.798 32.072  1.00 40.30 ? 379  HIS A CD2 1 
ATOM   2864 C  CE1 . HIS A 1 378 ? 29.249 21.931 33.791  1.00 40.68 ? 379  HIS A CE1 1 
ATOM   2865 N  NE2 . HIS A 1 378 ? 29.185 22.104 32.498  1.00 40.44 ? 379  HIS A NE2 1 
ATOM   2866 N  N   . GLY A 1 379 ? 35.759 23.474 33.574  1.00 34.60 ? 380  GLY A N   1 
ATOM   2867 C  CA  . GLY A 1 379 ? 37.047 24.140 33.481  1.00 33.90 ? 380  GLY A CA  1 
ATOM   2868 C  C   . GLY A 1 379 ? 37.067 25.532 34.111  1.00 34.06 ? 380  GLY A C   1 
ATOM   2869 O  O   . GLY A 1 379 ? 37.637 26.469 33.544  1.00 33.58 ? 380  GLY A O   1 
ATOM   2870 N  N   . LEU A 1 380 ? 36.427 25.737 35.274  1.00 33.86 ? 381  LEU A N   1 
ATOM   2871 C  CA  . LEU A 1 380 ? 36.544 27.020 35.967  1.00 34.36 ? 381  LEU A CA  1 
ATOM   2872 C  C   . LEU A 1 380 ? 37.223 26.837 37.346  1.00 34.44 ? 381  LEU A C   1 
ATOM   2873 O  O   . LEU A 1 380 ? 37.316 25.750 37.936  1.00 34.53 ? 381  LEU A O   1 
ATOM   2874 C  CB  . LEU A 1 380 ? 35.159 27.701 36.161  1.00 33.28 ? 381  LEU A CB  1 
ATOM   2875 C  CG  . LEU A 1 380 ? 34.216 27.868 34.952  1.00 33.33 ? 381  LEU A CG  1 
ATOM   2876 C  CD1 . LEU A 1 380 ? 33.067 28.786 35.329  1.00 31.68 ? 381  LEU A CD1 1 
ATOM   2877 C  CD2 . LEU A 1 380 ? 34.937 28.503 33.777  1.00 33.48 ? 381  LEU A CD2 1 
ATOM   2878 N  N   . LYS A 1 381 ? 37.729 27.968 37.863  1.00 34.72 ? 382  LYS A N   1 
ATOM   2879 C  CA  . LYS A 1 381 ? 38.422 28.068 39.146  1.00 34.30 ? 382  LYS A CA  1 
ATOM   2880 C  C   . LYS A 1 381 ? 37.967 29.382 39.755  1.00 32.77 ? 382  LYS A C   1 
ATOM   2881 O  O   . LYS A 1 381 ? 37.415 30.250 39.074  1.00 32.50 ? 382  LYS A O   1 
ATOM   2882 C  CB  . LYS A 1 381 ? 39.932 28.147 39.003  1.00 35.84 ? 382  LYS A CB  1 
ATOM   2883 C  CG  . LYS A 1 381 ? 40.622 27.413 37.859  1.00 38.70 ? 382  LYS A CG  1 
ATOM   2884 C  CD  . LYS A 1 381 ? 42.132 27.422 38.054  1.00 41.27 ? 382  LYS A CD  1 
ATOM   2885 C  CE  . LYS A 1 381 ? 42.476 26.372 39.086  1.00 43.75 ? 382  LYS A CE  1 
ATOM   2886 N  NZ  . LYS A 1 381 ? 41.889 25.105 38.650  1.00 46.71 ? 382  LYS A NZ  1 
ATOM   2887 N  N   . CYS A 1 382 ? 38.232 29.549 41.040  1.00 31.33 ? 383  CYS A N   1 
ATOM   2888 C  CA  . CYS A 1 382 ? 37.773 30.711 41.741  1.00 30.45 ? 383  CYS A CA  1 
ATOM   2889 C  C   . CYS A 1 382 ? 38.228 32.031 41.177  1.00 29.50 ? 383  CYS A C   1 
ATOM   2890 O  O   . CYS A 1 382 ? 39.422 32.207 40.927  1.00 28.61 ? 383  CYS A O   1 
ATOM   2891 C  CB  . CYS A 1 382 ? 38.223 30.670 43.172  1.00 31.28 ? 383  CYS A CB  1 
ATOM   2892 S  SG  . CYS A 1 382 ? 37.455 29.272 44.001  1.00 33.05 ? 383  CYS A SG  1 
ATOM   2893 N  N   . LYS A 1 383 ? 37.226 32.902 40.955  1.00 29.63 ? 384  LYS A N   1 
ATOM   2894 C  CA  . LYS A 1 383 ? 37.491 34.290 40.631  1.00 30.21 ? 384  LYS A CA  1 
ATOM   2895 C  C   . LYS A 1 383 ? 37.993 34.980 41.917  1.00 30.17 ? 384  LYS A C   1 
ATOM   2896 O  O   . LYS A 1 383 ? 38.913 35.809 41.867  1.00 29.54 ? 384  LYS A O   1 
ATOM   2897 C  CB  . LYS A 1 383 ? 36.212 34.925 40.104  1.00 32.37 ? 384  LYS A CB  1 
ATOM   2898 C  CG  . LYS A 1 383 ? 36.303 36.366 39.566  1.00 36.71 ? 384  LYS A CG  1 
ATOM   2899 C  CD  . LYS A 1 383 ? 35.797 37.593 40.445  1.00 41.28 ? 384  LYS A CD  1 
ATOM   2900 C  CE  . LYS A 1 383 ? 36.666 38.217 41.616  1.00 43.43 ? 384  LYS A CE  1 
ATOM   2901 N  NZ  . LYS A 1 383 ? 35.944 38.934 42.683  1.00 43.66 ? 384  LYS A NZ  1 
ATOM   2902 N  N   . SER A 1 384 ? 37.421 34.676 43.104  1.00 29.74 ? 385  SER A N   1 
ATOM   2903 C  CA  . SER A 1 384 ? 37.915 35.234 44.354  1.00 28.91 ? 385  SER A CA  1 
ATOM   2904 C  C   . SER A 1 384 ? 39.069 34.383 44.874  1.00 28.77 ? 385  SER A C   1 
ATOM   2905 O  O   . SER A 1 384 ? 39.502 33.365 44.325  1.00 26.93 ? 385  SER A O   1 
ATOM   2906 C  CB  . SER A 1 384 ? 36.796 35.278 45.436  1.00 29.30 ? 385  SER A CB  1 
ATOM   2907 O  OG  . SER A 1 384 ? 35.619 36.010 45.083  1.00 30.22 ? 385  SER A OG  1 
ATOM   2908 N  N   . GLN A 1 385 ? 39.571 34.885 45.991  1.00 29.62 ? 386  GLN A N   1 
ATOM   2909 C  CA  . GLN A 1 385 ? 40.620 34.212 46.720  1.00 31.05 ? 386  GLN A CA  1 
ATOM   2910 C  C   . GLN A 1 385 ? 39.809 33.319 47.676  1.00 29.52 ? 386  GLN A C   1 
ATOM   2911 O  O   . GLN A 1 385 ? 38.759 33.699 48.187  1.00 29.31 ? 386  GLN A O   1 
ATOM   2912 C  CB  . GLN A 1 385 ? 41.464 35.286 47.422  1.00 34.09 ? 386  GLN A CB  1 
ATOM   2913 C  CG  . GLN A 1 385 ? 42.811 34.783 47.952  1.00 40.19 ? 386  GLN A CG  1 
ATOM   2914 C  CD  . GLN A 1 385 ? 43.814 35.880 48.347  1.00 43.09 ? 386  GLN A CD  1 
ATOM   2915 O  OE1 . GLN A 1 385 ? 44.036 36.192 49.531  1.00 44.92 ? 386  GLN A OE1 1 
ATOM   2916 N  NE2 . GLN A 1 385 ? 44.491 36.472 47.352  1.00 44.16 ? 386  GLN A NE2 1 
ATOM   2917 N  N   . PHE A 1 386 ? 40.260 32.082 47.859  1.00 27.83 ? 387  PHE A N   1 
ATOM   2918 C  CA  . PHE A 1 386 ? 39.530 31.063 48.584  1.00 25.40 ? 387  PHE A CA  1 
ATOM   2919 C  C   . PHE A 1 386 ? 40.375 30.390 49.676  1.00 23.88 ? 387  PHE A C   1 
ATOM   2920 O  O   . PHE A 1 386 ? 41.440 29.877 49.368  1.00 23.12 ? 387  PHE A O   1 
ATOM   2921 C  CB  . PHE A 1 386 ? 39.041 30.160 47.432  1.00 24.63 ? 387  PHE A CB  1 
ATOM   2922 C  CG  . PHE A 1 386 ? 38.060 29.080 47.798  1.00 24.98 ? 387  PHE A CG  1 
ATOM   2923 C  CD1 . PHE A 1 386 ? 36.981 29.368 48.654  1.00 24.62 ? 387  PHE A CD1 1 
ATOM   2924 C  CD2 . PHE A 1 386 ? 38.221 27.799 47.256  1.00 25.45 ? 387  PHE A CD2 1 
ATOM   2925 C  CE1 . PHE A 1 386 ? 36.050 28.373 48.966  1.00 23.91 ? 387  PHE A CE1 1 
ATOM   2926 C  CE2 . PHE A 1 386 ? 37.283 26.808 47.579  1.00 25.15 ? 387  PHE A CE2 1 
ATOM   2927 C  CZ  . PHE A 1 386 ? 36.200 27.098 48.429  1.00 25.00 ? 387  PHE A CZ  1 
ATOM   2928 N  N   . THR A 1 387 ? 39.982 30.386 50.957  1.00 22.82 ? 388  THR A N   1 
ATOM   2929 C  CA  . THR A 1 387 ? 40.752 29.732 52.011  1.00 21.43 ? 388  THR A CA  1 
ATOM   2930 C  C   . THR A 1 387 ? 39.785 28.762 52.682  1.00 21.64 ? 388  THR A C   1 
ATOM   2931 O  O   . THR A 1 387 ? 38.570 28.998 52.697  1.00 22.65 ? 388  THR A O   1 
ATOM   2932 C  CB  . THR A 1 387 ? 41.380 30.788 53.089  1.00 21.14 ? 388  THR A CB  1 
ATOM   2933 O  OG1 . THR A 1 387 ? 40.353 31.406 53.834  1.00 20.39 ? 388  THR A OG1 1 
ATOM   2934 C  CG2 . THR A 1 387 ? 42.090 31.978 52.449  1.00 19.82 ? 388  THR A CG2 1 
ATOM   2935 N  N   . ILE A 1 388 ? 40.294 27.625 53.189  1.00 21.15 ? 389  ILE A N   1 
ATOM   2936 C  CA  . ILE A 1 388 ? 39.499 26.542 53.766  1.00 19.56 ? 389  ILE A CA  1 
ATOM   2937 C  C   . ILE A 1 388 ? 40.076 26.127 55.124  1.00 18.98 ? 389  ILE A C   1 
ATOM   2938 O  O   . ILE A 1 388 ? 41.243 25.754 55.170  1.00 17.68 ? 389  ILE A O   1 
ATOM   2939 C  CB  . ILE A 1 388 ? 39.513 25.337 52.765  1.00 19.47 ? 389  ILE A CB  1 
ATOM   2940 C  CG1 . ILE A 1 388 ? 39.028 25.781 51.425  1.00 19.39 ? 389  ILE A CG1 1 
ATOM   2941 C  CG2 . ILE A 1 388 ? 38.654 24.180 53.293  1.00 18.97 ? 389  ILE A CG2 1 
ATOM   2942 C  CD1 . ILE A 1 388 ? 39.949 25.198 50.352  1.00 20.81 ? 389  ILE A CD1 1 
ATOM   2943 N  N   . THR A 1 389 ? 39.332 26.131 56.236  1.00 18.34 ? 390  THR A N   1 
ATOM   2944 C  CA  . THR A 1 389 ? 39.866 25.710 57.537  1.00 18.66 ? 390  THR A CA  1 
ATOM   2945 C  C   . THR A 1 389 ? 39.114 24.422 57.940  1.00 20.19 ? 390  THR A C   1 
ATOM   2946 O  O   . THR A 1 389 ? 37.878 24.473 58.094  1.00 20.66 ? 390  THR A O   1 
ATOM   2947 C  CB  . THR A 1 389 ? 39.628 26.782 58.641  1.00 16.88 ? 390  THR A CB  1 
ATOM   2948 O  OG1 . THR A 1 389 ? 40.255 27.975 58.243  1.00 17.21 ? 390  THR A OG1 1 
ATOM   2949 C  CG2 . THR A 1 389 ? 40.250 26.441 59.949  1.00 16.92 ? 390  THR A CG2 1 
ATOM   2950 N  N   . PRO A 1 390 ? 39.769 23.247 58.119  1.00 20.47 ? 391  PRO A N   1 
ATOM   2951 C  CA  . PRO A 1 390 ? 39.219 22.048 58.779  1.00 20.84 ? 391  PRO A CA  1 
ATOM   2952 C  C   . PRO A 1 390 ? 39.036 22.186 60.283  1.00 19.62 ? 391  PRO A C   1 
ATOM   2953 O  O   . PRO A 1 390 ? 39.854 22.838 60.921  1.00 19.75 ? 391  PRO A O   1 
ATOM   2954 C  CB  . PRO A 1 390 ? 40.175 20.873 58.470  1.00 21.39 ? 391  PRO A CB  1 
ATOM   2955 C  CG  . PRO A 1 390 ? 40.854 21.361 57.229  1.00 21.64 ? 391  PRO A CG  1 
ATOM   2956 C  CD  . PRO A 1 390 ? 41.037 22.888 57.495  1.00 21.45 ? 391  PRO A CD  1 
ATOM   2957 N  N   . GLY A 1 391 ? 37.979 21.585 60.848  1.00 18.35 ? 392  GLY A N   1 
ATOM   2958 C  CA  . GLY A 1 391 ? 37.690 21.657 62.266  1.00 15.89 ? 392  GLY A CA  1 
ATOM   2959 C  C   . GLY A 1 391 ? 38.632 20.898 63.147  1.00 14.94 ? 392  GLY A C   1 
ATOM   2960 O  O   . GLY A 1 391 ? 38.818 21.356 64.264  1.00 14.68 ? 392  GLY A O   1 
ATOM   2961 N  N   . SER A 1 392 ? 39.260 19.792 62.713  1.00 14.21 ? 393  SER A N   1 
ATOM   2962 C  CA  . SER A 1 392 ? 40.155 19.044 63.579  1.00 14.17 ? 393  SER A CA  1 
ATOM   2963 C  C   . SER A 1 392 ? 41.068 18.192 62.754  1.00 16.05 ? 393  SER A C   1 
ATOM   2964 O  O   . SER A 1 392 ? 40.865 18.142 61.528  1.00 16.46 ? 393  SER A O   1 
ATOM   2965 C  CB  . SER A 1 392 ? 39.371 18.148 64.489  1.00 13.72 ? 393  SER A CB  1 
ATOM   2966 O  OG  . SER A 1 392 ? 38.514 17.236 63.787  1.00 12.35 ? 393  SER A OG  1 
ATOM   2967 N  N   . GLU A 1 393 ? 42.077 17.574 63.415  1.00 16.75 ? 394  GLU A N   1 
ATOM   2968 C  CA  . GLU A 1 393 ? 43.012 16.658 62.740  1.00 18.28 ? 394  GLU A CA  1 
ATOM   2969 C  C   . GLU A 1 393 ? 42.255 15.564 62.038  1.00 17.99 ? 394  GLU A C   1 
ATOM   2970 O  O   . GLU A 1 393 ? 42.619 15.239 60.919  1.00 19.35 ? 394  GLU A O   1 
ATOM   2971 C  CB  . GLU A 1 393 ? 43.971 15.875 63.655  1.00 20.27 ? 394  GLU A CB  1 
ATOM   2972 C  CG  . GLU A 1 393 ? 45.460 16.087 63.511  1.00 22.21 ? 394  GLU A CG  1 
ATOM   2973 C  CD  . GLU A 1 393 ? 45.898 15.959 62.075  1.00 24.86 ? 394  GLU A CD  1 
ATOM   2974 O  OE1 . GLU A 1 393 ? 46.180 14.860 61.620  1.00 25.98 ? 394  GLU A OE1 1 
ATOM   2975 O  OE2 . GLU A 1 393 ? 45.970 16.981 61.405  1.00 27.69 ? 394  GLU A OE2 1 
ATOM   2976 N  N   . GLN A 1 394 ? 41.298 14.954 62.746  1.00 16.44 ? 395  GLN A N   1 
ATOM   2977 C  CA  . GLN A 1 394 ? 40.399 13.950 62.236  1.00 16.37 ? 395  GLN A CA  1 
ATOM   2978 C  C   . GLN A 1 394 ? 39.587 14.371 61.025  1.00 14.66 ? 395  GLN A C   1 
ATOM   2979 O  O   . GLN A 1 394 ? 39.514 13.605 60.078  1.00 13.81 ? 395  GLN A O   1 
ATOM   2980 C  CB  . GLN A 1 394 ? 39.524 13.554 63.412  1.00 19.19 ? 395  GLN A CB  1 
ATOM   2981 C  CG  . GLN A 1 394 ? 38.665 12.342 63.116  1.00 22.61 ? 395  GLN A CG  1 
ATOM   2982 C  CD  . GLN A 1 394 ? 38.074 11.801 64.387  1.00 25.00 ? 395  GLN A CD  1 
ATOM   2983 O  OE1 . GLN A 1 394 ? 36.923 12.116 64.687  1.00 26.47 ? 395  GLN A OE1 1 
ATOM   2984 N  NE2 . GLN A 1 394 ? 38.859 11.030 65.161  1.00 25.46 ? 395  GLN A NE2 1 
ATOM   2985 N  N   . ILE A 1 395 ? 38.900 15.506 60.997  1.00 14.17 ? 396  ILE A N   1 
ATOM   2986 C  CA  . ILE A 1 395 ? 38.271 15.964 59.749  1.00 14.09 ? 396  ILE A CA  1 
ATOM   2987 C  C   . ILE A 1 395 ? 39.329 16.186 58.650  1.00 15.62 ? 396  ILE A C   1 
ATOM   2988 O  O   . ILE A 1 395 ? 39.125 15.744 57.526  1.00 17.20 ? 396  ILE A O   1 
ATOM   2989 C  CB  . ILE A 1 395 ? 37.500 17.254 60.043  1.00 12.54 ? 396  ILE A CB  1 
ATOM   2990 C  CG1 . ILE A 1 395 ? 36.431 16.913 61.041  1.00 12.23 ? 396  ILE A CG1 1 
ATOM   2991 C  CG2 . ILE A 1 395 ? 36.951 17.886 58.767  1.00 11.30 ? 396  ILE A CG2 1 
ATOM   2992 C  CD1 . ILE A 1 395 ? 35.497 18.031 61.488  1.00 9.77  ? 396  ILE A CD1 1 
ATOM   2993 N  N   . ARG A 1 396 ? 40.496 16.786 58.936  1.00 16.33 ? 397  ARG A N   1 
ATOM   2994 C  CA  . ARG A 1 396 ? 41.519 17.063 57.968  1.00 16.65 ? 397  ARG A CA  1 
ATOM   2995 C  C   . ARG A 1 396 ? 42.030 15.793 57.303  1.00 18.05 ? 397  ARG A C   1 
ATOM   2996 O  O   . ARG A 1 396 ? 42.090 15.697 56.070  1.00 18.39 ? 397  ARG A O   1 
ATOM   2997 C  CB  . ARG A 1 396 ? 42.674 17.742 58.631  1.00 16.47 ? 397  ARG A CB  1 
ATOM   2998 C  CG  . ARG A 1 396 ? 43.733 18.075 57.580  1.00 17.11 ? 397  ARG A CG  1 
ATOM   2999 C  CD  . ARG A 1 396 ? 45.189 18.153 58.053  1.00 18.21 ? 397  ARG A CD  1 
ATOM   3000 N  NE  . ARG A 1 396 ? 45.675 16.927 58.667  1.00 18.05 ? 397  ARG A NE  1 
ATOM   3001 C  CZ  . ARG A 1 396 ? 46.240 15.898 58.004  1.00 19.23 ? 397  ARG A CZ  1 
ATOM   3002 N  NH1 . ARG A 1 396 ? 46.325 15.920 56.663  1.00 18.14 ? 397  ARG A NH1 1 
ATOM   3003 N  NH2 . ARG A 1 396 ? 46.660 14.842 58.745  1.00 17.02 ? 397  ARG A NH2 1 
ATOM   3004 N  N   . ALA A 1 397 ? 42.486 14.843 58.138  1.00 18.74 ? 398  ALA A N   1 
ATOM   3005 C  CA  . ALA A 1 397 ? 42.952 13.533 57.707  1.00 18.23 ? 398  ALA A CA  1 
ATOM   3006 C  C   . ALA A 1 397 ? 41.855 12.850 56.891  1.00 18.98 ? 398  ALA A C   1 
ATOM   3007 O  O   . ALA A 1 397 ? 42.166 12.477 55.754  1.00 20.41 ? 398  ALA A O   1 
ATOM   3008 C  CB  . ALA A 1 397 ? 43.282 12.708 58.930  1.00 16.40 ? 398  ALA A CB  1 
ATOM   3009 N  N   . THR A 1 398 ? 40.579 12.748 57.357  1.00 18.45 ? 399  THR A N   1 
ATOM   3010 C  CA  . THR A 1 398 ? 39.514 12.083 56.597  1.00 17.58 ? 399  THR A CA  1 
ATOM   3011 C  C   . THR A 1 398 ? 39.098 12.794 55.290  1.00 18.94 ? 399  THR A C   1 
ATOM   3012 O  O   . THR A 1 398 ? 38.812 12.077 54.333  1.00 18.85 ? 399  THR A O   1 
ATOM   3013 C  CB  . THR A 1 398 ? 38.222 11.872 57.514  1.00 16.08 ? 399  THR A CB  1 
ATOM   3014 O  OG1 . THR A 1 398 ? 38.623 11.411 58.810  1.00 11.09 ? 399  THR A OG1 1 
ATOM   3015 C  CG2 . THR A 1 398 ? 37.273 10.869 56.916  1.00 12.29 ? 399  THR A CG2 1 
ATOM   3016 N  N   . ILE A 1 399 ? 39.010 14.140 55.134  1.00 19.80 ? 400  ILE A N   1 
ATOM   3017 C  CA  . ILE A 1 399 ? 38.612 14.789 53.838  1.00 20.75 ? 400  ILE A CA  1 
ATOM   3018 C  C   . ILE A 1 399 ? 39.741 14.730 52.781  1.00 22.51 ? 400  ILE A C   1 
ATOM   3019 O  O   . ILE A 1 399 ? 39.544 14.823 51.560  1.00 22.03 ? 400  ILE A O   1 
ATOM   3020 C  CB  . ILE A 1 399 ? 38.231 16.282 54.028  1.00 19.29 ? 400  ILE A CB  1 
ATOM   3021 C  CG1 . ILE A 1 399 ? 39.424 17.039 54.603  1.00 18.12 ? 400  ILE A CG1 1 
ATOM   3022 C  CG2 . ILE A 1 399 ? 37.045 16.407 54.978  1.00 18.30 ? 400  ILE A CG2 1 
ATOM   3023 C  CD1 . ILE A 1 399 ? 39.247 18.535 54.512  1.00 18.72 ? 400  ILE A CD1 1 
ATOM   3024 N  N   . GLU A 1 400 ? 40.967 14.560 53.302  1.00 23.97 ? 401  GLU A N   1 
ATOM   3025 C  CA  . GLU A 1 400 ? 42.176 14.318 52.507  1.00 26.16 ? 401  GLU A CA  1 
ATOM   3026 C  C   . GLU A 1 400 ? 42.071 12.962 51.815  1.00 26.87 ? 401  GLU A C   1 
ATOM   3027 O  O   . GLU A 1 400 ? 42.208 12.853 50.592  1.00 27.50 ? 401  GLU A O   1 
ATOM   3028 C  CB  . GLU A 1 400 ? 43.392 14.325 53.418  1.00 26.04 ? 401  GLU A CB  1 
ATOM   3029 C  CG  . GLU A 1 400 ? 44.679 14.523 52.703  1.00 28.00 ? 401  GLU A CG  1 
ATOM   3030 C  CD  . GLU A 1 400 ? 44.798 15.914 52.126  1.00 28.56 ? 401  GLU A CD  1 
ATOM   3031 O  OE1 . GLU A 1 400 ? 45.096 16.820 52.917  1.00 29.11 ? 401  GLU A OE1 1 
ATOM   3032 O  OE2 . GLU A 1 400 ? 44.615 16.045 50.905  1.00 28.32 ? 401  GLU A OE2 1 
ATOM   3033 N  N   . ARG A 1 401 ? 41.735 11.966 52.660  1.00 27.52 ? 402  ARG A N   1 
ATOM   3034 C  CA  . ARG A 1 401 ? 41.462 10.587 52.268  1.00 27.06 ? 402  ARG A CA  1 
ATOM   3035 C  C   . ARG A 1 401 ? 40.258 10.388 51.345  1.00 27.09 ? 402  ARG A C   1 
ATOM   3036 O  O   . ARG A 1 401 ? 40.359 9.645  50.368  1.00 27.87 ? 402  ARG A O   1 
ATOM   3037 C  CB  . ARG A 1 401 ? 41.251 9.775  53.513  1.00 27.56 ? 402  ARG A CB  1 
ATOM   3038 C  CG  . ARG A 1 401 ? 41.262 8.289  53.232  1.00 28.05 ? 402  ARG A CG  1 
ATOM   3039 C  CD  . ARG A 1 401 ? 39.877 7.804  53.541  1.00 28.97 ? 402  ARG A CD  1 
ATOM   3040 N  NE  . ARG A 1 401 ? 39.762 7.456  54.929  1.00 28.96 ? 402  ARG A NE  1 
ATOM   3041 C  CZ  . ARG A 1 401 ? 38.612 7.440  55.578  1.00 28.73 ? 402  ARG A CZ  1 
ATOM   3042 N  NH1 . ARG A 1 401 ? 37.488 7.970  55.127  1.00 28.26 ? 402  ARG A NH1 1 
ATOM   3043 N  NH2 . ARG A 1 401 ? 38.656 6.968  56.786  1.00 27.70 ? 402  ARG A NH2 1 
ATOM   3044 N  N   . ASP A 1 402 ? 39.094 10.992 51.612  1.00 26.11 ? 403  ASP A N   1 
ATOM   3045 C  CA  . ASP A 1 402 ? 37.918 10.813 50.774  1.00 24.59 ? 403  ASP A CA  1 
ATOM   3046 C  C   . ASP A 1 402 ? 37.900 11.694 49.544  1.00 24.44 ? 403  ASP A C   1 
ATOM   3047 O  O   . ASP A 1 402 ? 36.906 11.744 48.833  1.00 23.32 ? 403  ASP A O   1 
ATOM   3048 C  CB  . ASP A 1 402 ? 36.647 11.018 51.669  1.00 24.45 ? 403  ASP A CB  1 
ATOM   3049 C  CG  . ASP A 1 402 ? 36.447 9.858  52.657  1.00 24.87 ? 403  ASP A CG  1 
ATOM   3050 O  OD1 . ASP A 1 402 ? 37.019 8.802  52.400  1.00 26.80 ? 403  ASP A OD1 1 
ATOM   3051 O  OD2 . ASP A 1 402 ? 35.767 9.969  53.685  1.00 23.61 ? 403  ASP A OD2 1 
ATOM   3052 N  N   . GLY A 1 403 ? 39.007 12.398 49.279  1.00 25.63 ? 404  GLY A N   1 
ATOM   3053 C  CA  . GLY A 1 403 ? 39.184 13.178 48.058  1.00 26.16 ? 404  GLY A CA  1 
ATOM   3054 C  C   . GLY A 1 403 ? 38.753 14.636 48.073  1.00 26.74 ? 404  GLY A C   1 
ATOM   3055 O  O   . GLY A 1 403 ? 39.061 15.355 47.126  1.00 27.78 ? 404  GLY A O   1 
ATOM   3056 N  N   . TYR A 1 404 ? 38.101 15.151 49.111  1.00 27.01 ? 405  TYR A N   1 
ATOM   3057 C  CA  . TYR A 1 404 ? 37.555 16.497 49.053  1.00 26.47 ? 405  TYR A CA  1 
ATOM   3058 C  C   . TYR A 1 404 ? 38.587 17.591 49.130  1.00 25.93 ? 405  TYR A C   1 
ATOM   3059 O  O   . TYR A 1 404 ? 38.391 18.613 48.464  1.00 26.05 ? 405  TYR A O   1 
ATOM   3060 C  CB  . TYR A 1 404 ? 36.614 16.830 50.181  1.00 28.30 ? 405  TYR A CB  1 
ATOM   3061 C  CG  . TYR A 1 404 ? 35.491 15.848 50.486  1.00 29.15 ? 405  TYR A CG  1 
ATOM   3062 C  CD1 . TYR A 1 404 ? 34.796 15.146 49.499  1.00 29.19 ? 405  TYR A CD1 1 
ATOM   3063 C  CD2 . TYR A 1 404 ? 35.125 15.706 51.821  1.00 29.99 ? 405  TYR A CD2 1 
ATOM   3064 C  CE1 . TYR A 1 404 ? 33.729 14.316 49.853  1.00 30.17 ? 405  TYR A CE1 1 
ATOM   3065 C  CE2 . TYR A 1 404 ? 34.068 14.884 52.179  1.00 30.73 ? 405  TYR A CE2 1 
ATOM   3066 C  CZ  . TYR A 1 404 ? 33.370 14.197 51.199  1.00 30.88 ? 405  TYR A CZ  1 
ATOM   3067 O  OH  . TYR A 1 404 ? 32.276 13.437 51.602  1.00 33.17 ? 405  TYR A OH  1 
ATOM   3068 N  N   . ALA A 1 405 ? 39.645 17.441 49.947  1.00 24.86 ? 406  ALA A N   1 
ATOM   3069 C  CA  . ALA A 1 405 ? 40.636 18.468 50.023  1.00 24.23 ? 406  ALA A CA  1 
ATOM   3070 C  C   . ALA A 1 405 ? 41.261 18.800 48.663  1.00 24.81 ? 406  ALA A C   1 
ATOM   3071 O  O   . ALA A 1 405 ? 41.515 19.979 48.385  1.00 23.81 ? 406  ALA A O   1 
ATOM   3072 C  CB  . ALA A 1 405 ? 41.695 18.030 50.974  1.00 23.12 ? 406  ALA A CB  1 
ATOM   3073 N  N   . GLN A 1 406 ? 41.474 17.812 47.777  1.00 25.67 ? 407  GLN A N   1 
ATOM   3074 C  CA  . GLN A 1 406 ? 42.038 18.137 46.465  1.00 26.92 ? 407  GLN A CA  1 
ATOM   3075 C  C   . GLN A 1 406 ? 41.075 18.791 45.486  1.00 26.03 ? 407  GLN A C   1 
ATOM   3076 O  O   . GLN A 1 406 ? 41.580 19.487 44.618  1.00 26.52 ? 407  GLN A O   1 
ATOM   3077 C  CB  . GLN A 1 406 ? 42.654 16.881 45.773  1.00 28.32 ? 407  GLN A CB  1 
ATOM   3078 C  CG  . GLN A 1 406 ? 43.627 17.187 44.577  1.00 31.43 ? 407  GLN A CG  1 
ATOM   3079 C  CD  . GLN A 1 406 ? 44.886 18.085 44.835  1.00 33.77 ? 407  GLN A CD  1 
ATOM   3080 O  OE1 . GLN A 1 406 ? 45.564 18.048 45.877  1.00 34.38 ? 407  GLN A OE1 1 
ATOM   3081 N  NE2 . GLN A 1 406 ? 45.323 18.909 43.873  1.00 33.08 ? 407  GLN A NE2 1 
ATOM   3082 N  N   . VAL A 1 407 ? 39.750 18.663 45.551  1.00 25.12 ? 408  VAL A N   1 
ATOM   3083 C  CA  . VAL A 1 407 ? 38.844 19.391 44.647  1.00 25.06 ? 408  VAL A CA  1 
ATOM   3084 C  C   . VAL A 1 407 ? 38.871 20.881 44.993  1.00 25.37 ? 408  VAL A C   1 
ATOM   3085 O  O   . VAL A 1 407 ? 38.900 21.747 44.121  1.00 24.39 ? 408  VAL A O   1 
ATOM   3086 C  CB  . VAL A 1 407 ? 37.403 18.864 44.795  1.00 24.22 ? 408  VAL A CB  1 
ATOM   3087 C  CG1 . VAL A 1 407 ? 36.476 19.646 43.917  1.00 24.23 ? 408  VAL A CG1 1 
ATOM   3088 C  CG2 . VAL A 1 407 ? 37.330 17.427 44.363  1.00 23.00 ? 408  VAL A CG2 1 
ATOM   3089 N  N   . LEU A 1 408 ? 38.835 21.113 46.312  1.00 25.41 ? 409  LEU A N   1 
ATOM   3090 C  CA  . LEU A 1 408 ? 38.928 22.437 46.910  1.00 25.83 ? 409  LEU A CA  1 
ATOM   3091 C  C   . LEU A 1 408 ? 40.273 23.091 46.559  1.00 26.63 ? 409  LEU A C   1 
ATOM   3092 O  O   . LEU A 1 408 ? 40.289 24.279 46.229  1.00 27.25 ? 409  LEU A O   1 
ATOM   3093 C  CB  . LEU A 1 408 ? 38.741 22.273 48.426  1.00 24.55 ? 409  LEU A CB  1 
ATOM   3094 C  CG  . LEU A 1 408 ? 37.423 21.733 48.965  1.00 22.97 ? 409  LEU A CG  1 
ATOM   3095 C  CD1 . LEU A 1 408 ? 37.591 21.467 50.450  1.00 20.96 ? 409  LEU A CD1 1 
ATOM   3096 C  CD2 . LEU A 1 408 ? 36.296 22.693 48.626  1.00 21.38 ? 409  LEU A CD2 1 
ATOM   3097 N  N   . ARG A 1 409 ? 41.412 22.373 46.629  1.00 26.79 ? 410  ARG A N   1 
ATOM   3098 C  CA  . ARG A 1 409 ? 42.676 22.861 46.070  1.00 26.73 ? 410  ARG A CA  1 
ATOM   3099 C  C   . ARG A 1 409 ? 42.648 23.007 44.552  1.00 26.53 ? 410  ARG A C   1 
ATOM   3100 O  O   . ARG A 1 409 ? 43.114 24.059 44.117  1.00 26.13 ? 410  ARG A O   1 
ATOM   3101 C  CB  . ARG A 1 409 ? 43.876 21.977 46.283  1.00 26.80 ? 410  ARG A CB  1 
ATOM   3102 C  CG  . ARG A 1 409 ? 44.486 22.012 47.637  1.00 27.70 ? 410  ARG A CG  1 
ATOM   3103 C  CD  . ARG A 1 409 ? 45.375 20.779 47.632  1.00 29.11 ? 410  ARG A CD  1 
ATOM   3104 N  NE  . ARG A 1 409 ? 45.454 20.273 48.993  1.00 31.16 ? 410  ARG A NE  1 
ATOM   3105 C  CZ  . ARG A 1 409 ? 45.218 19.013 49.391  1.00 31.78 ? 410  ARG A CZ  1 
ATOM   3106 N  NH1 . ARG A 1 409 ? 44.997 17.960 48.605  1.00 29.63 ? 410  ARG A NH1 1 
ATOM   3107 N  NH2 . ARG A 1 409 ? 45.289 18.786 50.691  1.00 32.80 ? 410  ARG A NH2 1 
ATOM   3108 N  N   . ASP A 1 410 ? 42.162 22.062 43.716  1.00 25.81 ? 411  ASP A N   1 
ATOM   3109 C  CA  . ASP A 1 410 ? 42.155 22.286 42.290  1.00 26.39 ? 411  ASP A CA  1 
ATOM   3110 C  C   . ASP A 1 410 ? 41.247 23.480 41.914  1.00 26.73 ? 411  ASP A C   1 
ATOM   3111 O  O   . ASP A 1 410 ? 41.542 24.027 40.852  1.00 26.93 ? 411  ASP A O   1 
ATOM   3112 C  CB  . ASP A 1 410 ? 41.637 21.115 41.462  1.00 27.40 ? 411  ASP A CB  1 
ATOM   3113 C  CG  . ASP A 1 410 ? 42.333 19.768 41.575  1.00 28.36 ? 411  ASP A CG  1 
ATOM   3114 O  OD1 . ASP A 1 410 ? 43.545 19.709 41.754  1.00 28.01 ? 411  ASP A OD1 1 
ATOM   3115 O  OD2 . ASP A 1 410 ? 41.628 18.767 41.471  1.00 30.48 ? 411  ASP A OD2 1 
ATOM   3116 N  N   . VAL A 1 411 ? 40.164 23.948 42.612  1.00 25.07 ? 412  VAL A N   1 
ATOM   3117 C  CA  . VAL A 1 411 ? 39.466 25.172 42.197  1.00 22.92 ? 412  VAL A CA  1 
ATOM   3118 C  C   . VAL A 1 411 ? 40.273 26.405 42.570  1.00 22.47 ? 412  VAL A C   1 
ATOM   3119 O  O   . VAL A 1 411 ? 39.894 27.509 42.193  1.00 23.29 ? 412  VAL A O   1 
ATOM   3120 C  CB  . VAL A 1 411 ? 38.051 25.411 42.829  1.00 22.35 ? 412  VAL A CB  1 
ATOM   3121 C  CG1 . VAL A 1 411 ? 37.072 24.895 41.851  1.00 21.88 ? 412  VAL A CG1 1 
ATOM   3122 C  CG2 . VAL A 1 411 ? 37.830 24.757 44.168  1.00 21.87 ? 412  VAL A CG2 1 
ATOM   3123 N  N   . GLY A 1 412 ? 41.345 26.314 43.355  1.00 21.97 ? 413  GLY A N   1 
ATOM   3124 C  CA  . GLY A 1 412 ? 42.117 27.490 43.714  1.00 21.33 ? 413  GLY A CA  1 
ATOM   3125 C  C   . GLY A 1 412 ? 42.084 27.846 45.194  1.00 21.28 ? 413  GLY A C   1 
ATOM   3126 O  O   . GLY A 1 412 ? 42.257 29.012 45.520  1.00 22.27 ? 413  GLY A O   1 
ATOM   3127 N  N   . GLY A 1 413 ? 41.876 26.923 46.135  1.00 21.43 ? 414  GLY A N   1 
ATOM   3128 C  CA  . GLY A 1 413 ? 41.832 27.252 47.553  1.00 21.16 ? 414  GLY A CA  1 
ATOM   3129 C  C   . GLY A 1 413 ? 43.115 26.904 48.291  1.00 21.76 ? 414  GLY A C   1 
ATOM   3130 O  O   . GLY A 1 413 ? 43.858 26.015 47.873  1.00 22.69 ? 414  GLY A O   1 
ATOM   3131 N  N   . ILE A 1 414 ? 43.406 27.623 49.376  1.00 21.46 ? 415  ILE A N   1 
ATOM   3132 C  CA  . ILE A 1 414 ? 44.492 27.231 50.218  1.00 21.12 ? 415  ILE A CA  1 
ATOM   3133 C  C   . ILE A 1 414 ? 43.824 26.711 51.509  1.00 20.53 ? 415  ILE A C   1 
ATOM   3134 O  O   . ILE A 1 414 ? 42.823 27.232 52.025  1.00 18.82 ? 415  ILE A O   1 
ATOM   3135 C  CB  . ILE A 1 414 ? 45.465 28.505 50.360  1.00 23.47 ? 415  ILE A CB  1 
ATOM   3136 C  CG1 . ILE A 1 414 ? 46.565 28.271 51.397  1.00 24.47 ? 415  ILE A CG1 1 
ATOM   3137 C  CG2 . ILE A 1 414 ? 44.741 29.739 50.879  1.00 23.92 ? 415  ILE A CG2 1 
ATOM   3138 C  CD1 . ILE A 1 414 ? 47.524 27.083 51.177  1.00 26.14 ? 415  ILE A CD1 1 
ATOM   3139 N  N   . VAL A 1 415 ? 44.391 25.586 51.970  1.00 19.72 ? 416  VAL A N   1 
ATOM   3140 C  CA  . VAL A 1 415 ? 43.986 24.905 53.195  1.00 19.71 ? 416  VAL A CA  1 
ATOM   3141 C  C   . VAL A 1 415 ? 44.832 25.429 54.378  1.00 20.24 ? 416  VAL A C   1 
ATOM   3142 O  O   . VAL A 1 415 ? 46.067 25.433 54.368  1.00 21.52 ? 416  VAL A O   1 
ATOM   3143 C  CB  . VAL A 1 415 ? 44.172 23.353 53.002  1.00 19.77 ? 416  VAL A CB  1 
ATOM   3144 C  CG1 . VAL A 1 415 ? 43.706 22.630 54.271  1.00 20.09 ? 416  VAL A CG1 1 
ATOM   3145 C  CG2 . VAL A 1 415 ? 43.362 22.814 51.806  1.00 17.73 ? 416  VAL A CG2 1 
ATOM   3146 N  N   . LEU A 1 416 ? 44.191 25.860 55.459  1.00 19.21 ? 417  LEU A N   1 
ATOM   3147 C  CA  . LEU A 1 416 ? 44.935 26.469 56.512  1.00 18.17 ? 417  LEU A CA  1 
ATOM   3148 C  C   . LEU A 1 416 ? 45.050 25.475 57.657  1.00 17.34 ? 417  LEU A C   1 
ATOM   3149 O  O   . LEU A 1 416 ? 44.494 24.371 57.624  1.00 16.86 ? 417  LEU A O   1 
ATOM   3150 C  CB  . LEU A 1 416 ? 44.191 27.765 56.870  1.00 19.90 ? 417  LEU A CB  1 
ATOM   3151 C  CG  . LEU A 1 416 ? 43.823 28.767 55.732  1.00 21.24 ? 417  LEU A CG  1 
ATOM   3152 C  CD1 . LEU A 1 416 ? 43.233 30.029 56.352  1.00 21.42 ? 417  LEU A CD1 1 
ATOM   3153 C  CD2 . LEU A 1 416 ? 45.056 29.168 54.900  1.00 21.96 ? 417  LEU A CD2 1 
ATOM   3154 N  N   . ALA A 1 417 ? 45.866 25.794 58.658  1.00 15.94 ? 418  ALA A N   1 
ATOM   3155 C  CA  . ALA A 1 417 ? 45.993 24.960 59.848  1.00 15.84 ? 418  ALA A CA  1 
ATOM   3156 C  C   . ALA A 1 417 ? 44.634 24.696 60.532  1.00 15.57 ? 418  ALA A C   1 
ATOM   3157 O  O   . ALA A 1 417 ? 43.722 25.489 60.335  1.00 16.34 ? 418  ALA A O   1 
ATOM   3158 C  CB  . ALA A 1 417 ? 46.939 25.691 60.798  1.00 14.92 ? 418  ALA A CB  1 
ATOM   3159 N  N   . ASN A 1 418 ? 44.393 23.664 61.354  1.00 15.28 ? 419  ASN A N   1 
ATOM   3160 C  CA  . ASN A 1 418 ? 43.110 23.383 62.017  1.00 13.87 ? 419  ASN A CA  1 
ATOM   3161 C  C   . ASN A 1 418 ? 43.025 24.324 63.195  1.00 14.36 ? 419  ASN A C   1 
ATOM   3162 O  O   . ASN A 1 418 ? 43.311 23.938 64.314  1.00 15.82 ? 419  ASN A O   1 
ATOM   3163 C  CB  . ASN A 1 418 ? 43.095 21.925 62.516  1.00 12.76 ? 419  ASN A CB  1 
ATOM   3164 C  CG  . ASN A 1 418 ? 43.647 20.853 61.579  1.00 9.20  ? 419  ASN A CG  1 
ATOM   3165 O  OD1 . ASN A 1 418 ? 43.440 20.869 60.379  1.00 8.04  ? 419  ASN A OD1 1 
ATOM   3166 N  ND2 . ASN A 1 418 ? 44.311 19.849 62.113  1.00 8.38  ? 419  ASN A ND2 1 
ATOM   3167 N  N   . ALA A 1 419 ? 42.695 25.596 62.997  1.00 16.24 ? 420  ALA A N   1 
ATOM   3168 C  CA  . ALA A 1 419 ? 42.726 26.651 64.040  1.00 16.24 ? 420  ALA A CA  1 
ATOM   3169 C  C   . ALA A 1 419 ? 41.761 27.737 63.665  1.00 15.53 ? 420  ALA A C   1 
ATOM   3170 O  O   . ALA A 1 419 ? 41.350 27.805 62.511  1.00 15.74 ? 420  ALA A O   1 
ATOM   3171 C  CB  . ALA A 1 419 ? 44.100 27.337 64.146  1.00 16.58 ? 420  ALA A CB  1 
ATOM   3172 N  N   . CYS A 1 420 ? 41.392 28.593 64.618  1.00 15.72 ? 421  CYS A N   1 
ATOM   3173 C  CA  . CYS A 1 420 ? 40.483 29.704 64.367  1.00 16.26 ? 421  CYS A CA  1 
ATOM   3174 C  C   . CYS A 1 420 ? 40.866 30.535 63.160  1.00 15.35 ? 421  CYS A C   1 
ATOM   3175 O  O   . CYS A 1 420 ? 40.011 30.775 62.302  1.00 16.19 ? 421  CYS A O   1 
ATOM   3176 C  CB  . CYS A 1 420 ? 40.492 30.619 65.465  1.00 16.61 ? 421  CYS A CB  1 
ATOM   3177 S  SG  . CYS A 1 420 ? 39.959 29.755 66.913  1.00 24.13 ? 421  CYS A SG  1 
ATOM   3178 N  N   . GLY A 1 421 ? 42.133 31.006 63.178  1.00 13.86 ? 422  GLY A N   1 
ATOM   3179 C  CA  . GLY A 1 421 ? 42.729 31.773 62.078  1.00 14.59 ? 422  GLY A CA  1 
ATOM   3180 C  C   . GLY A 1 421 ? 42.102 33.169 61.811  1.00 14.21 ? 422  GLY A C   1 
ATOM   3181 O  O   . GLY A 1 421 ? 41.961 33.971 62.771  1.00 12.70 ? 422  GLY A O   1 
ATOM   3182 N  N   . PRO A 1 422 ? 41.688 33.456 60.527  1.00 12.94 ? 423  PRO A N   1 
ATOM   3183 C  CA  . PRO A 1 422 ? 41.059 34.700 60.137  1.00 14.32 ? 423  PRO A CA  1 
ATOM   3184 C  C   . PRO A 1 422 ? 39.844 35.047 61.003  1.00 16.10 ? 423  PRO A C   1 
ATOM   3185 O  O   . PRO A 1 422 ? 39.441 36.206 61.064  1.00 17.65 ? 423  PRO A O   1 
ATOM   3186 C  CB  . PRO A 1 422 ? 40.692 34.530 58.664  1.00 13.51 ? 423  PRO A CB  1 
ATOM   3187 C  CG  . PRO A 1 422 ? 41.754 33.601 58.100  1.00 12.16 ? 423  PRO A CG  1 
ATOM   3188 C  CD  . PRO A 1 422 ? 42.002 32.697 59.318  1.00 11.72 ? 423  PRO A CD  1 
ATOM   3189 N  N   . CYS A 1 423 ? 39.280 34.086 61.739  1.00 17.31 ? 424  CYS A N   1 
ATOM   3190 C  CA  . CYS A 1 423 ? 38.106 34.351 62.491  1.00 17.85 ? 424  CYS A CA  1 
ATOM   3191 C  C   . CYS A 1 423 ? 38.361 35.213 63.696  1.00 17.70 ? 424  CYS A C   1 
ATOM   3192 O  O   . CYS A 1 423 ? 37.482 36.009 63.954  1.00 17.61 ? 424  CYS A O   1 
ATOM   3193 C  CB  . CYS A 1 423 ? 37.572 32.992 62.751  1.00 19.57 ? 424  CYS A CB  1 
ATOM   3194 S  SG  . CYS A 1 423 ? 36.021 33.115 63.620  1.00 22.45 ? 424  CYS A SG  1 
ATOM   3195 N  N   . ILE A 1 424 ? 39.436 35.148 64.490  1.00 18.19 ? 425  ILE A N   1 
ATOM   3196 C  CA  . ILE A 1 424 ? 39.692 36.230 65.469  1.00 18.23 ? 425  ILE A CA  1 
ATOM   3197 C  C   . ILE A 1 424 ? 40.775 37.124 64.827  1.00 18.80 ? 425  ILE A C   1 
ATOM   3198 O  O   . ILE A 1 424 ? 41.737 37.522 65.484  1.00 19.68 ? 425  ILE A O   1 
ATOM   3199 C  CB  . ILE A 1 424 ? 40.283 35.787 66.854  1.00 18.86 ? 425  ILE A CB  1 
ATOM   3200 C  CG1 . ILE A 1 424 ? 40.394 34.279 66.934  1.00 20.05 ? 425  ILE A CG1 1 
ATOM   3201 C  CG2 . ILE A 1 424 ? 39.437 36.357 67.993  1.00 16.72 ? 425  ILE A CG2 1 
ATOM   3202 C  CD1 . ILE A 1 424 ? 41.658 33.796 66.248  1.00 20.92 ? 425  ILE A CD1 1 
ATOM   3203 N  N   . GLY A 1 425 ? 40.730 37.412 63.527  1.00 18.70 ? 426  GLY A N   1 
ATOM   3204 C  CA  . GLY A 1 425 ? 41.738 38.246 62.897  1.00 18.83 ? 426  GLY A CA  1 
ATOM   3205 C  C   . GLY A 1 425 ? 43.180 37.797 62.955  1.00 19.31 ? 426  GLY A C   1 
ATOM   3206 O  O   . GLY A 1 425 ? 44.050 38.672 62.980  1.00 19.45 ? 426  GLY A O   1 
ATOM   3207 N  N   . GLN A 1 426 ? 43.494 36.494 63.034  1.00 19.28 ? 427  GLN A N   1 
ATOM   3208 C  CA  . GLN A 1 426 ? 44.905 36.030 62.962  1.00 19.51 ? 427  GLN A CA  1 
ATOM   3209 C  C   . GLN A 1 426 ? 45.166 35.701 61.509  1.00 18.34 ? 427  GLN A C   1 
ATOM   3210 O  O   . GLN A 1 426 ? 45.394 34.563 61.140  1.00 16.74 ? 427  GLN A O   1 
ATOM   3211 C  CB  . GLN A 1 426 ? 45.218 34.726 63.739  1.00 19.45 ? 427  GLN A CB  1 
ATOM   3212 C  CG  . GLN A 1 426 ? 45.073 34.708 65.216  1.00 18.71 ? 427  GLN A CG  1 
ATOM   3213 C  CD  . GLN A 1 426 ? 46.368 35.162 65.822  1.00 19.89 ? 427  GLN A CD  1 
ATOM   3214 O  OE1 . GLN A 1 426 ? 47.404 34.517 65.726  1.00 20.00 ? 427  GLN A OE1 1 
ATOM   3215 N  NE2 . GLN A 1 426 ? 46.317 36.313 66.469  1.00 21.30 ? 427  GLN A NE2 1 
ATOM   3216 N  N   . TRP A 1 427 ? 45.127 36.738 60.705  1.00 18.65 ? 428  TRP A N   1 
ATOM   3217 C  CA  . TRP A 1 427 ? 45.251 36.646 59.270  1.00 19.41 ? 428  TRP A CA  1 
ATOM   3218 C  C   . TRP A 1 427 ? 46.353 37.640 58.967  1.00 20.85 ? 428  TRP A C   1 
ATOM   3219 O  O   . TRP A 1 427 ? 46.284 38.757 59.482  1.00 21.89 ? 428  TRP A O   1 
ATOM   3220 C  CB  . TRP A 1 427 ? 43.941 37.095 58.657  1.00 17.26 ? 428  TRP A CB  1 
ATOM   3221 C  CG  . TRP A 1 427 ? 43.755 37.029 57.142  1.00 16.85 ? 428  TRP A CG  1 
ATOM   3222 C  CD1 . TRP A 1 427 ? 44.698 36.510 56.265  1.00 16.11 ? 428  TRP A CD1 1 
ATOM   3223 C  CD2 . TRP A 1 427 ? 42.572 37.379 56.520  1.00 15.54 ? 428  TRP A CD2 1 
ATOM   3224 N  NE1 . TRP A 1 427 ? 44.104 36.504 55.090  1.00 16.99 ? 428  TRP A NE1 1 
ATOM   3225 C  CE2 . TRP A 1 427 ? 42.835 37.008 55.181  1.00 16.64 ? 428  TRP A CE2 1 
ATOM   3226 C  CE3 . TRP A 1 427 ? 41.335 37.928 56.883  1.00 14.44 ? 428  TRP A CE3 1 
ATOM   3227 C  CZ2 . TRP A 1 427 ? 41.825 37.191 54.203  1.00 16.28 ? 428  TRP A CZ2 1 
ATOM   3228 C  CZ3 . TRP A 1 427 ? 40.342 38.103 55.905  1.00 14.06 ? 428  TRP A CZ3 1 
ATOM   3229 C  CH2 . TRP A 1 427 ? 40.576 37.739 54.578  1.00 14.27 ? 428  TRP A CH2 1 
ATOM   3230 N  N   . ASP A 1 428 ? 47.402 37.305 58.219  1.00 22.38 ? 429  ASP A N   1 
ATOM   3231 C  CA  . ASP A 1 428 ? 48.295 38.339 57.738  1.00 23.50 ? 429  ASP A CA  1 
ATOM   3232 C  C   . ASP A 1 428 ? 47.812 38.610 56.338  1.00 23.33 ? 429  ASP A C   1 
ATOM   3233 O  O   . ASP A 1 428 ? 48.329 38.051 55.371  1.00 22.43 ? 429  ASP A O   1 
ATOM   3234 C  CB  . ASP A 1 428 ? 49.698 37.852 57.677  1.00 26.74 ? 429  ASP A CB  1 
ATOM   3235 C  CG  . ASP A 1 428 ? 50.709 38.917 57.248  1.00 28.83 ? 429  ASP A CG  1 
ATOM   3236 O  OD1 . ASP A 1 428 ? 50.633 40.058 57.725  1.00 29.90 ? 429  ASP A OD1 1 
ATOM   3237 O  OD2 . ASP A 1 428 ? 51.570 38.569 56.436  1.00 31.24 ? 429  ASP A OD2 1 
ATOM   3238 N  N   . ARG A 1 429 ? 46.812 39.483 56.236  1.00 24.70 ? 430  ARG A N   1 
ATOM   3239 C  CA  . ARG A 1 429 ? 46.177 39.736 54.954  1.00 27.06 ? 430  ARG A CA  1 
ATOM   3240 C  C   . ARG A 1 429 ? 46.865 40.871 54.211  1.00 29.32 ? 430  ARG A C   1 
ATOM   3241 O  O   . ARG A 1 429 ? 47.128 41.930 54.794  1.00 30.43 ? 430  ARG A O   1 
ATOM   3242 C  CB  . ARG A 1 429 ? 44.714 40.038 55.219  1.00 25.41 ? 430  ARG A CB  1 
ATOM   3243 C  CG  . ARG A 1 429 ? 44.051 41.097 54.355  1.00 25.07 ? 430  ARG A CG  1 
ATOM   3244 C  CD  . ARG A 1 429 ? 42.844 40.573 53.662  1.00 23.53 ? 430  ARG A CD  1 
ATOM   3245 N  NE  . ARG A 1 429 ? 41.672 41.357 53.986  1.00 21.11 ? 430  ARG A NE  1 
ATOM   3246 C  CZ  . ARG A 1 429 ? 40.682 41.558 53.141  1.00 18.87 ? 430  ARG A CZ  1 
ATOM   3247 N  NH1 . ARG A 1 429 ? 40.744 41.186 51.857  1.00 14.88 ? 430  ARG A NH1 1 
ATOM   3248 N  NH2 . ARG A 1 429 ? 39.659 42.207 53.683  1.00 17.15 ? 430  ARG A NH2 1 
ATOM   3249 N  N   . LYS A 1 430 ? 47.166 40.711 52.915  1.00 31.35 ? 431  LYS A N   1 
ATOM   3250 C  CA  . LYS A 1 430 ? 47.833 41.806 52.225  1.00 32.85 ? 431  LYS A CA  1 
ATOM   3251 C  C   . LYS A 1 430 ? 47.321 42.303 50.886  1.00 32.92 ? 431  LYS A C   1 
ATOM   3252 O  O   . LYS A 1 430 ? 47.975 43.175 50.315  1.00 33.46 ? 431  LYS A O   1 
ATOM   3253 C  CB  . LYS A 1 430 ? 49.337 41.454 52.111  1.00 34.41 ? 431  LYS A CB  1 
ATOM   3254 C  CG  . LYS A 1 430 ? 50.056 41.705 53.444  1.00 35.92 ? 431  LYS A CG  1 
ATOM   3255 C  CD  . LYS A 1 430 ? 51.557 41.651 53.291  1.00 38.61 ? 431  LYS A CD  1 
ATOM   3256 C  CE  . LYS A 1 430 ? 52.219 42.121 54.568  1.00 41.22 ? 431  LYS A CE  1 
ATOM   3257 N  NZ  . LYS A 1 430 ? 52.036 41.150 55.614  1.00 43.43 ? 431  LYS A NZ  1 
ATOM   3258 N  N   . ASP A 1 431 ? 46.185 41.804 50.383  1.00 32.81 ? 432  ASP A N   1 
ATOM   3259 C  CA  . ASP A 1 431 ? 45.545 42.288 49.143  1.00 33.45 ? 432  ASP A CA  1 
ATOM   3260 C  C   . ASP A 1 431 ? 44.834 43.673 49.216  1.00 34.40 ? 432  ASP A C   1 
ATOM   3261 O  O   . ASP A 1 431 ? 44.326 44.143 48.198  1.00 35.13 ? 432  ASP A O   1 
ATOM   3262 C  CB  . ASP A 1 431 ? 44.528 41.214 48.674  1.00 32.31 ? 432  ASP A CB  1 
ATOM   3263 C  CG  . ASP A 1 431 ? 43.402 40.889 49.684  1.00 31.30 ? 432  ASP A CG  1 
ATOM   3264 O  OD1 . ASP A 1 431 ? 43.719 40.702 50.858  1.00 29.99 ? 432  ASP A OD1 1 
ATOM   3265 O  OD2 . ASP A 1 431 ? 42.227 40.835 49.292  1.00 29.71 ? 432  ASP A OD2 1 
ATOM   3266 N  N   . ILE A 1 432 ? 44.802 44.413 50.337  1.00 35.46 ? 433  ILE A N   1 
ATOM   3267 C  CA  . ILE A 1 432 ? 44.031 45.649 50.497  1.00 37.19 ? 433  ILE A CA  1 
ATOM   3268 C  C   . ILE A 1 432 ? 44.893 46.638 51.288  1.00 39.51 ? 433  ILE A C   1 
ATOM   3269 O  O   . ILE A 1 432 ? 45.668 46.161 52.110  1.00 39.30 ? 433  ILE A O   1 
ATOM   3270 C  CB  . ILE A 1 432 ? 42.675 45.495 51.332  1.00 36.46 ? 433  ILE A CB  1 
ATOM   3271 C  CG1 . ILE A 1 432 ? 42.862 44.581 52.565  1.00 36.40 ? 433  ILE A CG1 1 
ATOM   3272 C  CG2 . ILE A 1 432 ? 41.583 44.995 50.422  1.00 35.51 ? 433  ILE A CG2 1 
ATOM   3273 C  CD1 . ILE A 1 432 ? 42.325 45.084 53.946  1.00 35.02 ? 433  ILE A CD1 1 
ATOM   3274 N  N   . LYS A 1 433 ? 44.882 47.990 51.175  1.00 41.94 ? 434  LYS A N   1 
ATOM   3275 C  CA  . LYS A 1 433 ? 45.652 48.817 52.111  1.00 44.53 ? 434  LYS A CA  1 
ATOM   3276 C  C   . LYS A 1 433 ? 44.803 48.954 53.358  1.00 44.10 ? 434  LYS A C   1 
ATOM   3277 O  O   . LYS A 1 433 ? 43.684 48.449 53.348  1.00 44.21 ? 434  LYS A O   1 
ATOM   3278 C  CB  . LYS A 1 433 ? 45.954 50.222 51.540  1.00 47.31 ? 434  LYS A CB  1 
ATOM   3279 C  CG  . LYS A 1 433 ? 44.760 51.225 51.450  1.00 50.65 ? 434  LYS A CG  1 
ATOM   3280 C  CD  . LYS A 1 433 ? 45.118 52.732 51.610  1.00 51.00 ? 434  LYS A CD  1 
ATOM   3281 C  CE  . LYS A 1 433 ? 43.880 53.616 51.413  1.00 50.98 ? 434  LYS A CE  1 
ATOM   3282 N  NZ  . LYS A 1 433 ? 42.919 53.428 52.495  1.00 51.54 ? 434  LYS A NZ  1 
ATOM   3283 N  N   . LYS A 1 434 ? 45.207 49.605 54.448  1.00 44.80 ? 435  LYS A N   1 
ATOM   3284 C  CA  . LYS A 1 434 ? 44.243 49.716 55.559  1.00 46.20 ? 435  LYS A CA  1 
ATOM   3285 C  C   . LYS A 1 434 ? 43.160 50.763 55.173  1.00 45.12 ? 435  LYS A C   1 
ATOM   3286 O  O   . LYS A 1 434 ? 43.499 51.689 54.429  1.00 46.24 ? 435  LYS A O   1 
ATOM   3287 C  CB  . LYS A 1 434 ? 44.968 50.149 56.862  1.00 48.60 ? 435  LYS A CB  1 
ATOM   3288 C  CG  . LYS A 1 434 ? 44.244 49.632 58.149  1.00 51.61 ? 435  LYS A CG  1 
ATOM   3289 C  CD  . LYS A 1 434 ? 44.196 48.060 58.250  1.00 53.30 ? 435  LYS A CD  1 
ATOM   3290 C  CE  . LYS A 1 434 ? 45.036 47.392 59.375  1.00 53.75 ? 435  LYS A CE  1 
ATOM   3291 N  NZ  . LYS A 1 434 ? 44.652 47.891 60.694  1.00 54.50 ? 435  LYS A NZ  1 
ATOM   3292 N  N   . GLY A 1 435 ? 41.867 50.690 55.544  1.00 42.92 ? 436  GLY A N   1 
ATOM   3293 C  CA  . GLY A 1 435 ? 40.878 51.722 55.170  1.00 40.15 ? 436  GLY A CA  1 
ATOM   3294 C  C   . GLY A 1 435 ? 40.302 51.631 53.743  1.00 38.52 ? 436  GLY A C   1 
ATOM   3295 O  O   . GLY A 1 435 ? 39.464 52.451 53.330  1.00 37.26 ? 436  GLY A O   1 
ATOM   3296 N  N   . GLU A 1 436 ? 40.725 50.568 53.039  1.00 36.97 ? 437  GLU A N   1 
ATOM   3297 C  CA  . GLU A 1 436 ? 40.208 50.299 51.732  1.00 36.35 ? 437  GLU A CA  1 
ATOM   3298 C  C   . GLU A 1 436 ? 38.879 49.555 51.989  1.00 36.12 ? 437  GLU A C   1 
ATOM   3299 O  O   . GLU A 1 436 ? 38.700 48.747 52.903  1.00 36.43 ? 437  GLU A O   1 
ATOM   3300 C  CB  . GLU A 1 436 ? 41.255 49.462 50.995  1.00 37.11 ? 437  GLU A CB  1 
ATOM   3301 C  CG  . GLU A 1 436 ? 41.166 49.627 49.496  1.00 37.83 ? 437  GLU A CG  1 
ATOM   3302 C  CD  . GLU A 1 436 ? 42.010 48.665 48.657  1.00 38.67 ? 437  GLU A CD  1 
ATOM   3303 O  OE1 . GLU A 1 436 ? 43.160 48.410 49.010  1.00 38.51 ? 437  GLU A OE1 1 
ATOM   3304 O  OE2 . GLU A 1 436 ? 41.522 48.199 47.617  1.00 38.12 ? 437  GLU A OE2 1 
ATOM   3305 N  N   . LYS A 1 437 ? 37.878 49.877 51.202  1.00 35.48 ? 438  LYS A N   1 
ATOM   3306 C  CA  . LYS A 1 437 ? 36.533 49.358 51.348  1.00 34.53 ? 438  LYS A CA  1 
ATOM   3307 C  C   . LYS A 1 437 ? 36.467 48.085 50.516  1.00 32.97 ? 438  LYS A C   1 
ATOM   3308 O  O   . LYS A 1 437 ? 36.769 48.133 49.317  1.00 32.76 ? 438  LYS A O   1 
ATOM   3309 C  CB  . LYS A 1 437 ? 35.600 50.420 50.823  1.00 36.32 ? 438  LYS A CB  1 
ATOM   3310 C  CG  . LYS A 1 437 ? 34.116 50.277 50.966  1.00 38.64 ? 438  LYS A CG  1 
ATOM   3311 C  CD  . LYS A 1 437 ? 33.445 51.453 50.222  1.00 41.99 ? 438  LYS A CD  1 
ATOM   3312 C  CE  . LYS A 1 437 ? 32.130 52.034 50.822  1.00 43.73 ? 438  LYS A CE  1 
ATOM   3313 N  NZ  . LYS A 1 437 ? 32.401 52.689 52.097  1.00 46.67 ? 438  LYS A NZ  1 
ATOM   3314 N  N   . ASN A 1 438 ? 36.110 46.935 51.116  1.00 31.17 ? 439  ASN A N   1 
ATOM   3315 C  CA  . ASN A 1 438 ? 35.970 45.688 50.336  1.00 28.99 ? 439  ASN A CA  1 
ATOM   3316 C  C   . ASN A 1 438 ? 34.969 44.695 50.895  1.00 26.91 ? 439  ASN A C   1 
ATOM   3317 O  O   . ASN A 1 438 ? 34.518 44.852 52.026  1.00 25.04 ? 439  ASN A O   1 
ATOM   3318 C  CB  . ASN A 1 438 ? 37.322 44.962 50.204  1.00 28.21 ? 439  ASN A CB  1 
ATOM   3319 C  CG  . ASN A 1 438 ? 37.978 44.422 51.480  1.00 26.96 ? 439  ASN A CG  1 
ATOM   3320 O  OD1 . ASN A 1 438 ? 37.905 44.916 52.604  1.00 24.24 ? 439  ASN A OD1 1 
ATOM   3321 N  ND2 . ASN A 1 438 ? 38.652 43.307 51.260  1.00 27.98 ? 439  ASN A ND2 1 
ATOM   3322 N  N   . THR A 1 439 ? 34.617 43.706 50.088  1.00 25.51 ? 440  THR A N   1 
ATOM   3323 C  CA  . THR A 1 439 ? 33.751 42.659 50.579  1.00 26.85 ? 440  THR A CA  1 
ATOM   3324 C  C   . THR A 1 439 ? 34.404 41.251 50.677  1.00 27.96 ? 440  THR A C   1 
ATOM   3325 O  O   . THR A 1 439 ? 34.939 40.686 49.701  1.00 28.49 ? 440  THR A O   1 
ATOM   3326 C  CB  . THR A 1 439 ? 32.491 42.633 49.666  1.00 26.53 ? 440  THR A CB  1 
ATOM   3327 O  OG1 . THR A 1 439 ? 31.711 43.791 49.992  1.00 25.62 ? 440  THR A OG1 1 
ATOM   3328 C  CG2 . THR A 1 439 ? 31.610 41.406 49.871  1.00 25.87 ? 440  THR A CG2 1 
ATOM   3329 N  N   . ILE A 1 440 ? 34.298 40.656 51.889  1.00 27.69 ? 441  ILE A N   1 
ATOM   3330 C  CA  . ILE A 1 440 ? 34.750 39.281 52.171  1.00 26.86 ? 441  ILE A CA  1 
ATOM   3331 C  C   . ILE A 1 440 ? 33.529 38.418 52.603  1.00 25.68 ? 441  ILE A C   1 
ATOM   3332 O  O   . ILE A 1 440 ? 32.783 38.844 53.476  1.00 25.72 ? 441  ILE A O   1 
ATOM   3333 C  CB  . ILE A 1 440 ? 35.885 39.253 53.324  1.00 26.53 ? 441  ILE A CB  1 
ATOM   3334 C  CG1 . ILE A 1 440 ? 35.403 39.784 54.691  1.00 27.41 ? 441  ILE A CG1 1 
ATOM   3335 C  CG2 . ILE A 1 440 ? 37.064 40.128 52.867  1.00 25.43 ? 441  ILE A CG2 1 
ATOM   3336 C  CD1 . ILE A 1 440 ? 36.197 39.315 55.948  1.00 26.22 ? 441  ILE A CD1 1 
ATOM   3337 N  N   . VAL A 1 441 ? 33.183 37.247 52.045  1.00 24.56 ? 442  VAL A N   1 
ATOM   3338 C  CA  . VAL A 1 441 ? 32.026 36.482 52.531  1.00 22.62 ? 442  VAL A CA  1 
ATOM   3339 C  C   . VAL A 1 441 ? 32.593 35.292 53.301  1.00 21.99 ? 442  VAL A C   1 
ATOM   3340 O  O   . VAL A 1 441 ? 33.536 34.644 52.822  1.00 21.63 ? 442  VAL A O   1 
ATOM   3341 C  CB  . VAL A 1 441 ? 31.126 35.976 51.358  1.00 21.99 ? 442  VAL A CB  1 
ATOM   3342 C  CG1 . VAL A 1 441 ? 30.552 37.152 50.607  1.00 22.68 ? 442  VAL A CG1 1 
ATOM   3343 C  CG2 . VAL A 1 441 ? 31.914 35.318 50.264  1.00 23.40 ? 442  VAL A CG2 1 
ATOM   3344 N  N   . THR A 1 442 ? 32.069 34.997 54.499  1.00 20.65 ? 443  THR A N   1 
ATOM   3345 C  CA  . THR A 1 442 ? 32.561 33.904 55.351  1.00 19.42 ? 443  THR A CA  1 
ATOM   3346 C  C   . THR A 1 442 ? 31.452 32.934 55.755  1.00 19.14 ? 443  THR A C   1 
ATOM   3347 O  O   . THR A 1 442 ? 30.269 33.283 55.673  1.00 18.98 ? 443  THR A O   1 
ATOM   3348 C  CB  . THR A 1 442 ? 33.177 34.397 56.690  1.00 18.40 ? 443  THR A CB  1 
ATOM   3349 O  OG1 . THR A 1 442 ? 32.078 34.837 57.499  1.00 19.80 ? 443  THR A OG1 1 
ATOM   3350 C  CG2 . THR A 1 442 ? 34.203 35.508 56.525  1.00 17.18 ? 443  THR A CG2 1 
ATOM   3351 N  N   . SER A 1 443 ? 31.837 31.734 56.195  1.00 17.60 ? 444  SER A N   1 
ATOM   3352 C  CA  . SER A 1 443 ? 30.870 30.835 56.779  1.00 16.66 ? 444  SER A CA  1 
ATOM   3353 C  C   . SER A 1 443 ? 31.055 30.893 58.305  1.00 16.27 ? 444  SER A C   1 
ATOM   3354 O  O   . SER A 1 443 ? 30.830 29.907 59.020  1.00 15.56 ? 444  SER A O   1 
ATOM   3355 C  CB  . SER A 1 443 ? 31.105 29.423 56.228  1.00 17.05 ? 444  SER A CB  1 
ATOM   3356 O  OG  . SER A 1 443 ? 32.285 28.793 56.785  1.00 17.22 ? 444  SER A OG  1 
ATOM   3357 N  N   . TYR A 1 444 ? 31.455 32.056 58.851  1.00 15.29 ? 445  TYR A N   1 
ATOM   3358 C  CA  . TYR A 1 444 ? 31.685 32.164 60.288  1.00 15.01 ? 445  TYR A CA  1 
ATOM   3359 C  C   . TYR A 1 444 ? 30.414 32.590 61.030  1.00 14.04 ? 445  TYR A C   1 
ATOM   3360 O  O   . TYR A 1 444 ? 29.317 32.198 60.665  1.00 14.37 ? 445  TYR A O   1 
ATOM   3361 C  CB  . TYR A 1 444 ? 32.897 33.174 60.568  1.00 14.38 ? 445  TYR A CB  1 
ATOM   3362 C  CG  . TYR A 1 444 ? 34.257 32.877 59.869  1.00 14.26 ? 445  TYR A CG  1 
ATOM   3363 C  CD1 . TYR A 1 444 ? 34.498 31.658 59.231  1.00 13.19 ? 445  TYR A CD1 1 
ATOM   3364 C  CD2 . TYR A 1 444 ? 35.275 33.860 59.803  1.00 14.46 ? 445  TYR A CD2 1 
ATOM   3365 C  CE1 . TYR A 1 444 ? 35.712 31.410 58.600  1.00 13.55 ? 445  TYR A CE1 1 
ATOM   3366 C  CE2 . TYR A 1 444 ? 36.502 33.603 59.175  1.00 13.31 ? 445  TYR A CE2 1 
ATOM   3367 C  CZ  . TYR A 1 444 ? 36.701 32.382 58.551  1.00 13.62 ? 445  TYR A CZ  1 
ATOM   3368 O  OH  . TYR A 1 444 ? 37.900 32.072 57.923  1.00 18.11 ? 445  TYR A OH  1 
ATOM   3369 N  N   . ASN A 1 445 ? 30.493 33.359 62.098  1.00 14.40 ? 446  ASN A N   1 
ATOM   3370 C  CA  . ASN A 1 445 ? 29.346 33.797 62.847  1.00 14.30 ? 446  ASN A CA  1 
ATOM   3371 C  C   . ASN A 1 445 ? 29.287 35.259 63.225  1.00 15.28 ? 446  ASN A C   1 
ATOM   3372 O  O   . ASN A 1 445 ? 28.195 35.746 63.474  1.00 17.09 ? 446  ASN A O   1 
ATOM   3373 C  CB  . ASN A 1 445 ? 29.250 32.996 64.119  1.00 14.15 ? 446  ASN A CB  1 
ATOM   3374 C  CG  . ASN A 1 445 ? 30.533 32.953 64.951  1.00 15.00 ? 446  ASN A CG  1 
ATOM   3375 O  OD1 . ASN A 1 445 ? 30.978 33.966 65.502  1.00 16.03 ? 446  ASN A OD1 1 
ATOM   3376 N  ND2 . ASN A 1 445 ? 31.152 31.765 65.063  1.00 14.27 ? 446  ASN A ND2 1 
ATOM   3377 N  N   . ARG A 1 446 ? 30.380 35.988 63.402  1.00 16.34 ? 447  ARG A N   1 
ATOM   3378 C  CA  . ARG A 1 446 ? 30.348 37.408 63.811  1.00 17.60 ? 447  ARG A CA  1 
ATOM   3379 C  C   . ARG A 1 446 ? 31.051 38.099 62.660  1.00 18.72 ? 447  ARG A C   1 
ATOM   3380 O  O   . ARG A 1 446 ? 31.810 37.468 61.908  1.00 18.44 ? 447  ARG A O   1 
ATOM   3381 C  CB  . ARG A 1 446 ? 31.152 37.762 65.078  1.00 16.14 ? 447  ARG A CB  1 
ATOM   3382 C  CG  . ARG A 1 446 ? 30.540 37.264 66.349  1.00 16.56 ? 447  ARG A CG  1 
ATOM   3383 C  CD  . ARG A 1 446 ? 31.551 36.832 67.386  1.00 16.90 ? 447  ARG A CD  1 
ATOM   3384 N  NE  . ARG A 1 446 ? 30.688 36.408 68.448  1.00 17.52 ? 447  ARG A NE  1 
ATOM   3385 C  CZ  . ARG A 1 446 ? 31.078 35.903 69.613  1.00 19.81 ? 447  ARG A CZ  1 
ATOM   3386 N  NH1 . ARG A 1 446 ? 32.341 35.607 69.847  1.00 20.02 ? 447  ARG A NH1 1 
ATOM   3387 N  NH2 . ARG A 1 446 ? 30.133 35.569 70.511  1.00 17.97 ? 447  ARG A NH2 1 
ATOM   3388 N  N   . ASN A 1 447 ? 30.678 39.382 62.522  1.00 19.89 ? 448  ASN A N   1 
ATOM   3389 C  CA  . ASN A 1 447 ? 31.172 40.257 61.458  1.00 21.72 ? 448  ASN A CA  1 
ATOM   3390 C  C   . ASN A 1 447 ? 31.333 41.746 61.815  1.00 21.56 ? 448  ASN A C   1 
ATOM   3391 O  O   . ASN A 1 447 ? 31.221 42.655 60.988  1.00 22.92 ? 448  ASN A O   1 
ATOM   3392 C  CB  . ASN A 1 447 ? 30.238 40.073 60.188  1.00 22.15 ? 448  ASN A CB  1 
ATOM   3393 C  CG  . ASN A 1 447 ? 28.753 40.173 60.445  1.00 21.60 ? 448  ASN A CG  1 
ATOM   3394 O  OD1 . ASN A 1 447 ? 28.339 40.447 61.553  1.00 22.59 ? 448  ASN A OD1 1 
ATOM   3395 N  ND2 . ASN A 1 447 ? 27.898 40.060 59.461  1.00 20.43 ? 448  ASN A ND2 1 
ATOM   3396 N  N   . PHE A 1 448 ? 31.716 41.883 63.077  1.00 21.16 ? 449  PHE A N   1 
ATOM   3397 C  CA  . PHE A 1 448 ? 32.048 43.122 63.739  1.00 22.39 ? 449  PHE A CA  1 
ATOM   3398 C  C   . PHE A 1 448 ? 33.279 43.816 63.175  1.00 24.09 ? 449  PHE A C   1 
ATOM   3399 O  O   . PHE A 1 448 ? 34.263 43.195 62.747  1.00 23.30 ? 449  PHE A O   1 
ATOM   3400 C  CB  . PHE A 1 448 ? 32.288 42.890 65.243  1.00 22.00 ? 449  PHE A CB  1 
ATOM   3401 C  CG  . PHE A 1 448 ? 31.098 42.244 65.910  1.00 22.25 ? 449  PHE A CG  1 
ATOM   3402 C  CD1 . PHE A 1 448 ? 29.816 42.364 65.358  1.00 21.99 ? 449  PHE A CD1 1 
ATOM   3403 C  CD2 . PHE A 1 448 ? 31.306 41.563 67.101  1.00 22.24 ? 449  PHE A CD2 1 
ATOM   3404 C  CE1 . PHE A 1 448 ? 28.746 41.802 66.014  1.00 22.64 ? 449  PHE A CE1 1 
ATOM   3405 C  CE2 . PHE A 1 448 ? 30.227 40.996 67.765  1.00 22.77 ? 449  PHE A CE2 1 
ATOM   3406 C  CZ  . PHE A 1 448 ? 28.954 41.123 67.216  1.00 24.40 ? 449  PHE A CZ  1 
ATOM   3407 N  N   . THR A 1 449 ? 33.161 45.153 63.268  1.00 25.84 ? 450  THR A N   1 
ATOM   3408 C  CA  . THR A 1 449 ? 34.099 46.124 62.711  1.00 27.57 ? 450  THR A CA  1 
ATOM   3409 C  C   . THR A 1 449 ? 35.527 45.725 62.992  1.00 27.57 ? 450  THR A C   1 
ATOM   3410 O  O   . THR A 1 449 ? 35.843 45.470 64.153  1.00 28.07 ? 450  THR A O   1 
ATOM   3411 C  CB  . THR A 1 449 ? 33.823 47.528 63.307  1.00 28.65 ? 450  THR A CB  1 
ATOM   3412 O  OG1 . THR A 1 449 ? 32.400 47.718 63.424  1.00 29.88 ? 450  THR A OG1 1 
ATOM   3413 C  CG2 . THR A 1 449 ? 34.309 48.642 62.372  1.00 28.90 ? 450  THR A CG2 1 
ATOM   3414 N  N   . GLY A 1 450 ? 36.319 45.529 61.923  1.00 27.11 ? 451  GLY A N   1 
ATOM   3415 C  CA  . GLY A 1 450 ? 37.732 45.192 62.057  1.00 25.75 ? 451  GLY A CA  1 
ATOM   3416 C  C   . GLY A 1 450 ? 38.130 43.868 62.686  1.00 23.82 ? 451  GLY A C   1 
ATOM   3417 O  O   . GLY A 1 450 ? 39.298 43.581 62.924  1.00 22.53 ? 451  GLY A O   1 
ATOM   3418 N  N   . ARG A 1 451 ? 37.175 42.994 62.865  1.00 23.20 ? 452  ARG A N   1 
ATOM   3419 C  CA  . ARG A 1 451 ? 37.461 41.786 63.587  1.00 21.86 ? 452  ARG A CA  1 
ATOM   3420 C  C   . ARG A 1 451 ? 38.314 40.792 62.823  1.00 20.17 ? 452  ARG A C   1 
ATOM   3421 O  O   . ARG A 1 451 ? 39.100 40.135 63.475  1.00 19.52 ? 452  ARG A O   1 
ATOM   3422 C  CB  . ARG A 1 451 ? 36.110 41.208 64.000  1.00 21.98 ? 452  ARG A CB  1 
ATOM   3423 C  CG  . ARG A 1 451 ? 36.278 39.914 64.777  1.00 23.17 ? 452  ARG A CG  1 
ATOM   3424 C  CD  . ARG A 1 451 ? 34.960 39.205 65.063  1.00 24.90 ? 452  ARG A CD  1 
ATOM   3425 N  NE  . ARG A 1 451 ? 35.256 37.791 65.239  1.00 24.71 ? 452  ARG A NE  1 
ATOM   3426 C  CZ  . ARG A 1 451 ? 35.297 37.152 66.405  1.00 25.82 ? 452  ARG A CZ  1 
ATOM   3427 N  NH1 . ARG A 1 451 ? 35.154 37.756 67.578  1.00 26.30 ? 452  ARG A NH1 1 
ATOM   3428 N  NH2 . ARG A 1 451 ? 35.577 35.853 66.389  1.00 25.39 ? 452  ARG A NH2 1 
ATOM   3429 N  N   . ASN A 1 452 ? 38.232 40.680 61.499  1.00 20.16 ? 453  ASN A N   1 
ATOM   3430 C  CA  . ASN A 1 452 ? 38.985 39.694 60.745  1.00 20.79 ? 453  ASN A CA  1 
ATOM   3431 C  C   . ASN A 1 452 ? 40.315 40.148 60.195  1.00 21.46 ? 453  ASN A C   1 
ATOM   3432 O  O   . ASN A 1 452 ? 41.208 39.336 59.940  1.00 21.81 ? 453  ASN A O   1 
ATOM   3433 C  CB  . ASN A 1 452 ? 38.150 39.166 59.586  1.00 20.83 ? 453  ASN A CB  1 
ATOM   3434 C  CG  . ASN A 1 452 ? 36.821 38.569 60.029  1.00 20.94 ? 453  ASN A CG  1 
ATOM   3435 O  OD1 . ASN A 1 452 ? 35.784 39.169 59.737  1.00 20.75 ? 453  ASN A OD1 1 
ATOM   3436 N  ND2 . ASN A 1 452 ? 36.726 37.461 60.777  1.00 21.71 ? 453  ASN A ND2 1 
ATOM   3437 N  N   . ASP A 1 453 ? 40.461 41.441 59.989  1.00 21.98 ? 454  ASP A N   1 
ATOM   3438 C  CA  . ASP A 1 453 ? 41.716 41.982 59.500  1.00 23.30 ? 454  ASP A CA  1 
ATOM   3439 C  C   . ASP A 1 453 ? 42.073 43.332 60.097  1.00 24.26 ? 454  ASP A C   1 
ATOM   3440 O  O   . ASP A 1 453 ? 42.871 44.036 59.481  1.00 25.77 ? 454  ASP A O   1 
ATOM   3441 C  CB  . ASP A 1 453 ? 41.651 42.138 57.988  1.00 20.91 ? 454  ASP A CB  1 
ATOM   3442 C  CG  . ASP A 1 453 ? 40.488 42.994 57.485  1.00 20.42 ? 454  ASP A CG  1 
ATOM   3443 O  OD1 . ASP A 1 453 ? 39.698 43.560 58.253  1.00 21.36 ? 454  ASP A OD1 1 
ATOM   3444 O  OD2 . ASP A 1 453 ? 40.330 43.057 56.270  1.00 20.64 ? 454  ASP A OD2 1 
ATOM   3445 N  N   . ALA A 1 454 ? 41.515 43.730 61.245  1.00 24.96 ? 455  ALA A N   1 
ATOM   3446 C  CA  . ALA A 1 454 ? 41.738 45.043 61.806  1.00 26.33 ? 455  ALA A CA  1 
ATOM   3447 C  C   . ALA A 1 454 ? 41.438 46.188 60.807  1.00 28.19 ? 455  ALA A C   1 
ATOM   3448 O  O   . ALA A 1 454 ? 41.838 47.334 61.060  1.00 29.08 ? 455  ALA A O   1 
ATOM   3449 C  CB  . ALA A 1 454 ? 43.190 45.158 62.317  1.00 23.55 ? 455  ALA A CB  1 
ATOM   3450 N  N   . ASN A 1 455 ? 40.715 45.944 59.680  1.00 29.12 ? 456  ASN A N   1 
ATOM   3451 C  CA  . ASN A 1 455 ? 40.370 47.013 58.751  1.00 30.71 ? 456  ASN A CA  1 
ATOM   3452 C  C   . ASN A 1 455 ? 38.912 47.376 58.924  1.00 32.31 ? 456  ASN A C   1 
ATOM   3453 O  O   . ASN A 1 455 ? 38.055 46.618 58.487  1.00 33.43 ? 456  ASN A O   1 
ATOM   3454 C  CB  . ASN A 1 455 ? 40.593 46.637 57.262  1.00 29.20 ? 456  ASN A CB  1 
ATOM   3455 C  CG  . ASN A 1 455 ? 40.157 47.732 56.311  1.00 27.57 ? 456  ASN A CG  1 
ATOM   3456 O  OD1 . ASN A 1 455 ? 39.921 48.870 56.706  1.00 28.10 ? 456  ASN A OD1 1 
ATOM   3457 N  ND2 . ASN A 1 455 ? 40.016 47.382 55.039  1.00 26.87 ? 456  ASN A ND2 1 
ATOM   3458 N  N   . PRO A 1 456 ? 38.583 48.531 59.529  1.00 33.56 ? 457  PRO A N   1 
ATOM   3459 C  CA  . PRO A 1 456 ? 37.201 48.912 59.798  1.00 33.74 ? 457  PRO A CA  1 
ATOM   3460 C  C   . PRO A 1 456 ? 36.277 49.145 58.617  1.00 33.26 ? 457  PRO A C   1 
ATOM   3461 O  O   . PRO A 1 456 ? 35.059 49.177 58.786  1.00 33.11 ? 457  PRO A O   1 
ATOM   3462 C  CB  . PRO A 1 456 ? 37.343 50.126 60.729  1.00 34.13 ? 457  PRO A CB  1 
ATOM   3463 C  CG  . PRO A 1 456 ? 38.706 50.685 60.424  1.00 34.39 ? 457  PRO A CG  1 
ATOM   3464 C  CD  . PRO A 1 456 ? 39.506 49.418 60.258  1.00 33.78 ? 457  PRO A CD  1 
ATOM   3465 N  N   . GLU A 1 457 ? 36.822 49.187 57.411  1.00 33.72 ? 458  GLU A N   1 
ATOM   3466 C  CA  . GLU A 1 457 ? 35.994 49.324 56.247  1.00 33.82 ? 458  GLU A CA  1 
ATOM   3467 C  C   . GLU A 1 457 ? 35.827 47.997 55.497  1.00 32.56 ? 458  GLU A C   1 
ATOM   3468 O  O   . GLU A 1 457 ? 35.372 47.994 54.354  1.00 33.06 ? 458  GLU A O   1 
ATOM   3469 C  CB  . GLU A 1 457 ? 36.631 50.438 55.398  1.00 36.60 ? 458  GLU A CB  1 
ATOM   3470 C  CG  . GLU A 1 457 ? 35.904 51.770 55.427  1.00 41.23 ? 458  GLU A CG  1 
ATOM   3471 C  CD  . GLU A 1 457 ? 34.705 51.839 54.478  1.00 45.67 ? 458  GLU A CD  1 
ATOM   3472 O  OE1 . GLU A 1 457 ? 33.605 51.400 54.856  1.00 48.78 ? 458  GLU A OE1 1 
ATOM   3473 O  OE2 . GLU A 1 457 ? 34.896 52.351 53.369  1.00 47.59 ? 458  GLU A OE2 1 
ATOM   3474 N  N   . THR A 1 458 ? 36.175 46.836 56.075  1.00 31.46 ? 459  THR A N   1 
ATOM   3475 C  CA  . THR A 1 458 ? 35.912 45.502 55.494  1.00 30.98 ? 459  THR A CA  1 
ATOM   3476 C  C   . THR A 1 458 ? 34.459 45.152 55.753  1.00 30.40 ? 459  THR A C   1 
ATOM   3477 O  O   . THR A 1 458 ? 33.958 45.170 56.876  1.00 30.08 ? 459  THR A O   1 
ATOM   3478 C  CB  . THR A 1 458 ? 36.897 44.453 56.138  1.00 30.91 ? 459  THR A CB  1 
ATOM   3479 O  OG1 . THR A 1 458 ? 37.941 44.440 55.186  1.00 30.99 ? 459  THR A OG1 1 
ATOM   3480 C  CG2 . THR A 1 458 ? 36.460 43.010 56.334  1.00 30.35 ? 459  THR A CG2 1 
ATOM   3481 N  N   . HIS A 1 459 ? 33.767 44.855 54.675  1.00 30.00 ? 460  HIS A N   1 
ATOM   3482 C  CA  . HIS A 1 459 ? 32.348 44.529 54.754  1.00 30.13 ? 460  HIS A CA  1 
ATOM   3483 C  C   . HIS A 1 459 ? 32.302 43.005 54.752  1.00 28.63 ? 460  HIS A C   1 
ATOM   3484 O  O   . HIS A 1 459 ? 32.605 42.350 53.745  1.00 28.63 ? 460  HIS A O   1 
ATOM   3485 C  CB  . HIS A 1 459 ? 31.593 45.141 53.530  1.00 31.04 ? 460  HIS A CB  1 
ATOM   3486 C  CG  . HIS A 1 459 ? 31.515 46.668 53.568  1.00 32.66 ? 460  HIS A CG  1 
ATOM   3487 N  ND1 . HIS A 1 459 ? 32.494 47.546 53.400  1.00 33.92 ? 460  HIS A ND1 1 
ATOM   3488 C  CD2 . HIS A 1 459 ? 30.369 47.401 53.786  1.00 33.91 ? 460  HIS A CD2 1 
ATOM   3489 C  CE1 . HIS A 1 459 ? 31.996 48.754 53.500  1.00 34.34 ? 460  HIS A CE1 1 
ATOM   3490 N  NE2 . HIS A 1 459 ? 30.721 48.653 53.731  1.00 34.29 ? 460  HIS A NE2 1 
ATOM   3491 N  N   . ALA A 1 460 ? 32.020 42.429 55.923  1.00 26.36 ? 461  ALA A N   1 
ATOM   3492 C  CA  . ALA A 1 460 ? 31.952 40.981 56.018  1.00 25.31 ? 461  ALA A CA  1 
ATOM   3493 C  C   . ALA A 1 460 ? 30.517 40.457 56.134  1.00 24.57 ? 461  ALA A C   1 
ATOM   3494 O  O   . ALA A 1 460 ? 29.697 41.023 56.862  1.00 25.08 ? 461  ALA A O   1 
ATOM   3495 C  CB  . ALA A 1 460 ? 32.748 40.530 57.218  1.00 24.23 ? 461  ALA A CB  1 
ATOM   3496 N  N   . PHE A 1 461 ? 30.194 39.427 55.354  1.00 23.55 ? 462  PHE A N   1 
ATOM   3497 C  CA  . PHE A 1 461 ? 28.865 38.823 55.314  1.00 23.57 ? 462  PHE A CA  1 
ATOM   3498 C  C   . PHE A 1 461 ? 29.017 37.356 55.753  1.00 22.68 ? 462  PHE A C   1 
ATOM   3499 O  O   . PHE A 1 461 ? 29.984 36.698 55.345  1.00 21.94 ? 462  PHE A O   1 
ATOM   3500 C  CB  . PHE A 1 461 ? 28.312 38.870 53.890  1.00 24.68 ? 462  PHE A CB  1 
ATOM   3501 C  CG  . PHE A 1 461 ? 28.147 40.287 53.349  1.00 27.85 ? 462  PHE A CG  1 
ATOM   3502 C  CD1 . PHE A 1 461 ? 29.249 40.990 52.816  1.00 29.33 ? 462  PHE A CD1 1 
ATOM   3503 C  CD2 . PHE A 1 461 ? 26.903 40.931 53.426  1.00 28.39 ? 462  PHE A CD2 1 
ATOM   3504 C  CE1 . PHE A 1 461 ? 29.121 42.316 52.373  1.00 28.98 ? 462  PHE A CE1 1 
ATOM   3505 C  CE2 . PHE A 1 461 ? 26.781 42.251 52.983  1.00 29.43 ? 462  PHE A CE2 1 
ATOM   3506 C  CZ  . PHE A 1 461 ? 27.886 42.944 52.459  1.00 29.61 ? 462  PHE A CZ  1 
ATOM   3507 N  N   . VAL A 1 462 ? 28.128 36.814 56.606  1.00 20.58 ? 463  VAL A N   1 
ATOM   3508 C  CA  . VAL A 1 462 ? 28.211 35.410 56.985  1.00 19.02 ? 463  VAL A CA  1 
ATOM   3509 C  C   . VAL A 1 462 ? 27.129 34.575 56.332  1.00 17.65 ? 463  VAL A C   1 
ATOM   3510 O  O   . VAL A 1 462 ? 25.996 35.000 56.217  1.00 17.14 ? 463  VAL A O   1 
ATOM   3511 C  CB  . VAL A 1 462 ? 28.119 35.192 58.513  1.00 19.01 ? 463  VAL A CB  1 
ATOM   3512 C  CG1 . VAL A 1 462 ? 29.457 35.608 59.072  1.00 18.32 ? 463  VAL A CG1 1 
ATOM   3513 C  CG2 . VAL A 1 462 ? 27.027 35.991 59.204  1.00 19.60 ? 463  VAL A CG2 1 
ATOM   3514 N  N   . THR A 1 463 ? 27.474 33.395 55.809  1.00 17.78 ? 464  THR A N   1 
ATOM   3515 C  CA  . THR A 1 463 ? 26.558 32.444 55.149  1.00 15.39 ? 464  THR A CA  1 
ATOM   3516 C  C   . THR A 1 463 ? 27.014 30.965 55.320  1.00 15.71 ? 464  THR A C   1 
ATOM   3517 O  O   . THR A 1 463 ? 27.790 30.617 56.206  1.00 15.03 ? 464  THR A O   1 
ATOM   3518 C  CB  . THR A 1 463 ? 26.483 32.903 53.667  1.00 14.08 ? 464  THR A CB  1 
ATOM   3519 O  OG1 . THR A 1 463 ? 25.418 32.131 53.111  1.00 12.46 ? 464  THR A OG1 1 
ATOM   3520 C  CG2 . THR A 1 463 ? 27.838 32.822 52.928  1.00 12.92 ? 464  THR A CG2 1 
ATOM   3521 N  N   . SER A 1 464 ? 26.574 30.040 54.499  1.00 17.23 ? 465  SER A N   1 
ATOM   3522 C  CA  . SER A 1 464 ? 26.908 28.620 54.558  1.00 18.89 ? 465  SER A CA  1 
ATOM   3523 C  C   . SER A 1 464 ? 28.122 28.226 53.687  1.00 20.37 ? 465  SER A C   1 
ATOM   3524 O  O   . SER A 1 464 ? 28.321 28.871 52.647  1.00 19.75 ? 465  SER A O   1 
ATOM   3525 C  CB  . SER A 1 464 ? 25.680 27.878 54.104  1.00 18.70 ? 465  SER A CB  1 
ATOM   3526 O  OG  . SER A 1 464 ? 25.371 28.451 52.822  1.00 16.09 ? 465  SER A OG  1 
ATOM   3527 N  N   . PRO A 1 465 ? 28.917 27.166 54.000  1.00 21.33 ? 466  PRO A N   1 
ATOM   3528 C  CA  . PRO A 1 465 ? 30.047 26.712 53.197  1.00 21.38 ? 466  PRO A CA  1 
ATOM   3529 C  C   . PRO A 1 465 ? 29.731 26.515 51.728  1.00 21.39 ? 466  PRO A C   1 
ATOM   3530 O  O   . PRO A 1 465 ? 30.504 26.944 50.895  1.00 22.44 ? 466  PRO A O   1 
ATOM   3531 C  CB  . PRO A 1 465 ? 30.538 25.439 53.907  1.00 21.05 ? 466  PRO A CB  1 
ATOM   3532 C  CG  . PRO A 1 465 ? 29.383 25.039 54.770  1.00 21.60 ? 466  PRO A CG  1 
ATOM   3533 C  CD  . PRO A 1 465 ? 28.856 26.389 55.226  1.00 21.61 ? 466  PRO A CD  1 
ATOM   3534 N  N   . GLU A 1 466 ? 28.602 25.982 51.323  1.00 21.19 ? 467  GLU A N   1 
ATOM   3535 C  CA  . GLU A 1 466 ? 28.320 25.785 49.923  1.00 21.24 ? 467  GLU A CA  1 
ATOM   3536 C  C   . GLU A 1 466 ? 28.034 27.044 49.169  1.00 21.89 ? 467  GLU A C   1 
ATOM   3537 O  O   . GLU A 1 466 ? 28.325 27.026 47.987  1.00 23.15 ? 467  GLU A O   1 
ATOM   3538 C  CB  . GLU A 1 466 ? 27.136 24.837 49.738  1.00 20.80 ? 467  GLU A CB  1 
ATOM   3539 C  CG  . GLU A 1 466 ? 25.891 25.056 50.587  1.00 19.96 ? 467  GLU A CG  1 
ATOM   3540 C  CD  . GLU A 1 466 ? 25.868 24.391 51.965  1.00 20.27 ? 467  GLU A CD  1 
ATOM   3541 O  OE1 . GLU A 1 466 ? 26.897 24.258 52.636  1.00 21.19 ? 467  GLU A OE1 1 
ATOM   3542 O  OE2 . GLU A 1 466 ? 24.777 24.033 52.393  1.00 18.23 ? 467  GLU A OE2 1 
ATOM   3543 N  N   . ILE A 1 467 ? 27.485 28.103 49.793  1.00 22.01 ? 468  ILE A N   1 
ATOM   3544 C  CA  . ILE A 1 467 ? 27.150 29.351 49.116  1.00 21.18 ? 468  ILE A CA  1 
ATOM   3545 C  C   . ILE A 1 467 ? 28.403 30.218 48.998  1.00 20.78 ? 468  ILE A C   1 
ATOM   3546 O  O   . ILE A 1 467 ? 28.589 30.865 47.957  1.00 20.59 ? 468  ILE A O   1 
ATOM   3547 C  CB  . ILE A 1 467 ? 26.026 30.022 49.935  1.00 22.68 ? 468  ILE A CB  1 
ATOM   3548 C  CG1 . ILE A 1 467 ? 24.700 29.274 49.716  1.00 22.68 ? 468  ILE A CG1 1 
ATOM   3549 C  CG2 . ILE A 1 467 ? 25.848 31.467 49.513  1.00 23.15 ? 468  ILE A CG2 1 
ATOM   3550 C  CD1 . ILE A 1 467 ? 24.048 29.310 48.314  1.00 22.55 ? 468  ILE A CD1 1 
ATOM   3551 N  N   . VAL A 1 468 ? 29.260 30.277 50.059  1.00 19.49 ? 469  VAL A N   1 
ATOM   3552 C  CA  . VAL A 1 468 ? 30.571 30.919 49.984  1.00 17.63 ? 469  VAL A CA  1 
ATOM   3553 C  C   . VAL A 1 468 ? 31.248 30.307 48.775  1.00 17.73 ? 469  VAL A C   1 
ATOM   3554 O  O   . VAL A 1 468 ? 31.710 31.085 47.980  1.00 17.05 ? 469  VAL A O   1 
ATOM   3555 C  CB  . VAL A 1 468 ? 31.485 30.648 51.232  1.00 16.01 ? 469  VAL A CB  1 
ATOM   3556 C  CG1 . VAL A 1 468 ? 32.958 31.000 50.992  1.00 14.27 ? 469  VAL A CG1 1 
ATOM   3557 C  CG2 . VAL A 1 468 ? 31.031 31.492 52.356  1.00 14.84 ? 469  VAL A CG2 1 
ATOM   3558 N  N   . THR A 1 469 ? 31.309 28.974 48.579  1.00 18.80 ? 470  THR A N   1 
ATOM   3559 C  CA  . THR A 1 469 ? 31.965 28.388 47.408  1.00 18.99 ? 470  THR A CA  1 
ATOM   3560 C  C   . THR A 1 469 ? 31.326 28.836 46.092  1.00 20.45 ? 470  THR A C   1 
ATOM   3561 O  O   . THR A 1 469 ? 32.062 29.208 45.186  1.00 21.66 ? 470  THR A O   1 
ATOM   3562 C  CB  . THR A 1 469 ? 31.952 26.832 47.467  1.00 17.60 ? 470  THR A CB  1 
ATOM   3563 O  OG1 . THR A 1 469 ? 32.391 26.434 48.751  1.00 15.37 ? 470  THR A OG1 1 
ATOM   3564 C  CG2 . THR A 1 469 ? 32.952 26.205 46.504  1.00 16.13 ? 470  THR A CG2 1 
ATOM   3565 N  N   . ALA A 1 470 ? 30.010 28.903 45.916  1.00 21.42 ? 471  ALA A N   1 
ATOM   3566 C  CA  . ALA A 1 470 ? 29.422 29.357 44.663  1.00 22.56 ? 471  ALA A CA  1 
ATOM   3567 C  C   . ALA A 1 470 ? 29.771 30.807 44.374  1.00 23.50 ? 471  ALA A C   1 
ATOM   3568 O  O   . ALA A 1 470 ? 30.146 31.143 43.253  1.00 25.37 ? 471  ALA A O   1 
ATOM   3569 C  CB  . ALA A 1 470 ? 27.909 29.253 44.709  1.00 21.84 ? 471  ALA A CB  1 
ATOM   3570 N  N   . LEU A 1 471 ? 29.689 31.666 45.388  1.00 23.92 ? 472  LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 471 ? 29.971 33.078 45.243  1.00 24.29 ? 472  LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 471 ? 31.466 33.315 45.034  1.00 25.39 ? 472  LEU A C   1 
ATOM   3573 O  O   . LEU A 1 471 ? 31.796 34.278 44.350  1.00 26.60 ? 472  LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 471 ? 29.479 33.854 46.486  1.00 22.70 ? 472  LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 471 ? 27.997 33.894 46.872  1.00 21.66 ? 472  LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 471 ? 27.839 34.716 48.115  1.00 20.62 ? 472  LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 471 ? 27.159 34.512 45.780  1.00 21.56 ? 472  LEU A CD2 1 
ATOM   3578 N  N   . ALA A 1 472 ? 32.405 32.514 45.584  1.00 25.78 ? 473  ALA A N   1 
ATOM   3579 C  CA  . ALA A 1 472 ? 33.846 32.624 45.315  1.00 25.12 ? 473  ALA A CA  1 
ATOM   3580 C  C   . ALA A 1 472 ? 34.214 32.235 43.863  1.00 24.33 ? 473  ALA A C   1 
ATOM   3581 O  O   . ALA A 1 472 ? 35.157 32.781 43.285  1.00 22.54 ? 473  ALA A O   1 
ATOM   3582 C  CB  . ALA A 1 472 ? 34.638 31.721 46.316  1.00 23.30 ? 473  ALA A CB  1 
ATOM   3583 N  N   . ILE A 1 473 ? 33.487 31.285 43.266  1.00 24.57 ? 474  ILE A N   1 
ATOM   3584 C  CA  . ILE A 1 473 ? 33.696 30.891 41.876  1.00 26.65 ? 474  ILE A CA  1 
ATOM   3585 C  C   . ILE A 1 473 ? 33.269 32.020 40.937  1.00 28.30 ? 474  ILE A C   1 
ATOM   3586 O  O   . ILE A 1 473 ? 33.898 32.204 39.885  1.00 29.03 ? 474  ILE A O   1 
ATOM   3587 C  CB  . ILE A 1 473 ? 32.891 29.599 41.636  1.00 26.64 ? 474  ILE A CB  1 
ATOM   3588 C  CG1 . ILE A 1 473 ? 33.714 28.473 42.269  1.00 26.28 ? 474  ILE A CG1 1 
ATOM   3589 C  CG2 . ILE A 1 473 ? 32.551 29.347 40.164  1.00 25.72 ? 474  ILE A CG2 1 
ATOM   3590 C  CD1 . ILE A 1 473 ? 32.874 27.209 42.471  1.00 24.63 ? 474  ILE A CD1 1 
ATOM   3591 N  N   . ALA A 1 474 ? 32.203 32.745 41.349  1.00 28.34 ? 475  ALA A N   1 
ATOM   3592 C  CA  . ALA A 1 474 ? 31.663 33.884 40.642  1.00 28.38 ? 475  ALA A CA  1 
ATOM   3593 C  C   . ALA A 1 474 ? 32.305 35.250 40.923  1.00 28.97 ? 475  ALA A C   1 
ATOM   3594 O  O   . ALA A 1 474 ? 32.334 36.132 40.065  1.00 30.54 ? 475  ALA A O   1 
ATOM   3595 C  CB  . ALA A 1 474 ? 30.189 33.959 40.968  1.00 27.45 ? 475  ALA A CB  1 
ATOM   3596 N  N   . GLY A 1 475 ? 32.805 35.444 42.144  1.00 29.00 ? 476  GLY A N   1 
ATOM   3597 C  CA  . GLY A 1 475 ? 33.407 36.680 42.629  1.00 28.58 ? 476  GLY A CA  1 
ATOM   3598 C  C   . GLY A 1 475 ? 32.505 37.891 42.845  1.00 28.31 ? 476  GLY A C   1 
ATOM   3599 O  O   . GLY A 1 475 ? 33.012 38.997 42.985  1.00 27.68 ? 476  GLY A O   1 
ATOM   3600 N  N   . THR A 1 476 ? 31.194 37.725 42.923  1.00 28.01 ? 477  THR A N   1 
ATOM   3601 C  CA  . THR A 1 476 ? 30.306 38.843 43.015  1.00 29.44 ? 477  THR A CA  1 
ATOM   3602 C  C   . THR A 1 476 ? 29.113 38.485 43.879  1.00 31.99 ? 477  THR A C   1 
ATOM   3603 O  O   . THR A 1 476 ? 28.633 37.346 43.832  1.00 32.57 ? 477  THR A O   1 
ATOM   3604 C  CB  . THR A 1 476 ? 29.809 39.268 41.614  1.00 27.41 ? 477  THR A CB  1 
ATOM   3605 O  OG1 . THR A 1 476 ? 28.874 40.311 41.872  1.00 27.56 ? 477  THR A OG1 1 
ATOM   3606 C  CG2 . THR A 1 476 ? 29.124 38.202 40.817  1.00 25.10 ? 477  THR A CG2 1 
ATOM   3607 N  N   . LEU A 1 477 ? 28.622 39.477 44.656  1.00 34.14 ? 478  LEU A N   1 
ATOM   3608 C  CA  . LEU A 1 477 ? 27.416 39.318 45.468  1.00 36.45 ? 478  LEU A CA  1 
ATOM   3609 C  C   . LEU A 1 477 ? 26.194 39.291 44.571  1.00 38.47 ? 478  LEU A C   1 
ATOM   3610 O  O   . LEU A 1 477 ? 25.144 38.791 45.010  1.00 39.73 ? 478  LEU A O   1 
ATOM   3611 C  CB  . LEU A 1 477 ? 27.139 40.449 46.430  1.00 35.50 ? 478  LEU A CB  1 
ATOM   3612 C  CG  . LEU A 1 477 ? 27.971 40.609 47.647  1.00 35.51 ? 478  LEU A CG  1 
ATOM   3613 C  CD1 . LEU A 1 477 ? 27.663 41.965 48.292  1.00 35.86 ? 478  LEU A CD1 1 
ATOM   3614 C  CD2 . LEU A 1 477 ? 27.706 39.416 48.557  1.00 35.35 ? 478  LEU A CD2 1 
ATOM   3615 N  N   . LYS A 1 478 ? 26.301 39.893 43.368  1.00 39.53 ? 479  LYS A N   1 
ATOM   3616 C  CA  . LYS A 1 478 ? 25.204 39.828 42.425  1.00 40.75 ? 479  LYS A CA  1 
ATOM   3617 C  C   . LYS A 1 478 ? 25.307 38.488 41.706  1.00 39.22 ? 479  LYS A C   1 
ATOM   3618 O  O   . LYS A 1 478 ? 25.734 38.433 40.556  1.00 40.58 ? 479  LYS A O   1 
ATOM   3619 C  CB  . LYS A 1 478 ? 25.257 40.943 41.348  1.00 43.93 ? 479  LYS A CB  1 
ATOM   3620 C  CG  . LYS A 1 478 ? 25.749 42.338 41.707  1.00 47.27 ? 479  LYS A CG  1 
ATOM   3621 C  CD  . LYS A 1 478 ? 25.287 43.281 40.598  1.00 51.13 ? 479  LYS A CD  1 
ATOM   3622 C  CE  . LYS A 1 478 ? 23.735 43.367 40.519  1.00 53.36 ? 479  LYS A CE  1 
ATOM   3623 N  NZ  . LYS A 1 478 ? 23.182 44.192 41.584  1.00 55.62 ? 479  LYS A NZ  1 
ATOM   3624 N  N   . PHE A 1 479 ? 25.008 37.376 42.370  1.00 37.00 ? 480  PHE A N   1 
ATOM   3625 C  CA  . PHE A 1 479 ? 24.965 36.043 41.763  1.00 34.75 ? 480  PHE A CA  1 
ATOM   3626 C  C   . PHE A 1 479 ? 24.127 35.099 42.638  1.00 33.70 ? 480  PHE A C   1 
ATOM   3627 O  O   . PHE A 1 479 ? 24.474 34.775 43.779  1.00 34.36 ? 480  PHE A O   1 
ATOM   3628 C  CB  . PHE A 1 479 ? 26.391 35.445 41.594  1.00 33.70 ? 480  PHE A CB  1 
ATOM   3629 C  CG  . PHE A 1 479 ? 26.370 34.020 41.024  1.00 32.98 ? 480  PHE A CG  1 
ATOM   3630 C  CD1 . PHE A 1 479 ? 25.940 33.766 39.715  1.00 32.47 ? 480  PHE A CD1 1 
ATOM   3631 C  CD2 . PHE A 1 479 ? 26.717 32.928 41.834  1.00 32.92 ? 480  PHE A CD2 1 
ATOM   3632 C  CE1 . PHE A 1 479 ? 25.849 32.456 39.238  1.00 30.53 ? 480  PHE A CE1 1 
ATOM   3633 C  CE2 . PHE A 1 479 ? 26.624 31.619 41.341  1.00 31.22 ? 480  PHE A CE2 1 
ATOM   3634 C  CZ  . PHE A 1 479 ? 26.188 31.378 40.041  1.00 30.27 ? 480  PHE A CZ  1 
ATOM   3635 N  N   . ASN A 1 480 ? 23.021 34.626 42.104  1.00 31.71 ? 481  ASN A N   1 
ATOM   3636 C  CA  . ASN A 1 480 ? 22.154 33.737 42.827  1.00 31.56 ? 481  ASN A CA  1 
ATOM   3637 C  C   . ASN A 1 480 ? 22.394 32.344 42.254  1.00 31.57 ? 481  ASN A C   1 
ATOM   3638 O  O   . ASN A 1 480 ? 22.027 32.163 41.111  1.00 31.44 ? 481  ASN A O   1 
ATOM   3639 C  CB  . ASN A 1 480 ? 20.717 34.221 42.629  1.00 31.06 ? 481  ASN A CB  1 
ATOM   3640 C  CG  . ASN A 1 480 ? 19.666 33.374 43.310  1.00 30.45 ? 481  ASN A CG  1 
ATOM   3641 O  OD1 . ASN A 1 480 ? 19.972 32.455 44.055  1.00 32.15 ? 481  ASN A OD1 1 
ATOM   3642 N  ND2 . ASN A 1 480 ? 18.388 33.529 43.028  1.00 30.14 ? 481  ASN A ND2 1 
ATOM   3643 N  N   . PRO A 1 481 ? 22.998 31.345 42.941  1.00 32.65 ? 482  PRO A N   1 
ATOM   3644 C  CA  . PRO A 1 481 ? 23.420 30.046 42.399  1.00 33.16 ? 482  PRO A CA  1 
ATOM   3645 C  C   . PRO A 1 481 ? 22.281 29.208 41.869  1.00 33.95 ? 482  PRO A C   1 
ATOM   3646 O  O   . PRO A 1 481 ? 22.489 28.476 40.895  1.00 34.27 ? 482  PRO A O   1 
ATOM   3647 C  CB  . PRO A 1 481 ? 24.130 29.334 43.520  1.00 32.36 ? 482  PRO A CB  1 
ATOM   3648 C  CG  . PRO A 1 481 ? 24.549 30.428 44.444  1.00 32.35 ? 482  PRO A CG  1 
ATOM   3649 C  CD  . PRO A 1 481 ? 23.369 31.400 44.354  1.00 32.53 ? 482  PRO A CD  1 
ATOM   3650 N  N   . GLU A 1 482 ? 21.125 29.409 42.545  1.00 34.68 ? 483  GLU A N   1 
ATOM   3651 C  CA  . GLU A 1 482 ? 19.856 28.804 42.217  1.00 35.55 ? 483  GLU A CA  1 
ATOM   3652 C  C   . GLU A 1 482 ? 19.341 29.270 40.881  1.00 36.02 ? 483  GLU A C   1 
ATOM   3653 O  O   . GLU A 1 482 ? 18.806 28.461 40.137  1.00 37.15 ? 483  GLU A O   1 
ATOM   3654 C  CB  . GLU A 1 482 ? 18.779 29.136 43.222  1.00 36.38 ? 483  GLU A CB  1 
ATOM   3655 C  CG  . GLU A 1 482 ? 18.960 28.416 44.531  1.00 38.57 ? 483  GLU A CG  1 
ATOM   3656 C  CD  . GLU A 1 482 ? 17.711 28.246 45.390  1.00 40.00 ? 483  GLU A CD  1 
ATOM   3657 O  OE1 . GLU A 1 482 ? 16.759 27.582 44.948  1.00 39.38 ? 483  GLU A OE1 1 
ATOM   3658 O  OE2 . GLU A 1 482 ? 17.741 28.751 46.517  1.00 40.80 ? 483  GLU A OE2 1 
ATOM   3659 N  N   . THR A 1 483 ? 19.453 30.538 40.497  1.00 36.81 ? 484  THR A N   1 
ATOM   3660 C  CA  . THR A 1 483 ? 18.879 30.975 39.226  1.00 37.36 ? 484  THR A CA  1 
ATOM   3661 C  C   . THR A 1 483 ? 19.824 31.061 38.035  1.00 39.31 ? 484  THR A C   1 
ATOM   3662 O  O   . THR A 1 483 ? 19.615 30.385 37.016  1.00 39.46 ? 484  THR A O   1 
ATOM   3663 C  CB  . THR A 1 483 ? 18.204 32.328 39.447  1.00 35.70 ? 484  THR A CB  1 
ATOM   3664 O  OG1 . THR A 1 483 ? 19.181 33.154 40.051  1.00 34.54 ? 484  THR A OG1 1 
ATOM   3665 C  CG2 . THR A 1 483 ? 17.020 32.282 40.394  1.00 33.99 ? 484  THR A CG2 1 
ATOM   3666 N  N   . ASP A 1 484 ? 20.910 31.820 38.247  1.00 40.55 ? 485  ASP A N   1 
ATOM   3667 C  CA  . ASP A 1 484 ? 21.869 32.200 37.226  1.00 41.93 ? 485  ASP A CA  1 
ATOM   3668 C  C   . ASP A 1 484 ? 22.802 31.153 36.651  1.00 42.82 ? 485  ASP A C   1 
ATOM   3669 O  O   . ASP A 1 484 ? 23.012 30.059 37.183  1.00 43.54 ? 485  ASP A O   1 
ATOM   3670 C  CB  . ASP A 1 484 ? 22.708 33.329 37.767  1.00 42.74 ? 485  ASP A CB  1 
ATOM   3671 C  CG  . ASP A 1 484 ? 21.941 34.466 38.429  1.00 43.53 ? 485  ASP A CG  1 
ATOM   3672 O  OD1 . ASP A 1 484 ? 20.773 34.688 38.107  1.00 44.14 ? 485  ASP A OD1 1 
ATOM   3673 O  OD2 . ASP A 1 484 ? 22.522 35.140 39.271  1.00 44.43 ? 485  ASP A OD2 1 
ATOM   3674 N  N   . PHE A 1 485 ? 23.397 31.576 35.545  1.00 43.88 ? 486  PHE A N   1 
ATOM   3675 C  CA  . PHE A 1 485 ? 24.253 30.699 34.786  1.00 45.54 ? 486  PHE A CA  1 
ATOM   3676 C  C   . PHE A 1 485 ? 25.705 31.176 34.691  1.00 46.26 ? 486  PHE A C   1 
ATOM   3677 O  O   . PHE A 1 485 ? 26.015 32.341 34.396  1.00 47.44 ? 486  PHE A O   1 
ATOM   3678 C  CB  . PHE A 1 485 ? 23.726 30.543 33.365  1.00 45.93 ? 486  PHE A CB  1 
ATOM   3679 C  CG  . PHE A 1 485 ? 22.466 29.732 33.249  1.00 47.03 ? 486  PHE A CG  1 
ATOM   3680 C  CD1 . PHE A 1 485 ? 21.224 30.312 33.510  1.00 48.25 ? 486  PHE A CD1 1 
ATOM   3681 C  CD2 . PHE A 1 485 ? 22.563 28.391 32.892  1.00 47.43 ? 486  PHE A CD2 1 
ATOM   3682 C  CE1 . PHE A 1 485 ? 20.064 29.528 33.417  1.00 48.82 ? 486  PHE A CE1 1 
ATOM   3683 C  CE2 . PHE A 1 485 ? 21.414 27.612 32.799  1.00 47.57 ? 486  PHE A CE2 1 
ATOM   3684 C  CZ  . PHE A 1 485 ? 20.164 28.180 33.063  1.00 48.69 ? 486  PHE A CZ  1 
ATOM   3685 N  N   . LEU A 1 486 ? 26.632 30.264 34.964  1.00 45.76 ? 487  LEU A N   1 
ATOM   3686 C  CA  . LEU A 1 486 ? 28.012 30.557 34.718  1.00 44.86 ? 487  LEU A CA  1 
ATOM   3687 C  C   . LEU A 1 486 ? 28.316 30.222 33.251  1.00 45.55 ? 487  LEU A C   1 
ATOM   3688 O  O   . LEU A 1 486 ? 27.479 29.732 32.493  1.00 45.08 ? 487  LEU A O   1 
ATOM   3689 C  CB  . LEU A 1 486 ? 28.755 29.728 35.708  1.00 43.32 ? 487  LEU A CB  1 
ATOM   3690 C  CG  . LEU A 1 486 ? 29.359 30.404 36.907  1.00 42.11 ? 487  LEU A CG  1 
ATOM   3691 C  CD1 . LEU A 1 486 ? 28.497 31.507 37.395  1.00 39.62 ? 487  LEU A CD1 1 
ATOM   3692 C  CD2 . LEU A 1 486 ? 29.616 29.335 37.949  1.00 42.64 ? 487  LEU A CD2 1 
ATOM   3693 N  N   . THR A 1 487 ? 29.540 30.473 32.805  1.00 46.79 ? 488  THR A N   1 
ATOM   3694 C  CA  . THR A 1 487 ? 29.944 30.234 31.424  1.00 47.74 ? 488  THR A CA  1 
ATOM   3695 C  C   . THR A 1 487 ? 31.154 29.349 31.596  1.00 48.71 ? 488  THR A C   1 
ATOM   3696 O  O   . THR A 1 487 ? 32.064 29.792 32.313  1.00 49.45 ? 488  THR A O   1 
ATOM   3697 C  CB  . THR A 1 487 ? 30.400 31.518 30.729  1.00 47.59 ? 488  THR A CB  1 
ATOM   3698 O  OG1 . THR A 1 487 ? 29.307 32.427 30.765  1.00 48.35 ? 488  THR A OG1 1 
ATOM   3699 C  CG2 . THR A 1 487 ? 30.699 31.353 29.255  1.00 47.37 ? 488  THR A CG2 1 
ATOM   3700 N  N   . GLY A 1 488 ? 31.209 28.158 30.978  1.00 48.99 ? 489  GLY A N   1 
ATOM   3701 C  CA  . GLY A 1 488 ? 32.374 27.324 31.104  1.00 49.87 ? 489  GLY A CA  1 
ATOM   3702 C  C   . GLY A 1 488 ? 33.422 27.706 30.066  1.00 51.18 ? 489  GLY A C   1 
ATOM   3703 O  O   . GLY A 1 488 ? 33.267 28.624 29.253  1.00 50.32 ? 489  GLY A O   1 
ATOM   3704 N  N   . LYS A 1 489 ? 34.525 26.952 30.120  1.00 52.80 ? 490  LYS A N   1 
ATOM   3705 C  CA  . LYS A 1 489 ? 35.605 27.005 29.136  1.00 54.82 ? 490  LYS A CA  1 
ATOM   3706 C  C   . LYS A 1 489 ? 35.033 26.640 27.753  1.00 55.88 ? 490  LYS A C   1 
ATOM   3707 O  O   . LYS A 1 489 ? 35.220 27.368 26.777  1.00 56.09 ? 490  LYS A O   1 
ATOM   3708 C  CB  . LYS A 1 489 ? 36.671 26.026 29.635  1.00 55.62 ? 490  LYS A CB  1 
ATOM   3709 C  CG  . LYS A 1 489 ? 37.941 25.883 28.815  1.00 56.87 ? 490  LYS A CG  1 
ATOM   3710 C  CD  . LYS A 1 489 ? 39.016 25.131 29.599  1.00 58.23 ? 490  LYS A CD  1 
ATOM   3711 C  CE  . LYS A 1 489 ? 39.951 26.015 30.432  1.00 58.55 ? 490  LYS A CE  1 
ATOM   3712 N  NZ  . LYS A 1 489 ? 39.251 26.690 31.510  1.00 60.05 ? 490  LYS A NZ  1 
ATOM   3713 N  N   . ASP A 1 490 ? 34.183 25.586 27.779  1.00 56.89 ? 491  ASP A N   1 
ATOM   3714 C  CA  . ASP A 1 490 ? 33.402 24.980 26.687  1.00 57.09 ? 491  ASP A CA  1 
ATOM   3715 C  C   . ASP A 1 490 ? 32.743 25.926 25.691  1.00 56.47 ? 491  ASP A C   1 
ATOM   3716 O  O   . ASP A 1 490 ? 32.612 25.595 24.515  1.00 56.21 ? 491  ASP A O   1 
ATOM   3717 C  CB  . ASP A 1 490 ? 32.293 24.056 27.296  1.00 58.26 ? 491  ASP A CB  1 
ATOM   3718 C  CG  . ASP A 1 490 ? 31.611 24.503 28.620  1.00 60.23 ? 491  ASP A CG  1 
ATOM   3719 O  OD1 . ASP A 1 490 ? 30.673 25.304 28.626  1.00 60.19 ? 491  ASP A OD1 1 
ATOM   3720 O  OD2 . ASP A 1 490 ? 32.033 24.035 29.683  1.00 60.87 ? 491  ASP A OD2 1 
ATOM   3721 N  N   . GLY A 1 491 ? 32.371 27.111 26.181  1.00 56.15 ? 492  GLY A N   1 
ATOM   3722 C  CA  . GLY A 1 491 ? 31.648 28.102 25.410  1.00 55.83 ? 492  GLY A CA  1 
ATOM   3723 C  C   . GLY A 1 491 ? 30.161 28.096 25.776  1.00 55.56 ? 492  GLY A C   1 
ATOM   3724 O  O   . GLY A 1 491 ? 29.427 28.986 25.348  1.00 55.67 ? 492  GLY A O   1 
ATOM   3725 N  N   . LYS A 1 492 ? 29.734 27.137 26.620  1.00 55.05 ? 493  LYS A N   1 
ATOM   3726 C  CA  . LYS A 1 492 ? 28.333 26.964 27.016  1.00 54.65 ? 493  LYS A CA  1 
ATOM   3727 C  C   . LYS A 1 492 ? 28.015 27.524 28.407  1.00 53.91 ? 493  LYS A C   1 
ATOM   3728 O  O   . LYS A 1 492 ? 28.863 27.677 29.294  1.00 54.23 ? 493  LYS A O   1 
ATOM   3729 C  CB  . LYS A 1 492 ? 27.918 25.463 27.019  1.00 54.71 ? 493  LYS A CB  1 
ATOM   3730 C  CG  . LYS A 1 492 ? 27.962 24.764 25.661  1.00 54.97 ? 493  LYS A CG  1 
ATOM   3731 C  CD  . LYS A 1 492 ? 27.648 23.251 25.652  1.00 55.46 ? 493  LYS A CD  1 
ATOM   3732 C  CE  . LYS A 1 492 ? 26.217 22.850 26.067  1.00 55.50 ? 493  LYS A CE  1 
ATOM   3733 N  NZ  . LYS A 1 492 ? 25.700 21.799 25.199  1.00 55.06 ? 493  LYS A NZ  1 
ATOM   3734 N  N   . LYS A 1 493 ? 26.729 27.842 28.567  1.00 53.04 ? 494  LYS A N   1 
ATOM   3735 C  CA  . LYS A 1 493 ? 26.174 28.249 29.850  1.00 52.15 ? 494  LYS A CA  1 
ATOM   3736 C  C   . LYS A 1 493 ? 25.879 26.998 30.678  1.00 50.51 ? 494  LYS A C   1 
ATOM   3737 O  O   . LYS A 1 493 ? 25.490 25.952 30.162  1.00 50.31 ? 494  LYS A O   1 
ATOM   3738 C  CB  . LYS A 1 493 ? 24.878 29.041 29.649  1.00 52.61 ? 494  LYS A CB  1 
ATOM   3739 C  CG  . LYS A 1 493 ? 25.021 30.292 28.798  1.00 54.99 ? 494  LYS A CG  1 
ATOM   3740 C  CD  . LYS A 1 493 ? 25.989 31.280 29.432  1.00 57.10 ? 494  LYS A CD  1 
ATOM   3741 C  CE  . LYS A 1 493 ? 25.322 31.945 30.630  1.00 59.37 ? 494  LYS A CE  1 
ATOM   3742 N  NZ  . LYS A 1 493 ? 26.282 32.435 31.609  1.00 60.29 ? 494  LYS A NZ  1 
ATOM   3743 N  N   . PHE A 1 494 ? 26.119 27.055 31.973  1.00 48.77 ? 495  PHE A N   1 
ATOM   3744 C  CA  . PHE A 1 494 ? 25.715 25.955 32.812  1.00 47.06 ? 495  PHE A CA  1 
ATOM   3745 C  C   . PHE A 1 494 ? 25.187 26.588 34.085  1.00 46.48 ? 495  PHE A C   1 
ATOM   3746 O  O   . PHE A 1 494 ? 25.422 27.765 34.356  1.00 45.58 ? 495  PHE A O   1 
ATOM   3747 C  CB  . PHE A 1 494 ? 26.911 25.013 33.079  1.00 46.59 ? 495  PHE A CB  1 
ATOM   3748 C  CG  . PHE A 1 494 ? 28.077 25.488 33.955  1.00 45.83 ? 495  PHE A CG  1 
ATOM   3749 C  CD1 . PHE A 1 494 ? 29.107 26.258 33.413  1.00 44.87 ? 495  PHE A CD1 1 
ATOM   3750 C  CD2 . PHE A 1 494 ? 28.129 25.103 35.307  1.00 45.51 ? 495  PHE A CD2 1 
ATOM   3751 C  CE1 . PHE A 1 494 ? 30.180 26.632 34.216  1.00 44.23 ? 495  PHE A CE1 1 
ATOM   3752 C  CE2 . PHE A 1 494 ? 29.212 25.489 36.100  1.00 44.74 ? 495  PHE A CE2 1 
ATOM   3753 C  CZ  . PHE A 1 494 ? 30.237 26.252 35.553  1.00 44.37 ? 495  PHE A CZ  1 
ATOM   3754 N  N   . LYS A 1 495 ? 24.393 25.836 34.839  1.00 46.35 ? 496  LYS A N   1 
ATOM   3755 C  CA  . LYS A 1 495 ? 23.844 26.295 36.110  1.00 45.89 ? 496  LYS A CA  1 
ATOM   3756 C  C   . LYS A 1 495 ? 24.328 25.282 37.155  1.00 44.94 ? 496  LYS A C   1 
ATOM   3757 O  O   . LYS A 1 495 ? 24.528 24.097 36.862  1.00 45.12 ? 496  LYS A O   1 
ATOM   3758 C  CB  . LYS A 1 495 ? 22.325 26.291 36.005  1.00 47.13 ? 496  LYS A CB  1 
ATOM   3759 C  CG  . LYS A 1 495 ? 21.504 27.345 36.738  1.00 49.03 ? 496  LYS A CG  1 
ATOM   3760 C  CD  . LYS A 1 495 ? 20.038 26.920 37.015  1.00 50.61 ? 496  LYS A CD  1 
ATOM   3761 C  CE  . LYS A 1 495 ? 19.988 25.869 38.145  1.00 51.98 ? 496  LYS A CE  1 
ATOM   3762 N  NZ  . LYS A 1 495 ? 20.667 26.326 39.362  1.00 53.59 ? 496  LYS A NZ  1 
ATOM   3763 N  N   . LEU A 1 496 ? 24.583 25.722 38.383  1.00 43.61 ? 497  LEU A N   1 
ATOM   3764 C  CA  . LEU A 1 496 ? 24.943 24.808 39.462  1.00 42.13 ? 497  LEU A CA  1 
ATOM   3765 C  C   . LEU A 1 496 ? 23.826 23.899 40.028  1.00 42.22 ? 497  LEU A C   1 
ATOM   3766 O  O   . LEU A 1 496 ? 22.763 24.368 40.419  1.00 41.91 ? 497  LEU A O   1 
ATOM   3767 C  CB  . LEU A 1 496 ? 25.511 25.611 40.619  1.00 39.96 ? 497  LEU A CB  1 
ATOM   3768 C  CG  . LEU A 1 496 ? 26.978 25.961 40.785  1.00 37.84 ? 497  LEU A CG  1 
ATOM   3769 C  CD1 . LEU A 1 496 ? 27.847 25.641 39.586  1.00 36.13 ? 497  LEU A CD1 1 
ATOM   3770 C  CD2 . LEU A 1 496 ? 26.986 27.424 41.086  1.00 35.98 ? 497  LEU A CD2 1 
ATOM   3771 N  N   . GLU A 1 497 ? 24.035 22.589 40.107  1.00 42.94 ? 498  GLU A N   1 
ATOM   3772 C  CA  . GLU A 1 497 ? 23.155 21.645 40.779  1.00 43.94 ? 498  GLU A CA  1 
ATOM   3773 C  C   . GLU A 1 497 ? 23.375 21.937 42.280  1.00 43.25 ? 498  GLU A C   1 
ATOM   3774 O  O   . GLU A 1 497 ? 24.413 22.451 42.736  1.00 41.76 ? 498  GLU A O   1 
ATOM   3775 C  CB  . GLU A 1 497 ? 23.576 20.196 40.369  1.00 46.58 ? 498  GLU A CB  1 
ATOM   3776 C  CG  . GLU A 1 497 ? 23.773 19.045 41.382  1.00 51.93 ? 498  GLU A CG  1 
ATOM   3777 C  CD  . GLU A 1 497 ? 25.186 18.513 41.740  1.00 55.34 ? 498  GLU A CD  1 
ATOM   3778 O  OE1 . GLU A 1 497 ? 25.868 17.995 40.831  1.00 55.81 ? 498  GLU A OE1 1 
ATOM   3779 O  OE2 . GLU A 1 497 ? 25.562 18.592 42.933  1.00 56.86 ? 498  GLU A OE2 1 
ATOM   3780 N  N   . ALA A 1 498 ? 22.344 21.596 43.063  1.00 42.15 ? 499  ALA A N   1 
ATOM   3781 C  CA  . ALA A 1 498 ? 22.375 21.805 44.498  1.00 40.10 ? 499  ALA A CA  1 
ATOM   3782 C  C   . ALA A 1 498 ? 23.342 20.793 45.050  1.00 39.44 ? 499  ALA A C   1 
ATOM   3783 O  O   . ALA A 1 498 ? 23.391 19.694 44.520  1.00 39.25 ? 499  ALA A O   1 
ATOM   3784 C  CB  . ALA A 1 498 ? 21.009 21.553 45.063  1.00 40.01 ? 499  ALA A CB  1 
ATOM   3785 N  N   . PRO A 1 499 ? 24.162 21.053 46.057  1.00 39.53 ? 500  PRO A N   1 
ATOM   3786 C  CA  . PRO A 1 499 ? 25.159 20.102 46.546  1.00 39.52 ? 500  PRO A CA  1 
ATOM   3787 C  C   . PRO A 1 499 ? 24.551 18.872 47.214  1.00 39.85 ? 500  PRO A C   1 
ATOM   3788 O  O   . PRO A 1 499 ? 23.466 18.964 47.785  1.00 39.01 ? 500  PRO A O   1 
ATOM   3789 C  CB  . PRO A 1 499 ? 26.013 20.925 47.492  1.00 39.90 ? 500  PRO A CB  1 
ATOM   3790 C  CG  . PRO A 1 499 ? 25.007 21.904 48.069  1.00 39.53 ? 500  PRO A CG  1 
ATOM   3791 C  CD  . PRO A 1 499 ? 24.209 22.296 46.827  1.00 39.52 ? 500  PRO A CD  1 
ATOM   3792 N  N   . ASP A 1 500 ? 25.141 17.690 47.026  1.00 40.49 ? 501  ASP A N   1 
ATOM   3793 C  CA  . ASP A 1 500 ? 24.744 16.555 47.836  1.00 40.84 ? 501  ASP A CA  1 
ATOM   3794 C  C   . ASP A 1 500 ? 26.007 15.882 48.365  1.00 39.83 ? 501  ASP A C   1 
ATOM   3795 O  O   . ASP A 1 500 ? 27.023 15.808 47.679  1.00 40.62 ? 501  ASP A O   1 
ATOM   3796 C  CB  . ASP A 1 500 ? 23.931 15.514 47.070  1.00 42.10 ? 501  ASP A CB  1 
ATOM   3797 C  CG  . ASP A 1 500 ? 23.365 14.549 48.125  1.00 45.17 ? 501  ASP A CG  1 
ATOM   3798 O  OD1 . ASP A 1 500 ? 22.550 14.974 48.972  1.00 44.88 ? 501  ASP A OD1 1 
ATOM   3799 O  OD2 . ASP A 1 500 ? 23.808 13.389 48.138  1.00 46.18 ? 501  ASP A OD2 1 
ATOM   3800 N  N   . ALA A 1 501 ? 25.902 15.318 49.572  1.00 38.64 ? 502  ALA A N   1 
ATOM   3801 C  CA  . ALA A 1 501 ? 27.027 14.759 50.311  1.00 37.91 ? 502  ALA A CA  1 
ATOM   3802 C  C   . ALA A 1 501 ? 26.598 14.115 51.623  1.00 36.96 ? 502  ALA A C   1 
ATOM   3803 O  O   . ALA A 1 501 ? 25.579 14.454 52.230  1.00 37.41 ? 502  ALA A O   1 
ATOM   3804 C  CB  . ALA A 1 501 ? 28.078 15.842 50.654  1.00 36.89 ? 502  ALA A CB  1 
ATOM   3805 N  N   . ASP A 1 502 ? 27.462 13.213 52.083  1.00 36.43 ? 503  ASP A N   1 
ATOM   3806 C  CA  . ASP A 1 502 ? 27.233 12.441 53.289  1.00 35.81 ? 503  ASP A CA  1 
ATOM   3807 C  C   . ASP A 1 502 ? 27.437 13.237 54.541  1.00 35.17 ? 503  ASP A C   1 
ATOM   3808 O  O   . ASP A 1 502 ? 28.360 14.050 54.576  1.00 35.09 ? 503  ASP A O   1 
ATOM   3809 C  CB  . ASP A 1 502 ? 28.175 11.257 53.355  1.00 37.06 ? 503  ASP A CB  1 
ATOM   3810 C  CG  . ASP A 1 502 ? 28.194 10.468 52.066  1.00 38.71 ? 503  ASP A CG  1 
ATOM   3811 O  OD1 . ASP A 1 502 ? 27.123 10.197 51.530  1.00 39.65 ? 503  ASP A OD1 1 
ATOM   3812 O  OD2 . ASP A 1 502 ? 29.283 10.139 51.597  1.00 40.90 ? 503  ASP A OD2 1 
ATOM   3813 N  N   . GLU A 1 503 ? 26.594 12.998 55.550  1.00 34.66 ? 504  GLU A N   1 
ATOM   3814 C  CA  . GLU A 1 503 ? 26.795 13.663 56.813  1.00 35.46 ? 504  GLU A CA  1 
ATOM   3815 C  C   . GLU A 1 503 ? 28.052 13.168 57.521  1.00 36.14 ? 504  GLU A C   1 
ATOM   3816 O  O   . GLU A 1 503 ? 28.576 13.904 58.358  1.00 37.65 ? 504  GLU A O   1 
ATOM   3817 C  CB  . GLU A 1 503 ? 25.591 13.472 57.771  1.00 34.78 ? 504  GLU A CB  1 
ATOM   3818 C  CG  . GLU A 1 503 ? 25.141 12.061 58.123  1.00 36.21 ? 504  GLU A CG  1 
ATOM   3819 C  CD  . GLU A 1 503 ? 24.061 12.004 59.199  1.00 37.48 ? 504  GLU A CD  1 
ATOM   3820 O  OE1 . GLU A 1 503 ? 23.214 12.881 59.273  1.00 37.92 ? 504  GLU A OE1 1 
ATOM   3821 O  OE2 . GLU A 1 503 ? 24.077 11.081 60.003  1.00 38.41 ? 504  GLU A OE2 1 
ATOM   3822 N  N   . LEU A 1 504 ? 28.628 11.995 57.209  1.00 35.37 ? 505  LEU A N   1 
ATOM   3823 C  CA  . LEU A 1 504 ? 29.750 11.415 57.958  1.00 34.82 ? 505  LEU A CA  1 
ATOM   3824 C  C   . LEU A 1 504 ? 30.458 10.448 57.034  1.00 36.49 ? 505  LEU A C   1 
ATOM   3825 O  O   . LEU A 1 504 ? 29.877 10.036 56.018  1.00 36.65 ? 505  LEU A O   1 
ATOM   3826 C  CB  . LEU A 1 504 ? 29.269 10.647 59.164  1.00 32.17 ? 505  LEU A CB  1 
ATOM   3827 C  CG  . LEU A 1 504 ? 28.789 11.418 60.362  1.00 30.63 ? 505  LEU A CG  1 
ATOM   3828 C  CD1 . LEU A 1 504 ? 27.941 10.429 61.136  1.00 31.31 ? 505  LEU A CD1 1 
ATOM   3829 C  CD2 . LEU A 1 504 ? 29.920 12.047 61.165  1.00 28.82 ? 505  LEU A CD2 1 
ATOM   3830 N  N   . PRO A 1 505 ? 31.717 10.057 57.275  1.00 37.99 ? 506  PRO A N   1 
ATOM   3831 C  CA  . PRO A 1 505 ? 32.442 9.227  56.332  1.00 39.32 ? 506  PRO A CA  1 
ATOM   3832 C  C   . PRO A 1 505 ? 31.771 7.884  56.188  1.00 41.42 ? 506  PRO A C   1 
ATOM   3833 O  O   . PRO A 1 505 ? 31.227 7.351  57.153  1.00 41.12 ? 506  PRO A O   1 
ATOM   3834 C  CB  . PRO A 1 505 ? 33.837 9.180  56.907  1.00 39.23 ? 506  PRO A CB  1 
ATOM   3835 C  CG  . PRO A 1 505 ? 33.659 9.427  58.387  1.00 38.35 ? 506  PRO A CG  1 
ATOM   3836 C  CD  . PRO A 1 505 ? 32.584 10.497 58.370  1.00 38.02 ? 506  PRO A CD  1 
ATOM   3837 N  N   . ARG A 1 506 ? 31.744 7.406  54.939  1.00 44.57 ? 507  ARG A N   1 
ATOM   3838 C  CA  . ARG A 1 506 ? 31.209 6.080  54.626  1.00 46.84 ? 507  ARG A CA  1 
ATOM   3839 C  C   . ARG A 1 506 ? 32.018 5.024  55.375  1.00 46.07 ? 507  ARG A C   1 
ATOM   3840 O  O   . ARG A 1 506 ? 31.495 4.116  56.020  1.00 46.02 ? 507  ARG A O   1 
ATOM   3841 C  CB  . ARG A 1 506 ? 31.289 5.902  53.122  1.00 50.18 ? 507  ARG A CB  1 
ATOM   3842 C  CG  . ARG A 1 506 ? 29.966 5.482  52.503  1.00 54.58 ? 507  ARG A CG  1 
ATOM   3843 C  CD  . ARG A 1 506 ? 29.916 5.967  51.040  1.00 58.42 ? 507  ARG A CD  1 
ATOM   3844 N  NE  . ARG A 1 506 ? 28.627 5.634  50.431  1.00 62.29 ? 507  ARG A NE  1 
ATOM   3845 C  CZ  . ARG A 1 506 ? 27.509 6.369  50.551  1.00 64.08 ? 507  ARG A CZ  1 
ATOM   3846 N  NH1 . ARG A 1 506 ? 27.533 7.514  51.225  1.00 65.10 ? 507  ARG A NH1 1 
ATOM   3847 N  NH2 . ARG A 1 506 ? 26.364 5.966  49.986  1.00 64.18 ? 507  ARG A NH2 1 
ATOM   3848 N  N   . ALA A 1 507 ? 33.334 5.249  55.341  1.00 45.66 ? 508  ALA A N   1 
ATOM   3849 C  CA  . ALA A 1 507 ? 34.288 4.476  56.108  1.00 45.68 ? 508  ALA A CA  1 
ATOM   3850 C  C   . ALA A 1 507 ? 34.339 5.042  57.521  1.00 46.09 ? 508  ALA A C   1 
ATOM   3851 O  O   . ALA A 1 507 ? 33.530 5.871  57.935  1.00 46.27 ? 508  ALA A O   1 
ATOM   3852 C  CB  . ALA A 1 507 ? 35.670 4.573  55.477  1.00 44.66 ? 508  ALA A CB  1 
ATOM   3853 N  N   . GLU A 1 508 ? 35.249 4.579  58.361  1.00 46.29 ? 509  GLU A N   1 
ATOM   3854 C  CA  . GLU A 1 508 ? 35.347 5.152  59.690  1.00 45.94 ? 509  GLU A CA  1 
ATOM   3855 C  C   . GLU A 1 508 ? 36.219 6.383  59.579  1.00 44.09 ? 509  GLU A C   1 
ATOM   3856 O  O   . GLU A 1 508 ? 36.707 6.679  58.492  1.00 43.44 ? 509  GLU A O   1 
ATOM   3857 C  CB  . GLU A 1 508 ? 35.901 4.085  60.622  1.00 48.58 ? 509  GLU A CB  1 
ATOM   3858 C  CG  . GLU A 1 508 ? 34.878 2.919  60.632  1.00 53.46 ? 509  GLU A CG  1 
ATOM   3859 C  CD  . GLU A 1 508 ? 33.365 3.242  60.486  1.00 55.99 ? 509  GLU A CD  1 
ATOM   3860 O  OE1 . GLU A 1 508 ? 32.805 3.843  61.419  1.00 56.73 ? 509  GLU A OE1 1 
ATOM   3861 O  OE2 . GLU A 1 508 ? 32.782 2.906  59.435  1.00 55.82 ? 509  GLU A OE2 1 
ATOM   3862 N  N   . PHE A 1 509 ? 36.340 7.171  60.646  1.00 41.54 ? 510  PHE A N   1 
ATOM   3863 C  CA  . PHE A 1 509 ? 37.065 8.416  60.566  1.00 38.78 ? 510  PHE A CA  1 
ATOM   3864 C  C   . PHE A 1 509 ? 38.548 8.104  60.631  1.00 39.06 ? 510  PHE A C   1 
ATOM   3865 O  O   . PHE A 1 509 ? 38.936 7.169  61.326  1.00 38.50 ? 510  PHE A O   1 
ATOM   3866 C  CB  . PHE A 1 509 ? 36.626 9.311  61.720  1.00 35.37 ? 510  PHE A CB  1 
ATOM   3867 C  CG  . PHE A 1 509 ? 35.579 10.391 61.424  1.00 31.36 ? 510  PHE A CG  1 
ATOM   3868 C  CD1 . PHE A 1 509 ? 35.875 11.468 60.574  1.00 29.54 ? 510  PHE A CD1 1 
ATOM   3869 C  CD2 . PHE A 1 509 ? 34.362 10.346 62.081  1.00 29.05 ? 510  PHE A CD2 1 
ATOM   3870 C  CE1 . PHE A 1 509 ? 34.966 12.493 60.394  1.00 27.04 ? 510  PHE A CE1 1 
ATOM   3871 C  CE2 . PHE A 1 509 ? 33.460 11.374 61.902  1.00 28.25 ? 510  PHE A CE2 1 
ATOM   3872 C  CZ  . PHE A 1 509 ? 33.759 12.441 61.067  1.00 27.69 ? 510  PHE A CZ  1 
ATOM   3873 N  N   . ASP A 1 510 ? 39.388 8.795  59.841  1.00 40.07 ? 511  ASP A N   1 
ATOM   3874 C  CA  . ASP A 1 510 ? 40.825 8.644  59.962  1.00 40.48 ? 511  ASP A CA  1 
ATOM   3875 C  C   . ASP A 1 510 ? 41.166 9.679  61.036  1.00 41.65 ? 511  ASP A C   1 
ATOM   3876 O  O   . ASP A 1 510 ? 40.897 10.872 60.920  1.00 42.00 ? 511  ASP A O   1 
ATOM   3877 C  CB  . ASP A 1 510 ? 41.538 8.971  58.656  1.00 39.42 ? 511  ASP A CB  1 
ATOM   3878 C  CG  . ASP A 1 510 ? 43.059 8.723  58.691  1.00 39.97 ? 511  ASP A CG  1 
ATOM   3879 O  OD1 . ASP A 1 510 ? 43.671 8.916  59.752  1.00 40.19 ? 511  ASP A OD1 1 
ATOM   3880 O  OD2 . ASP A 1 510 ? 43.651 8.360  57.656  1.00 38.00 ? 511  ASP A OD2 1 
ATOM   3881 N  N   . PRO A 1 511 ? 41.756 9.261  62.140  1.00 43.28 ? 512  PRO A N   1 
ATOM   3882 C  CA  . PRO A 1 511 ? 41.984 10.133 63.287  1.00 43.81 ? 512  PRO A CA  1 
ATOM   3883 C  C   . PRO A 1 511 ? 43.177 11.071 63.223  1.00 44.34 ? 512  PRO A C   1 
ATOM   3884 O  O   . PRO A 1 511 ? 43.298 11.893 64.122  1.00 44.51 ? 512  PRO A O   1 
ATOM   3885 C  CB  . PRO A 1 511 ? 42.036 9.148  64.430  1.00 44.28 ? 512  PRO A CB  1 
ATOM   3886 C  CG  . PRO A 1 511 ? 42.757 7.961  63.816  1.00 44.31 ? 512  PRO A CG  1 
ATOM   3887 C  CD  . PRO A 1 511 ? 42.089 7.860  62.443  1.00 43.88 ? 512  PRO A CD  1 
ATOM   3888 N  N   . GLY A 1 512 ? 44.048 10.979 62.197  1.00 45.51 ? 513  GLY A N   1 
ATOM   3889 C  CA  . GLY A 1 512 ? 45.248 11.818 62.007  1.00 46.87 ? 513  GLY A CA  1 
ATOM   3890 C  C   . GLY A 1 512 ? 46.406 11.592 62.996  1.00 48.07 ? 513  GLY A C   1 
ATOM   3891 O  O   . GLY A 1 512 ? 46.688 10.461 63.395  1.00 47.51 ? 513  GLY A O   1 
ATOM   3892 N  N   . GLN A 1 513 ? 47.105 12.642 63.453  1.00 49.72 ? 514  GLN A N   1 
ATOM   3893 C  CA  . GLN A 1 513 ? 48.166 12.436 64.432  1.00 51.98 ? 514  GLN A CA  1 
ATOM   3894 C  C   . GLN A 1 513 ? 47.784 12.796 65.872  1.00 51.75 ? 514  GLN A C   1 
ATOM   3895 O  O   . GLN A 1 513 ? 46.824 13.539 66.127  1.00 52.43 ? 514  GLN A O   1 
ATOM   3896 C  CB  . GLN A 1 513 ? 49.442 13.207 63.976  1.00 54.50 ? 514  GLN A CB  1 
ATOM   3897 C  CG  . GLN A 1 513 ? 49.432 14.690 63.602  1.00 58.91 ? 514  GLN A CG  1 
ATOM   3898 C  CD  . GLN A 1 513 ? 49.611 15.763 64.684  1.00 61.58 ? 514  GLN A CD  1 
ATOM   3899 O  OE1 . GLN A 1 513 ? 49.242 16.921 64.445  1.00 63.68 ? 514  GLN A OE1 1 
ATOM   3900 N  NE2 . GLN A 1 513 ? 50.201 15.509 65.859  1.00 62.38 ? 514  GLN A NE2 1 
ATOM   3901 N  N   . ASP A 1 514 ? 48.581 12.212 66.794  1.00 50.77 ? 515  ASP A N   1 
ATOM   3902 C  CA  . ASP A 1 514 ? 48.451 12.329 68.251  1.00 49.23 ? 515  ASP A CA  1 
ATOM   3903 C  C   . ASP A 1 514 ? 48.636 13.780 68.683  1.00 46.11 ? 515  ASP A C   1 
ATOM   3904 O  O   . ASP A 1 514 ? 49.699 14.402 68.510  1.00 46.75 ? 515  ASP A O   1 
ATOM   3905 C  CB  . ASP A 1 514 ? 49.515 11.472 68.955  1.00 53.01 ? 515  ASP A CB  1 
ATOM   3906 C  CG  . ASP A 1 514 ? 51.027 11.842 68.827  1.00 56.18 ? 515  ASP A CG  1 
ATOM   3907 O  OD1 . ASP A 1 514 ? 51.510 12.174 67.725  1.00 58.25 ? 515  ASP A OD1 1 
ATOM   3908 O  OD2 . ASP A 1 514 ? 51.725 11.796 69.855  1.00 57.76 ? 515  ASP A OD2 1 
ATOM   3909 N  N   . THR A 1 515 ? 47.577 14.376 69.183  1.00 41.12 ? 516  THR A N   1 
ATOM   3910 C  CA  . THR A 1 515 ? 47.717 15.745 69.576  1.00 36.14 ? 516  THR A CA  1 
ATOM   3911 C  C   . THR A 1 515 ? 47.419 15.844 71.028  1.00 32.62 ? 516  THR A C   1 
ATOM   3912 O  O   . THR A 1 515 ? 47.887 16.771 71.654  1.00 33.10 ? 516  THR A O   1 
ATOM   3913 C  CB  . THR A 1 515 ? 46.797 16.604 68.707  1.00 36.41 ? 516  THR A CB  1 
ATOM   3914 O  OG1 . THR A 1 515 ? 45.533 15.955 68.545  1.00 36.77 ? 516  THR A OG1 1 
ATOM   3915 C  CG2 . THR A 1 515 ? 47.444 16.840 67.337  1.00 34.64 ? 516  THR A CG2 1 
ATOM   3916 N  N   . TYR A 1 516 ? 46.797 14.860 71.636  1.00 28.50 ? 517  TYR A N   1 
ATOM   3917 C  CA  . TYR A 1 516 ? 46.535 14.929 73.048  1.00 25.69 ? 517  TYR A CA  1 
ATOM   3918 C  C   . TYR A 1 516 ? 47.698 14.565 73.939  1.00 27.00 ? 517  TYR A C   1 
ATOM   3919 O  O   . TYR A 1 516 ? 48.453 13.676 73.611  1.00 26.91 ? 517  TYR A O   1 
ATOM   3920 C  CB  . TYR A 1 516 ? 45.417 14.026 73.384  1.00 20.91 ? 517  TYR A CB  1 
ATOM   3921 C  CG  . TYR A 1 516 ? 44.979 14.153 74.818  1.00 15.83 ? 517  TYR A CG  1 
ATOM   3922 C  CD1 . TYR A 1 516 ? 44.291 15.275 75.278  1.00 14.57 ? 517  TYR A CD1 1 
ATOM   3923 C  CD2 . TYR A 1 516 ? 45.233 13.070 75.645  1.00 13.56 ? 517  TYR A CD2 1 
ATOM   3924 C  CE1 . TYR A 1 516 ? 43.847 15.303 76.599  1.00 14.88 ? 517  TYR A CE1 1 
ATOM   3925 C  CE2 . TYR A 1 516 ? 44.792 13.078 76.960  1.00 13.14 ? 517  TYR A CE2 1 
ATOM   3926 C  CZ  . TYR A 1 516 ? 44.099 14.198 77.418  1.00 14.12 ? 517  TYR A CZ  1 
ATOM   3927 O  OH  . TYR A 1 516 ? 43.647 14.265 78.711  1.00 15.37 ? 517  TYR A OH  1 
ATOM   3928 N  N   . GLN A 1 517 ? 47.814 15.187 75.108  1.00 29.33 ? 518  GLN A N   1 
ATOM   3929 C  CA  . GLN A 1 517 ? 48.821 14.856 76.100  1.00 31.54 ? 518  GLN A CA  1 
ATOM   3930 C  C   . GLN A 1 517 ? 48.153 14.800 77.464  1.00 31.93 ? 518  GLN A C   1 
ATOM   3931 O  O   . GLN A 1 517 ? 47.677 15.825 77.976  1.00 32.75 ? 518  GLN A O   1 
ATOM   3932 C  CB  . GLN A 1 517 ? 49.832 15.929 76.021  1.00 34.34 ? 518  GLN A CB  1 
ATOM   3933 C  CG  . GLN A 1 517 ? 51.007 15.870 76.947  1.00 38.63 ? 518  GLN A CG  1 
ATOM   3934 C  CD  . GLN A 1 517 ? 51.956 16.996 76.516  1.00 43.13 ? 518  GLN A CD  1 
ATOM   3935 O  OE1 . GLN A 1 517 ? 52.354 17.090 75.327  1.00 45.28 ? 518  GLN A OE1 1 
ATOM   3936 N  NE2 . GLN A 1 517 ? 52.325 17.898 77.451  1.00 43.15 ? 518  GLN A NE2 1 
ATOM   3937 N  N   . HIS A 1 518 ? 48.138 13.638 78.095  1.00 31.88 ? 519  HIS A N   1 
ATOM   3938 C  CA  . HIS A 1 518 ? 47.437 13.458 79.352  1.00 33.71 ? 519  HIS A CA  1 
ATOM   3939 C  C   . HIS A 1 518 ? 48.225 14.014 80.511  1.00 34.16 ? 519  HIS A C   1 
ATOM   3940 O  O   . HIS A 1 518 ? 49.448 13.948 80.394  1.00 32.24 ? 519  HIS A O   1 
ATOM   3941 C  CB  . HIS A 1 518 ? 47.200 11.967 79.541  1.00 36.34 ? 519  HIS A CB  1 
ATOM   3942 C  CG  . HIS A 1 518 ? 46.007 11.672 80.451  1.00 39.54 ? 519  HIS A CG  1 
ATOM   3943 N  ND1 . HIS A 1 518 ? 45.992 11.098 81.650  1.00 40.38 ? 519  HIS A ND1 1 
ATOM   3944 C  CD2 . HIS A 1 518 ? 44.694 12.001 80.155  1.00 40.26 ? 519  HIS A CD2 1 
ATOM   3945 C  CE1 . HIS A 1 518 ? 44.753 11.067 82.085  1.00 41.52 ? 519  HIS A CE1 1 
ATOM   3946 N  NE2 . HIS A 1 518 ? 43.976 11.616 81.172  1.00 41.43 ? 519  HIS A NE2 1 
ATOM   3947 N  N   . PRO A 1 519 ? 47.708 14.527 81.646  1.00 36.04 ? 520  PRO A N   1 
ATOM   3948 C  CA  . PRO A 1 519 ? 48.528 14.870 82.793  1.00 38.51 ? 520  PRO A CA  1 
ATOM   3949 C  C   . PRO A 1 519 ? 49.222 13.641 83.339  1.00 42.33 ? 520  PRO A C   1 
ATOM   3950 O  O   . PRO A 1 519 ? 48.595 12.587 83.439  1.00 42.37 ? 520  PRO A O   1 
ATOM   3951 C  CB  . PRO A 1 519 ? 47.602 15.479 83.781  1.00 36.76 ? 520  PRO A CB  1 
ATOM   3952 C  CG  . PRO A 1 519 ? 46.275 14.938 83.442  1.00 35.45 ? 520  PRO A CG  1 
ATOM   3953 C  CD  . PRO A 1 519 ? 46.333 14.877 81.918  1.00 35.68 ? 520  PRO A CD  1 
ATOM   3954 N  N   . PRO A 1 520 ? 50.514 13.702 83.658  1.00 46.70 ? 521  PRO A N   1 
ATOM   3955 C  CA  . PRO A 1 520 ? 51.195 12.679 84.446  1.00 50.47 ? 521  PRO A CA  1 
ATOM   3956 C  C   . PRO A 1 520 ? 50.492 12.718 85.792  1.00 53.90 ? 521  PRO A C   1 
ATOM   3957 O  O   . PRO A 1 520 ? 50.480 13.790 86.392  1.00 54.09 ? 521  PRO A O   1 
ATOM   3958 C  CB  . PRO A 1 520 ? 52.621 13.159 84.476  1.00 49.78 ? 521  PRO A CB  1 
ATOM   3959 C  CG  . PRO A 1 520 ? 52.501 14.672 84.465  1.00 48.96 ? 521  PRO A CG  1 
ATOM   3960 C  CD  . PRO A 1 520 ? 51.393 14.857 83.430  1.00 47.74 ? 521  PRO A CD  1 
ATOM   3961 N  N   . LYS A 1 521 ? 49.880 11.660 86.320  1.00 58.53 ? 522  LYS A N   1 
ATOM   3962 C  CA  . LYS A 1 521 ? 49.164 11.850 87.589  1.00 63.81 ? 522  LYS A CA  1 
ATOM   3963 C  C   . LYS A 1 521 ? 49.769 11.025 88.722  1.00 66.50 ? 522  LYS A C   1 
ATOM   3964 O  O   . LYS A 1 521 ? 49.197 10.447 89.644  1.00 67.00 ? 522  LYS A O   1 
ATOM   3965 C  CB  . LYS A 1 521 ? 47.660 11.562 87.321  1.00 64.09 ? 522  LYS A CB  1 
ATOM   3966 C  CG  . LYS A 1 521 ? 47.010 12.839 86.725  1.00 65.15 ? 522  LYS A CG  1 
ATOM   3967 C  CD  . LYS A 1 521 ? 46.775 14.072 87.656  1.00 65.52 ? 522  LYS A CD  1 
ATOM   3968 C  CE  . LYS A 1 521 ? 47.915 14.937 88.267  1.00 65.86 ? 522  LYS A CE  1 
ATOM   3969 N  NZ  . LYS A 1 521 ? 48.742 15.685 87.324  1.00 65.13 ? 522  LYS A NZ  1 
ATOM   3970 N  N   . ASP A 1 522 ? 51.046 11.327 88.612  1.00 69.66 ? 523  ASP A N   1 
ATOM   3971 C  CA  . ASP A 1 522 ? 52.149 10.770 89.314  1.00 73.18 ? 523  ASP A CA  1 
ATOM   3972 C  C   . ASP A 1 522 ? 52.981 12.051 89.458  1.00 74.61 ? 523  ASP A C   1 
ATOM   3973 O  O   . ASP A 1 522 ? 52.603 12.812 90.354  1.00 74.95 ? 523  ASP A O   1 
ATOM   3974 C  CB  . ASP A 1 522 ? 52.731 9.658  88.388  1.00 75.28 ? 523  ASP A CB  1 
ATOM   3975 C  CG  . ASP A 1 522 ? 52.555 9.830  86.863  1.00 76.66 ? 523  ASP A CG  1 
ATOM   3976 O  OD1 . ASP A 1 522 ? 53.289 10.588 86.247  1.00 78.56 ? 523  ASP A OD1 1 
ATOM   3977 O  OD2 . ASP A 1 522 ? 51.672 9.221  86.276  1.00 76.82 ? 523  ASP A OD2 1 
ATOM   3978 N  N   . SER A 1 523 ? 53.973 12.392 88.582  1.00 76.08 ? 524  SER A N   1 
ATOM   3979 C  CA  . SER A 1 523 ? 54.847 13.576 88.665  1.00 77.41 ? 524  SER A CA  1 
ATOM   3980 C  C   . SER A 1 523 ? 54.227 14.868 89.183  1.00 77.90 ? 524  SER A C   1 
ATOM   3981 O  O   . SER A 1 523 ? 54.263 15.025 90.410  1.00 78.48 ? 524  SER A O   1 
ATOM   3982 C  CB  . SER A 1 523 ? 55.474 13.867 87.292  1.00 77.58 ? 524  SER A CB  1 
ATOM   3983 O  OG  . SER A 1 523 ? 56.299 12.810 86.821  1.00 78.12 ? 524  SER A OG  1 
ATOM   3984 N  N   . SER A 1 524 ? 53.694 15.823 88.384  1.00 78.00 ? 525  SER A N   1 
ATOM   3985 C  CA  . SER A 1 524 ? 53.076 17.055 88.898  1.00 77.61 ? 525  SER A CA  1 
ATOM   3986 C  C   . SER A 1 524 ? 53.929 17.945 89.813  1.00 76.81 ? 525  SER A C   1 
ATOM   3987 O  O   . SER A 1 524 ? 53.503 19.034 90.199  1.00 77.34 ? 525  SER A O   1 
ATOM   3988 C  CB  . SER A 1 524 ? 51.780 16.690 89.615  1.00 78.00 ? 525  SER A CB  1 
ATOM   3989 O  OG  . SER A 1 524 ? 51.056 15.844 88.698  1.00 78.26 ? 525  SER A OG  1 
ATOM   3990 N  N   . GLY A 1 525 ? 55.179 17.507 90.084  1.00 75.72 ? 526  GLY A N   1 
ATOM   3991 C  CA  . GLY A 1 525 ? 56.220 18.198 90.843  1.00 73.67 ? 526  GLY A CA  1 
ATOM   3992 C  C   . GLY A 1 525 ? 57.071 19.101 89.929  1.00 71.85 ? 526  GLY A C   1 
ATOM   3993 O  O   . GLY A 1 525 ? 58.291 19.259 90.075  1.00 71.46 ? 526  GLY A O   1 
ATOM   3994 N  N   . GLN A 1 526 ? 56.345 19.675 88.954  1.00 69.75 ? 527  GLN A N   1 
ATOM   3995 C  CA  . GLN A 1 526 ? 56.822 20.675 88.038  1.00 67.23 ? 527  GLN A CA  1 
ATOM   3996 C  C   . GLN A 1 526 ? 56.737 21.998 88.794  1.00 64.56 ? 527  GLN A C   1 
ATOM   3997 O  O   . GLN A 1 526 ? 56.020 22.168 89.784  1.00 64.61 ? 527  GLN A O   1 
ATOM   3998 C  CB  . GLN A 1 526 ? 55.928 20.786 86.790  1.00 68.70 ? 527  GLN A CB  1 
ATOM   3999 C  CG  . GLN A 1 526 ? 56.103 19.818 85.595  1.00 70.03 ? 527  GLN A CG  1 
ATOM   4000 C  CD  . GLN A 1 526 ? 55.668 18.351 85.710  1.00 70.43 ? 527  GLN A CD  1 
ATOM   4001 O  OE1 . GLN A 1 526 ? 55.173 17.866 86.726  1.00 70.98 ? 527  GLN A OE1 1 
ATOM   4002 N  NE2 . GLN A 1 526 ? 55.821 17.592 84.627  1.00 70.22 ? 527  GLN A NE2 1 
ATOM   4003 N  N   . ARG A 1 527 ? 57.571 22.919 88.358  1.00 61.38 ? 528  ARG A N   1 
ATOM   4004 C  CA  . ARG A 1 527 ? 57.463 24.290 88.786  1.00 58.14 ? 528  ARG A CA  1 
ATOM   4005 C  C   . ARG A 1 527 ? 56.868 24.961 87.521  1.00 55.60 ? 528  ARG A C   1 
ATOM   4006 O  O   . ARG A 1 527 ? 57.078 24.484 86.384  1.00 55.46 ? 528  ARG A O   1 
ATOM   4007 C  CB  . ARG A 1 527 ? 58.867 24.773 89.128  1.00 57.84 ? 528  ARG A CB  1 
ATOM   4008 C  CG  . ARG A 1 527 ? 59.504 24.174 90.363  1.00 58.19 ? 528  ARG A CG  1 
ATOM   4009 C  CD  . ARG A 1 527 ? 60.982 24.589 90.428  1.00 60.04 ? 528  ARG A CD  1 
ATOM   4010 N  NE  . ARG A 1 527 ? 61.577 24.533 91.781  1.00 61.48 ? 528  ARG A NE  1 
ATOM   4011 C  CZ  . ARG A 1 527 ? 62.761 25.090 92.158  1.00 61.73 ? 528  ARG A CZ  1 
ATOM   4012 N  NH1 . ARG A 1 527 ? 63.605 25.708 91.330  1.00 61.36 ? 528  ARG A NH1 1 
ATOM   4013 N  NH2 . ARG A 1 527 ? 63.138 25.030 93.432  1.00 62.47 ? 528  ARG A NH2 1 
ATOM   4014 N  N   . VAL A 1 528 ? 56.084 26.038 87.601  1.00 52.04 ? 529  VAL A N   1 
ATOM   4015 C  CA  . VAL A 1 528 ? 55.692 26.698 86.373  1.00 49.33 ? 529  VAL A CA  1 
ATOM   4016 C  C   . VAL A 1 528 ? 56.521 27.962 86.380  1.00 47.39 ? 529  VAL A C   1 
ATOM   4017 O  O   . VAL A 1 528 ? 56.440 28.748 87.331  1.00 47.43 ? 529  VAL A O   1 
ATOM   4018 C  CB  . VAL A 1 528 ? 54.231 27.132 86.311  1.00 49.25 ? 529  VAL A CB  1 
ATOM   4019 C  CG1 . VAL A 1 528 ? 53.908 27.457 84.845  1.00 49.41 ? 529  VAL A CG1 1 
ATOM   4020 C  CG2 . VAL A 1 528 ? 53.315 26.059 86.833  1.00 50.28 ? 529  VAL A CG2 1 
ATOM   4021 N  N   . ASP A 1 529 ? 57.303 28.181 85.326  1.00 44.58 ? 530  ASP A N   1 
ATOM   4022 C  CA  . ASP A 1 529 ? 58.110 29.380 85.281  1.00 42.55 ? 530  ASP A CA  1 
ATOM   4023 C  C   . ASP A 1 529 ? 57.473 30.434 84.390  1.00 40.69 ? 530  ASP A C   1 
ATOM   4024 O  O   . ASP A 1 529 ? 57.127 30.190 83.216  1.00 41.84 ? 530  ASP A O   1 
ATOM   4025 C  CB  . ASP A 1 529 ? 59.511 29.158 84.713  1.00 43.45 ? 530  ASP A CB  1 
ATOM   4026 C  CG  . ASP A 1 529 ? 60.469 30.341 84.932  1.00 44.17 ? 530  ASP A CG  1 
ATOM   4027 O  OD1 . ASP A 1 529 ? 60.618 30.800 86.073  1.00 43.75 ? 530  ASP A OD1 1 
ATOM   4028 O  OD2 . ASP A 1 529 ? 61.071 30.796 83.952  1.00 45.46 ? 530  ASP A OD2 1 
ATOM   4029 N  N   . VAL A 1 530 ? 57.411 31.611 85.022  1.00 36.80 ? 531  VAL A N   1 
ATOM   4030 C  CA  . VAL A 1 530 ? 56.916 32.793 84.381  1.00 33.16 ? 531  VAL A CA  1 
ATOM   4031 C  C   . VAL A 1 530 ? 58.119 33.734 84.533  1.00 32.48 ? 531  VAL A C   1 
ATOM   4032 O  O   . VAL A 1 530 ? 58.473 34.190 85.631  1.00 32.23 ? 531  VAL A O   1 
ATOM   4033 C  CB  . VAL A 1 530 ? 55.672 33.297 85.143  1.00 31.00 ? 531  VAL A CB  1 
ATOM   4034 C  CG1 . VAL A 1 530 ? 55.129 34.537 84.507  1.00 29.53 ? 531  VAL A CG1 1 
ATOM   4035 C  CG2 . VAL A 1 530 ? 54.565 32.287 85.068  1.00 30.39 ? 531  VAL A CG2 1 
ATOM   4036 N  N   . SER A 1 531 ? 58.811 34.017 83.445  1.00 31.04 ? 532  SER A N   1 
ATOM   4037 C  CA  . SER A 1 531 ? 59.914 34.959 83.465  1.00 30.57 ? 532  SER A CA  1 
ATOM   4038 C  C   . SER A 1 531 ? 59.536 36.315 84.065  1.00 29.74 ? 532  SER A C   1 
ATOM   4039 O  O   . SER A 1 531 ? 58.531 36.898 83.640  1.00 29.43 ? 532  SER A O   1 
ATOM   4040 C  CB  . SER A 1 531 ? 60.390 35.173 82.055  1.00 31.23 ? 532  SER A CB  1 
ATOM   4041 O  OG  . SER A 1 531 ? 61.480 36.097 82.063  1.00 33.73 ? 532  SER A OG  1 
ATOM   4042 N  N   . PRO A 1 532 ? 60.285 36.927 85.000  1.00 29.45 ? 533  PRO A N   1 
ATOM   4043 C  CA  . PRO A 1 532 ? 59.906 38.192 85.637  1.00 27.60 ? 533  PRO A CA  1 
ATOM   4044 C  C   . PRO A 1 532 ? 60.041 39.354 84.678  1.00 26.58 ? 533  PRO A C   1 
ATOM   4045 O  O   . PRO A 1 532 ? 59.668 40.453 85.042  1.00 26.66 ? 533  PRO A O   1 
ATOM   4046 C  CB  . PRO A 1 532 ? 60.828 38.282 86.837  1.00 28.64 ? 533  PRO A CB  1 
ATOM   4047 C  CG  . PRO A 1 532 ? 61.307 36.850 87.077  1.00 28.85 ? 533  PRO A CG  1 
ATOM   4048 C  CD  . PRO A 1 532 ? 61.513 36.406 85.618  1.00 29.86 ? 533  PRO A CD  1 
ATOM   4049 N  N   . THR A 1 533 ? 60.599 39.178 83.467  1.00 25.36 ? 534  THR A N   1 
ATOM   4050 C  CA  . THR A 1 533 ? 60.811 40.245 82.494  1.00 24.11 ? 534  THR A CA  1 
ATOM   4051 C  C   . THR A 1 533 ? 60.112 39.932 81.176  1.00 22.94 ? 534  THR A C   1 
ATOM   4052 O  O   . THR A 1 533 ? 60.377 40.536 80.140  1.00 22.11 ? 534  THR A O   1 
ATOM   4053 C  CB  . THR A 1 533 ? 62.355 40.421 82.280  1.00 25.08 ? 534  THR A CB  1 
ATOM   4054 O  OG1 . THR A 1 533 ? 62.852 39.214 81.695  1.00 25.10 ? 534  THR A OG1 1 
ATOM   4055 C  CG2 . THR A 1 533 ? 63.118 40.684 83.593  1.00 26.83 ? 534  THR A CG2 1 
ATOM   4056 N  N   . SER A 1 534 ? 59.132 39.043 81.261  1.00 22.99 ? 535  SER A N   1 
ATOM   4057 C  CA  . SER A 1 534 ? 58.373 38.511 80.151  1.00 22.91 ? 535  SER A CA  1 
ATOM   4058 C  C   . SER A 1 534 ? 57.376 39.511 79.619  1.00 23.61 ? 535  SER A C   1 
ATOM   4059 O  O   . SER A 1 534 ? 56.715 40.216 80.377  1.00 24.52 ? 535  SER A O   1 
ATOM   4060 C  CB  . SER A 1 534 ? 57.630 37.321 80.619  1.00 22.39 ? 535  SER A CB  1 
ATOM   4061 O  OG  . SER A 1 534 ? 56.917 36.763 79.551  1.00 22.98 ? 535  SER A OG  1 
ATOM   4062 N  N   . GLN A 1 535 ? 57.195 39.549 78.316  1.00 24.56 ? 536  GLN A N   1 
ATOM   4063 C  CA  . GLN A 1 535 ? 56.243 40.482 77.759  1.00 25.05 ? 536  GLN A CA  1 
ATOM   4064 C  C   . GLN A 1 535 ? 54.927 39.844 77.379  1.00 23.77 ? 536  GLN A C   1 
ATOM   4065 O  O   . GLN A 1 535 ? 53.970 40.562 77.079  1.00 23.43 ? 536  GLN A O   1 
ATOM   4066 C  CB  . GLN A 1 535 ? 56.901 41.158 76.565  1.00 28.06 ? 536  GLN A CB  1 
ATOM   4067 C  CG  . GLN A 1 535 ? 57.894 42.256 76.988  1.00 31.74 ? 536  GLN A CG  1 
ATOM   4068 C  CD  . GLN A 1 535 ? 57.302 43.352 77.883  1.00 34.50 ? 536  GLN A CD  1 
ATOM   4069 O  OE1 . GLN A 1 535 ? 57.929 43.735 78.867  1.00 35.72 ? 536  GLN A OE1 1 
ATOM   4070 N  NE2 . GLN A 1 535 ? 56.139 43.943 77.595  1.00 36.63 ? 536  GLN A NE2 1 
ATOM   4071 N  N   . ARG A 1 536 ? 54.857 38.495 77.461  1.00 22.50 ? 537  ARG A N   1 
ATOM   4072 C  CA  . ARG A 1 536 ? 53.635 37.755 77.155  1.00 20.55 ? 537  ARG A CA  1 
ATOM   4073 C  C   . ARG A 1 536 ? 52.882 37.185 78.351  1.00 19.59 ? 537  ARG A C   1 
ATOM   4074 O  O   . ARG A 1 536 ? 51.677 36.933 78.230  1.00 19.54 ? 537  ARG A O   1 
ATOM   4075 C  CB  . ARG A 1 536 ? 53.972 36.614 76.194  1.00 20.37 ? 537  ARG A CB  1 
ATOM   4076 C  CG  . ARG A 1 536 ? 54.528 37.116 74.881  1.00 19.15 ? 537  ARG A CG  1 
ATOM   4077 C  CD  . ARG A 1 536 ? 54.637 35.999 73.897  1.00 20.34 ? 537  ARG A CD  1 
ATOM   4078 N  NE  . ARG A 1 536 ? 53.329 35.618 73.377  1.00 21.53 ? 537  ARG A NE  1 
ATOM   4079 C  CZ  . ARG A 1 536 ? 53.168 35.229 72.114  1.00 21.69 ? 537  ARG A CZ  1 
ATOM   4080 N  NH1 . ARG A 1 536 ? 54.188 35.291 71.258  1.00 21.59 ? 537  ARG A NH1 1 
ATOM   4081 N  NH2 . ARG A 1 536 ? 51.957 34.848 71.693  1.00 20.79 ? 537  ARG A NH2 1 
ATOM   4082 N  N   . LEU A 1 537 ? 53.587 36.945 79.481  1.00 17.88 ? 538  LEU A N   1 
ATOM   4083 C  CA  . LEU A 1 537 ? 53.022 36.381 80.689  1.00 16.79 ? 538  LEU A CA  1 
ATOM   4084 C  C   . LEU A 1 537 ? 53.433 37.216 81.884  1.00 17.74 ? 538  LEU A C   1 
ATOM   4085 O  O   . LEU A 1 537 ? 54.561 37.697 81.886  1.00 17.97 ? 538  LEU A O   1 
ATOM   4086 C  CB  . LEU A 1 537 ? 53.525 34.973 80.898  1.00 16.06 ? 538  LEU A CB  1 
ATOM   4087 C  CG  . LEU A 1 537 ? 53.156 33.881 79.895  1.00 17.33 ? 538  LEU A CG  1 
ATOM   4088 C  CD1 . LEU A 1 537 ? 54.087 32.684 80.122  1.00 16.69 ? 538  LEU A CD1 1 
ATOM   4089 C  CD2 . LEU A 1 537 ? 51.675 33.483 80.039  1.00 14.73 ? 538  LEU A CD2 1 
ATOM   4090 N  N   . GLN A 1 538 ? 52.573 37.390 82.898  1.00 17.82 ? 539  GLN A N   1 
ATOM   4091 C  CA  . GLN A 1 538 ? 52.874 38.142 84.095  1.00 19.16 ? 539  GLN A CA  1 
ATOM   4092 C  C   . GLN A 1 538 ? 51.978 37.680 85.212  1.00 19.14 ? 539  GLN A C   1 
ATOM   4093 O  O   . GLN A 1 538 ? 50.776 37.542 85.022  1.00 20.25 ? 539  GLN A O   1 
ATOM   4094 C  CB  . GLN A 1 538 ? 52.641 39.619 83.848  1.00 23.50 ? 539  GLN A CB  1 
ATOM   4095 C  CG  . GLN A 1 538 ? 52.695 40.520 85.085  1.00 27.95 ? 539  GLN A CG  1 
ATOM   4096 C  CD  . GLN A 1 538 ? 52.427 42.002 84.813  1.00 30.45 ? 539  GLN A CD  1 
ATOM   4097 O  OE1 . GLN A 1 538 ? 53.420 42.733 84.674  1.00 33.19 ? 539  GLN A OE1 1 
ATOM   4098 N  NE2 . GLN A 1 538 ? 51.149 42.433 84.661  1.00 28.55 ? 539  GLN A NE2 1 
ATOM   4099 N  N   . LEU A 1 539 ? 52.525 37.431 86.407  1.00 19.07 ? 540  LEU A N   1 
ATOM   4100 C  CA  . LEU A 1 539 ? 51.713 37.024 87.543  1.00 17.94 ? 540  LEU A CA  1 
ATOM   4101 C  C   . LEU A 1 539 ? 50.948 38.275 88.065  1.00 18.09 ? 540  LEU A C   1 
ATOM   4102 O  O   . LEU A 1 539 ? 51.355 39.428 87.862  1.00 16.53 ? 540  LEU A O   1 
ATOM   4103 C  CB  . LEU A 1 539 ? 52.646 36.416 88.601  1.00 16.92 ? 540  LEU A CB  1 
ATOM   4104 C  CG  . LEU A 1 539 ? 53.537 35.177 88.343  1.00 17.09 ? 540  LEU A CG  1 
ATOM   4105 C  CD1 . LEU A 1 539 ? 54.272 34.865 89.658  1.00 16.93 ? 540  LEU A CD1 1 
ATOM   4106 C  CD2 . LEU A 1 539 ? 52.757 33.932 87.998  1.00 14.41 ? 540  LEU A CD2 1 
ATOM   4107 N  N   . LEU A 1 540 ? 49.801 38.022 88.703  1.00 18.78 ? 541  LEU A N   1 
ATOM   4108 C  CA  . LEU A 1 540 ? 48.839 39.020 89.141  1.00 19.82 ? 541  LEU A CA  1 
ATOM   4109 C  C   . LEU A 1 540 ? 49.030 39.438 90.564  1.00 21.21 ? 541  LEU A C   1 
ATOM   4110 O  O   . LEU A 1 540 ? 49.476 38.717 91.440  1.00 22.20 ? 541  LEU A O   1 
ATOM   4111 C  CB  . LEU A 1 540 ? 47.411 38.539 89.083  1.00 18.70 ? 541  LEU A CB  1 
ATOM   4112 C  CG  . LEU A 1 540 ? 46.838 38.068 87.771  1.00 18.56 ? 541  LEU A CG  1 
ATOM   4113 C  CD1 . LEU A 1 540 ? 45.530 37.367 88.103  1.00 19.56 ? 541  LEU A CD1 1 
ATOM   4114 C  CD2 . LEU A 1 540 ? 46.601 39.190 86.808  1.00 18.91 ? 541  LEU A CD2 1 
ATOM   4115 N  N   . GLU A 1 541 ? 48.676 40.676 90.793  1.00 22.31 ? 542  GLU A N   1 
ATOM   4116 C  CA  . GLU A 1 541 ? 48.689 41.208 92.127  1.00 22.19 ? 542  GLU A CA  1 
ATOM   4117 C  C   . GLU A 1 541 ? 47.194 41.387 92.382  1.00 21.77 ? 542  GLU A C   1 
ATOM   4118 O  O   . GLU A 1 541 ? 46.378 41.652 91.463  1.00 22.22 ? 542  GLU A O   1 
ATOM   4119 C  CB  . GLU A 1 541 ? 49.492 42.471 92.013  1.00 23.88 ? 542  GLU A CB  1 
ATOM   4120 C  CG  . GLU A 1 541 ? 49.688 43.296 93.242  1.00 25.77 ? 542  GLU A CG  1 
ATOM   4121 C  CD  . GLU A 1 541 ? 50.594 44.493 92.996  1.00 28.49 ? 542  GLU A CD  1 
ATOM   4122 O  OE1 . GLU A 1 541 ? 50.558 45.110 91.918  1.00 29.92 ? 542  GLU A OE1 1 
ATOM   4123 O  OE2 . GLU A 1 541 ? 51.348 44.797 93.919  1.00 29.61 ? 542  GLU A OE2 1 
ATOM   4124 N  N   . PRO A 1 542 ? 46.778 41.159 93.616  1.00 21.16 ? 543  PRO A N   1 
ATOM   4125 C  CA  . PRO A 1 542 ? 45.408 41.359 93.994  1.00 21.10 ? 543  PRO A CA  1 
ATOM   4126 C  C   . PRO A 1 542 ? 44.941 42.802 93.851  1.00 21.45 ? 543  PRO A C   1 
ATOM   4127 O  O   . PRO A 1 542 ? 45.716 43.756 93.837  1.00 22.68 ? 543  PRO A O   1 
ATOM   4128 C  CB  . PRO A 1 542 ? 45.345 40.819 95.421  1.00 20.65 ? 543  PRO A CB  1 
ATOM   4129 C  CG  . PRO A 1 542 ? 46.767 40.849 95.910  1.00 19.88 ? 543  PRO A CG  1 
ATOM   4130 C  CD  . PRO A 1 542 ? 47.507 40.439 94.651  1.00 21.12 ? 543  PRO A CD  1 
ATOM   4131 N  N   . PHE A 1 543 ? 43.645 42.970 93.658  1.00 21.11 ? 544  PHE A N   1 
ATOM   4132 C  CA  . PHE A 1 543 ? 43.095 44.293 93.708  1.00 20.76 ? 544  PHE A CA  1 
ATOM   4133 C  C   . PHE A 1 543 ? 42.840 44.580 95.188  1.00 22.93 ? 544  PHE A C   1 
ATOM   4134 O  O   . PHE A 1 543 ? 42.866 43.759 96.100  1.00 22.30 ? 544  PHE A O   1 
ATOM   4135 C  CB  . PHE A 1 543 ? 41.803 44.321 92.893  1.00 18.22 ? 544  PHE A CB  1 
ATOM   4136 C  CG  . PHE A 1 543 ? 41.978 43.983 91.423  1.00 13.29 ? 544  PHE A CG  1 
ATOM   4137 C  CD1 . PHE A 1 543 ? 42.877 44.711 90.626  1.00 11.09 ? 544  PHE A CD1 1 
ATOM   4138 C  CD2 . PHE A 1 543 ? 41.213 42.963 90.875  1.00 11.27 ? 544  PHE A CD2 1 
ATOM   4139 C  CE1 . PHE A 1 543 ? 42.992 44.403 89.275  1.00 10.54 ? 544  PHE A CE1 1 
ATOM   4140 C  CE2 . PHE A 1 543 ? 41.325 42.655 89.505  1.00 10.42 ? 544  PHE A CE2 1 
ATOM   4141 C  CZ  . PHE A 1 543 ? 42.215 43.374 88.695  1.00 10.27 ? 544  PHE A CZ  1 
ATOM   4142 N  N   . ASP A 1 544 ? 42.625 45.854 95.364  1.00 25.34 ? 545  ASP A N   1 
ATOM   4143 C  CA  . ASP A 1 544 ? 42.285 46.497 96.620  1.00 28.54 ? 545  ASP A CA  1 
ATOM   4144 C  C   . ASP A 1 544 ? 40.952 46.032 97.226  1.00 29.60 ? 545  ASP A C   1 
ATOM   4145 O  O   . ASP A 1 544 ? 40.071 45.611 96.488  1.00 29.84 ? 545  ASP A O   1 
ATOM   4146 C  CB  . ASP A 1 544 ? 42.274 48.014 96.344  1.00 31.50 ? 545  ASP A CB  1 
ATOM   4147 C  CG  . ASP A 1 544 ? 41.673 48.519 95.005  1.00 34.42 ? 545  ASP A CG  1 
ATOM   4148 O  OD1 . ASP A 1 544 ? 42.121 48.095 93.912  1.00 36.20 ? 545  ASP A OD1 1 
ATOM   4149 O  OD2 . ASP A 1 544 ? 40.779 49.377 95.081  1.00 35.47 ? 545  ASP A OD2 1 
ATOM   4150 N  N   . LYS A 1 545 ? 40.757 46.048 98.548  1.00 30.23 ? 546  LYS A N   1 
ATOM   4151 C  CA  . LYS A 1 545 ? 39.473 45.753 99.188  1.00 31.11 ? 546  LYS A CA  1 
ATOM   4152 C  C   . LYS A 1 545 ? 38.592 47.005 99.045  1.00 31.01 ? 546  LYS A C   1 
ATOM   4153 O  O   . LYS A 1 545 ? 39.160 48.046 98.734  1.00 32.00 ? 546  LYS A O   1 
ATOM   4154 C  CB  . LYS A 1 545 ? 39.629 45.503 100.674 1.00 33.02 ? 546  LYS A CB  1 
ATOM   4155 C  CG  . LYS A 1 545 ? 40.650 44.445 101.066 1.00 37.59 ? 546  LYS A CG  1 
ATOM   4156 C  CD  . LYS A 1 545 ? 40.008 43.067 100.911 1.00 40.78 ? 546  LYS A CD  1 
ATOM   4157 C  CE  . LYS A 1 545 ? 40.887 41.874 101.296 1.00 42.67 ? 546  LYS A CE  1 
ATOM   4158 N  NZ  . LYS A 1 545 ? 40.068 40.687 101.458 1.00 44.31 ? 546  LYS A NZ  1 
ATOM   4159 N  N   . TRP A 1 546 ? 37.260 47.051 99.227  1.00 30.25 ? 547  TRP A N   1 
ATOM   4160 C  CA  . TRP A 1 546 ? 36.481 48.299 99.227  1.00 30.34 ? 547  TRP A CA  1 
ATOM   4161 C  C   . TRP A 1 546 ? 36.816 49.057 100.513 1.00 31.03 ? 547  TRP A C   1 
ATOM   4162 O  O   . TRP A 1 546 ? 36.967 48.456 101.588 1.00 29.77 ? 547  TRP A O   1 
ATOM   4163 C  CB  . TRP A 1 546 ? 34.985 47.986 99.196  1.00 28.97 ? 547  TRP A CB  1 
ATOM   4164 C  CG  . TRP A 1 546 ? 33.956 49.090 99.430  1.00 28.00 ? 547  TRP A CG  1 
ATOM   4165 C  CD1 . TRP A 1 546 ? 33.884 50.217 98.643  1.00 28.26 ? 547  TRP A CD1 1 
ATOM   4166 C  CD2 . TRP A 1 546 ? 32.946 49.038 100.368 1.00 28.74 ? 547  TRP A CD2 1 
ATOM   4167 N  NE1 . TRP A 1 546 ? 32.822 50.861 99.074  1.00 27.43 ? 547  TRP A NE1 1 
ATOM   4168 C  CE2 . TRP A 1 546 ? 32.236 50.197 100.080 1.00 28.21 ? 547  TRP A CE2 1 
ATOM   4169 C  CE3 . TRP A 1 546 ? 32.512 48.190 101.397 1.00 30.49 ? 547  TRP A CE3 1 
ATOM   4170 C  CZ2 . TRP A 1 546 ? 31.100 50.523 100.810 1.00 30.35 ? 547  TRP A CZ2 1 
ATOM   4171 C  CZ3 . TRP A 1 546 ? 31.362 48.516 102.138 1.00 30.61 ? 547  TRP A CZ3 1 
ATOM   4172 C  CH2 . TRP A 1 546 ? 30.658 49.682 101.843 1.00 31.06 ? 547  TRP A CH2 1 
ATOM   4173 N  N   . ASP A 1 547 ? 36.923 50.392 100.356 1.00 32.65 ? 548  ASP A N   1 
ATOM   4174 C  CA  . ASP A 1 547 ? 37.279 51.299 101.457 1.00 34.38 ? 548  ASP A CA  1 
ATOM   4175 C  C   . ASP A 1 547 ? 36.207 51.510 102.505 1.00 34.53 ? 548  ASP A C   1 
ATOM   4176 O  O   . ASP A 1 547 ? 36.498 51.994 103.595 1.00 34.82 ? 548  ASP A O   1 
ATOM   4177 C  CB  . ASP A 1 547 ? 37.690 52.685 100.924 1.00 35.89 ? 548  ASP A CB  1 
ATOM   4178 C  CG  . ASP A 1 547 ? 36.887 53.348 99.806  1.00 37.33 ? 548  ASP A CG  1 
ATOM   4179 O  OD1 . ASP A 1 547 ? 35.671 53.166 99.663  1.00 38.16 ? 548  ASP A OD1 1 
ATOM   4180 O  OD2 . ASP A 1 547 ? 37.529 54.106 99.080  1.00 38.66 ? 548  ASP A OD2 1 
ATOM   4181 N  N   . GLY A 1 548 ? 34.975 51.159 102.173 1.00 34.47 ? 549  GLY A N   1 
ATOM   4182 C  CA  . GLY A 1 548 ? 33.903 51.276 103.117 1.00 35.42 ? 549  GLY A CA  1 
ATOM   4183 C  C   . GLY A 1 548 ? 33.107 52.533 102.817 1.00 36.99 ? 549  GLY A C   1 
ATOM   4184 O  O   . GLY A 1 548 ? 32.162 52.815 103.549 1.00 37.62 ? 549  GLY A O   1 
ATOM   4185 N  N   . LYS A 1 549 ? 33.416 53.269 101.730 1.00 37.65 ? 550  LYS A N   1 
ATOM   4186 C  CA  . LYS A 1 549 ? 32.720 54.499 101.410 1.00 38.36 ? 550  LYS A CA  1 
ATOM   4187 C  C   . LYS A 1 549 ? 32.264 54.593 99.978  1.00 38.09 ? 550  LYS A C   1 
ATOM   4188 O  O   . LYS A 1 549 ? 32.782 53.923 99.070  1.00 37.85 ? 550  LYS A O   1 
ATOM   4189 C  CB  . LYS A 1 549 ? 33.561 55.729 101.648 1.00 39.82 ? 550  LYS A CB  1 
ATOM   4190 C  CG  . LYS A 1 549 ? 34.241 55.873 102.982 1.00 41.24 ? 550  LYS A CG  1 
ATOM   4191 C  CD  . LYS A 1 549 ? 35.722 55.675 102.676 1.00 44.59 ? 550  LYS A CD  1 
ATOM   4192 C  CE  . LYS A 1 549 ? 36.432 56.654 101.675 1.00 45.83 ? 550  LYS A CE  1 
ATOM   4193 N  NZ  . LYS A 1 549 ? 36.138 56.456 100.245 1.00 47.09 ? 550  LYS A NZ  1 
ATOM   4194 N  N   . ASP A 1 550 ? 31.352 55.570 99.844  1.00 37.50 ? 551  ASP A N   1 
ATOM   4195 C  CA  . ASP A 1 550 ? 30.657 55.790 98.606  1.00 38.01 ? 551  ASP A CA  1 
ATOM   4196 C  C   . ASP A 1 550 ? 31.610 56.344 97.581  1.00 37.33 ? 551  ASP A C   1 
ATOM   4197 O  O   . ASP A 1 550 ? 32.780 56.609 97.873  1.00 38.21 ? 551  ASP A O   1 
ATOM   4198 C  CB  . ASP A 1 550 ? 29.481 56.744 98.835  1.00 39.36 ? 551  ASP A CB  1 
ATOM   4199 C  CG  . ASP A 1 550 ? 28.330 56.205 99.689  1.00 41.62 ? 551  ASP A CG  1 
ATOM   4200 O  OD1 . ASP A 1 550 ? 28.056 55.007 99.696  1.00 41.87 ? 551  ASP A OD1 1 
ATOM   4201 O  OD2 . ASP A 1 550 ? 27.711 57.001 100.391 1.00 43.98 ? 551  ASP A OD2 1 
ATOM   4202 N  N   . LEU A 1 551 ? 31.094 56.500 96.380  1.00 35.95 ? 552  LEU A N   1 
ATOM   4203 C  CA  . LEU A 1 551 ? 31.930 56.925 95.321  1.00 34.67 ? 552  LEU A CA  1 
ATOM   4204 C  C   . LEU A 1 551 ? 31.699 58.365 94.901  1.00 34.59 ? 552  LEU A C   1 
ATOM   4205 O  O   . LEU A 1 551 ? 31.192 58.634 93.814  1.00 34.20 ? 552  LEU A O   1 
ATOM   4206 C  CB  . LEU A 1 551 ? 31.693 55.974 94.198  1.00 34.49 ? 552  LEU A CB  1 
ATOM   4207 C  CG  . LEU A 1 551 ? 32.017 54.533 94.353  1.00 33.39 ? 552  LEU A CG  1 
ATOM   4208 C  CD1 . LEU A 1 551 ? 31.739 53.929 93.003  1.00 32.35 ? 552  LEU A CD1 1 
ATOM   4209 C  CD2 . LEU A 1 551 ? 33.469 54.291 94.761  1.00 32.93 ? 552  LEU A CD2 1 
ATOM   4210 N  N   . GLU A 1 552 ? 32.088 59.322 95.742  1.00 34.57 ? 553  GLU A N   1 
ATOM   4211 C  CA  . GLU A 1 552 ? 31.984 60.700 95.346  1.00 34.28 ? 553  GLU A CA  1 
ATOM   4212 C  C   . GLU A 1 552 ? 32.958 61.189 94.278  1.00 33.82 ? 553  GLU A C   1 
ATOM   4213 O  O   . GLU A 1 552 ? 34.117 60.793 94.209  1.00 33.15 ? 553  GLU A O   1 
ATOM   4214 C  CB  . GLU A 1 552 ? 32.103 61.632 96.567  1.00 35.61 ? 553  GLU A CB  1 
ATOM   4215 C  CG  . GLU A 1 552 ? 32.872 61.336 97.846  1.00 38.72 ? 553  GLU A CG  1 
ATOM   4216 C  CD  . GLU A 1 552 ? 32.104 60.513 98.899  1.00 41.99 ? 553  GLU A CD  1 
ATOM   4217 O  OE1 . GLU A 1 552 ? 30.873 60.358 98.783  1.00 44.11 ? 553  GLU A OE1 1 
ATOM   4218 O  OE2 . GLU A 1 552 ? 32.752 60.018 99.842  1.00 42.36 ? 553  GLU A OE2 1 
ATOM   4219 N  N   . ASP A 1 553 ? 32.364 61.987 93.367  1.00 34.25 ? 554  ASP A N   1 
ATOM   4220 C  CA  . ASP A 1 553 ? 33.006 62.788 92.327  1.00 33.51 ? 554  ASP A CA  1 
ATOM   4221 C  C   . ASP A 1 553 ? 33.805 62.088 91.283  1.00 31.61 ? 554  ASP A C   1 
ATOM   4222 O  O   . ASP A 1 553 ? 34.938 62.414 90.949  1.00 30.98 ? 554  ASP A O   1 
ATOM   4223 C  CB  . ASP A 1 553 ? 33.881 63.858 92.990  1.00 35.91 ? 554  ASP A CB  1 
ATOM   4224 C  CG  . ASP A 1 553 ? 33.051 65.023 93.536  1.00 39.05 ? 554  ASP A CG  1 
ATOM   4225 O  OD1 . ASP A 1 553 ? 32.360 65.674 92.730  1.00 40.67 ? 554  ASP A OD1 1 
ATOM   4226 O  OD2 . ASP A 1 553 ? 33.088 65.242 94.758  1.00 39.04 ? 554  ASP A OD2 1 
ATOM   4227 N  N   . LEU A 1 554 ? 33.069 61.141 90.731  1.00 30.03 ? 555  LEU A N   1 
ATOM   4228 C  CA  . LEU A 1 554 ? 33.624 60.229 89.739  1.00 28.22 ? 555  LEU A CA  1 
ATOM   4229 C  C   . LEU A 1 554 ? 33.767 60.925 88.395  1.00 26.52 ? 555  LEU A C   1 
ATOM   4230 O  O   . LEU A 1 554 ? 32.879 61.658 87.968  1.00 26.02 ? 555  LEU A O   1 
ATOM   4231 C  CB  . LEU A 1 554 ? 32.710 58.990 89.587  1.00 28.67 ? 555  LEU A CB  1 
ATOM   4232 C  CG  . LEU A 1 554 ? 32.579 57.975 90.727  1.00 29.53 ? 555  LEU A CG  1 
ATOM   4233 C  CD1 . LEU A 1 554 ? 31.646 56.876 90.280  1.00 29.87 ? 555  LEU A CD1 1 
ATOM   4234 C  CD2 . LEU A 1 554 ? 33.919 57.297 91.040  1.00 28.80 ? 555  LEU A CD2 1 
ATOM   4235 N  N   . GLN A 1 555 ? 34.904 60.715 87.743  1.00 24.47 ? 556  GLN A N   1 
ATOM   4236 C  CA  . GLN A 1 555 ? 35.158 61.279 86.434  1.00 23.12 ? 556  GLN A CA  1 
ATOM   4237 C  C   . GLN A 1 555 ? 34.580 60.379 85.352  1.00 22.13 ? 556  GLN A C   1 
ATOM   4238 O  O   . GLN A 1 555 ? 34.689 59.170 85.493  1.00 22.37 ? 556  GLN A O   1 
ATOM   4239 C  CB  . GLN A 1 555 ? 36.652 61.430 86.315  1.00 23.30 ? 556  GLN A CB  1 
ATOM   4240 C  CG  . GLN A 1 555 ? 37.168 62.116 85.080  1.00 25.29 ? 556  GLN A CG  1 
ATOM   4241 C  CD  . GLN A 1 555 ? 36.745 63.563 84.804  1.00 28.20 ? 556  GLN A CD  1 
ATOM   4242 O  OE1 . GLN A 1 555 ? 36.788 64.477 85.651  1.00 28.81 ? 556  GLN A OE1 1 
ATOM   4243 N  NE2 . GLN A 1 555 ? 36.373 63.728 83.515  1.00 29.36 ? 556  GLN A NE2 1 
ATOM   4244 N  N   . ILE A 1 556 ? 33.952 60.840 84.262  1.00 21.54 ? 557  ILE A N   1 
ATOM   4245 C  CA  . ILE A 1 556 ? 33.411 59.907 83.264  1.00 22.16 ? 557  ILE A CA  1 
ATOM   4246 C  C   . ILE A 1 556 ? 34.523 59.630 82.269  1.00 21.49 ? 557  ILE A C   1 
ATOM   4247 O  O   . ILE A 1 556 ? 34.893 60.610 81.614  1.00 23.43 ? 557  ILE A O   1 
ATOM   4248 C  CB  . ILE A 1 556 ? 32.117 60.538 82.569  1.00 22.86 ? 557  ILE A CB  1 
ATOM   4249 C  CG1 . ILE A 1 556 ? 31.018 60.600 83.628  1.00 22.74 ? 557  ILE A CG1 1 
ATOM   4250 C  CG2 . ILE A 1 556 ? 31.590 59.724 81.374  1.00 23.40 ? 557  ILE A CG2 1 
ATOM   4251 C  CD1 . ILE A 1 556 ? 29.753 61.302 83.138  1.00 23.33 ? 557  ILE A CD1 1 
ATOM   4252 N  N   . LEU A 1 557 ? 35.143 58.432 82.143  1.00 19.66 ? 558  LEU A N   1 
ATOM   4253 C  CA  . LEU A 1 557 ? 36.154 58.263 81.094  1.00 18.22 ? 558  LEU A CA  1 
ATOM   4254 C  C   . LEU A 1 557 ? 35.570 58.448 79.664  1.00 17.61 ? 558  LEU A C   1 
ATOM   4255 O  O   . LEU A 1 557 ? 36.139 59.175 78.845  1.00 15.99 ? 558  LEU A O   1 
ATOM   4256 C  CB  . LEU A 1 557 ? 36.801 56.876 81.199  1.00 17.21 ? 558  LEU A CB  1 
ATOM   4257 C  CG  . LEU A 1 557 ? 37.792 56.485 80.094  1.00 17.34 ? 558  LEU A CG  1 
ATOM   4258 C  CD1 . LEU A 1 557 ? 39.026 57.396 80.154  1.00 16.70 ? 558  LEU A CD1 1 
ATOM   4259 C  CD2 . LEU A 1 557 ? 38.190 55.029 80.257  1.00 16.72 ? 558  LEU A CD2 1 
ATOM   4260 N  N   . ILE A 1 558 ? 34.412 57.849 79.332  1.00 16.70 ? 559  ILE A N   1 
ATOM   4261 C  CA  . ILE A 1 558 ? 33.816 58.008 78.012  1.00 16.95 ? 559  ILE A CA  1 
ATOM   4262 C  C   . ILE A 1 558 ? 32.345 57.633 78.109  1.00 19.11 ? 559  ILE A C   1 
ATOM   4263 O  O   . ILE A 1 558 ? 32.001 56.728 78.885  1.00 20.97 ? 559  ILE A O   1 
ATOM   4264 C  CB  . ILE A 1 558 ? 34.548 57.097 76.959  1.00 14.47 ? 559  ILE A CB  1 
ATOM   4265 C  CG1 . ILE A 1 558 ? 33.874 57.231 75.614  1.00 12.97 ? 559  ILE A CG1 1 
ATOM   4266 C  CG2 . ILE A 1 558 ? 34.530 55.633 77.390  1.00 13.35 ? 559  ILE A CG2 1 
ATOM   4267 C  CD1 . ILE A 1 558 ? 34.622 56.534 74.484  1.00 12.22 ? 559  ILE A CD1 1 
ATOM   4268 N  N   . LYS A 1 559 ? 31.476 58.346 77.376  1.00 19.41 ? 560  LYS A N   1 
ATOM   4269 C  CA  . LYS A 1 559 ? 30.079 57.966 77.233  1.00 19.89 ? 560  LYS A CA  1 
ATOM   4270 C  C   . LYS A 1 559 ? 30.049 57.340 75.852  1.00 20.83 ? 560  LYS A C   1 
ATOM   4271 O  O   . LYS A 1 559 ? 30.327 57.981 74.834  1.00 21.73 ? 560  LYS A O   1 
ATOM   4272 C  CB  . LYS A 1 559 ? 29.187 59.224 77.329  1.00 19.64 ? 560  LYS A CB  1 
ATOM   4273 C  CG  . LYS A 1 559 ? 27.752 59.105 76.833  1.00 20.02 ? 560  LYS A CG  1 
ATOM   4274 C  CD  . LYS A 1 559 ? 26.805 60.041 77.586  1.00 22.46 ? 560  LYS A CD  1 
ATOM   4275 C  CE  . LYS A 1 559 ? 25.495 60.216 76.798  1.00 23.10 ? 560  LYS A CE  1 
ATOM   4276 N  NZ  . LYS A 1 559 ? 24.545 61.160 77.383  1.00 22.87 ? 560  LYS A NZ  1 
ATOM   4277 N  N   . VAL A 1 560 ? 29.840 56.037 75.800  1.00 21.25 ? 561  VAL A N   1 
ATOM   4278 C  CA  . VAL A 1 560 ? 29.799 55.333 74.532  1.00 22.39 ? 561  VAL A CA  1 
ATOM   4279 C  C   . VAL A 1 560 ? 28.451 55.389 73.831  1.00 24.39 ? 561  VAL A C   1 
ATOM   4280 O  O   . VAL A 1 560 ? 27.393 55.116 74.432  1.00 25.51 ? 561  VAL A O   1 
ATOM   4281 C  CB  . VAL A 1 560 ? 30.169 53.899 74.795  1.00 20.89 ? 561  VAL A CB  1 
ATOM   4282 C  CG1 . VAL A 1 560 ? 30.021 53.025 73.546  1.00 20.17 ? 561  VAL A CG1 1 
ATOM   4283 C  CG2 . VAL A 1 560 ? 31.583 53.926 75.298  1.00 20.05 ? 561  VAL A CG2 1 
ATOM   4284 N  N   . LYS A 1 561 ? 28.476 55.672 72.532  1.00 25.51 ? 562  LYS A N   1 
ATOM   4285 C  CA  . LYS A 1 561 ? 27.211 55.701 71.808  1.00 26.81 ? 562  LYS A CA  1 
ATOM   4286 C  C   . LYS A 1 561 ? 27.140 54.564 70.805  1.00 26.17 ? 562  LYS A C   1 
ATOM   4287 O  O   . LYS A 1 561 ? 28.114 54.363 70.082  1.00 25.99 ? 562  LYS A O   1 
ATOM   4288 C  CB  . LYS A 1 561 ? 27.072 57.067 71.130  1.00 29.41 ? 562  LYS A CB  1 
ATOM   4289 C  CG  . LYS A 1 561 ? 26.345 57.189 69.806  1.00 32.05 ? 562  LYS A CG  1 
ATOM   4290 C  CD  . LYS A 1 561 ? 27.409 57.635 68.798  1.00 36.26 ? 562  LYS A CD  1 
ATOM   4291 C  CE  . LYS A 1 561 ? 27.179 56.987 67.431  1.00 38.92 ? 562  LYS A CE  1 
ATOM   4292 N  NZ  . LYS A 1 561 ? 27.719 55.631 67.409  1.00 41.39 ? 562  LYS A NZ  1 
ATOM   4293 N  N   . GLY A 1 562 ? 26.020 53.790 70.819  1.00 25.50 ? 563  GLY A N   1 
ATOM   4294 C  CA  . GLY A 1 562 ? 25.763 52.691 69.869  1.00 23.74 ? 563  GLY A CA  1 
ATOM   4295 C  C   . GLY A 1 562 ? 26.218 51.307 70.363  1.00 23.73 ? 563  GLY A C   1 
ATOM   4296 O  O   . GLY A 1 562 ? 26.375 51.060 71.565  1.00 23.57 ? 563  GLY A O   1 
ATOM   4297 N  N   . LYS A 1 563 ? 26.433 50.402 69.400  1.00 22.72 ? 564  LYS A N   1 
ATOM   4298 C  CA  . LYS A 1 563 ? 26.912 49.033 69.623  1.00 22.05 ? 564  LYS A CA  1 
ATOM   4299 C  C   . LYS A 1 563 ? 28.328 48.973 70.206  1.00 20.19 ? 564  LYS A C   1 
ATOM   4300 O  O   . LYS A 1 563 ? 29.212 49.577 69.607  1.00 19.69 ? 564  LYS A O   1 
ATOM   4301 C  CB  . LYS A 1 563 ? 26.868 48.328 68.297  1.00 23.58 ? 564  LYS A CB  1 
ATOM   4302 C  CG  . LYS A 1 563 ? 27.309 46.890 68.261  1.00 27.12 ? 564  LYS A CG  1 
ATOM   4303 C  CD  . LYS A 1 563 ? 27.135 46.500 66.799  1.00 29.35 ? 564  LYS A CD  1 
ATOM   4304 C  CE  . LYS A 1 563 ? 26.989 44.982 66.612  1.00 31.22 ? 564  LYS A CE  1 
ATOM   4305 N  NZ  . LYS A 1 563 ? 25.897 44.401 67.391  1.00 32.41 ? 564  LYS A NZ  1 
ATOM   4306 N  N   . CYS A 1 564 ? 28.516 48.287 71.349  1.00 18.52 ? 565  CYS A N   1 
ATOM   4307 C  CA  . CYS A 1 564 ? 29.790 48.129 72.040  1.00 16.95 ? 565  CYS A CA  1 
ATOM   4308 C  C   . CYS A 1 564 ? 29.954 46.713 72.620  1.00 16.63 ? 565  CYS A C   1 
ATOM   4309 O  O   . CYS A 1 564 ? 29.615 46.385 73.767  1.00 18.16 ? 565  CYS A O   1 
ATOM   4310 C  CB  . CYS A 1 564 ? 29.934 49.124 73.209  1.00 16.69 ? 565  CYS A CB  1 
ATOM   4311 S  SG  . CYS A 1 564 ? 31.611 49.445 73.879  1.00 15.02 ? 565  CYS A SG  1 
ATOM   4312 N  N   . THR A 1 565 ? 30.451 45.953 71.659  1.00 15.02 ? 566  THR A N   1 
ATOM   4313 C  CA  . THR A 1 565 ? 30.939 44.588 71.611  1.00 14.78 ? 566  THR A CA  1 
ATOM   4314 C  C   . THR A 1 565 ? 32.173 44.320 72.493  1.00 14.93 ? 566  THR A C   1 
ATOM   4315 O  O   . THR A 1 565 ? 32.903 45.296 72.718  1.00 15.63 ? 566  THR A O   1 
ATOM   4316 C  CB  . THR A 1 565 ? 31.188 44.426 70.091  1.00 15.48 ? 566  THR A CB  1 
ATOM   4317 O  OG1 . THR A 1 565 ? 29.946 44.348 69.422  1.00 17.00 ? 566  THR A OG1 1 
ATOM   4318 C  CG2 . THR A 1 565 ? 31.940 43.240 69.775  1.00 16.02 ? 566  THR A CG2 1 
ATOM   4319 N  N   . THR A 1 566 ? 32.569 43.131 73.007  1.00 14.92 ? 567  THR A N   1 
ATOM   4320 C  CA  . THR A 1 566 ? 33.880 43.053 73.653  1.00 15.32 ? 567  THR A CA  1 
ATOM   4321 C  C   . THR A 1 566 ? 34.993 43.080 72.600  1.00 17.10 ? 567  THR A C   1 
ATOM   4322 O  O   . THR A 1 566 ? 36.171 43.163 72.959  1.00 17.38 ? 567  THR A O   1 
ATOM   4323 C  CB  . THR A 1 566 ? 34.045 41.797 74.466  1.00 13.83 ? 567  THR A CB  1 
ATOM   4324 O  OG1 . THR A 1 566 ? 33.778 40.691 73.604  1.00 14.80 ? 567  THR A OG1 1 
ATOM   4325 C  CG2 . THR A 1 566 ? 33.171 41.795 75.644  1.00 11.51 ? 567  THR A CG2 1 
ATOM   4326 N  N   . ASP A 1 567 ? 34.670 42.957 71.293  1.00 17.87 ? 568  ASP A N   1 
ATOM   4327 C  CA  . ASP A 1 567 ? 35.663 43.256 70.257  1.00 18.57 ? 568  ASP A CA  1 
ATOM   4328 C  C   . ASP A 1 567 ? 35.933 44.736 70.151  1.00 18.46 ? 568  ASP A C   1 
ATOM   4329 O  O   . ASP A 1 567 ? 36.983 45.123 69.653  1.00 20.20 ? 568  ASP A O   1 
ATOM   4330 C  CB  . ASP A 1 567 ? 35.250 42.785 68.859  1.00 18.79 ? 568  ASP A CB  1 
ATOM   4331 C  CG  . ASP A 1 567 ? 35.602 41.310 68.663  1.00 18.61 ? 568  ASP A CG  1 
ATOM   4332 O  OD1 . ASP A 1 567 ? 36.781 40.949 68.681  1.00 20.26 ? 568  ASP A OD1 1 
ATOM   4333 O  OD2 . ASP A 1 567 ? 34.707 40.502 68.520  1.00 17.21 ? 568  ASP A OD2 1 
ATOM   4334 N  N   . HIS A 1 568 ? 35.066 45.587 70.701  1.00 18.32 ? 569  HIS A N   1 
ATOM   4335 C  CA  . HIS A 1 568 ? 35.326 47.019 70.746  1.00 17.18 ? 569  HIS A CA  1 
ATOM   4336 C  C   . HIS A 1 568 ? 35.980 47.347 72.099  1.00 16.01 ? 569  HIS A C   1 
ATOM   4337 O  O   . HIS A 1 568 ? 36.855 48.200 72.135  1.00 15.98 ? 569  HIS A O   1 
ATOM   4338 C  CB  . HIS A 1 568 ? 34.065 47.843 70.654  1.00 17.37 ? 569  HIS A CB  1 
ATOM   4339 C  CG  . HIS A 1 568 ? 33.241 47.782 69.369  1.00 19.00 ? 569  HIS A CG  1 
ATOM   4340 N  ND1 . HIS A 1 568 ? 32.711 46.748 68.700  1.00 19.85 ? 569  HIS A ND1 1 
ATOM   4341 C  CD2 . HIS A 1 568 ? 32.830 48.912 68.726  1.00 18.62 ? 569  HIS A CD2 1 
ATOM   4342 C  CE1 . HIS A 1 568 ? 31.990 47.193 67.712  1.00 18.78 ? 569  HIS A CE1 1 
ATOM   4343 N  NE2 . HIS A 1 568 ? 32.071 48.499 67.746  1.00 19.82 ? 569  HIS A NE2 1 
ATOM   4344 N  N   . ILE A 1 569 ? 35.647 46.666 73.201  1.00 14.28 ? 570  ILE A N   1 
ATOM   4345 C  CA  . ILE A 1 569 ? 36.226 46.962 74.492  1.00 12.33 ? 570  ILE A CA  1 
ATOM   4346 C  C   . ILE A 1 569 ? 37.638 46.458 74.567  1.00 11.78 ? 570  ILE A C   1 
ATOM   4347 O  O   . ILE A 1 569 ? 38.496 47.182 75.070  1.00 12.37 ? 570  ILE A O   1 
ATOM   4348 C  CB  . ILE A 1 569 ? 35.428 46.341 75.646  1.00 12.08 ? 570  ILE A CB  1 
ATOM   4349 C  CG1 . ILE A 1 569 ? 33.938 46.730 75.512  1.00 12.06 ? 570  ILE A CG1 1 
ATOM   4350 C  CG2 . ILE A 1 569 ? 35.960 46.898 76.984  1.00 11.62 ? 570  ILE A CG2 1 
ATOM   4351 C  CD1 . ILE A 1 569 ? 32.876 46.011 76.395  1.00 9.86  ? 570  ILE A CD1 1 
ATOM   4352 N  N   . SER A 1 570 ? 37.936 45.283 74.016  1.00 11.58 ? 571  SER A N   1 
ATOM   4353 C  CA  . SER A 1 570 ? 39.268 44.734 74.088  1.00 10.34 ? 571  SER A CA  1 
ATOM   4354 C  C   . SER A 1 570 ? 39.562 44.027 72.797  1.00 10.08 ? 571  SER A C   1 
ATOM   4355 O  O   . SER A 1 570 ? 39.219 42.853 72.713  1.00 10.69 ? 571  SER A O   1 
ATOM   4356 C  CB  . SER A 1 570 ? 39.341 43.774 75.292  1.00 10.81 ? 571  SER A CB  1 
ATOM   4357 O  OG  . SER A 1 570 ? 40.582 43.074 75.353  1.00 8.91  ? 571  SER A OG  1 
ATOM   4358 N  N   . ALA A 1 571 ? 40.236 44.647 71.824  1.00 8.40  ? 572  ALA A N   1 
ATOM   4359 C  CA  . ALA A 1 571 ? 40.423 43.990 70.563  1.00 7.79  ? 572  ALA A CA  1 
ATOM   4360 C  C   . ALA A 1 571 ? 41.207 42.660 70.515  1.00 8.29  ? 572  ALA A C   1 
ATOM   4361 O  O   . ALA A 1 571 ? 42.069 42.334 71.321  1.00 8.54  ? 572  ALA A O   1 
ATOM   4362 C  CB  . ALA A 1 571 ? 41.052 44.994 69.676  1.00 6.96  ? 572  ALA A CB  1 
ATOM   4363 N  N   . ALA A 1 572 ? 41.004 41.823 69.515  1.00 9.26  ? 573  ALA A N   1 
ATOM   4364 C  CA  . ALA A 1 572 ? 41.674 40.536 69.396  1.00 10.57 ? 573  ALA A CA  1 
ATOM   4365 C  C   . ALA A 1 572 ? 42.737 40.603 68.303  1.00 11.21 ? 573  ALA A C   1 
ATOM   4366 O  O   . ALA A 1 572 ? 43.513 41.550 68.374  1.00 11.68 ? 573  ALA A O   1 
ATOM   4367 C  CB  . ALA A 1 572 ? 40.594 39.488 69.113  1.00 8.24  ? 573  ALA A CB  1 
ATOM   4368 N  N   . GLY A 1 573 ? 42.864 39.739 67.282  1.00 13.65 ? 574  GLY A N   1 
ATOM   4369 C  CA  . GLY A 1 573 ? 43.927 39.803 66.266  1.00 15.38 ? 574  GLY A CA  1 
ATOM   4370 C  C   . GLY A 1 573 ? 45.295 39.911 66.965  1.00 18.48 ? 574  GLY A C   1 
ATOM   4371 O  O   . GLY A 1 573 ? 45.637 39.052 67.797  1.00 19.10 ? 574  GLY A O   1 
ATOM   4372 N  N   . PRO A 1 574 ? 46.050 41.010 66.728  1.00 19.02 ? 575  PRO A N   1 
ATOM   4373 C  CA  . PRO A 1 574 ? 47.413 41.220 67.227  1.00 18.63 ? 575  PRO A CA  1 
ATOM   4374 C  C   . PRO A 1 574 ? 47.559 41.296 68.713  1.00 18.23 ? 575  PRO A C   1 
ATOM   4375 O  O   . PRO A 1 574 ? 48.639 41.059 69.247  1.00 18.86 ? 575  PRO A O   1 
ATOM   4376 C  CB  . PRO A 1 574 ? 47.873 42.477 66.573  1.00 19.61 ? 575  PRO A CB  1 
ATOM   4377 C  CG  . PRO A 1 574 ? 46.564 43.217 66.287  1.00 20.53 ? 575  PRO A CG  1 
ATOM   4378 C  CD  . PRO A 1 574 ? 45.642 42.102 65.841  1.00 19.83 ? 575  PRO A CD  1 
ATOM   4379 N  N   . TRP A 1 575 ? 46.455 41.612 69.377  1.00 16.97 ? 576  TRP A N   1 
ATOM   4380 C  CA  . TRP A 1 575 ? 46.476 41.712 70.808  1.00 16.12 ? 576  TRP A CA  1 
ATOM   4381 C  C   . TRP A 1 575 ? 46.426 40.343 71.482  1.00 16.57 ? 576  TRP A C   1 
ATOM   4382 O  O   . TRP A 1 575 ? 46.634 40.265 72.696  1.00 17.24 ? 576  TRP A O   1 
ATOM   4383 C  CB  . TRP A 1 575 ? 45.307 42.636 71.207  1.00 15.23 ? 576  TRP A CB  1 
ATOM   4384 C  CG  . TRP A 1 575 ? 45.444 44.129 70.740  1.00 13.49 ? 576  TRP A CG  1 
ATOM   4385 C  CD1 . TRP A 1 575 ? 44.884 44.641 69.573  1.00 10.49 ? 576  TRP A CD1 1 
ATOM   4386 C  CD2 . TRP A 1 575 ? 46.145 45.090 71.435  1.00 11.33 ? 576  TRP A CD2 1 
ATOM   4387 N  NE1 . TRP A 1 575 ? 45.233 45.903 69.538  1.00 10.17 ? 576  TRP A NE1 1 
ATOM   4388 C  CE2 . TRP A 1 575 ? 45.988 46.227 70.623  1.00 11.21 ? 576  TRP A CE2 1 
ATOM   4389 C  CE3 . TRP A 1 575 ? 46.889 45.110 72.634  1.00 10.42 ? 576  TRP A CE3 1 
ATOM   4390 C  CZ2 . TRP A 1 575 ? 46.594 47.429 71.018  1.00 10.92 ? 576  TRP A CZ2 1 
ATOM   4391 C  CZ3 . TRP A 1 575 ? 47.490 46.301 73.014  1.00 11.08 ? 576  TRP A CZ3 1 
ATOM   4392 C  CH2 . TRP A 1 575 ? 47.344 47.455 72.209  1.00 10.71 ? 576  TRP A CH2 1 
ATOM   4393 N  N   . LEU A 1 576 ? 46.222 39.220 70.749  1.00 16.22 ? 577  LEU A N   1 
ATOM   4394 C  CA  . LEU A 1 576 ? 46.195 37.909 71.387  1.00 15.04 ? 577  LEU A CA  1 
ATOM   4395 C  C   . LEU A 1 576 ? 47.547 37.593 72.013  1.00 16.79 ? 577  LEU A C   1 
ATOM   4396 O  O   . LEU A 1 576 ? 47.664 36.995 73.088  1.00 18.20 ? 577  LEU A O   1 
ATOM   4397 C  CB  . LEU A 1 576 ? 45.771 36.884 70.365  1.00 11.54 ? 577  LEU A CB  1 
ATOM   4398 C  CG  . LEU A 1 576 ? 44.278 36.973 69.893  1.00 11.05 ? 577  LEU A CG  1 
ATOM   4399 C  CD1 . LEU A 1 576 ? 43.929 35.875 68.918  1.00 8.92  ? 577  LEU A CD1 1 
ATOM   4400 C  CD2 . LEU A 1 576 ? 43.336 36.794 71.053  1.00 9.65  ? 577  LEU A CD2 1 
ATOM   4401 N  N   . LYS A 1 577 ? 48.609 38.081 71.402  1.00 18.44 ? 578  LYS A N   1 
ATOM   4402 C  CA  . LYS A 1 577 ? 49.959 38.146 71.998  1.00 19.45 ? 578  LYS A CA  1 
ATOM   4403 C  C   . LYS A 1 577 ? 50.064 38.586 73.467  1.00 18.11 ? 578  LYS A C   1 
ATOM   4404 O  O   . LYS A 1 577 ? 51.017 38.219 74.140  1.00 18.78 ? 578  LYS A O   1 
ATOM   4405 C  CB  . LYS A 1 577 ? 50.743 39.088 71.141  1.00 22.00 ? 578  LYS A CB  1 
ATOM   4406 C  CG  . LYS A 1 577 ? 52.204 39.101 71.312  1.00 26.75 ? 578  LYS A CG  1 
ATOM   4407 C  CD  . LYS A 1 577 ? 52.787 40.336 70.624  1.00 32.77 ? 578  LYS A CD  1 
ATOM   4408 C  CE  . LYS A 1 577 ? 52.426 40.510 69.123  1.00 35.94 ? 578  LYS A CE  1 
ATOM   4409 N  NZ  . LYS A 1 577 ? 51.481 41.601 68.916  1.00 38.89 ? 578  LYS A NZ  1 
ATOM   4410 N  N   . PHE A 1 578 ? 49.115 39.328 74.041  1.00 16.51 ? 579  PHE A N   1 
ATOM   4411 C  CA  . PHE A 1 578 ? 49.214 39.772 75.409  1.00 15.93 ? 579  PHE A CA  1 
ATOM   4412 C  C   . PHE A 1 578 ? 48.136 39.223 76.360  1.00 15.96 ? 579  PHE A C   1 
ATOM   4413 O  O   . PHE A 1 578 ? 47.933 39.746 77.455  1.00 14.98 ? 579  PHE A O   1 
ATOM   4414 C  CB  . PHE A 1 578 ? 49.182 41.287 75.390  1.00 15.52 ? 579  PHE A CB  1 
ATOM   4415 C  CG  . PHE A 1 578 ? 50.323 41.949 74.608  1.00 15.65 ? 579  PHE A CG  1 
ATOM   4416 C  CD1 . PHE A 1 578 ? 51.681 41.667 74.860  1.00 15.38 ? 579  PHE A CD1 1 
ATOM   4417 C  CD2 . PHE A 1 578 ? 49.995 42.886 73.626  1.00 15.66 ? 579  PHE A CD2 1 
ATOM   4418 C  CE1 . PHE A 1 578 ? 52.684 42.325 74.140  1.00 14.73 ? 579  PHE A CE1 1 
ATOM   4419 C  CE2 . PHE A 1 578 ? 51.001 43.536 72.913  1.00 14.48 ? 579  PHE A CE2 1 
ATOM   4420 C  CZ  . PHE A 1 578 ? 52.342 43.262 73.167  1.00 14.67 ? 579  PHE A CZ  1 
ATOM   4421 N  N   . ARG A 1 579 ? 47.429 38.156 75.990  1.00 15.53 ? 580  ARG A N   1 
ATOM   4422 C  CA  . ARG A 1 579 ? 46.415 37.553 76.842  1.00 17.41 ? 580  ARG A CA  1 
ATOM   4423 C  C   . ARG A 1 579 ? 46.890 36.936 78.174  1.00 18.39 ? 580  ARG A C   1 
ATOM   4424 O  O   . ARG A 1 579 ? 46.060 36.416 78.919  1.00 19.13 ? 580  ARG A O   1 
ATOM   4425 C  CB  . ARG A 1 579 ? 45.673 36.493 76.029  1.00 17.98 ? 580  ARG A CB  1 
ATOM   4426 C  CG  . ARG A 1 579 ? 45.052 37.216 74.840  1.00 18.36 ? 580  ARG A CG  1 
ATOM   4427 C  CD  . ARG A 1 579 ? 43.963 38.192 75.218  1.00 18.42 ? 580  ARG A CD  1 
ATOM   4428 N  NE  . ARG A 1 579 ? 42.841 37.319 75.245  1.00 18.39 ? 580  ARG A NE  1 
ATOM   4429 C  CZ  . ARG A 1 579 ? 41.857 37.324 74.350  1.00 18.47 ? 580  ARG A CZ  1 
ATOM   4430 N  NH1 . ARG A 1 579 ? 41.566 38.286 73.513  1.00 17.97 ? 580  ARG A NH1 1 
ATOM   4431 N  NH2 . ARG A 1 579 ? 41.023 36.329 74.440  1.00 19.97 ? 580  ARG A NH2 1 
ATOM   4432 N  N   . GLY A 1 580 ? 48.205 36.917 78.477  1.00 18.30 ? 581  GLY A N   1 
ATOM   4433 C  CA  . GLY A 1 580 ? 48.739 36.534 79.775  1.00 17.00 ? 581  GLY A CA  1 
ATOM   4434 C  C   . GLY A 1 580 ? 49.420 37.734 80.459  1.00 16.97 ? 581  GLY A C   1 
ATOM   4435 O  O   . GLY A 1 580 ? 49.986 37.596 81.534  1.00 15.06 ? 581  GLY A O   1 
ATOM   4436 N  N   . HIS A 1 581 ? 49.409 38.936 79.874  1.00 16.96 ? 582  HIS A N   1 
ATOM   4437 C  CA  . HIS A 1 581 ? 50.030 40.095 80.475  1.00 16.77 ? 582  HIS A CA  1 
ATOM   4438 C  C   . HIS A 1 581 ? 48.990 41.214 80.690  1.00 16.14 ? 582  HIS A C   1 
ATOM   4439 O  O   . HIS A 1 581 ? 48.696 41.961 79.757  1.00 15.14 ? 582  HIS A O   1 
ATOM   4440 C  CB  . HIS A 1 581 ? 51.154 40.542 79.541  1.00 17.93 ? 582  HIS A CB  1 
ATOM   4441 C  CG  . HIS A 1 581 ? 52.193 41.391 80.302  1.00 20.57 ? 582  HIS A CG  1 
ATOM   4442 N  ND1 . HIS A 1 581 ? 52.146 42.605 80.917  1.00 20.51 ? 582  HIS A ND1 1 
ATOM   4443 C  CD2 . HIS A 1 581 ? 53.460 40.890 80.492  1.00 20.42 ? 582  HIS A CD2 1 
ATOM   4444 C  CE1 . HIS A 1 581 ? 53.313 42.842 81.449  1.00 21.14 ? 582  HIS A CE1 1 
ATOM   4445 N  NE2 . HIS A 1 581 ? 54.086 41.799 81.182  1.00 21.89 ? 582  HIS A NE2 1 
ATOM   4446 N  N   . LEU A 1 582 ? 48.399 41.398 81.877  1.00 15.87 ? 583  LEU A N   1 
ATOM   4447 C  CA  . LEU A 1 582 ? 47.404 42.457 82.136  1.00 16.35 ? 583  LEU A CA  1 
ATOM   4448 C  C   . LEU A 1 582 ? 47.768 43.922 81.761  1.00 17.65 ? 583  LEU A C   1 
ATOM   4449 O  O   . LEU A 1 582 ? 46.964 44.623 81.124  1.00 17.82 ? 583  LEU A O   1 
ATOM   4450 C  CB  . LEU A 1 582 ? 47.014 42.425 83.620  1.00 13.95 ? 583  LEU A CB  1 
ATOM   4451 C  CG  . LEU A 1 582 ? 45.868 43.281 84.121  1.00 12.84 ? 583  LEU A CG  1 
ATOM   4452 C  CD1 . LEU A 1 582 ? 44.703 42.902 83.278  1.00 12.46 ? 583  LEU A CD1 1 
ATOM   4453 C  CD2 . LEU A 1 582 ? 45.522 43.065 85.574  1.00 11.88 ? 583  LEU A CD2 1 
ATOM   4454 N  N   . ASP A 1 583 ? 48.964 44.402 82.167  1.00 18.69 ? 584  ASP A N   1 
ATOM   4455 C  CA  . ASP A 1 583 ? 49.459 45.733 81.818  1.00 18.71 ? 584  ASP A CA  1 
ATOM   4456 C  C   . ASP A 1 583 ? 49.637 45.964 80.330  1.00 16.91 ? 584  ASP A C   1 
ATOM   4457 O  O   . ASP A 1 583 ? 49.160 46.957 79.803  1.00 16.43 ? 584  ASP A O   1 
ATOM   4458 C  CB  . ASP A 1 583 ? 50.801 46.028 82.491  1.00 21.34 ? 584  ASP A CB  1 
ATOM   4459 C  CG  . ASP A 1 583 ? 50.984 47.544 82.641  1.00 24.64 ? 584  ASP A CG  1 
ATOM   4460 O  OD1 . ASP A 1 583 ? 50.394 48.104 83.569  1.00 27.26 ? 584  ASP A OD1 1 
ATOM   4461 O  OD2 . ASP A 1 583 ? 51.665 48.171 81.811  1.00 28.42 ? 584  ASP A OD2 1 
ATOM   4462 N  N   . ASN A 1 584 ? 50.339 45.090 79.633  1.00 16.67 ? 585  ASN A N   1 
ATOM   4463 C  CA  . ASN A 1 584 ? 50.472 45.209 78.201  1.00 16.10 ? 585  ASN A CA  1 
ATOM   4464 C  C   . ASN A 1 584 ? 49.168 45.156 77.423  1.00 15.36 ? 585  ASN A C   1 
ATOM   4465 O  O   . ASN A 1 584 ? 49.014 45.994 76.540  1.00 14.96 ? 585  ASN A O   1 
ATOM   4466 C  CB  . ASN A 1 584 ? 51.419 44.113 77.716  1.00 16.95 ? 585  ASN A CB  1 
ATOM   4467 C  CG  . ASN A 1 584 ? 52.924 44.336 77.928  1.00 18.91 ? 585  ASN A CG  1 
ATOM   4468 O  OD1 . ASN A 1 584 ? 53.686 43.381 78.105  1.00 21.44 ? 585  ASN A OD1 1 
ATOM   4469 N  ND2 . ASN A 1 584 ? 53.461 45.543 77.849  1.00 18.40 ? 585  ASN A ND2 1 
ATOM   4470 N  N   . ILE A 1 585 ? 48.209 44.252 77.745  1.00 14.79 ? 586  ILE A N   1 
ATOM   4471 C  CA  . ILE A 1 585 ? 46.935 44.162 77.045  1.00 13.52 ? 586  ILE A CA  1 
ATOM   4472 C  C   . ILE A 1 585 ? 46.064 45.376 77.392  1.00 13.65 ? 586  ILE A C   1 
ATOM   4473 O  O   . ILE A 1 585 ? 45.358 45.849 76.505  1.00 12.99 ? 586  ILE A O   1 
ATOM   4474 C  CB  . ILE A 1 585 ? 46.237 42.776 77.420  1.00 13.70 ? 586  ILE A CB  1 
ATOM   4475 C  CG1 . ILE A 1 585 ? 45.152 42.415 76.379  1.00 14.08 ? 586  ILE A CG1 1 
ATOM   4476 C  CG2 . ILE A 1 585 ? 45.557 42.826 78.813  1.00 13.27 ? 586  ILE A CG2 1 
ATOM   4477 C  CD1 . ILE A 1 585 ? 45.461 41.585 75.088  1.00 11.17 ? 586  ILE A CD1 1 
ATOM   4478 N  N   . SER A 1 586 ? 46.113 45.926 78.635  1.00 14.00 ? 587  SER A N   1 
ATOM   4479 C  CA  . SER A 1 586 ? 45.340 47.095 79.022  1.00 13.68 ? 587  SER A CA  1 
ATOM   4480 C  C   . SER A 1 586 ? 45.492 48.255 78.065  1.00 14.42 ? 587  SER A C   1 
ATOM   4481 O  O   . SER A 1 586 ? 44.633 49.136 78.095  1.00 14.11 ? 587  SER A O   1 
ATOM   4482 C  CB  . SER A 1 586 ? 45.723 47.581 80.389  1.00 13.10 ? 587  SER A CB  1 
ATOM   4483 O  OG  . SER A 1 586 ? 45.269 46.711 81.452  1.00 13.56 ? 587  SER A OG  1 
ATOM   4484 N  N   . ASN A 1 587 ? 46.530 48.246 77.182  1.00 14.32 ? 588  ASN A N   1 
ATOM   4485 C  CA  . ASN A 1 587 ? 46.712 49.284 76.187  1.00 14.56 ? 588  ASN A CA  1 
ATOM   4486 C  C   . ASN A 1 587 ? 45.774 49.217 74.992  1.00 14.11 ? 588  ASN A C   1 
ATOM   4487 O  O   . ASN A 1 587 ? 45.915 50.045 74.095  1.00 13.83 ? 588  ASN A O   1 
ATOM   4488 C  CB  . ASN A 1 587 ? 48.113 49.269 75.637  1.00 16.08 ? 588  ASN A CB  1 
ATOM   4489 C  CG  . ASN A 1 587 ? 49.177 49.863 76.538  1.00 17.36 ? 588  ASN A CG  1 
ATOM   4490 O  OD1 . ASN A 1 587 ? 48.965 50.705 77.408  1.00 18.37 ? 588  ASN A OD1 1 
ATOM   4491 N  ND2 . ASN A 1 587 ? 50.385 49.408 76.231  1.00 19.40 ? 588  ASN A ND2 1 
ATOM   4492 N  N   . ASN A 1 588 ? 44.865 48.246 74.885  1.00 13.88 ? 589  ASN A N   1 
ATOM   4493 C  CA  . ASN A 1 588 ? 43.807 48.313 73.881  1.00 14.80 ? 589  ASN A CA  1 
ATOM   4494 C  C   . ASN A 1 588 ? 42.460 48.709 74.511  1.00 14.85 ? 589  ASN A C   1 
ATOM   4495 O  O   . ASN A 1 588 ? 41.470 48.697 73.775  1.00 15.09 ? 589  ASN A O   1 
ATOM   4496 C  CB  . ASN A 1 588 ? 43.566 46.979 73.162  1.00 14.54 ? 589  ASN A CB  1 
ATOM   4497 C  CG  . ASN A 1 588 ? 43.080 45.789 73.986  1.00 14.57 ? 589  ASN A CG  1 
ATOM   4498 O  OD1 . ASN A 1 588 ? 43.195 44.657 73.523  1.00 15.56 ? 589  ASN A OD1 1 
ATOM   4499 N  ND2 . ASN A 1 588 ? 42.535 45.846 75.192  1.00 14.30 ? 589  ASN A ND2 1 
ATOM   4500 N  N   . LEU A 1 589 ? 42.356 49.028 75.819  1.00 14.56 ? 590  LEU A N   1 
ATOM   4501 C  CA  . LEU A 1 589 ? 41.077 49.328 76.446  1.00 14.82 ? 590  LEU A CA  1 
ATOM   4502 C  C   . LEU A 1 589 ? 40.309 50.474 75.754  1.00 16.31 ? 590  LEU A C   1 
ATOM   4503 O  O   . LEU A 1 589 ? 40.787 51.603 75.483  1.00 17.49 ? 590  LEU A O   1 
ATOM   4504 C  CB  . LEU A 1 589 ? 41.269 49.673 77.913  1.00 14.10 ? 590  LEU A CB  1 
ATOM   4505 C  CG  . LEU A 1 589 ? 39.990 50.134 78.673  1.00 15.66 ? 590  LEU A CG  1 
ATOM   4506 C  CD1 . LEU A 1 589 ? 38.964 48.993 78.701  1.00 14.09 ? 590  LEU A CD1 1 
ATOM   4507 C  CD2 . LEU A 1 589 ? 40.306 50.488 80.100  1.00 13.59 ? 590  LEU A CD2 1 
ATOM   4508 N  N   . LEU A 1 590 ? 39.123 49.980 75.305  1.00 15.35 ? 591  LEU A N   1 
ATOM   4509 C  CA  . LEU A 1 590 ? 38.114 50.745 74.597  1.00 12.60 ? 591  LEU A CA  1 
ATOM   4510 C  C   . LEU A 1 590 ? 38.587 51.441 73.349  1.00 12.63 ? 591  LEU A C   1 
ATOM   4511 O  O   . LEU A 1 590 ? 37.901 52.367 72.962  1.00 13.30 ? 591  LEU A O   1 
ATOM   4512 C  CB  . LEU A 1 590 ? 37.505 51.742 75.590  1.00 10.87 ? 591  LEU A CB  1 
ATOM   4513 C  CG  . LEU A 1 590 ? 36.681 51.043 76.667  1.00 9.35  ? 591  LEU A CG  1 
ATOM   4514 C  CD1 . LEU A 1 590 ? 36.617 51.884 77.891  1.00 7.75  ? 591  LEU A CD1 1 
ATOM   4515 C  CD2 . LEU A 1 590 ? 35.295 50.753 76.153  1.00 10.03 ? 591  LEU A CD2 1 
ATOM   4516 N  N   . ILE A 1 591 ? 39.649 51.048 72.624  1.00 13.14 ? 592  ILE A N   1 
ATOM   4517 C  CA  . ILE A 1 591 ? 40.050 51.836 71.466  1.00 13.48 ? 592  ILE A CA  1 
ATOM   4518 C  C   . ILE A 1 591 ? 39.120 51.825 70.254  1.00 14.00 ? 592  ILE A C   1 
ATOM   4519 O  O   . ILE A 1 591 ? 39.241 52.679 69.372  1.00 13.93 ? 592  ILE A O   1 
ATOM   4520 C  CB  . ILE A 1 591 ? 41.488 51.482 70.947  1.00 13.03 ? 592  ILE A CB  1 
ATOM   4521 C  CG1 . ILE A 1 591 ? 41.670 50.151 70.271  1.00 13.48 ? 592  ILE A CG1 1 
ATOM   4522 C  CG2 . ILE A 1 591 ? 42.368 51.626 72.156  1.00 13.34 ? 592  ILE A CG2 1 
ATOM   4523 C  CD1 . ILE A 1 591 ? 43.117 50.122 69.662  1.00 12.40 ? 592  ILE A CD1 1 
ATOM   4524 N  N   . GLY A 1 592 ? 38.127 50.917 70.235  1.00 14.90 ? 593  GLY A N   1 
ATOM   4525 C  CA  . GLY A 1 592 ? 37.133 50.834 69.169  1.00 15.16 ? 593  GLY A CA  1 
ATOM   4526 C  C   . GLY A 1 592 ? 35.741 51.371 69.554  1.00 15.98 ? 593  GLY A C   1 
ATOM   4527 O  O   . GLY A 1 592 ? 34.874 51.451 68.683  1.00 16.56 ? 593  GLY A O   1 
ATOM   4528 N  N   . ALA A 1 593 ? 35.413 51.713 70.807  1.00 16.85 ? 594  ALA A N   1 
ATOM   4529 C  CA  . ALA A 1 593 ? 34.116 52.341 71.140  1.00 17.19 ? 594  ALA A CA  1 
ATOM   4530 C  C   . ALA A 1 593 ? 33.977 53.722 70.498  1.00 16.78 ? 594  ALA A C   1 
ATOM   4531 O  O   . ALA A 1 593 ? 34.953 54.419 70.335  1.00 17.31 ? 594  ALA A O   1 
ATOM   4532 C  CB  . ALA A 1 593 ? 33.965 52.508 72.668  1.00 16.18 ? 594  ALA A CB  1 
ATOM   4533 N  N   . ILE A 1 594 ? 32.827 54.149 70.009  1.00 17.37 ? 595  ILE A N   1 
ATOM   4534 C  CA  . ILE A 1 594 ? 32.619 55.498 69.469  1.00 17.44 ? 595  ILE A CA  1 
ATOM   4535 C  C   . ILE A 1 594 ? 32.293 56.505 70.573  1.00 17.31 ? 595  ILE A C   1 
ATOM   4536 O  O   . ILE A 1 594 ? 31.296 56.320 71.272  1.00 18.68 ? 595  ILE A O   1 
ATOM   4537 C  CB  . ILE A 1 594 ? 31.470 55.464 68.450  1.00 16.43 ? 595  ILE A CB  1 
ATOM   4538 C  CG1 . ILE A 1 594 ? 31.760 54.481 67.329  1.00 16.95 ? 595  ILE A CG1 1 
ATOM   4539 C  CG2 . ILE A 1 594 ? 31.272 56.867 67.915  1.00 15.67 ? 595  ILE A CG2 1 
ATOM   4540 C  CD1 . ILE A 1 594 ? 33.038 54.760 66.481  1.00 17.92 ? 595  ILE A CD1 1 
ATOM   4541 N  N   . ASN A 1 595 ? 33.066 57.551 70.801  1.00 17.19 ? 596  ASN A N   1 
ATOM   4542 C  CA  . ASN A 1 595 ? 32.726 58.582 71.782  1.00 18.67 ? 596  ASN A CA  1 
ATOM   4543 C  C   . ASN A 1 595 ? 31.587 59.419 71.210  1.00 20.13 ? 596  ASN A C   1 
ATOM   4544 O  O   . ASN A 1 595 ? 31.533 59.791 70.035  1.00 20.73 ? 596  ASN A O   1 
ATOM   4545 C  CB  . ASN A 1 595 ? 33.930 59.461 72.015  1.00 18.70 ? 596  ASN A CB  1 
ATOM   4546 C  CG  . ASN A 1 595 ? 33.834 60.695 72.912  1.00 17.92 ? 596  ASN A CG  1 
ATOM   4547 O  OD1 . ASN A 1 595 ? 32.894 60.862 73.678  1.00 15.53 ? 596  ASN A OD1 1 
ATOM   4548 N  ND2 . ASN A 1 595 ? 34.852 61.566 72.820  1.00 16.21 ? 596  ASN A ND2 1 
ATOM   4549 N  N   . ILE A 1 596 ? 30.620 59.693 72.062  1.00 22.30 ? 597  ILE A N   1 
ATOM   4550 C  CA  . ILE A 1 596 ? 29.457 60.451 71.654  1.00 23.11 ? 597  ILE A CA  1 
ATOM   4551 C  C   . ILE A 1 596 ? 29.833 61.898 71.373  1.00 24.69 ? 597  ILE A C   1 
ATOM   4552 O  O   . ILE A 1 596 ? 29.290 62.433 70.406  1.00 24.50 ? 597  ILE A O   1 
ATOM   4553 C  CB  . ILE A 1 596 ? 28.371 60.309 72.772  1.00 22.72 ? 597  ILE A CB  1 
ATOM   4554 C  CG1 . ILE A 1 596 ? 27.096 61.008 72.290  1.00 23.23 ? 597  ILE A CG1 1 
ATOM   4555 C  CG2 . ILE A 1 596 ? 28.848 60.890 74.085  1.00 20.36 ? 597  ILE A CG2 1 
ATOM   4556 C  CD1 . ILE A 1 596 ? 25.763 60.477 72.840  1.00 23.98 ? 597  ILE A CD1 1 
ATOM   4557 N  N   . GLU A 1 597 ? 30.746 62.516 72.164  1.00 25.88 ? 598  GLU A N   1 
ATOM   4558 C  CA  . GLU A 1 597 ? 31.223 63.896 71.977  1.00 27.60 ? 598  GLU A CA  1 
ATOM   4559 C  C   . GLU A 1 597 ? 31.700 64.284 70.591  1.00 27.98 ? 598  GLU A C   1 
ATOM   4560 O  O   . GLU A 1 597 ? 31.346 65.339 70.087  1.00 28.08 ? 598  GLU A O   1 
ATOM   4561 C  CB  . GLU A 1 597 ? 32.346 64.175 72.964  1.00 28.25 ? 598  GLU A CB  1 
ATOM   4562 C  CG  . GLU A 1 597 ? 32.861 65.594 73.037  1.00 29.78 ? 598  GLU A CG  1 
ATOM   4563 C  CD  . GLU A 1 597 ? 33.511 66.035 74.363  1.00 32.53 ? 598  GLU A CD  1 
ATOM   4564 O  OE1 . GLU A 1 597 ? 33.571 65.308 75.364  1.00 32.23 ? 598  GLU A OE1 1 
ATOM   4565 O  OE2 . GLU A 1 597 ? 33.951 67.181 74.397  1.00 35.09 ? 598  GLU A OE2 1 
ATOM   4566 N  N   . ASN A 1 598 ? 32.481 63.436 69.957  1.00 28.92 ? 599  ASN A N   1 
ATOM   4567 C  CA  . ASN A 1 598 ? 33.004 63.772 68.660  1.00 30.63 ? 599  ASN A CA  1 
ATOM   4568 C  C   . ASN A 1 598 ? 32.714 62.727 67.593  1.00 32.30 ? 599  ASN A C   1 
ATOM   4569 O  O   . ASN A 1 598 ? 33.133 62.934 66.457  1.00 31.71 ? 599  ASN A O   1 
ATOM   4570 C  CB  . ASN A 1 598 ? 34.491 63.965 68.762  1.00 31.12 ? 599  ASN A CB  1 
ATOM   4571 C  CG  . ASN A 1 598 ? 35.171 62.780 69.426  1.00 32.28 ? 599  ASN A CG  1 
ATOM   4572 O  OD1 . ASN A 1 598 ? 34.594 61.713 69.645  1.00 32.15 ? 599  ASN A OD1 1 
ATOM   4573 N  ND2 . ASN A 1 598 ? 36.436 62.964 69.770  1.00 32.97 ? 599  ASN A ND2 1 
ATOM   4574 N  N   . ARG A 1 599 ? 32.026 61.613 67.899  1.00 34.99 ? 600  ARG A N   1 
ATOM   4575 C  CA  . ARG A 1 599 ? 31.725 60.523 66.948  1.00 38.11 ? 600  ARG A CA  1 
ATOM   4576 C  C   . ARG A 1 599 ? 32.978 59.778 66.518  1.00 37.12 ? 600  ARG A C   1 
ATOM   4577 O  O   . ARG A 1 599 ? 33.055 59.212 65.423  1.00 37.57 ? 600  ARG A O   1 
ATOM   4578 C  CB  . ARG A 1 599 ? 31.025 61.006 65.610  1.00 43.81 ? 600  ARG A CB  1 
ATOM   4579 C  CG  . ARG A 1 599 ? 29.475 61.131 65.472  1.00 48.99 ? 600  ARG A CG  1 
ATOM   4580 C  CD  . ARG A 1 599 ? 29.034 62.515 64.903  1.00 52.45 ? 600  ARG A CD  1 
ATOM   4581 N  NE  . ARG A 1 599 ? 29.484 63.668 65.688  1.00 56.01 ? 600  ARG A NE  1 
ATOM   4582 C  CZ  . ARG A 1 599 ? 29.233 63.823 66.996  1.00 58.56 ? 600  ARG A CZ  1 
ATOM   4583 N  NH1 . ARG A 1 599 ? 28.415 63.003 67.673  1.00 60.13 ? 600  ARG A NH1 1 
ATOM   4584 N  NH2 . ARG A 1 599 ? 29.763 64.871 67.636  1.00 60.23 ? 600  ARG A NH2 1 
ATOM   4585 N  N   . LYS A 1 600 ? 33.935 59.670 67.441  1.00 35.61 ? 601  LYS A N   1 
ATOM   4586 C  CA  . LYS A 1 600 ? 35.217 59.108 67.081  1.00 33.13 ? 601  LYS A CA  1 
ATOM   4587 C  C   . LYS A 1 600 ? 35.703 58.016 67.999  1.00 30.28 ? 601  LYS A C   1 
ATOM   4588 O  O   . LYS A 1 600 ? 35.430 57.975 69.192  1.00 29.78 ? 601  LYS A O   1 
ATOM   4589 C  CB  . LYS A 1 600 ? 36.227 60.238 67.037  1.00 34.83 ? 601  LYS A CB  1 
ATOM   4590 C  CG  . LYS A 1 600 ? 36.629 60.586 65.645  1.00 37.43 ? 601  LYS A CG  1 
ATOM   4591 C  CD  . LYS A 1 600 ? 36.928 62.064 65.597  1.00 40.80 ? 601  LYS A CD  1 
ATOM   4592 C  CE  . LYS A 1 600 ? 36.234 62.614 64.331  1.00 44.40 ? 601  LYS A CE  1 
ATOM   4593 N  NZ  . LYS A 1 600 ? 34.767 62.415 64.343  1.00 47.53 ? 601  LYS A NZ  1 
ATOM   4594 N  N   . ALA A 1 601 ? 36.451 57.149 67.344  1.00 26.91 ? 602  ALA A N   1 
ATOM   4595 C  CA  . ALA A 1 601 ? 37.125 56.016 67.948  1.00 24.52 ? 602  ALA A CA  1 
ATOM   4596 C  C   . ALA A 1 601 ? 38.534 56.381 68.471  1.00 23.22 ? 602  ALA A C   1 
ATOM   4597 O  O   . ALA A 1 601 ? 39.363 56.952 67.756  1.00 22.56 ? 602  ALA A O   1 
ATOM   4598 C  CB  . ALA A 1 601 ? 37.212 54.926 66.900  1.00 22.90 ? 602  ALA A CB  1 
ATOM   4599 N  N   . ASN A 1 602 ? 38.789 56.056 69.754  1.00 21.82 ? 603  ASN A N   1 
ATOM   4600 C  CA  . ASN A 1 602 ? 40.015 56.366 70.509  1.00 20.12 ? 603  ASN A CA  1 
ATOM   4601 C  C   . ASN A 1 602 ? 40.351 57.860 70.626  1.00 20.25 ? 603  ASN A C   1 
ATOM   4602 O  O   . ASN A 1 602 ? 41.505 58.252 70.436  1.00 20.76 ? 603  ASN A O   1 
ATOM   4603 C  CB  . ASN A 1 602 ? 41.225 55.616 69.886  1.00 17.85 ? 603  ASN A CB  1 
ATOM   4604 C  CG  . ASN A 1 602 ? 42.359 55.323 70.869  1.00 15.26 ? 603  ASN A CG  1 
ATOM   4605 O  OD1 . ASN A 1 602 ? 42.276 55.417 72.087  1.00 14.32 ? 603  ASN A OD1 1 
ATOM   4606 N  ND2 . ASN A 1 602 ? 43.493 54.901 70.385  1.00 12.84 ? 603  ASN A ND2 1 
ATOM   4607 N  N   . SER A 1 603 ? 39.379 58.730 70.969  1.00 20.50 ? 604  SER A N   1 
ATOM   4608 C  CA  . SER A 1 603 ? 39.616 60.181 71.034  1.00 20.31 ? 604  SER A CA  1 
ATOM   4609 C  C   . SER A 1 603 ? 38.694 60.887 72.024  1.00 19.72 ? 604  SER A C   1 
ATOM   4610 O  O   . SER A 1 603 ? 37.575 61.330 71.750  1.00 18.18 ? 604  SER A O   1 
ATOM   4611 C  CB  . SER A 1 603 ? 39.434 60.813 69.655  1.00 19.37 ? 604  SER A CB  1 
ATOM   4612 O  OG  . SER A 1 603 ? 40.100 62.074 69.735  1.00 19.04 ? 604  SER A OG  1 
ATOM   4613 N  N   . VAL A 1 604 ? 39.270 60.995 73.215  1.00 20.23 ? 605  VAL A N   1 
ATOM   4614 C  CA  . VAL A 1 604 ? 38.537 61.483 74.376  1.00 20.43 ? 605  VAL A CA  1 
ATOM   4615 C  C   . VAL A 1 604 ? 39.421 62.544 74.997  1.00 21.28 ? 605  VAL A C   1 
ATOM   4616 O  O   . VAL A 1 604 ? 40.665 62.487 74.933  1.00 21.33 ? 605  VAL A O   1 
ATOM   4617 C  CB  . VAL A 1 604 ? 38.232 60.344 75.460  1.00 19.42 ? 605  VAL A CB  1 
ATOM   4618 C  CG1 . VAL A 1 604 ? 37.260 59.293 74.855  1.00 18.66 ? 605  VAL A CG1 1 
ATOM   4619 C  CG2 . VAL A 1 604 ? 39.528 59.647 75.919  1.00 17.70 ? 605  VAL A CG2 1 
ATOM   4620 N  N   . ARG A 1 605 ? 38.637 63.501 75.522  1.00 20.40 ? 606  ARG A N   1 
ATOM   4621 C  CA  . ARG A 1 605 ? 39.136 64.674 76.154  1.00 19.75 ? 606  ARG A CA  1 
ATOM   4622 C  C   . ARG A 1 605 ? 39.681 64.329 77.541  1.00 19.56 ? 606  ARG A C   1 
ATOM   4623 O  O   . ARG A 1 605 ? 38.967 63.832 78.403  1.00 19.53 ? 606  ARG A O   1 
ATOM   4624 C  CB  . ARG A 1 605 ? 37.996 65.677 76.248  1.00 20.48 ? 606  ARG A CB  1 
ATOM   4625 C  CG  . ARG A 1 605 ? 38.304 67.010 76.937  1.00 21.70 ? 606  ARG A CG  1 
ATOM   4626 C  CD  . ARG A 1 605 ? 37.054 67.669 77.492  1.00 22.64 ? 606  ARG A CD  1 
ATOM   4627 N  NE  . ARG A 1 605 ? 36.147 68.102 76.436  1.00 25.32 ? 606  ARG A NE  1 
ATOM   4628 C  CZ  . ARG A 1 605 ? 36.072 69.374 75.973  1.00 27.48 ? 606  ARG A CZ  1 
ATOM   4629 N  NH1 . ARG A 1 605 ? 36.820 70.371 76.456  1.00 29.53 ? 606  ARG A NH1 1 
ATOM   4630 N  NH2 . ARG A 1 605 ? 35.195 69.677 75.007  1.00 26.63 ? 606  ARG A NH2 1 
ATOM   4631 N  N   . ASN A 1 606 ? 40.945 64.623 77.829  1.00 19.21 ? 607  ASN A N   1 
ATOM   4632 C  CA  . ASN A 1 606 ? 41.464 64.496 79.172  1.00 19.09 ? 607  ASN A CA  1 
ATOM   4633 C  C   . ASN A 1 606 ? 40.915 65.679 79.970  1.00 20.88 ? 607  ASN A C   1 
ATOM   4634 O  O   . ASN A 1 606 ? 41.198 66.825 79.636  1.00 21.45 ? 607  ASN A O   1 
ATOM   4635 C  CB  . ASN A 1 606 ? 42.977 64.530 79.127  1.00 16.81 ? 607  ASN A CB  1 
ATOM   4636 C  CG  . ASN A 1 606 ? 43.700 64.333 80.464  1.00 15.73 ? 607  ASN A CG  1 
ATOM   4637 O  OD1 . ASN A 1 606 ? 43.410 64.961 81.486  1.00 15.81 ? 607  ASN A OD1 1 
ATOM   4638 N  ND2 . ASN A 1 606 ? 44.693 63.438 80.490  1.00 12.97 ? 607  ASN A ND2 1 
ATOM   4639 N  N   . ALA A 1 607 ? 40.113 65.444 81.027  1.00 22.53 ? 608  ALA A N   1 
ATOM   4640 C  CA  . ALA A 1 607 ? 39.561 66.494 81.887  1.00 22.36 ? 608  ALA A CA  1 
ATOM   4641 C  C   . ALA A 1 607 ? 40.542 67.531 82.465  1.00 22.87 ? 608  ALA A C   1 
ATOM   4642 O  O   . ALA A 1 607 ? 40.190 68.705 82.578  1.00 23.55 ? 608  ALA A O   1 
ATOM   4643 C  CB  . ALA A 1 607 ? 38.851 65.847 83.055  1.00 22.25 ? 608  ALA A CB  1 
ATOM   4644 N  N   . VAL A 1 608 ? 41.787 67.143 82.804  1.00 22.05 ? 609  VAL A N   1 
ATOM   4645 C  CA  . VAL A 1 608 ? 42.790 68.028 83.389  1.00 21.31 ? 609  VAL A CA  1 
ATOM   4646 C  C   . VAL A 1 608 ? 43.568 68.903 82.386  1.00 19.94 ? 609  VAL A C   1 
ATOM   4647 O  O   . VAL A 1 608 ? 43.758 70.098 82.568  1.00 18.91 ? 609  VAL A O   1 
ATOM   4648 C  CB  . VAL A 1 608 ? 43.795 67.142 84.193  1.00 22.78 ? 609  VAL A CB  1 
ATOM   4649 C  CG1 . VAL A 1 608 ? 44.802 68.041 84.921  1.00 23.17 ? 609  VAL A CG1 1 
ATOM   4650 C  CG2 . VAL A 1 608 ? 43.051 66.225 85.162  1.00 22.29 ? 609  VAL A CG2 1 
ATOM   4651 N  N   . THR A 1 609 ? 44.086 68.305 81.322  1.00 19.20 ? 610  THR A N   1 
ATOM   4652 C  CA  . THR A 1 609 ? 44.960 68.965 80.371  1.00 18.06 ? 610  THR A CA  1 
ATOM   4653 C  C   . THR A 1 609 ? 44.167 69.506 79.190  1.00 18.15 ? 610  THR A C   1 
ATOM   4654 O  O   . THR A 1 609 ? 44.647 70.300 78.386  1.00 18.43 ? 610  THR A O   1 
ATOM   4655 C  CB  . THR A 1 609 ? 46.054 67.936 79.911  1.00 17.38 ? 610  THR A CB  1 
ATOM   4656 O  OG1 . THR A 1 609 ? 45.426 67.087 78.958  1.00 18.24 ? 610  THR A OG1 1 
ATOM   4657 C  CG2 . THR A 1 609 ? 46.601 67.022 81.014  1.00 14.82 ? 610  THR A CG2 1 
ATOM   4658 N  N   . GLN A 1 610 ? 42.945 69.045 79.014  1.00 18.27 ? 611  GLN A N   1 
ATOM   4659 C  CA  . GLN A 1 610 ? 42.036 69.490 77.969  1.00 20.49 ? 611  GLN A CA  1 
ATOM   4660 C  C   . GLN A 1 610 ? 42.567 69.276 76.563  1.00 21.36 ? 611  GLN A C   1 
ATOM   4661 O  O   . GLN A 1 610 ? 42.317 70.039 75.623  1.00 20.68 ? 611  GLN A O   1 
ATOM   4662 C  CB  . GLN A 1 610 ? 41.662 70.995 78.194  1.00 19.78 ? 611  GLN A CB  1 
ATOM   4663 C  CG  . GLN A 1 610 ? 40.858 71.298 79.480  1.00 20.64 ? 611  GLN A CG  1 
ATOM   4664 C  CD  . GLN A 1 610 ? 39.442 70.746 79.427  1.00 21.67 ? 611  GLN A CD  1 
ATOM   4665 O  OE1 . GLN A 1 610 ? 38.830 70.743 78.363  1.00 21.63 ? 611  GLN A OE1 1 
ATOM   4666 N  NE2 . GLN A 1 610 ? 38.863 70.199 80.495  1.00 22.14 ? 611  GLN A NE2 1 
ATOM   4667 N  N   . GLU A 1 611 ? 43.410 68.263 76.425  1.00 23.59 ? 612  GLU A N   1 
ATOM   4668 C  CA  . GLU A 1 611 ? 43.808 67.861 75.083  1.00 26.67 ? 612  GLU A CA  1 
ATOM   4669 C  C   . GLU A 1 611 ? 43.064 66.557 74.770  1.00 26.65 ? 612  GLU A C   1 
ATOM   4670 O  O   . GLU A 1 611 ? 42.732 65.798 75.691  1.00 27.87 ? 612  GLU A O   1 
ATOM   4671 C  CB  . GLU A 1 611 ? 45.310 67.624 75.005  1.00 30.00 ? 612  GLU A CB  1 
ATOM   4672 C  CG  . GLU A 1 611 ? 46.149 68.912 74.932  1.00 36.65 ? 612  GLU A CG  1 
ATOM   4673 C  CD  . GLU A 1 611 ? 46.403 69.550 73.544  1.00 40.50 ? 612  GLU A CD  1 
ATOM   4674 O  OE1 . GLU A 1 611 ? 45.505 69.585 72.683  1.00 41.83 ? 612  GLU A OE1 1 
ATOM   4675 O  OE2 . GLU A 1 611 ? 47.530 70.027 73.336  1.00 42.53 ? 612  GLU A OE2 1 
ATOM   4676 N  N   . PHE A 1 612 ? 42.731 66.302 73.505  1.00 25.08 ? 613  PHE A N   1 
ATOM   4677 C  CA  . PHE A 1 612 ? 42.110 65.051 73.113  1.00 24.82 ? 613  PHE A CA  1 
ATOM   4678 C  C   . PHE A 1 612 ? 43.145 63.988 72.719  1.00 24.22 ? 613  PHE A C   1 
ATOM   4679 O  O   . PHE A 1 612 ? 44.155 64.246 72.060  1.00 23.75 ? 613  PHE A O   1 
ATOM   4680 C  CB  . PHE A 1 612 ? 41.150 65.276 71.939  1.00 25.03 ? 613  PHE A CB  1 
ATOM   4681 C  CG  . PHE A 1 612 ? 39.735 65.705 72.338  1.00 25.16 ? 613  PHE A CG  1 
ATOM   4682 C  CD1 . PHE A 1 612 ? 39.416 67.053 72.548  1.00 24.60 ? 613  PHE A CD1 1 
ATOM   4683 C  CD2 . PHE A 1 612 ? 38.748 64.720 72.459  1.00 24.72 ? 613  PHE A CD2 1 
ATOM   4684 C  CE1 . PHE A 1 612 ? 38.096 67.387 72.875  1.00 25.29 ? 613  PHE A CE1 1 
ATOM   4685 C  CE2 . PHE A 1 612 ? 37.440 65.072 72.786  1.00 25.59 ? 613  PHE A CE2 1 
ATOM   4686 C  CZ  . PHE A 1 612 ? 37.100 66.403 72.996  1.00 24.50 ? 613  PHE A CZ  1 
ATOM   4687 N  N   . GLY A 1 613 ? 42.934 62.759 73.176  1.00 23.99 ? 614  GLY A N   1 
ATOM   4688 C  CA  . GLY A 1 613 ? 43.847 61.665 72.863  1.00 22.74 ? 614  GLY A CA  1 
ATOM   4689 C  C   . GLY A 1 613 ? 43.328 60.275 73.261  1.00 21.67 ? 614  GLY A C   1 
ATOM   4690 O  O   . GLY A 1 613 ? 42.136 60.079 73.522  1.00 22.20 ? 614  GLY A O   1 
ATOM   4691 N  N   . PRO A 1 614 ? 44.207 59.270 73.342  1.00 20.40 ? 615  PRO A N   1 
ATOM   4692 C  CA  . PRO A 1 614 ? 43.794 57.875 73.420  1.00 18.74 ? 615  PRO A CA  1 
ATOM   4693 C  C   . PRO A 1 614 ? 43.173 57.490 74.760  1.00 18.37 ? 615  PRO A C   1 
ATOM   4694 O  O   . PRO A 1 614 ? 43.501 58.035 75.827  1.00 18.09 ? 615  PRO A O   1 
ATOM   4695 C  CB  . PRO A 1 614 ? 45.046 57.144 73.074  1.00 17.42 ? 615  PRO A CB  1 
ATOM   4696 C  CG  . PRO A 1 614 ? 45.894 58.202 72.384  1.00 18.32 ? 615  PRO A CG  1 
ATOM   4697 C  CD  . PRO A 1 614 ? 45.656 59.420 73.211  1.00 18.75 ? 615  PRO A CD  1 
ATOM   4698 N  N   . VAL A 1 615 ? 42.208 56.558 74.670  1.00 16.91 ? 616  VAL A N   1 
ATOM   4699 C  CA  . VAL A 1 615 ? 41.456 56.104 75.834  1.00 16.04 ? 616  VAL A CA  1 
ATOM   4700 C  C   . VAL A 1 615 ? 42.389 55.455 76.843  1.00 16.32 ? 616  VAL A C   1 
ATOM   4701 O  O   . VAL A 1 615 ? 42.353 55.972 77.972  1.00 15.78 ? 616  VAL A O   1 
ATOM   4702 C  CB  . VAL A 1 615 ? 40.312 55.112 75.413  1.00 14.53 ? 616  VAL A CB  1 
ATOM   4703 C  CG1 . VAL A 1 615 ? 39.486 54.779 76.626  1.00 11.98 ? 616  VAL A CG1 1 
ATOM   4704 C  CG2 . VAL A 1 615 ? 39.439 55.725 74.332  1.00 11.76 ? 616  VAL A CG2 1 
ATOM   4705 N  N   . PRO A 1 616 ? 43.241 54.415 76.534  1.00 17.02 ? 617  PRO A N   1 
ATOM   4706 C  CA  . PRO A 1 616 ? 44.106 53.768 77.530  1.00 16.49 ? 617  PRO A CA  1 
ATOM   4707 C  C   . PRO A 1 616 ? 45.003 54.776 78.227  1.00 16.75 ? 617  PRO A C   1 
ATOM   4708 O  O   . PRO A 1 616 ? 44.967 54.824 79.456  1.00 15.82 ? 617  PRO A O   1 
ATOM   4709 C  CB  . PRO A 1 616 ? 44.864 52.696 76.751  1.00 15.63 ? 617  PRO A CB  1 
ATOM   4710 C  CG  . PRO A 1 616 ? 44.670 52.990 75.292  1.00 15.18 ? 617  PRO A CG  1 
ATOM   4711 C  CD  . PRO A 1 616 ? 43.314 53.646 75.269  1.00 15.92 ? 617  PRO A CD  1 
ATOM   4712 N  N   . ASP A 1 617 ? 45.703 55.613 77.449  1.00 17.23 ? 618  ASP A N   1 
ATOM   4713 C  CA  . ASP A 1 617 ? 46.586 56.648 77.974  1.00 18.94 ? 618  ASP A CA  1 
ATOM   4714 C  C   . ASP A 1 617 ? 45.875 57.649 78.890  1.00 18.56 ? 618  ASP A C   1 
ATOM   4715 O  O   . ASP A 1 617 ? 46.465 58.070 79.895  1.00 18.96 ? 618  ASP A O   1 
ATOM   4716 C  CB  . ASP A 1 617 ? 47.237 57.401 76.829  1.00 20.86 ? 618  ASP A CB  1 
ATOM   4717 C  CG  . ASP A 1 617 ? 47.873 56.450 75.810  1.00 24.03 ? 618  ASP A CG  1 
ATOM   4718 O  OD1 . ASP A 1 617 ? 47.186 55.791 75.034  1.00 27.25 ? 618  ASP A OD1 1 
ATOM   4719 O  OD2 . ASP A 1 617 ? 49.082 56.333 75.778  1.00 25.52 ? 618  ASP A OD2 1 
ATOM   4720 N  N   . THR A 1 618 ? 44.624 58.035 78.612  1.00 17.43 ? 619  THR A N   1 
ATOM   4721 C  CA  . THR A 1 618 ? 43.903 58.963 79.497  1.00 17.58 ? 619  THR A CA  1 
ATOM   4722 C  C   . THR A 1 618 ? 43.489 58.250 80.792  1.00 17.60 ? 619  THR A C   1 
ATOM   4723 O  O   . THR A 1 618 ? 43.444 58.852 81.877  1.00 18.70 ? 619  THR A O   1 
ATOM   4724 C  CB  . THR A 1 618 ? 42.643 59.519 78.757  1.00 16.72 ? 619  THR A CB  1 
ATOM   4725 O  OG1 . THR A 1 618 ? 43.098 59.978 77.488  1.00 14.92 ? 619  THR A OG1 1 
ATOM   4726 C  CG2 . THR A 1 618 ? 41.922 60.597 79.535  1.00 14.24 ? 619  THR A CG2 1 
ATOM   4727 N  N   . ALA A 1 619 ? 43.132 56.960 80.696  1.00 16.37 ? 620  ALA A N   1 
ATOM   4728 C  CA  . ALA A 1 619 ? 42.787 56.197 81.870  1.00 15.41 ? 620  ALA A CA  1 
ATOM   4729 C  C   . ALA A 1 619 ? 44.067 56.035 82.681  1.00 15.12 ? 620  ALA A C   1 
ATOM   4730 O  O   . ALA A 1 619 ? 43.978 56.047 83.889  1.00 15.22 ? 620  ALA A O   1 
ATOM   4731 C  CB  . ALA A 1 619 ? 42.237 54.838 81.416  1.00 14.49 ? 620  ALA A CB  1 
ATOM   4732 N  N   . ARG A 1 620 ? 45.279 55.847 82.128  1.00 16.26 ? 621  ARG A N   1 
ATOM   4733 C  CA  . ARG A 1 620 ? 46.498 55.731 82.934  1.00 18.04 ? 621  ARG A CA  1 
ATOM   4734 C  C   . ARG A 1 620 ? 46.759 57.057 83.599  1.00 18.80 ? 621  ARG A C   1 
ATOM   4735 O  O   . ARG A 1 620 ? 47.005 57.006 84.787  1.00 18.99 ? 621  ARG A O   1 
ATOM   4736 C  CB  . ARG A 1 620 ? 47.757 55.388 82.125  1.00 18.12 ? 621  ARG A CB  1 
ATOM   4737 C  CG  . ARG A 1 620 ? 47.672 53.990 81.520  1.00 19.92 ? 621  ARG A CG  1 
ATOM   4738 C  CD  . ARG A 1 620 ? 48.944 53.474 80.872  1.00 20.41 ? 621  ARG A CD  1 
ATOM   4739 N  NE  . ARG A 1 620 ? 48.745 52.210 80.154  1.00 21.29 ? 621  ARG A NE  1 
ATOM   4740 C  CZ  . ARG A 1 620 ? 49.006 51.024 80.718  1.00 21.14 ? 621  ARG A CZ  1 
ATOM   4741 N  NH1 . ARG A 1 620 ? 49.401 50.928 81.999  1.00 18.14 ? 621  ARG A NH1 1 
ATOM   4742 N  NH2 . ARG A 1 620 ? 48.826 49.908 79.989  1.00 18.97 ? 621  ARG A NH2 1 
ATOM   4743 N  N   . TYR A 1 621 ? 46.658 58.206 82.909  1.00 20.40 ? 622  TYR A N   1 
ATOM   4744 C  CA  . TYR A 1 621 ? 46.843 59.526 83.491  1.00 22.20 ? 622  TYR A CA  1 
ATOM   4745 C  C   . TYR A 1 621 ? 45.887 59.731 84.640  1.00 22.40 ? 622  TYR A C   1 
ATOM   4746 O  O   . TYR A 1 621 ? 46.334 60.282 85.638  1.00 23.24 ? 622  TYR A O   1 
ATOM   4747 C  CB  . TYR A 1 621 ? 46.621 60.611 82.412  1.00 25.15 ? 622  TYR A CB  1 
ATOM   4748 C  CG  . TYR A 1 621 ? 46.877 62.052 82.875  1.00 27.74 ? 622  TYR A CG  1 
ATOM   4749 C  CD1 . TYR A 1 621 ? 45.842 62.762 83.505  1.00 28.30 ? 622  TYR A CD1 1 
ATOM   4750 C  CD2 . TYR A 1 621 ? 48.136 62.664 82.673  1.00 27.92 ? 622  TYR A CD2 1 
ATOM   4751 C  CE1 . TYR A 1 621 ? 46.071 64.068 83.937  1.00 30.28 ? 622  TYR A CE1 1 
ATOM   4752 C  CE2 . TYR A 1 621 ? 48.369 63.976 83.106  1.00 28.53 ? 622  TYR A CE2 1 
ATOM   4753 C  CZ  . TYR A 1 621 ? 47.326 64.665 83.731  1.00 30.05 ? 622  TYR A CZ  1 
ATOM   4754 O  OH  . TYR A 1 621 ? 47.469 65.970 84.151  1.00 32.30 ? 622  TYR A OH  1 
ATOM   4755 N  N   . TYR A 1 622 ? 44.603 59.320 84.551  1.00 21.68 ? 623  TYR A N   1 
ATOM   4756 C  CA  . TYR A 1 622 ? 43.664 59.478 85.648  1.00 20.41 ? 623  TYR A CA  1 
ATOM   4757 C  C   . TYR A 1 622 ? 44.029 58.623 86.834  1.00 19.91 ? 623  TYR A C   1 
ATOM   4758 O  O   . TYR A 1 622 ? 43.918 59.038 87.986  1.00 18.40 ? 623  TYR A O   1 
ATOM   4759 C  CB  . TYR A 1 622 ? 42.260 59.110 85.215  1.00 21.10 ? 623  TYR A CB  1 
ATOM   4760 C  CG  . TYR A 1 622 ? 41.530 60.068 84.290  1.00 21.11 ? 623  TYR A CG  1 
ATOM   4761 C  CD1 . TYR A 1 622 ? 42.033 61.359 84.046  1.00 21.05 ? 623  TYR A CD1 1 
ATOM   4762 C  CD2 . TYR A 1 622 ? 40.368 59.630 83.651  1.00 20.86 ? 623  TYR A CD2 1 
ATOM   4763 C  CE1 . TYR A 1 622 ? 41.383 62.228 83.175  1.00 20.58 ? 623  TYR A CE1 1 
ATOM   4764 C  CE2 . TYR A 1 622 ? 39.709 60.498 82.775  1.00 21.50 ? 623  TYR A CE2 1 
ATOM   4765 C  CZ  . TYR A 1 622 ? 40.230 61.792 82.538  1.00 21.50 ? 623  TYR A CZ  1 
ATOM   4766 O  OH  . TYR A 1 622 ? 39.579 62.664 81.683  1.00 19.93 ? 623  TYR A OH  1 
ATOM   4767 N  N   . LYS A 1 623 ? 44.483 57.416 86.561  1.00 20.49 ? 624  LYS A N   1 
ATOM   4768 C  CA  . LYS A 1 623 ? 44.967 56.544 87.626  1.00 22.85 ? 624  LYS A CA  1 
ATOM   4769 C  C   . LYS A 1 623 ? 46.246 57.043 88.349  1.00 23.72 ? 624  LYS A C   1 
ATOM   4770 O  O   . LYS A 1 623 ? 46.357 56.968 89.571  1.00 22.97 ? 624  LYS A O   1 
ATOM   4771 C  CB  . LYS A 1 623 ? 45.171 55.188 86.969  1.00 23.35 ? 624  LYS A CB  1 
ATOM   4772 C  CG  . LYS A 1 623 ? 45.501 54.075 87.934  1.00 23.75 ? 624  LYS A CG  1 
ATOM   4773 C  CD  . LYS A 1 623 ? 46.105 52.980 87.142  1.00 24.48 ? 624  LYS A CD  1 
ATOM   4774 C  CE  . LYS A 1 623 ? 46.590 51.956 88.132  1.00 26.49 ? 624  LYS A CE  1 
ATOM   4775 N  NZ  . LYS A 1 623 ? 47.014 50.750 87.429  1.00 26.92 ? 624  LYS A NZ  1 
ATOM   4776 N  N   . GLN A 1 624 ? 47.225 57.564 87.585  1.00 25.71 ? 625  GLN A N   1 
ATOM   4777 C  CA  . GLN A 1 624 ? 48.480 58.169 88.050  1.00 27.51 ? 625  GLN A CA  1 
ATOM   4778 C  C   . GLN A 1 624 ? 48.144 59.330 88.960  1.00 26.59 ? 625  GLN A C   1 
ATOM   4779 O  O   . GLN A 1 624 ? 48.669 59.404 90.053  1.00 26.17 ? 625  GLN A O   1 
ATOM   4780 C  CB  . GLN A 1 624 ? 49.261 58.634 86.835  1.00 31.36 ? 625  GLN A CB  1 
ATOM   4781 C  CG  . GLN A 1 624 ? 50.647 59.276 87.029  1.00 39.07 ? 625  GLN A CG  1 
ATOM   4782 C  CD  . GLN A 1 624 ? 51.278 59.926 85.759  1.00 43.68 ? 625  GLN A CD  1 
ATOM   4783 O  OE1 . GLN A 1 624 ? 50.761 60.862 85.123  1.00 47.17 ? 625  GLN A OE1 1 
ATOM   4784 N  NE2 . GLN A 1 624 ? 52.473 59.556 85.321  1.00 44.91 ? 625  GLN A NE2 1 
ATOM   4785 N  N   . HIS A 1 625 ? 47.177 60.172 88.583  1.00 26.22 ? 626  HIS A N   1 
ATOM   4786 C  CA  . HIS A 1 625 ? 46.758 61.314 89.392  1.00 26.02 ? 626  HIS A CA  1 
ATOM   4787 C  C   . HIS A 1 625 ? 45.663 61.101 90.451  1.00 26.80 ? 626  HIS A C   1 
ATOM   4788 O  O   . HIS A 1 625 ? 45.207 62.057 91.076  1.00 26.66 ? 626  HIS A O   1 
ATOM   4789 C  CB  . HIS A 1 625 ? 46.377 62.416 88.401  1.00 24.68 ? 626  HIS A CB  1 
ATOM   4790 C  CG  . HIS A 1 625 ? 47.636 62.868 87.666  1.00 26.77 ? 626  HIS A CG  1 
ATOM   4791 N  ND1 . HIS A 1 625 ? 48.631 63.620 88.126  1.00 27.04 ? 626  HIS A ND1 1 
ATOM   4792 C  CD2 . HIS A 1 625 ? 48.012 62.453 86.410  1.00 27.62 ? 626  HIS A CD2 1 
ATOM   4793 C  CE1 . HIS A 1 625 ? 49.585 63.662 87.214  1.00 28.63 ? 626  HIS A CE1 1 
ATOM   4794 N  NE2 . HIS A 1 625 ? 49.193 62.950 86.182  1.00 27.75 ? 626  HIS A NE2 1 
ATOM   4795 N  N   . GLY A 1 626 ? 45.195 59.865 90.718  1.00 27.29 ? 627  GLY A N   1 
ATOM   4796 C  CA  . GLY A 1 626 ? 44.188 59.592 91.742  1.00 26.23 ? 627  GLY A CA  1 
ATOM   4797 C  C   . GLY A 1 626 ? 42.745 59.834 91.335  1.00 26.25 ? 627  GLY A C   1 
ATOM   4798 O  O   . GLY A 1 626 ? 41.909 59.892 92.233  1.00 27.65 ? 627  GLY A O   1 
ATOM   4799 N  N   . ILE A 1 627 ? 42.396 60.034 90.053  1.00 24.88 ? 628  ILE A N   1 
ATOM   4800 C  CA  . ILE A 1 627 ? 41.009 60.264 89.612  1.00 23.44 ? 628  ILE A CA  1 
ATOM   4801 C  C   . ILE A 1 627 ? 40.248 58.934 89.310  1.00 23.75 ? 628  ILE A C   1 
ATOM   4802 O  O   . ILE A 1 627 ? 40.592 58.260 88.342  1.00 23.23 ? 628  ILE A O   1 
ATOM   4803 C  CB  . ILE A 1 627 ? 41.060 61.166 88.345  1.00 21.74 ? 628  ILE A CB  1 
ATOM   4804 C  CG1 . ILE A 1 627 ? 41.794 62.432 88.611  1.00 20.62 ? 628  ILE A CG1 1 
ATOM   4805 C  CG2 . ILE A 1 627 ? 39.688 61.603 87.957  1.00 21.49 ? 628  ILE A CG2 1 
ATOM   4806 C  CD1 . ILE A 1 627 ? 42.165 63.190 87.324  1.00 19.70 ? 628  ILE A CD1 1 
ATOM   4807 N  N   . ARG A 1 628 ? 39.209 58.545 90.099  1.00 24.23 ? 629  ARG A N   1 
ATOM   4808 C  CA  . ARG A 1 628 ? 38.362 57.360 89.955  1.00 23.34 ? 629  ARG A CA  1 
ATOM   4809 C  C   . ARG A 1 628 ? 37.315 57.588 88.859  1.00 22.74 ? 629  ARG A C   1 
ATOM   4810 O  O   . ARG A 1 628 ? 36.563 58.581 88.893  1.00 23.06 ? 629  ARG A O   1 
ATOM   4811 C  CB  . ARG A 1 628 ? 37.680 57.052 91.321  1.00 24.79 ? 629  ARG A CB  1 
ATOM   4812 C  CG  . ARG A 1 628 ? 38.624 56.526 92.401  1.00 28.68 ? 629  ARG A CG  1 
ATOM   4813 C  CD  . ARG A 1 628 ? 38.165 56.929 93.794  1.00 33.13 ? 629  ARG A CD  1 
ATOM   4814 N  NE  . ARG A 1 628 ? 37.230 56.060 94.532  1.00 36.97 ? 629  ARG A NE  1 
ATOM   4815 C  CZ  . ARG A 1 628 ? 37.652 55.197 95.476  1.00 38.40 ? 629  ARG A CZ  1 
ATOM   4816 N  NH1 . ARG A 1 628 ? 38.951 54.946 95.654  1.00 38.57 ? 629  ARG A NH1 1 
ATOM   4817 N  NH2 . ARG A 1 628 ? 36.774 54.502 96.211  1.00 39.90 ? 629  ARG A NH2 1 
ATOM   4818 N  N   . TRP A 1 629 ? 37.234 56.653 87.885  1.00 20.78 ? 630  TRP A N   1 
ATOM   4819 C  CA  . TRP A 1 629 ? 36.384 56.886 86.747  1.00 19.02 ? 630  TRP A CA  1 
ATOM   4820 C  C   . TRP A 1 629 ? 35.341 55.829 86.478  1.00 18.31 ? 630  TRP A C   1 
ATOM   4821 O  O   . TRP A 1 629 ? 35.366 54.735 87.048  1.00 18.72 ? 630  TRP A O   1 
ATOM   4822 C  CB  . TRP A 1 629 ? 37.261 57.106 85.491  1.00 19.15 ? 630  TRP A CB  1 
ATOM   4823 C  CG  . TRP A 1 629 ? 38.291 56.047 85.115  1.00 19.94 ? 630  TRP A CG  1 
ATOM   4824 C  CD1 . TRP A 1 629 ? 39.605 56.142 85.522  1.00 19.88 ? 630  TRP A CD1 1 
ATOM   4825 C  CD2 . TRP A 1 629 ? 38.050 54.911 84.348  1.00 18.82 ? 630  TRP A CD2 1 
ATOM   4826 N  NE1 . TRP A 1 629 ? 40.198 55.066 85.029  1.00 21.11 ? 630  TRP A NE1 1 
ATOM   4827 C  CE2 . TRP A 1 629 ? 39.325 54.304 84.323  1.00 18.84 ? 630  TRP A CE2 1 
ATOM   4828 C  CE3 . TRP A 1 629 ? 36.967 54.319 83.678  1.00 16.93 ? 630  TRP A CE3 1 
ATOM   4829 C  CZ2 . TRP A 1 629 ? 39.525 53.107 83.631  1.00 16.74 ? 630  TRP A CZ2 1 
ATOM   4830 C  CZ3 . TRP A 1 629 ? 37.180 53.119 82.982  1.00 17.38 ? 630  TRP A CZ3 1 
ATOM   4831 C  CH2 . TRP A 1 629 ? 38.447 52.518 82.960  1.00 17.43 ? 630  TRP A CH2 1 
ATOM   4832 N  N   . VAL A 1 630 ? 34.430 56.214 85.576  1.00 16.86 ? 631  VAL A N   1 
ATOM   4833 C  CA  . VAL A 1 630 ? 33.220 55.484 85.236  1.00 15.62 ? 631  VAL A CA  1 
ATOM   4834 C  C   . VAL A 1 630 ? 33.097 55.344 83.721  1.00 15.86 ? 631  VAL A C   1 
ATOM   4835 O  O   . VAL A 1 630 ? 33.601 56.233 83.008  1.00 16.74 ? 631  VAL A O   1 
ATOM   4836 C  CB  . VAL A 1 630 ? 32.111 56.332 85.884  1.00 15.51 ? 631  VAL A CB  1 
ATOM   4837 C  CG1 . VAL A 1 630 ? 31.101 56.847 84.886  1.00 14.92 ? 631  VAL A CG1 1 
ATOM   4838 C  CG2 . VAL A 1 630 ? 31.427 55.501 86.892  1.00 13.70 ? 631  VAL A CG2 1 
ATOM   4839 N  N   . VAL A 1 631 ? 32.418 54.321 83.171  1.00 15.02 ? 632  VAL A N   1 
ATOM   4840 C  CA  . VAL A 1 631 ? 32.087 54.403 81.733  1.00 15.84 ? 632  VAL A CA  1 
ATOM   4841 C  C   . VAL A 1 631 ? 30.562 54.478 81.617  1.00 15.30 ? 632  VAL A C   1 
ATOM   4842 O  O   . VAL A 1 631 ? 29.845 53.870 82.425  1.00 13.93 ? 632  VAL A O   1 
ATOM   4843 C  CB  . VAL A 1 631 ? 32.633 53.163 80.924  1.00 17.21 ? 632  VAL A CB  1 
ATOM   4844 C  CG1 . VAL A 1 631 ? 31.998 52.995 79.532  1.00 16.19 ? 632  VAL A CG1 1 
ATOM   4845 C  CG2 . VAL A 1 631 ? 34.092 53.406 80.609  1.00 17.21 ? 632  VAL A CG2 1 
ATOM   4846 N  N   . ILE A 1 632 ? 30.041 55.230 80.625  1.00 14.83 ? 633  ILE A N   1 
ATOM   4847 C  CA  . ILE A 1 632 ? 28.598 55.319 80.415  1.00 15.05 ? 633  ILE A CA  1 
ATOM   4848 C  C   . ILE A 1 632 ? 28.259 54.594 79.106  1.00 14.68 ? 633  ILE A C   1 
ATOM   4849 O  O   . ILE A 1 632 ? 28.783 54.934 78.060  1.00 13.69 ? 633  ILE A O   1 
ATOM   4850 C  CB  . ILE A 1 632 ? 28.146 56.834 80.389  1.00 15.49 ? 633  ILE A CB  1 
ATOM   4851 C  CG1 . ILE A 1 632 ? 28.446 57.511 81.733  1.00 15.65 ? 633  ILE A CG1 1 
ATOM   4852 C  CG2 . ILE A 1 632 ? 26.624 56.945 80.151  1.00 15.99 ? 633  ILE A CG2 1 
ATOM   4853 C  CD1 . ILE A 1 632 ? 27.594 57.066 82.950  1.00 15.67 ? 633  ILE A CD1 1 
ATOM   4854 N  N   . GLY A 1 633 ? 27.344 53.619 79.065  1.00 15.55 ? 634  GLY A N   1 
ATOM   4855 C  CA  . GLY A 1 633 ? 27.145 52.806 77.874  1.00 17.19 ? 634  GLY A CA  1 
ATOM   4856 C  C   . GLY A 1 633 ? 25.682 52.720 77.480  1.00 18.63 ? 634  GLY A C   1 
ATOM   4857 O  O   . GLY A 1 633 ? 24.747 53.084 78.215  1.00 17.91 ? 634  GLY A O   1 
ATOM   4858 N  N   . ASP A 1 634 ? 25.509 52.237 76.253  1.00 20.66 ? 635  ASP A N   1 
ATOM   4859 C  CA  . ASP A 1 634 ? 24.174 52.234 75.707  1.00 22.73 ? 635  ASP A CA  1 
ATOM   4860 C  C   . ASP A 1 634 ? 23.443 50.899 75.975  1.00 23.22 ? 635  ASP A C   1 
ATOM   4861 O  O   . ASP A 1 634 ? 23.373 50.472 77.137  1.00 23.40 ? 635  ASP A O   1 
ATOM   4862 C  CB  . ASP A 1 634 ? 24.384 52.594 74.245  1.00 24.07 ? 635  ASP A CB  1 
ATOM   4863 C  CG  . ASP A 1 634 ? 23.196 53.330 73.578  1.00 27.46 ? 635  ASP A CG  1 
ATOM   4864 O  OD1 . ASP A 1 634 ? 22.029 53.080 73.932  1.00 26.92 ? 635  ASP A OD1 1 
ATOM   4865 O  OD2 . ASP A 1 634 ? 23.447 54.140 72.659  1.00 30.20 ? 635  ASP A OD2 1 
ATOM   4866 N  N   . GLU A 1 635 ? 22.845 50.274 74.960  1.00 22.83 ? 636  GLU A N   1 
ATOM   4867 C  CA  . GLU A 1 635 ? 22.184 48.992 75.074  1.00 23.12 ? 636  GLU A CA  1 
ATOM   4868 C  C   . GLU A 1 635 ? 23.025 47.795 74.667  1.00 21.67 ? 636  GLU A C   1 
ATOM   4869 O  O   . GLU A 1 635 ? 23.741 47.876 73.668  1.00 20.09 ? 636  GLU A O   1 
ATOM   4870 C  CB  . GLU A 1 635 ? 21.007 48.951 74.200  1.00 26.90 ? 636  GLU A CB  1 
ATOM   4871 C  CG  . GLU A 1 635 ? 19.889 49.810 74.716  1.00 33.58 ? 636  GLU A CG  1 
ATOM   4872 C  CD  . GLU A 1 635 ? 18.743 48.872 74.927  1.00 36.31 ? 636  GLU A CD  1 
ATOM   4873 O  OE1 . GLU A 1 635 ? 18.135 48.588 73.877  1.00 38.23 ? 636  GLU A OE1 1 
ATOM   4874 O  OE2 . GLU A 1 635 ? 18.537 48.438 76.083  1.00 37.19 ? 636  GLU A OE2 1 
ATOM   4875 N  N   . ASN A 1 636 ? 22.875 46.675 75.399  1.00 20.14 ? 637  ASN A N   1 
ATOM   4876 C  CA  . ASN A 1 636 ? 23.531 45.405 75.145  1.00 18.76 ? 637  ASN A CA  1 
ATOM   4877 C  C   . ASN A 1 636 ? 25.049 45.604 75.095  1.00 18.11 ? 637  ASN A C   1 
ATOM   4878 O  O   . ASN A 1 636 ? 25.796 45.175 74.203  1.00 17.05 ? 637  ASN A O   1 
ATOM   4879 C  CB  . ASN A 1 636 ? 22.968 44.828 73.830  1.00 17.94 ? 637  ASN A CB  1 
ATOM   4880 C  CG  . ASN A 1 636 ? 23.254 43.358 73.573  1.00 17.61 ? 637  ASN A CG  1 
ATOM   4881 O  OD1 . ASN A 1 636 ? 23.593 43.020 72.433  1.00 19.71 ? 637  ASN A OD1 1 
ATOM   4882 N  ND2 . ASN A 1 636 ? 23.130 42.412 74.505  1.00 16.93 ? 637  ASN A ND2 1 
ATOM   4883 N  N   . TYR A 1 637 ? 25.449 46.233 76.197  1.00 17.68 ? 638  TYR A N   1 
ATOM   4884 C  CA  . TYR A 1 637 ? 26.825 46.572 76.386  1.00 18.12 ? 638  TYR A CA  1 
ATOM   4885 C  C   . TYR A 1 637 ? 27.558 45.292 76.808  1.00 18.46 ? 638  TYR A C   1 
ATOM   4886 O  O   . TYR A 1 637 ? 27.136 44.546 77.700  1.00 18.90 ? 638  TYR A O   1 
ATOM   4887 C  CB  . TYR A 1 637 ? 26.926 47.666 77.452  1.00 17.07 ? 638  TYR A CB  1 
ATOM   4888 C  CG  . TYR A 1 637 ? 28.368 48.043 77.759  1.00 17.21 ? 638  TYR A CG  1 
ATOM   4889 C  CD1 . TYR A 1 637 ? 28.973 49.059 77.008  1.00 17.29 ? 638  TYR A CD1 1 
ATOM   4890 C  CD2 . TYR A 1 637 ? 29.095 47.362 78.770  1.00 17.37 ? 638  TYR A CD2 1 
ATOM   4891 C  CE1 . TYR A 1 637 ? 30.298 49.405 77.258  1.00 16.08 ? 638  TYR A CE1 1 
ATOM   4892 C  CE2 . TYR A 1 637 ? 30.420 47.707 79.022  1.00 16.84 ? 638  TYR A CE2 1 
ATOM   4893 C  CZ  . TYR A 1 637 ? 31.005 48.733 78.254  1.00 16.87 ? 638  TYR A CZ  1 
ATOM   4894 O  OH  . TYR A 1 637 ? 32.315 49.096 78.497  1.00 16.55 ? 638  TYR A OH  1 
ATOM   4895 N  N   . GLY A 1 638 ? 28.676 45.070 76.097  1.00 18.54 ? 639  GLY A N   1 
ATOM   4896 C  CA  . GLY A 1 638 ? 29.551 43.940 76.345  1.00 17.39 ? 639  GLY A CA  1 
ATOM   4897 C  C   . GLY A 1 638 ? 29.151 42.743 75.486  1.00 16.60 ? 639  GLY A C   1 
ATOM   4898 O  O   . GLY A 1 638 ? 29.589 41.629 75.787  1.00 16.65 ? 639  GLY A O   1 
ATOM   4899 N  N   . GLU A 1 639 ? 28.381 42.978 74.406  1.00 15.62 ? 640  GLU A N   1 
ATOM   4900 C  CA  . GLU A 1 639 ? 27.919 41.985 73.450  1.00 15.15 ? 640  GLU A CA  1 
ATOM   4901 C  C   . GLU A 1 639 ? 29.081 41.150 72.852  1.00 15.16 ? 640  GLU A C   1 
ATOM   4902 O  O   . GLU A 1 639 ? 30.168 41.683 72.614  1.00 16.08 ? 640  GLU A O   1 
ATOM   4903 C  CB  . GLU A 1 639 ? 27.171 42.764 72.371  1.00 14.13 ? 640  GLU A CB  1 
ATOM   4904 C  CG  . GLU A 1 639 ? 26.528 41.900 71.274  1.00 17.45 ? 640  GLU A CG  1 
ATOM   4905 C  CD  . GLU A 1 639 ? 26.152 42.610 69.980  1.00 18.23 ? 640  GLU A CD  1 
ATOM   4906 O  OE1 . GLU A 1 639 ? 25.821 43.798 70.008  1.00 20.90 ? 640  GLU A OE1 1 
ATOM   4907 O  OE2 . GLU A 1 639 ? 26.193 41.967 68.935  1.00 19.58 ? 640  GLU A OE2 1 
ATOM   4908 N  N   . GLY A 1 640 ? 28.988 39.845 72.621  1.00 15.04 ? 641  GLY A N   1 
ATOM   4909 C  CA  . GLY A 1 640 ? 30.003 39.135 71.837  1.00 16.49 ? 641  GLY A CA  1 
ATOM   4910 C  C   . GLY A 1 640 ? 30.752 38.104 72.648  1.00 17.28 ? 641  GLY A C   1 
ATOM   4911 O  O   . GLY A 1 640 ? 30.192 37.476 73.546  1.00 19.32 ? 641  GLY A O   1 
ATOM   4912 N  N   . ALA A 1 641 ? 31.901 38.061 72.454  1.00 16.44 ? 642  ALA A N   1 
ATOM   4913 C  CA  . ALA A 1 641 ? 32.853 37.221 73.059  1.00 15.39 ? 642  ALA A CA  1 
ATOM   4914 C  C   . ALA A 1 641 ? 32.922 37.226 74.630  1.00 15.68 ? 642  ALA A C   1 
ATOM   4915 O  O   . ALA A 1 641 ? 32.699 38.230 75.285  1.00 14.29 ? 642  ALA A O   1 
ATOM   4916 C  CB  . ALA A 1 641 ? 34.203 37.567 72.460  1.00 14.21 ? 642  ALA A CB  1 
ATOM   4917 N  N   . SER A 1 642 ? 33.221 36.232 75.394  1.00 16.18 ? 643  SER A N   1 
ATOM   4918 C  CA  . SER A 1 642 ? 33.354 36.030 76.694  1.00 16.40 ? 643  SER A CA  1 
ATOM   4919 C  C   . SER A 1 642 ? 34.674 36.413 77.373  1.00 16.75 ? 643  SER A C   1 
ATOM   4920 O  O   . SER A 1 642 ? 34.685 36.452 78.616  1.00 17.84 ? 643  SER A O   1 
ATOM   4921 C  CB  . SER A 1 642 ? 32.952 34.632 77.111  1.00 16.68 ? 643  SER A CB  1 
ATOM   4922 O  OG  . SER A 1 642 ? 33.835 33.720 76.443  1.00 18.65 ? 643  SER A OG  1 
ATOM   4923 N  N   . ARG A 1 643 ? 35.737 36.795 76.646  1.00 15.17 ? 644  ARG A N   1 
ATOM   4924 C  CA  . ARG A 1 643 ? 36.984 37.279 77.243  1.00 14.86 ? 644  ARG A CA  1 
ATOM   4925 C  C   . ARG A 1 643 ? 36.925 38.180 78.502  1.00 14.59 ? 644  ARG A C   1 
ATOM   4926 O  O   . ARG A 1 643 ? 36.520 39.346 78.457  1.00 14.76 ? 644  ARG A O   1 
ATOM   4927 C  CB  . ARG A 1 643 ? 37.810 37.990 76.100  1.00 14.99 ? 644  ARG A CB  1 
ATOM   4928 C  CG  . ARG A 1 643 ? 37.151 39.271 75.553  1.00 14.15 ? 644  ARG A CG  1 
ATOM   4929 C  CD  . ARG A 1 643 ? 37.898 39.851 74.379  1.00 14.52 ? 644  ARG A CD  1 
ATOM   4930 N  NE  . ARG A 1 643 ? 37.574 39.103 73.179  1.00 15.22 ? 644  ARG A NE  1 
ATOM   4931 C  CZ  . ARG A 1 643 ? 37.611 39.605 71.952  1.00 13.85 ? 644  ARG A CZ  1 
ATOM   4932 N  NH1 . ARG A 1 643 ? 37.886 40.891 71.750  1.00 12.82 ? 644  ARG A NH1 1 
ATOM   4933 N  NH2 . ARG A 1 643 ? 37.326 38.812 70.904  1.00 12.12 ? 644  ARG A NH2 1 
ATOM   4934 N  N   . GLU A 1 644 ? 37.273 37.670 79.698  1.00 14.46 ? 645  GLU A N   1 
ATOM   4935 C  CA  . GLU A 1 644 ? 37.309 38.511 80.915  1.00 13.80 ? 645  GLU A CA  1 
ATOM   4936 C  C   . GLU A 1 644 ? 38.263 39.701 80.980  1.00 13.42 ? 645  GLU A C   1 
ATOM   4937 O  O   . GLU A 1 644 ? 38.163 40.540 81.882  1.00 12.83 ? 645  GLU A O   1 
ATOM   4938 C  CB  . GLU A 1 644 ? 37.608 37.677 82.103  1.00 12.69 ? 645  GLU A CB  1 
ATOM   4939 C  CG  . GLU A 1 644 ? 38.980 37.044 82.024  1.00 13.96 ? 645  GLU A CG  1 
ATOM   4940 C  CD  . GLU A 1 644 ? 39.210 36.061 83.163  1.00 15.13 ? 645  GLU A CD  1 
ATOM   4941 O  OE1 . GLU A 1 644 ? 38.549 36.122 84.203  1.00 13.20 ? 645  GLU A OE1 1 
ATOM   4942 O  OE2 . GLU A 1 644 ? 40.053 35.195 82.991  1.00 14.40 ? 645  GLU A OE2 1 
ATOM   4943 N  N   . HIS A 1 645 ? 39.127 39.795 79.961  1.00 13.11 ? 646  HIS A N   1 
ATOM   4944 C  CA  . HIS A 1 645 ? 40.061 40.902 79.868  1.00 13.06 ? 646  HIS A CA  1 
ATOM   4945 C  C   . HIS A 1 645 ? 39.243 42.222 79.779  1.00 12.88 ? 646  HIS A C   1 
ATOM   4946 O  O   . HIS A 1 645 ? 39.669 43.217 80.337  1.00 11.94 ? 646  HIS A O   1 
ATOM   4947 C  CB  . HIS A 1 645 ? 40.925 40.605 78.620  1.00 13.88 ? 646  HIS A CB  1 
ATOM   4948 C  CG  . HIS A 1 645 ? 41.680 39.262 78.728  1.00 14.61 ? 646  HIS A CG  1 
ATOM   4949 N  ND1 . HIS A 1 645 ? 41.214 37.993 78.704  1.00 13.99 ? 646  HIS A ND1 1 
ATOM   4950 C  CD2 . HIS A 1 645 ? 43.030 39.195 79.009  1.00 13.99 ? 646  HIS A CD2 1 
ATOM   4951 C  CE1 . HIS A 1 645 ? 42.217 37.202 78.974  1.00 14.40 ? 646  HIS A CE1 1 
ATOM   4952 N  NE2 . HIS A 1 645 ? 43.305 37.937 79.158  1.00 15.71 ? 646  HIS A NE2 1 
ATOM   4953 N  N   . SER A 1 646 ? 38.041 42.278 79.154  1.00 12.35 ? 647  SER A N   1 
ATOM   4954 C  CA  . SER A 1 646 ? 37.239 43.466 79.058  1.00 12.28 ? 647  SER A CA  1 
ATOM   4955 C  C   . SER A 1 646 ? 36.761 43.902 80.374  1.00 11.96 ? 647  SER A C   1 
ATOM   4956 O  O   . SER A 1 646 ? 36.292 45.039 80.426  1.00 13.37 ? 647  SER A O   1 
ATOM   4957 C  CB  . SER A 1 646 ? 35.952 43.356 78.271  1.00 13.15 ? 647  SER A CB  1 
ATOM   4958 O  OG  . SER A 1 646 ? 36.222 42.877 76.975  1.00 17.95 ? 647  SER A OG  1 
ATOM   4959 N  N   . ALA A 1 647 ? 36.770 43.061 81.404  1.00 10.54 ? 648  ALA A N   1 
ATOM   4960 C  CA  . ALA A 1 647 ? 36.437 43.558 82.741  1.00 9.86  ? 648  ALA A CA  1 
ATOM   4961 C  C   . ALA A 1 647 ? 37.699 43.731 83.625  1.00 9.93  ? 648  ALA A C   1 
ATOM   4962 O  O   . ALA A 1 647 ? 37.682 44.497 84.580  1.00 9.38  ? 648  ALA A O   1 
ATOM   4963 C  CB  . ALA A 1 647 ? 35.529 42.608 83.451  1.00 8.12  ? 648  ALA A CB  1 
ATOM   4964 N  N   . LEU A 1 648 ? 38.824 43.067 83.312  1.00 10.44 ? 649  LEU A N   1 
ATOM   4965 C  CA  . LEU A 1 648 ? 40.020 43.075 84.142  1.00 11.59 ? 649  LEU A CA  1 
ATOM   4966 C  C   . LEU A 1 648 ? 40.755 44.350 83.828  1.00 11.58 ? 649  LEU A C   1 
ATOM   4967 O  O   . LEU A 1 648 ? 41.253 45.037 84.739  1.00 11.20 ? 649  LEU A O   1 
ATOM   4968 C  CB  . LEU A 1 648 ? 40.981 41.897 83.860  1.00 11.05 ? 649  LEU A CB  1 
ATOM   4969 C  CG  . LEU A 1 648 ? 40.865 40.490 84.485  1.00 11.76 ? 649  LEU A CG  1 
ATOM   4970 C  CD1 . LEU A 1 648 ? 41.786 39.602 83.674  1.00 10.67 ? 649  LEU A CD1 1 
ATOM   4971 C  CD2 . LEU A 1 648 ? 41.390 40.375 85.914  1.00 10.27 ? 649  LEU A CD2 1 
ATOM   4972 N  N   . GLU A 1 649 ? 40.727 44.645 82.523  1.00 11.27 ? 650  GLU A N   1 
ATOM   4973 C  CA  . GLU A 1 649 ? 41.396 45.820 82.051  1.00 12.35 ? 650  GLU A CA  1 
ATOM   4974 C  C   . GLU A 1 649 ? 40.752 47.116 82.560  1.00 13.51 ? 650  GLU A C   1 
ATOM   4975 O  O   . GLU A 1 649 ? 41.580 47.920 83.005  1.00 15.26 ? 650  GLU A O   1 
ATOM   4976 C  CB  . GLU A 1 649 ? 41.438 45.844 80.564  1.00 11.32 ? 650  GLU A CB  1 
ATOM   4977 C  CG  . GLU A 1 649 ? 42.336 44.903 79.832  1.00 11.39 ? 650  GLU A CG  1 
ATOM   4978 C  CD  . GLU A 1 649 ? 42.150 45.021 78.306  1.00 13.44 ? 650  GLU A CD  1 
ATOM   4979 O  OE1 . GLU A 1 649 ? 42.118 46.150 77.806  1.00 13.80 ? 650  GLU A OE1 1 
ATOM   4980 O  OE2 . GLU A 1 649 ? 42.025 44.000 77.602  1.00 12.23 ? 650  GLU A OE2 1 
ATOM   4981 N  N   . PRO A 1 650 ? 39.431 47.492 82.642  1.00 14.03 ? 651  PRO A N   1 
ATOM   4982 C  CA  . PRO A 1 650 ? 39.013 48.704 83.336  1.00 12.44 ? 651  PRO A CA  1 
ATOM   4983 C  C   . PRO A 1 650 ? 39.337 48.638 84.794  1.00 11.92 ? 651  PRO A C   1 
ATOM   4984 O  O   . PRO A 1 650 ? 39.494 49.703 85.356  1.00 11.47 ? 651  PRO A O   1 
ATOM   4985 C  CB  . PRO A 1 650 ? 37.509 48.883 83.071  1.00 12.30 ? 651  PRO A CB  1 
ATOM   4986 C  CG  . PRO A 1 650 ? 37.058 47.630 82.391  1.00 13.10 ? 651  PRO A CG  1 
ATOM   4987 C  CD  . PRO A 1 650 ? 38.351 47.191 81.681  1.00 14.32 ? 651  PRO A CD  1 
ATOM   4988 N  N   . ARG A 1 651 ? 39.490 47.482 85.444  1.00 12.18 ? 652  ARG A N   1 
ATOM   4989 C  CA  . ARG A 1 651 ? 39.847 47.457 86.859  1.00 12.55 ? 652  ARG A CA  1 
ATOM   4990 C  C   . ARG A 1 651 ? 41.326 47.850 87.085  1.00 13.89 ? 652  ARG A C   1 
ATOM   4991 O  O   . ARG A 1 651 ? 41.636 48.591 88.033  1.00 14.54 ? 652  ARG A O   1 
ATOM   4992 C  CB  . ARG A 1 651 ? 39.579 46.053 87.382  1.00 12.62 ? 652  ARG A CB  1 
ATOM   4993 C  CG  . ARG A 1 651 ? 39.667 45.846 88.886  1.00 11.55 ? 652  ARG A CG  1 
ATOM   4994 C  CD  . ARG A 1 651 ? 38.794 46.801 89.621  1.00 10.48 ? 652  ARG A CD  1 
ATOM   4995 N  NE  . ARG A 1 651 ? 38.612 46.274 90.937  1.00 13.09 ? 652  ARG A NE  1 
ATOM   4996 C  CZ  . ARG A 1 651 ? 39.070 46.856 92.047  1.00 16.01 ? 652  ARG A CZ  1 
ATOM   4997 N  NH1 . ARG A 1 651 ? 39.753 47.988 91.977  1.00 17.30 ? 652  ARG A NH1 1 
ATOM   4998 N  NH2 . ARG A 1 651 ? 38.834 46.303 93.247  1.00 16.71 ? 652  ARG A NH2 1 
ATOM   4999 N  N   . HIS A 1 652 ? 42.232 47.392 86.197  1.00 12.63 ? 653  HIS A N   1 
ATOM   5000 C  CA  . HIS A 1 652 ? 43.629 47.654 86.306  1.00 12.05 ? 653  HIS A CA  1 
ATOM   5001 C  C   . HIS A 1 652 ? 43.829 49.115 86.045  1.00 12.83 ? 653  HIS A C   1 
ATOM   5002 O  O   . HIS A 1 652 ? 44.549 49.739 86.787  1.00 13.36 ? 653  HIS A O   1 
ATOM   5003 C  CB  . HIS A 1 652 ? 44.312 46.784 85.295  1.00 12.88 ? 653  HIS A CB  1 
ATOM   5004 C  CG  . HIS A 1 652 ? 45.825 46.912 85.242  1.00 13.40 ? 653  HIS A CG  1 
ATOM   5005 N  ND1 . HIS A 1 652 ? 46.488 47.350 84.149  1.00 14.59 ? 653  HIS A ND1 1 
ATOM   5006 C  CD2 . HIS A 1 652 ? 46.705 46.659 86.272  1.00 11.69 ? 653  HIS A CD2 1 
ATOM   5007 C  CE1 . HIS A 1 652 ? 47.743 47.396 84.513  1.00 12.67 ? 653  HIS A CE1 1 
ATOM   5008 N  NE2 . HIS A 1 652 ? 47.862 46.985 85.755  1.00 11.07 ? 653  HIS A NE2 1 
ATOM   5009 N  N   . LEU A 1 653 ? 43.251 49.764 85.047  1.00 13.99 ? 654  LEU A N   1 
ATOM   5010 C  CA  . LEU A 1 653 ? 43.475 51.182 84.830  1.00 13.96 ? 654  LEU A CA  1 
ATOM   5011 C  C   . LEU A 1 653 ? 42.682 52.174 85.709  1.00 15.50 ? 654  LEU A C   1 
ATOM   5012 O  O   . LEU A 1 653 ? 42.652 53.380 85.440  1.00 15.65 ? 654  LEU A O   1 
ATOM   5013 C  CB  . LEU A 1 653 ? 43.260 51.411 83.330  1.00 12.39 ? 654  LEU A CB  1 
ATOM   5014 C  CG  . LEU A 1 653 ? 44.211 50.752 82.294  1.00 11.68 ? 654  LEU A CG  1 
ATOM   5015 C  CD1 . LEU A 1 653 ? 44.068 51.461 80.949  1.00 7.78  ? 654  LEU A CD1 1 
ATOM   5016 C  CD2 . LEU A 1 653 ? 45.683 50.895 82.720  1.00 12.37 ? 654  LEU A CD2 1 
ATOM   5017 N  N   . GLY A 1 654 ? 42.104 51.736 86.848  1.00 16.27 ? 655  GLY A N   1 
ATOM   5018 C  CA  . GLY A 1 654 ? 41.451 52.624 87.798  1.00 16.63 ? 655  GLY A CA  1 
ATOM   5019 C  C   . GLY A 1 654 ? 39.945 52.787 87.715  1.00 17.78 ? 655  GLY A C   1 
ATOM   5020 O  O   . GLY A 1 654 ? 39.414 53.574 88.511  1.00 19.85 ? 655  GLY A O   1 
ATOM   5021 N  N   . GLY A 1 655 ? 39.251 52.097 86.779  1.00 18.98 ? 656  GLY A N   1 
ATOM   5022 C  CA  . GLY A 1 655 ? 37.798 52.102 86.556  1.00 17.39 ? 656  GLY A CA  1 
ATOM   5023 C  C   . GLY A 1 655 ? 37.054 51.690 87.775  1.00 17.94 ? 656  GLY A C   1 
ATOM   5024 O  O   . GLY A 1 655 ? 37.610 50.888 88.510  1.00 18.28 ? 656  GLY A O   1 
ATOM   5025 N  N   . ARG A 1 656 ? 35.825 52.181 88.010  1.00 18.67 ? 657  ARG A N   1 
ATOM   5026 C  CA  . ARG A 1 656 ? 35.101 51.871 89.257  1.00 18.47 ? 657  ARG A CA  1 
ATOM   5027 C  C   . ARG A 1 656 ? 33.715 51.260 89.101  1.00 16.30 ? 657  ARG A C   1 
ATOM   5028 O  O   . ARG A 1 656 ? 33.314 50.386 89.850  1.00 14.75 ? 657  ARG A O   1 
ATOM   5029 C  CB  . ARG A 1 656 ? 34.974 53.145 90.084  1.00 21.60 ? 657  ARG A CB  1 
ATOM   5030 C  CG  . ARG A 1 656 ? 35.457 53.008 91.493  1.00 25.46 ? 657  ARG A CG  1 
ATOM   5031 C  CD  . ARG A 1 656 ? 36.977 52.772 91.636  1.00 30.28 ? 657  ARG A CD  1 
ATOM   5032 N  NE  . ARG A 1 656 ? 37.170 52.010 92.875  1.00 34.65 ? 657  ARG A NE  1 
ATOM   5033 C  CZ  . ARG A 1 656 ? 38.352 51.620 93.334  1.00 37.56 ? 657  ARG A CZ  1 
ATOM   5034 N  NH1 . ARG A 1 656 ? 39.486 51.919 92.707  1.00 38.81 ? 657  ARG A NH1 1 
ATOM   5035 N  NH2 . ARG A 1 656 ? 38.404 50.901 94.456  1.00 39.60 ? 657  ARG A NH2 1 
ATOM   5036 N  N   . ALA A 1 657 ? 33.009 51.655 88.043  1.00 15.48 ? 658  ALA A N   1 
ATOM   5037 C  CA  . ALA A 1 657 ? 31.619 51.292 87.774  1.00 13.83 ? 658  ALA A CA  1 
ATOM   5038 C  C   . ALA A 1 657 ? 31.395 51.505 86.291  1.00 13.14 ? 658  ALA A C   1 
ATOM   5039 O  O   . ALA A 1 657 ? 32.063 52.377 85.712  1.00 13.76 ? 658  ALA A O   1 
ATOM   5040 C  CB  . ALA A 1 657 ? 30.610 52.196 88.483  1.00 10.79 ? 658  ALA A CB  1 
ATOM   5041 N  N   . ILE A 1 658 ? 30.484 50.726 85.688  1.00 11.68 ? 659  ILE A N   1 
ATOM   5042 C  CA  . ILE A 1 658 ? 30.122 50.910 84.294  1.00 12.50 ? 659  ILE A CA  1 
ATOM   5043 C  C   . ILE A 1 658 ? 28.611 51.108 84.343  1.00 12.84 ? 659  ILE A C   1 
ATOM   5044 O  O   . ILE A 1 658 ? 27.955 50.333 85.024  1.00 14.85 ? 659  ILE A O   1 
ATOM   5045 C  CB  . ILE A 1 658 ? 30.471 49.651 83.430  1.00 13.54 ? 659  ILE A CB  1 
ATOM   5046 C  CG1 . ILE A 1 658 ? 31.942 49.232 83.573  1.00 12.83 ? 659  ILE A CG1 1 
ATOM   5047 C  CG2 . ILE A 1 658 ? 30.152 49.980 81.953  1.00 13.84 ? 659  ILE A CG2 1 
ATOM   5048 C  CD1 . ILE A 1 658 ? 32.990 50.123 82.862  1.00 10.81 ? 659  ILE A CD1 1 
ATOM   5049 N  N   . ILE A 1 659 ? 27.965 52.069 83.661  1.00 12.96 ? 660  ILE A N   1 
ATOM   5050 C  CA  . ILE A 1 659 ? 26.543 52.308 83.788  1.00 12.16 ? 660  ILE A CA  1 
ATOM   5051 C  C   . ILE A 1 659 ? 26.026 52.284 82.383  1.00 11.63 ? 660  ILE A C   1 
ATOM   5052 O  O   . ILE A 1 659 ? 26.561 52.964 81.516  1.00 11.22 ? 660  ILE A O   1 
ATOM   5053 C  CB  . ILE A 1 659 ? 26.315 53.669 84.485  1.00 13.95 ? 660  ILE A CB  1 
ATOM   5054 C  CG1 . ILE A 1 659 ? 26.874 53.591 85.917  1.00 15.47 ? 660  ILE A CG1 1 
ATOM   5055 C  CG2 . ILE A 1 659 ? 24.816 54.002 84.562  1.00 13.95 ? 660  ILE A CG2 1 
ATOM   5056 C  CD1 . ILE A 1 659 ? 27.108 54.992 86.561  1.00 18.06 ? 660  ILE A CD1 1 
ATOM   5057 N  N   . THR A 1 660 ? 24.995 51.465 82.144  1.00 11.45 ? 661  THR A N   1 
ATOM   5058 C  CA  . THR A 1 660 ? 24.383 51.257 80.809  1.00 10.30 ? 661  THR A CA  1 
ATOM   5059 C  C   . THR A 1 660 ? 22.847 51.102 80.885  1.00 11.21 ? 661  THR A C   1 
ATOM   5060 O  O   . THR A 1 660 ? 22.243 50.987 81.972  1.00 10.29 ? 661  THR A O   1 
ATOM   5061 C  CB  . THR A 1 660 ? 24.967 49.951 80.143  1.00 9.69  ? 661  THR A CB  1 
ATOM   5062 O  OG1 . THR A 1 660 ? 24.565 48.870 80.996  1.00 7.62  ? 661  THR A OG1 1 
ATOM   5063 C  CG2 . THR A 1 660 ? 26.511 49.952 79.997  1.00 7.24  ? 661  THR A CG2 1 
ATOM   5064 N  N   . LYS A 1 661 ? 22.234 51.072 79.698  1.00 11.28 ? 662  LYS A N   1 
ATOM   5065 C  CA  . LYS A 1 661 ? 20.843 50.695 79.549  1.00 13.41 ? 662  LYS A CA  1 
ATOM   5066 C  C   . LYS A 1 661 ? 20.625 49.180 79.790  1.00 13.23 ? 662  LYS A C   1 
ATOM   5067 O  O   . LYS A 1 661 ? 19.737 48.753 80.530  1.00 12.80 ? 662  LYS A O   1 
ATOM   5068 C  CB  . LYS A 1 661 ? 20.402 51.076 78.153  1.00 14.40 ? 662  LYS A CB  1 
ATOM   5069 C  CG  . LYS A 1 661 ? 20.015 52.523 78.090  1.00 15.43 ? 662  LYS A CG  1 
ATOM   5070 C  CD  . LYS A 1 661 ? 20.016 52.832 76.646  1.00 17.23 ? 662  LYS A CD  1 
ATOM   5071 C  CE  . LYS A 1 661 ? 19.730 54.318 76.396  1.00 20.00 ? 662  LYS A CE  1 
ATOM   5072 N  NZ  . LYS A 1 661 ? 19.927 54.601 74.973  1.00 22.20 ? 662  LYS A NZ  1 
ATOM   5073 N  N   . SER A 1 662 ? 21.387 48.326 79.124  1.00 13.06 ? 663  SER A N   1 
ATOM   5074 C  CA  . SER A 1 662 ? 21.397 46.904 79.456  1.00 13.83 ? 663  SER A CA  1 
ATOM   5075 C  C   . SER A 1 662 ? 22.793 46.351 79.287  1.00 14.13 ? 663  SER A C   1 
ATOM   5076 O  O   . SER A 1 662 ? 23.692 46.993 78.743  1.00 14.73 ? 663  SER A O   1 
ATOM   5077 C  CB  . SER A 1 662 ? 20.487 46.098 78.569  1.00 12.62 ? 663  SER A CB  1 
ATOM   5078 O  OG  . SER A 1 662 ? 20.565 46.502 77.200  1.00 14.85 ? 663  SER A OG  1 
ATOM   5079 N  N   . PHE A 1 663 ? 23.023 45.169 79.837  1.00 16.08 ? 664  PHE A N   1 
ATOM   5080 C  CA  . PHE A 1 663 ? 24.294 44.432 79.689  1.00 17.34 ? 664  PHE A CA  1 
ATOM   5081 C  C   . PHE A 1 663 ? 24.032 43.102 78.974  1.00 17.21 ? 664  PHE A C   1 
ATOM   5082 O  O   . PHE A 1 663 ? 22.924 42.547 78.996  1.00 15.76 ? 664  PHE A O   1 
ATOM   5083 C  CB  . PHE A 1 663 ? 24.959 44.078 81.066  1.00 17.22 ? 664  PHE A CB  1 
ATOM   5084 C  CG  . PHE A 1 663 ? 25.577 45.256 81.813  1.00 18.85 ? 664  PHE A CG  1 
ATOM   5085 C  CD1 . PHE A 1 663 ? 26.879 45.685 81.473  1.00 17.51 ? 664  PHE A CD1 1 
ATOM   5086 C  CD2 . PHE A 1 663 ? 24.831 45.950 82.797  1.00 17.82 ? 664  PHE A CD2 1 
ATOM   5087 C  CE1 . PHE A 1 663 ? 27.415 46.805 82.109  1.00 16.03 ? 664  PHE A CE1 1 
ATOM   5088 C  CE2 . PHE A 1 663 ? 25.400 47.068 83.416  1.00 16.63 ? 664  PHE A CE2 1 
ATOM   5089 C  CZ  . PHE A 1 663 ? 26.683 47.493 83.070  1.00 15.85 ? 664  PHE A CZ  1 
ATOM   5090 N  N   . ALA A 1 664 ? 25.098 42.583 78.329  1.00 17.60 ? 665  ALA A N   1 
ATOM   5091 C  CA  . ALA A 1 664 ? 25.072 41.209 77.841  1.00 16.14 ? 665  ALA A CA  1 
ATOM   5092 C  C   . ALA A 1 664 ? 25.535 40.387 79.060  1.00 16.69 ? 665  ALA A C   1 
ATOM   5093 O  O   . ALA A 1 664 ? 26.416 40.782 79.831  1.00 18.56 ? 665  ALA A O   1 
ATOM   5094 C  CB  . ALA A 1 664 ? 26.038 41.017 76.751  1.00 14.40 ? 665  ALA A CB  1 
ATOM   5095 N  N   . ARG A 1 665 ? 24.936 39.218 79.262  1.00 15.31 ? 666  ARG A N   1 
ATOM   5096 C  CA  . ARG A 1 665 ? 25.122 38.348 80.402  1.00 11.78 ? 666  ARG A CA  1 
ATOM   5097 C  C   . ARG A 1 665 ? 26.493 38.032 80.872  1.00 11.25 ? 666  ARG A C   1 
ATOM   5098 O  O   . ARG A 1 665 ? 26.772 38.209 82.070  1.00 9.55  ? 666  ARG A O   1 
ATOM   5099 C  CB  . ARG A 1 665 ? 24.393 37.065 80.095  1.00 11.34 ? 666  ARG A CB  1 
ATOM   5100 C  CG  . ARG A 1 665 ? 24.337 35.949 81.141  1.00 11.00 ? 666  ARG A CG  1 
ATOM   5101 C  CD  . ARG A 1 665 ? 24.036 34.575 80.442  1.00 12.89 ? 666  ARG A CD  1 
ATOM   5102 N  NE  . ARG A 1 665 ? 25.003 33.652 80.997  1.00 14.54 ? 666  ARG A NE  1 
ATOM   5103 C  CZ  . ARG A 1 665 ? 25.933 32.962 80.374  1.00 13.55 ? 666  ARG A CZ  1 
ATOM   5104 N  NH1 . ARG A 1 665 ? 26.022 32.843 79.071  1.00 12.26 ? 666  ARG A NH1 1 
ATOM   5105 N  NH2 . ARG A 1 665 ? 26.781 32.353 81.172  1.00 13.86 ? 666  ARG A NH2 1 
ATOM   5106 N  N   . ILE A 1 666 ? 27.319 37.594 79.907  1.00 9.93  ? 667  ILE A N   1 
ATOM   5107 C  CA  . ILE A 1 666 ? 28.598 37.095 80.345  1.00 10.83 ? 667  ILE A CA  1 
ATOM   5108 C  C   . ILE A 1 666 ? 29.449 38.280 80.752  1.00 11.93 ? 667  ILE A C   1 
ATOM   5109 O  O   . ILE A 1 666 ? 30.052 38.185 81.817  1.00 12.87 ? 667  ILE A O   1 
ATOM   5110 C  CB  . ILE A 1 666 ? 29.336 36.302 79.274  1.00 9.95  ? 667  ILE A CB  1 
ATOM   5111 C  CG1 . ILE A 1 666 ? 28.554 35.107 78.819  1.00 9.05  ? 667  ILE A CG1 1 
ATOM   5112 C  CG2 . ILE A 1 666 ? 30.591 35.703 79.912  1.00 8.73  ? 667  ILE A CG2 1 
ATOM   5113 C  CD1 . ILE A 1 666 ? 29.155 34.369 77.612  1.00 9.11  ? 667  ILE A CD1 1 
ATOM   5114 N  N   . HIS A 1 667 ? 29.460 39.420 80.031  1.00 12.67 ? 668  HIS A N   1 
ATOM   5115 C  CA  . HIS A 1 667 ? 30.203 40.583 80.467  1.00 11.38 ? 668  HIS A CA  1 
ATOM   5116 C  C   . HIS A 1 667 ? 29.754 41.080 81.830  1.00 11.03 ? 668  HIS A C   1 
ATOM   5117 O  O   . HIS A 1 667 ? 30.629 41.438 82.583  1.00 10.54 ? 668  HIS A O   1 
ATOM   5118 C  CB  . HIS A 1 667 ? 30.055 41.635 79.403  1.00 11.60 ? 668  HIS A CB  1 
ATOM   5119 C  CG  . HIS A 1 667 ? 31.068 42.719 79.655  1.00 12.73 ? 668  HIS A CG  1 
ATOM   5120 N  ND1 . HIS A 1 667 ? 32.348 42.480 79.863  1.00 13.44 ? 668  HIS A ND1 1 
ATOM   5121 C  CD2 . HIS A 1 667 ? 30.842 44.069 79.823  1.00 12.95 ? 668  HIS A CD2 1 
ATOM   5122 C  CE1 . HIS A 1 667 ? 32.928 43.632 80.179  1.00 14.22 ? 668  HIS A CE1 1 
ATOM   5123 N  NE2 . HIS A 1 667 ? 32.010 44.578 80.149  1.00 13.03 ? 668  HIS A NE2 1 
ATOM   5124 N  N   . GLU A 1 668 ? 28.476 41.086 82.224  1.00 11.57 ? 669  GLU A N   1 
ATOM   5125 C  CA  . GLU A 1 668 ? 27.996 41.540 83.527  1.00 12.53 ? 669  GLU A CA  1 
ATOM   5126 C  C   . GLU A 1 668 ? 28.437 40.659 84.681  1.00 12.80 ? 669  GLU A C   1 
ATOM   5127 O  O   . GLU A 1 668 ? 28.789 41.154 85.757  1.00 13.84 ? 669  GLU A O   1 
ATOM   5128 C  CB  . GLU A 1 668 ? 26.476 41.612 83.524  1.00 13.36 ? 669  GLU A CB  1 
ATOM   5129 C  CG  . GLU A 1 668 ? 25.935 42.239 84.789  1.00 16.18 ? 669  GLU A CG  1 
ATOM   5130 C  CD  . GLU A 1 668 ? 24.437 42.084 85.123  1.00 18.71 ? 669  GLU A CD  1 
ATOM   5131 O  OE1 . GLU A 1 668 ? 23.674 41.428 84.396  1.00 20.81 ? 669  GLU A OE1 1 
ATOM   5132 O  OE2 . GLU A 1 668 ? 24.029 42.627 86.147  1.00 17.80 ? 669  GLU A OE2 1 
ATOM   5133 N  N   . THR A 1 669 ? 28.435 39.347 84.467  1.00 11.93 ? 670  THR A N   1 
ATOM   5134 C  CA  . THR A 1 669 ? 28.990 38.426 85.424  1.00 12.73 ? 670  THR A CA  1 
ATOM   5135 C  C   . THR A 1 669 ? 30.505 38.674 85.563  1.00 12.94 ? 670  THR A C   1 
ATOM   5136 O  O   . THR A 1 669 ? 30.979 38.760 86.700  1.00 13.64 ? 670  THR A O   1 
ATOM   5137 C  CB  . THR A 1 669 ? 28.723 36.962 84.977  1.00 14.46 ? 670  THR A CB  1 
ATOM   5138 O  OG1 . THR A 1 669 ? 27.352 36.806 84.549  1.00 16.92 ? 670  THR A OG1 1 
ATOM   5139 C  CG2 . THR A 1 669 ? 28.965 36.022 86.152  1.00 13.86 ? 670  THR A CG2 1 
ATOM   5140 N  N   . ASN A 1 670 ? 31.313 38.780 84.484  1.00 12.22 ? 671  ASN A N   1 
ATOM   5141 C  CA  . ASN A 1 670 ? 32.740 39.137 84.542  1.00 11.88 ? 671  ASN A CA  1 
ATOM   5142 C  C   . ASN A 1 670 ? 32.983 40.492 85.199  1.00 11.89 ? 671  ASN A C   1 
ATOM   5143 O  O   . ASN A 1 670 ? 33.908 40.531 85.993  1.00 12.26 ? 671  ASN A O   1 
ATOM   5144 C  CB  . ASN A 1 670 ? 33.397 39.176 83.122  1.00 10.88 ? 671  ASN A CB  1 
ATOM   5145 C  CG  . ASN A 1 670 ? 33.426 37.832 82.406  1.00 9.57  ? 671  ASN A CG  1 
ATOM   5146 O  OD1 . ASN A 1 670 ? 33.619 37.702 81.190  1.00 9.39  ? 671  ASN A OD1 1 
ATOM   5147 N  ND2 . ASN A 1 670 ? 33.277 36.758 83.162  1.00 7.73  ? 671  ASN A ND2 1 
ATOM   5148 N  N   . LEU A 1 671 ? 32.211 41.589 84.971  1.00 12.06 ? 672  LEU A N   1 
ATOM   5149 C  CA  . LEU A 1 671 ? 32.377 42.822 85.709  1.00 11.32 ? 672  LEU A CA  1 
ATOM   5150 C  C   . LEU A 1 671 ? 32.187 42.608 87.196  1.00 11.78 ? 672  LEU A C   1 
ATOM   5151 O  O   . LEU A 1 671 ? 33.067 43.036 87.954  1.00 12.49 ? 672  LEU A O   1 
ATOM   5152 C  CB  . LEU A 1 671 ? 31.410 43.845 85.241  1.00 10.44 ? 672  LEU A CB  1 
ATOM   5153 C  CG  . LEU A 1 671 ? 31.604 44.465 83.849  1.00 13.26 ? 672  LEU A CG  1 
ATOM   5154 C  CD1 . LEU A 1 671 ? 30.442 45.408 83.587  1.00 11.65 ? 672  LEU A CD1 1 
ATOM   5155 C  CD2 . LEU A 1 671 ? 32.910 45.288 83.754  1.00 11.46 ? 672  LEU A CD2 1 
ATOM   5156 N  N   . LYS A 1 672 ? 31.154 41.890 87.685  1.00 11.58 ? 673  LYS A N   1 
ATOM   5157 C  CA  . LYS A 1 672 ? 30.990 41.739 89.140  1.00 11.26 ? 673  LYS A CA  1 
ATOM   5158 C  C   . LYS A 1 672 ? 32.115 40.879 89.719  1.00 12.63 ? 673  LYS A C   1 
ATOM   5159 O  O   . LYS A 1 672 ? 32.525 41.070 90.870  1.00 14.11 ? 673  LYS A O   1 
ATOM   5160 C  CB  . LYS A 1 672 ? 29.622 41.076 89.508  1.00 11.59 ? 673  LYS A CB  1 
ATOM   5161 C  CG  . LYS A 1 672 ? 28.298 41.532 88.859  1.00 10.84 ? 673  LYS A CG  1 
ATOM   5162 C  CD  . LYS A 1 672 ? 27.188 40.608 89.272  1.00 11.38 ? 673  LYS A CD  1 
ATOM   5163 C  CE  . LYS A 1 672 ? 25.913 40.960 88.518  1.00 14.53 ? 673  LYS A CE  1 
ATOM   5164 N  NZ  . LYS A 1 672 ? 24.821 40.005 88.766  1.00 15.14 ? 673  LYS A NZ  1 
ATOM   5165 N  N   . LYS A 1 673 ? 32.683 39.939 88.936  1.00 13.20 ? 674  LYS A N   1 
ATOM   5166 C  CA  . LYS A 1 673 ? 33.744 39.041 89.403  1.00 13.64 ? 674  LYS A CA  1 
ATOM   5167 C  C   . LYS A 1 673 ? 35.046 39.722 89.776  1.00 15.24 ? 674  LYS A C   1 
ATOM   5168 O  O   . LYS A 1 673 ? 35.724 39.309 90.699  1.00 15.98 ? 674  LYS A O   1 
ATOM   5169 C  CB  . LYS A 1 673 ? 34.063 38.023 88.347  1.00 12.58 ? 674  LYS A CB  1 
ATOM   5170 C  CG  . LYS A 1 673 ? 33.164 36.816 88.261  1.00 12.40 ? 674  LYS A CG  1 
ATOM   5171 C  CD  . LYS A 1 673 ? 33.351 36.012 89.549  1.00 14.00 ? 674  LYS A CD  1 
ATOM   5172 C  CE  . LYS A 1 673 ? 32.925 34.540 89.426  1.00 14.23 ? 674  LYS A CE  1 
ATOM   5173 N  NZ  . LYS A 1 673 ? 33.175 33.722 90.596  1.00 16.25 ? 674  LYS A NZ  1 
ATOM   5174 N  N   . GLN A 1 674 ? 35.401 40.773 89.024  1.00 16.26 ? 675  GLN A N   1 
ATOM   5175 C  CA  . GLN A 1 674 ? 36.600 41.594 89.182  1.00 16.19 ? 675  GLN A CA  1 
ATOM   5176 C  C   . GLN A 1 674 ? 36.440 42.790 90.077  1.00 15.84 ? 675  GLN A C   1 
ATOM   5177 O  O   . GLN A 1 674 ? 37.287 43.663 89.994  1.00 15.31 ? 675  GLN A O   1 
ATOM   5178 C  CB  . GLN A 1 674 ? 37.104 42.123 87.821  1.00 16.47 ? 675  GLN A CB  1 
ATOM   5179 C  CG  . GLN A 1 674 ? 37.465 41.030 86.823  1.00 17.10 ? 675  GLN A CG  1 
ATOM   5180 C  CD  . GLN A 1 674 ? 38.276 39.880 87.424  1.00 18.33 ? 675  GLN A CD  1 
ATOM   5181 O  OE1 . GLN A 1 674 ? 38.144 38.747 86.983  1.00 19.86 ? 675  GLN A OE1 1 
ATOM   5182 N  NE2 . GLN A 1 674 ? 39.105 39.995 88.448  1.00 15.43 ? 675  GLN A NE2 1 
ATOM   5183 N  N   . GLY A 1 675 ? 35.368 42.906 90.860  1.00 15.89 ? 676  GLY A N   1 
ATOM   5184 C  CA  . GLY A 1 675 ? 35.252 43.993 91.829  1.00 15.94 ? 676  GLY A CA  1 
ATOM   5185 C  C   . GLY A 1 675 ? 34.594 45.281 91.366  1.00 15.88 ? 676  GLY A C   1 
ATOM   5186 O  O   . GLY A 1 675 ? 34.426 46.241 92.129  1.00 15.76 ? 676  GLY A O   1 
ATOM   5187 N  N   . LEU A 1 676 ? 34.184 45.283 90.097  1.00 15.99 ? 677  LEU A N   1 
ATOM   5188 C  CA  . LEU A 1 676 ? 33.505 46.446 89.533  1.00 15.25 ? 677  LEU A CA  1 
ATOM   5189 C  C   . LEU A 1 676 ? 32.003 46.399 89.810  1.00 14.53 ? 677  LEU A C   1 
ATOM   5190 O  O   . LEU A 1 676 ? 31.488 45.422 90.346  1.00 14.94 ? 677  LEU A O   1 
ATOM   5191 C  CB  . LEU A 1 676 ? 33.787 46.533 88.012  1.00 14.25 ? 677  LEU A CB  1 
ATOM   5192 C  CG  . LEU A 1 676 ? 35.191 47.027 87.620  1.00 13.54 ? 677  LEU A CG  1 
ATOM   5193 C  CD1 . LEU A 1 676 ? 35.746 46.146 86.568  1.00 14.38 ? 677  LEU A CD1 1 
ATOM   5194 C  CD2 . LEU A 1 676 ? 35.139 48.372 86.984  1.00 11.84 ? 677  LEU A CD2 1 
ATOM   5195 N  N   . LEU A 1 677 ? 31.319 47.519 89.591  1.00 13.93 ? 678  LEU A N   1 
ATOM   5196 C  CA  . LEU A 1 677 ? 29.914 47.602 89.779  1.00 13.37 ? 678  LEU A CA  1 
ATOM   5197 C  C   . LEU A 1 677 ? 29.232 47.728 88.435  1.00 14.27 ? 678  LEU A C   1 
ATOM   5198 O  O   . LEU A 1 677 ? 29.188 48.857 87.939  1.00 14.83 ? 678  LEU A O   1 
ATOM   5199 C  CB  . LEU A 1 677 ? 29.565 48.801 90.609  1.00 12.77 ? 678  LEU A CB  1 
ATOM   5200 C  CG  . LEU A 1 677 ? 29.819 48.839 92.080  1.00 12.36 ? 678  LEU A CG  1 
ATOM   5201 C  CD1 . LEU A 1 677 ? 29.615 50.271 92.582  1.00 12.21 ? 678  LEU A CD1 1 
ATOM   5202 C  CD2 . LEU A 1 677 ? 28.889 47.855 92.761  1.00 12.22 ? 678  LEU A CD2 1 
ATOM   5203 N  N   . PRO A 1 678 ? 28.601 46.721 87.790  1.00 14.16 ? 679  PRO A N   1 
ATOM   5204 C  CA  . PRO A 1 678 ? 27.816 46.931 86.582  1.00 14.65 ? 679  PRO A CA  1 
ATOM   5205 C  C   . PRO A 1 678 ? 26.432 47.483 86.914  1.00 15.29 ? 679  PRO A C   1 
ATOM   5206 O  O   . PRO A 1 678 ? 25.658 46.757 87.537  1.00 16.45 ? 679  PRO A O   1 
ATOM   5207 C  CB  . PRO A 1 678 ? 27.836 45.560 85.956  1.00 14.28 ? 679  PRO A CB  1 
ATOM   5208 C  CG  . PRO A 1 678 ? 27.678 44.686 87.163  1.00 14.33 ? 679  PRO A CG  1 
ATOM   5209 C  CD  . PRO A 1 678 ? 28.600 45.328 88.187  1.00 13.38 ? 679  PRO A CD  1 
ATOM   5210 N  N   . LEU A 1 679 ? 25.996 48.695 86.502  1.00 15.57 ? 680  LEU A N   1 
ATOM   5211 C  CA  . LEU A 1 679 ? 24.662 49.210 86.938  1.00 13.84 ? 680  LEU A CA  1 
ATOM   5212 C  C   . LEU A 1 679 ? 23.829 49.627 85.745  1.00 12.91 ? 680  LEU A C   1 
ATOM   5213 O  O   . LEU A 1 679 ? 24.371 49.969 84.692  1.00 11.86 ? 680  LEU A O   1 
ATOM   5214 C  CB  . LEU A 1 679 ? 24.834 50.400 87.898  1.00 11.69 ? 680  LEU A CB  1 
ATOM   5215 C  CG  . LEU A 1 679 ? 25.727 50.163 89.119  1.00 12.13 ? 680  LEU A CG  1 
ATOM   5216 C  CD1 . LEU A 1 679 ? 26.098 51.479 89.771  1.00 10.71 ? 680  LEU A CD1 1 
ATOM   5217 C  CD2 . LEU A 1 679 ? 24.987 49.359 90.170  1.00 11.34 ? 680  LEU A CD2 1 
ATOM   5218 N  N   . THR A 1 680 ? 22.512 49.470 85.844  1.00 12.86 ? 681  THR A N   1 
ATOM   5219 C  CA  . THR A 1 680 ? 21.639 49.900 84.753  1.00 14.23 ? 681  THR A CA  1 
ATOM   5220 C  C   . THR A 1 680 ? 20.731 51.075 85.157  1.00 14.93 ? 681  THR A C   1 
ATOM   5221 O  O   . THR A 1 680 ? 20.429 51.241 86.343  1.00 15.04 ? 681  THR A O   1 
ATOM   5222 C  CB  . THR A 1 680 ? 20.701 48.762 84.255  1.00 13.92 ? 681  THR A CB  1 
ATOM   5223 O  OG1 . THR A 1 680 ? 20.120 48.116 85.409  1.00 14.65 ? 681  THR A OG1 1 
ATOM   5224 C  CG2 . THR A 1 680 ? 21.432 47.801 83.376  1.00 11.77 ? 681  THR A CG2 1 
ATOM   5225 N  N   . PHE A 1 681 ? 20.297 51.910 84.198  1.00 15.68 ? 682  PHE A N   1 
ATOM   5226 C  CA  . PHE A 1 681 ? 19.326 52.972 84.477  1.00 16.02 ? 682  PHE A CA  1 
ATOM   5227 C  C   . PHE A 1 681 ? 17.949 52.422 84.902  1.00 16.61 ? 682  PHE A C   1 
ATOM   5228 O  O   . PHE A 1 681 ? 17.478 51.449 84.309  1.00 15.88 ? 682  PHE A O   1 
ATOM   5229 C  CB  . PHE A 1 681 ? 19.144 53.850 83.246  1.00 14.06 ? 682  PHE A CB  1 
ATOM   5230 C  CG  . PHE A 1 681 ? 20.413 54.615 82.929  1.00 13.02 ? 682  PHE A CG  1 
ATOM   5231 C  CD1 . PHE A 1 681 ? 20.829 55.655 83.781  1.00 12.79 ? 682  PHE A CD1 1 
ATOM   5232 C  CD2 . PHE A 1 681 ? 21.156 54.269 81.795  1.00 11.16 ? 682  PHE A CD2 1 
ATOM   5233 C  CE1 . PHE A 1 681 ? 21.995 56.341 83.489  1.00 10.42 ? 682  PHE A CE1 1 
ATOM   5234 C  CE2 . PHE A 1 681 ? 22.330 54.963 81.513  1.00 9.21  ? 682  PHE A CE2 1 
ATOM   5235 C  CZ  . PHE A 1 681 ? 22.735 55.990 82.366  1.00 10.43 ? 682  PHE A CZ  1 
ATOM   5236 N  N   . ALA A 1 682 ? 17.338 52.920 85.996  1.00 16.51 ? 683  ALA A N   1 
ATOM   5237 C  CA  . ALA A 1 682 ? 15.992 52.488 86.327  1.00 17.44 ? 683  ALA A CA  1 
ATOM   5238 C  C   . ALA A 1 682 ? 15.071 53.081 85.252  1.00 18.63 ? 683  ALA A C   1 
ATOM   5239 O  O   . ALA A 1 682 ? 14.034 52.493 84.918  1.00 19.94 ? 683  ALA A O   1 
ATOM   5240 C  CB  . ALA A 1 682 ? 15.558 53.004 87.689  1.00 16.97 ? 683  ALA A CB  1 
ATOM   5241 N  N   . ASP A 1 683 ? 15.421 54.250 84.684  1.00 18.56 ? 684  ASP A N   1 
ATOM   5242 C  CA  . ASP A 1 683 ? 14.743 54.799 83.515  1.00 18.99 ? 684  ASP A CA  1 
ATOM   5243 C  C   . ASP A 1 683 ? 15.785 55.057 82.438  1.00 18.26 ? 684  ASP A C   1 
ATOM   5244 O  O   . ASP A 1 683 ? 16.571 55.982 82.591  1.00 16.99 ? 684  ASP A O   1 
ATOM   5245 C  CB  . ASP A 1 683 ? 14.050 56.090 83.909  1.00 20.72 ? 684  ASP A CB  1 
ATOM   5246 C  CG  . ASP A 1 683 ? 13.417 56.912 82.783  1.00 23.42 ? 684  ASP A CG  1 
ATOM   5247 O  OD1 . ASP A 1 683 ? 13.471 56.534 81.605  1.00 25.06 ? 684  ASP A OD1 1 
ATOM   5248 O  OD2 . ASP A 1 683 ? 12.849 57.961 83.112  1.00 25.24 ? 684  ASP A OD2 1 
ATOM   5249 N  N   . PRO A 1 684 ? 15.817 54.339 81.318  1.00 18.06 ? 685  PRO A N   1 
ATOM   5250 C  CA  . PRO A 1 684 ? 16.771 54.524 80.225  1.00 18.57 ? 685  PRO A CA  1 
ATOM   5251 C  C   . PRO A 1 684 ? 16.862 55.883 79.575  1.00 18.49 ? 685  PRO A C   1 
ATOM   5252 O  O   . PRO A 1 684 ? 17.834 56.085 78.861  1.00 17.88 ? 685  PRO A O   1 
ATOM   5253 C  CB  . PRO A 1 684 ? 16.437 53.476 79.174  1.00 18.33 ? 685  PRO A CB  1 
ATOM   5254 C  CG  . PRO A 1 684 ? 14.993 53.217 79.425  1.00 17.48 ? 685  PRO A CG  1 
ATOM   5255 C  CD  . PRO A 1 684 ? 14.888 53.281 80.969  1.00 17.56 ? 685  PRO A CD  1 
ATOM   5256 N  N   . ALA A 1 685 ? 15.923 56.800 79.825  1.00 19.32 ? 686  ALA A N   1 
ATOM   5257 C  CA  . ALA A 1 685 ? 15.992 58.149 79.253  1.00 20.83 ? 686  ALA A CA  1 
ATOM   5258 C  C   . ALA A 1 685 ? 17.053 59.003 80.013  1.00 21.14 ? 686  ALA A C   1 
ATOM   5259 O  O   . ALA A 1 685 ? 17.676 59.908 79.443  1.00 21.05 ? 686  ALA A O   1 
ATOM   5260 C  CB  . ALA A 1 685 ? 14.589 58.771 79.342  1.00 20.57 ? 686  ALA A CB  1 
ATOM   5261 N  N   . ASP A 1 686 ? 17.319 58.705 81.299  1.00 21.00 ? 687  ASP A N   1 
ATOM   5262 C  CA  . ASP A 1 686 ? 18.434 59.295 82.043  1.00 20.72 ? 687  ASP A CA  1 
ATOM   5263 C  C   . ASP A 1 686 ? 19.755 59.239 81.344  1.00 19.68 ? 687  ASP A C   1 
ATOM   5264 O  O   . ASP A 1 686 ? 20.621 60.000 81.701  1.00 19.73 ? 687  ASP A O   1 
ATOM   5265 C  CB  . ASP A 1 686 ? 18.598 58.618 83.411  1.00 20.50 ? 687  ASP A CB  1 
ATOM   5266 C  CG  . ASP A 1 686 ? 17.279 58.794 84.162  1.00 22.78 ? 687  ASP A CG  1 
ATOM   5267 O  OD1 . ASP A 1 686 ? 16.631 59.815 83.927  1.00 22.93 ? 687  ASP A OD1 1 
ATOM   5268 O  OD2 . ASP A 1 686 ? 16.846 57.925 84.938  1.00 23.48 ? 687  ASP A OD2 1 
ATOM   5269 N  N   . TYR A 1 687 ? 19.990 58.398 80.361  1.00 20.56 ? 688  TYR A N   1 
ATOM   5270 C  CA  . TYR A 1 687 ? 21.244 58.370 79.644  1.00 22.08 ? 688  TYR A CA  1 
ATOM   5271 C  C   . TYR A 1 687 ? 21.485 59.722 79.017  1.00 24.70 ? 688  TYR A C   1 
ATOM   5272 O  O   . TYR A 1 687 ? 22.634 60.170 79.045  1.00 25.34 ? 688  TYR A O   1 
ATOM   5273 C  CB  . TYR A 1 687 ? 21.146 57.287 78.615  1.00 21.47 ? 688  TYR A CB  1 
ATOM   5274 C  CG  . TYR A 1 687 ? 22.261 57.194 77.591  1.00 21.80 ? 688  TYR A CG  1 
ATOM   5275 C  CD1 . TYR A 1 687 ? 23.402 56.410 77.844  1.00 22.23 ? 688  TYR A CD1 1 
ATOM   5276 C  CD2 . TYR A 1 687 ? 22.106 57.824 76.349  1.00 21.36 ? 688  TYR A CD2 1 
ATOM   5277 C  CE1 . TYR A 1 687 ? 24.371 56.256 76.843  1.00 21.96 ? 688  TYR A CE1 1 
ATOM   5278 C  CE2 . TYR A 1 687 ? 23.070 57.670 75.356  1.00 22.33 ? 688  TYR A CE2 1 
ATOM   5279 C  CZ  . TYR A 1 687 ? 24.189 56.887 75.616  1.00 21.99 ? 688  TYR A CZ  1 
ATOM   5280 O  OH  . TYR A 1 687 ? 25.130 56.756 74.629  1.00 23.55 ? 688  TYR A OH  1 
ATOM   5281 N  N   . ASN A 1 688 ? 20.388 60.372 78.541  1.00 26.47 ? 689  ASN A N   1 
ATOM   5282 C  CA  . ASN A 1 688 ? 20.391 61.741 77.953  1.00 27.04 ? 689  ASN A CA  1 
ATOM   5283 C  C   . ASN A 1 688 ? 20.625 62.883 78.961  1.00 26.29 ? 689  ASN A C   1 
ATOM   5284 O  O   . ASN A 1 688 ? 20.971 63.974 78.524  1.00 26.51 ? 689  ASN A O   1 
ATOM   5285 C  CB  . ASN A 1 688 ? 19.056 61.988 77.204  1.00 27.37 ? 689  ASN A CB  1 
ATOM   5286 C  CG  . ASN A 1 688 ? 18.735 60.921 76.143  1.00 29.75 ? 689  ASN A CG  1 
ATOM   5287 O  OD1 . ASN A 1 688 ? 19.290 60.814 75.044  1.00 30.21 ? 689  ASN A OD1 1 
ATOM   5288 N  ND2 . ASN A 1 688 ? 17.828 60.009 76.467  1.00 33.16 ? 689  ASN A ND2 1 
ATOM   5289 N  N   . LYS A 1 689 ? 20.498 62.645 80.281  1.00 26.04 ? 690  LYS A N   1 
ATOM   5290 C  CA  . LYS A 1 689 ? 20.760 63.605 81.358  1.00 27.17 ? 690  LYS A CA  1 
ATOM   5291 C  C   . LYS A 1 689 ? 22.207 63.720 81.882  1.00 27.19 ? 690  LYS A C   1 
ATOM   5292 O  O   . LYS A 1 689 ? 22.503 64.504 82.798  1.00 28.11 ? 690  LYS A O   1 
ATOM   5293 C  CB  . LYS A 1 689 ? 19.895 63.294 82.594  1.00 28.69 ? 690  LYS A CB  1 
ATOM   5294 C  CG  . LYS A 1 689 ? 18.392 63.321 82.484  1.00 31.86 ? 690  LYS A CG  1 
ATOM   5295 C  CD  . LYS A 1 689 ? 17.898 62.913 83.876  1.00 36.58 ? 690  LYS A CD  1 
ATOM   5296 C  CE  . LYS A 1 689 ? 16.347 62.953 84.043  1.00 39.63 ? 690  LYS A CE  1 
ATOM   5297 N  NZ  . LYS A 1 689 ? 15.864 62.164 85.200  1.00 41.48 ? 690  LYS A NZ  1 
ATOM   5298 N  N   . ILE A 1 690 ? 23.099 62.862 81.362  1.00 26.44 ? 691  ILE A N   1 
ATOM   5299 C  CA  . ILE A 1 690 ? 24.505 62.762 81.705  1.00 23.95 ? 691  ILE A CA  1 
ATOM   5300 C  C   . ILE A 1 690 ? 25.231 63.189 80.449  1.00 24.18 ? 691  ILE A C   1 
ATOM   5301 O  O   . ILE A 1 690 ? 25.028 62.615 79.389  1.00 23.12 ? 691  ILE A O   1 
ATOM   5302 C  CB  . ILE A 1 690 ? 24.884 61.300 82.042  1.00 22.90 ? 691  ILE A CB  1 
ATOM   5303 C  CG1 . ILE A 1 690 ? 24.207 60.840 83.317  1.00 21.77 ? 691  ILE A CG1 1 
ATOM   5304 C  CG2 . ILE A 1 690 ? 26.367 61.195 82.222  1.00 21.40 ? 691  ILE A CG2 1 
ATOM   5305 C  CD1 . ILE A 1 690 ? 24.500 59.392 83.644  1.00 19.57 ? 691  ILE A CD1 1 
ATOM   5306 N  N   . HIS A 1 691 ? 26.116 64.180 80.656  1.00 25.87 ? 692  HIS A N   1 
ATOM   5307 C  CA  . HIS A 1 691 ? 27.001 64.850 79.681  1.00 26.56 ? 692  HIS A CA  1 
ATOM   5308 C  C   . HIS A 1 691 ? 28.400 64.463 80.119  1.00 26.19 ? 692  HIS A C   1 
ATOM   5309 O  O   . HIS A 1 691 ? 28.659 64.328 81.324  1.00 25.30 ? 692  HIS A O   1 
ATOM   5310 C  CB  . HIS A 1 691 ? 26.880 66.377 79.749  1.00 28.09 ? 692  HIS A CB  1 
ATOM   5311 C  CG  . HIS A 1 691 ? 25.433 66.771 79.970  1.00 32.06 ? 692  HIS A CG  1 
ATOM   5312 N  ND1 . HIS A 1 691 ? 24.887 67.262 81.087  1.00 32.87 ? 692  HIS A ND1 1 
ATOM   5313 C  CD2 . HIS A 1 691 ? 24.425 66.546 79.051  1.00 33.80 ? 692  HIS A CD2 1 
ATOM   5314 C  CE1 . HIS A 1 691 ? 23.591 67.322 80.875  1.00 34.73 ? 692  HIS A CE1 1 
ATOM   5315 N  NE2 . HIS A 1 691 ? 23.318 66.890 79.658  1.00 34.32 ? 692  HIS A NE2 1 
ATOM   5316 N  N   . PRO A 1 692 ? 29.326 64.287 79.177  1.00 25.91 ? 693  PRO A N   1 
ATOM   5317 C  CA  . PRO A 1 692 ? 30.753 64.046 79.461  1.00 25.43 ? 693  PRO A CA  1 
ATOM   5318 C  C   . PRO A 1 692 ? 31.537 64.900 80.491  1.00 25.08 ? 693  PRO A C   1 
ATOM   5319 O  O   . PRO A 1 692 ? 32.607 64.481 80.965  1.00 24.05 ? 693  PRO A O   1 
ATOM   5320 C  CB  . PRO A 1 692 ? 31.378 64.105 78.081  1.00 25.24 ? 693  PRO A CB  1 
ATOM   5321 C  CG  . PRO A 1 692 ? 30.311 63.867 77.037  1.00 25.28 ? 693  PRO A CG  1 
ATOM   5322 C  CD  . PRO A 1 692 ? 29.037 64.376 77.738  1.00 25.12 ? 693  PRO A CD  1 
ATOM   5323 N  N   . VAL A 1 693 ? 31.019 66.080 80.871  1.00 25.18 ? 694  VAL A N   1 
ATOM   5324 C  CA  . VAL A 1 693 ? 31.689 66.967 81.829  1.00 25.80 ? 694  VAL A CA  1 
ATOM   5325 C  C   . VAL A 1 693 ? 31.159 66.908 83.269  1.00 26.97 ? 694  VAL A C   1 
ATOM   5326 O  O   . VAL A 1 693 ? 31.762 67.468 84.184  1.00 27.07 ? 694  VAL A O   1 
ATOM   5327 C  CB  . VAL A 1 693 ? 31.612 68.381 81.175  1.00 26.09 ? 694  VAL A CB  1 
ATOM   5328 C  CG1 . VAL A 1 693 ? 30.211 68.949 81.230  1.00 26.25 ? 694  VAL A CG1 1 
ATOM   5329 C  CG2 . VAL A 1 693 ? 32.564 69.311 81.878  1.00 26.15 ? 694  VAL A CG2 1 
ATOM   5330 N  N   . ASP A 1 694 ? 30.061 66.154 83.500  1.00 28.62 ? 695  ASP A N   1 
ATOM   5331 C  CA  . ASP A 1 694 ? 29.441 65.972 84.802  1.00 30.15 ? 695  ASP A CA  1 
ATOM   5332 C  C   . ASP A 1 694 ? 30.251 64.995 85.641  1.00 30.87 ? 695  ASP A C   1 
ATOM   5333 O  O   . ASP A 1 694 ? 31.034 64.181 85.131  1.00 32.37 ? 695  ASP A O   1 
ATOM   5334 C  CB  . ASP A 1 694 ? 28.011 65.449 84.633  1.00 31.05 ? 695  ASP A CB  1 
ATOM   5335 C  CG  . ASP A 1 694 ? 27.077 66.374 83.841  1.00 33.63 ? 695  ASP A CG  1 
ATOM   5336 O  OD1 . ASP A 1 694 ? 27.119 67.602 83.946  1.00 34.62 ? 695  ASP A OD1 1 
ATOM   5337 O  OD2 . ASP A 1 694 ? 26.265 65.852 83.101  1.00 34.78 ? 695  ASP A OD2 1 
ATOM   5338 N  N   . LYS A 1 695 ? 30.058 65.105 86.959  1.00 31.60 ? 696  LYS A N   1 
ATOM   5339 C  CA  . LYS A 1 695 ? 30.735 64.279 87.964  1.00 31.32 ? 696  LYS A CA  1 
ATOM   5340 C  C   . LYS A 1 695 ? 29.624 63.410 88.560  1.00 30.35 ? 696  LYS A C   1 
ATOM   5341 O  O   . LYS A 1 695 ? 28.491 63.903 88.615  1.00 29.92 ? 696  LYS A O   1 
ATOM   5342 C  CB  . LYS A 1 695 ? 31.355 65.174 89.065  1.00 33.44 ? 696  LYS A CB  1 
ATOM   5343 C  CG  . LYS A 1 695 ? 32.487 66.112 88.637  1.00 34.44 ? 696  LYS A CG  1 
ATOM   5344 C  CD  . LYS A 1 695 ? 33.723 65.277 88.457  1.00 36.44 ? 696  LYS A CD  1 
ATOM   5345 C  CE  . LYS A 1 695 ? 34.609 65.859 87.362  1.00 38.57 ? 696  LYS A CE  1 
ATOM   5346 N  NZ  . LYS A 1 695 ? 34.076 65.647 86.016  1.00 39.42 ? 696  LYS A NZ  1 
ATOM   5347 N  N   . LEU A 1 696 ? 29.866 62.153 89.023  1.00 28.73 ? 697  LEU A N   1 
ATOM   5348 C  CA  . LEU A 1 696 ? 28.768 61.316 89.508  1.00 26.79 ? 697  LEU A CA  1 
ATOM   5349 C  C   . LEU A 1 696 ? 29.043 60.761 90.872  1.00 25.61 ? 697  LEU A C   1 
ATOM   5350 O  O   . LEU A 1 696 ? 30.164 60.307 91.077  1.00 24.96 ? 697  LEU A O   1 
ATOM   5351 C  CB  . LEU A 1 696 ? 28.514 60.158 88.486  1.00 25.97 ? 697  LEU A CB  1 
ATOM   5352 C  CG  . LEU A 1 696 ? 28.268 60.458 86.968  1.00 25.34 ? 697  LEU A CG  1 
ATOM   5353 C  CD1 . LEU A 1 696 ? 28.068 59.211 86.169  1.00 25.20 ? 697  LEU A CD1 1 
ATOM   5354 C  CD2 . LEU A 1 696 ? 26.992 61.228 86.799  1.00 26.31 ? 697  LEU A CD2 1 
ATOM   5355 N  N   . THR A 1 697 ? 28.087 60.836 91.812  1.00 25.62 ? 698  THR A N   1 
ATOM   5356 C  CA  . THR A 1 697 ? 28.268 60.161 93.098  1.00 26.68 ? 698  THR A CA  1 
ATOM   5357 C  C   . THR A 1 697 ? 27.288 58.983 93.249  1.00 27.35 ? 698  THR A C   1 
ATOM   5358 O  O   . THR A 1 697 ? 26.062 59.159 93.245  1.00 28.06 ? 698  THR A O   1 
ATOM   5359 C  CB  . THR A 1 697 ? 28.053 61.094 94.357  1.00 26.82 ? 698  THR A CB  1 
ATOM   5360 O  OG1 . THR A 1 697 ? 29.156 62.016 94.291  1.00 27.23 ? 698  THR A OG1 1 
ATOM   5361 C  CG2 . THR A 1 697 ? 28.101 60.399 95.761  1.00 25.16 ? 698  THR A CG2 1 
ATOM   5362 N  N   . ILE A 1 698 ? 27.839 57.766 93.394  1.00 26.94 ? 699  ILE A N   1 
ATOM   5363 C  CA  . ILE A 1 698 ? 27.021 56.591 93.586  1.00 27.66 ? 699  ILE A CA  1 
ATOM   5364 C  C   . ILE A 1 698 ? 26.970 56.616 95.109  1.00 28.48 ? 699  ILE A C   1 
ATOM   5365 O  O   . ILE A 1 698 ? 27.977 56.734 95.791  1.00 29.11 ? 699  ILE A O   1 
ATOM   5366 C  CB  . ILE A 1 698 ? 27.674 55.228 93.106  1.00 26.91 ? 699  ILE A CB  1 
ATOM   5367 C  CG1 . ILE A 1 698 ? 28.226 55.337 91.694  1.00 26.64 ? 699  ILE A CG1 1 
ATOM   5368 C  CG2 . ILE A 1 698 ? 26.637 54.107 93.192  1.00 24.37 ? 699  ILE A CG2 1 
ATOM   5369 C  CD1 . ILE A 1 698 ? 27.241 55.508 90.567  1.00 28.91 ? 699  ILE A CD1 1 
ATOM   5370 N  N   . GLN A 1 699 ? 25.780 56.440 95.659  1.00 30.00 ? 700  GLN A N   1 
ATOM   5371 C  CA  . GLN A 1 699 ? 25.540 56.526 97.073  1.00 30.97 ? 700  GLN A CA  1 
ATOM   5372 C  C   . GLN A 1 699 ? 24.643 55.429 97.672  1.00 30.48 ? 700  GLN A C   1 
ATOM   5373 O  O   . GLN A 1 699 ? 23.641 54.959 97.118  1.00 28.91 ? 700  GLN A O   1 
ATOM   5374 C  CB  . GLN A 1 699 ? 25.018 57.934 97.179  1.00 33.60 ? 700  GLN A CB  1 
ATOM   5375 C  CG  . GLN A 1 699 ? 24.525 58.491 98.489  1.00 38.12 ? 700  GLN A CG  1 
ATOM   5376 C  CD  . GLN A 1 699 ? 24.015 59.885 98.203  1.00 40.27 ? 700  GLN A CD  1 
ATOM   5377 O  OE1 . GLN A 1 699 ? 22.830 60.064 97.926  1.00 42.86 ? 700  GLN A OE1 1 
ATOM   5378 N  NE2 . GLN A 1 699 ? 24.889 60.886 98.189  1.00 40.75 ? 700  GLN A NE2 1 
ATOM   5379 N  N   . GLY A 1 700 ? 25.065 55.010 98.863  1.00 31.13 ? 701  GLY A N   1 
ATOM   5380 C  CA  . GLY A 1 700 ? 24.314 54.017 99.587  1.00 32.83 ? 701  GLY A CA  1 
ATOM   5381 C  C   . GLY A 1 700 ? 24.878 52.626 99.389  1.00 33.82 ? 701  GLY A C   1 
ATOM   5382 O  O   . GLY A 1 700 ? 24.127 51.650 99.340  1.00 34.55 ? 701  GLY A O   1 
ATOM   5383 N  N   . LEU A 1 701 ? 26.218 52.575 99.284  1.00 34.63 ? 702  LEU A N   1 
ATOM   5384 C  CA  . LEU A 1 701 ? 26.994 51.354 99.161  1.00 34.77 ? 702  LEU A CA  1 
ATOM   5385 C  C   . LEU A 1 701 ? 27.097 50.678 100.502 1.00 36.11 ? 702  LEU A C   1 
ATOM   5386 O  O   . LEU A 1 701 ? 27.364 49.483 100.539 1.00 36.53 ? 702  LEU A O   1 
ATOM   5387 C  CB  . LEU A 1 701 ? 28.382 51.686 98.642  1.00 32.50 ? 702  LEU A CB  1 
ATOM   5388 C  CG  . LEU A 1 701 ? 28.820 51.448 97.199  1.00 32.07 ? 702  LEU A CG  1 
ATOM   5389 C  CD1 . LEU A 1 701 ? 27.680 50.953 96.335  1.00 30.39 ? 702  LEU A CD1 1 
ATOM   5390 C  CD2 . LEU A 1 701 ? 29.417 52.731 96.688  1.00 31.14 ? 702  LEU A CD2 1 
ATOM   5391 N  N   . LYS A 1 702 ? 26.856 51.442 101.580 1.00 38.43 ? 703  LYS A N   1 
ATOM   5392 C  CA  . LYS A 1 702 ? 26.993 50.966 102.952 1.00 41.03 ? 703  LYS A CA  1 
ATOM   5393 C  C   . LYS A 1 702 ? 25.964 49.958 103.446 1.00 41.15 ? 703  LYS A C   1 
ATOM   5394 O  O   . LYS A 1 702 ? 26.220 49.141 104.340 1.00 41.67 ? 703  LYS A O   1 
ATOM   5395 C  CB  . LYS A 1 702 ? 26.989 52.160 103.899 1.00 43.38 ? 703  LYS A CB  1 
ATOM   5396 C  CG  . LYS A 1 702 ? 28.258 52.999 103.859 1.00 47.02 ? 703  LYS A CG  1 
ATOM   5397 C  CD  . LYS A 1 702 ? 28.244 54.177 102.888 1.00 50.07 ? 703  LYS A CD  1 
ATOM   5398 C  CE  . LYS A 1 702 ? 29.553 54.980 103.125 1.00 52.29 ? 703  LYS A CE  1 
ATOM   5399 N  NZ  . LYS A 1 702 ? 29.535 56.312 102.527 1.00 54.44 ? 703  LYS A NZ  1 
ATOM   5400 N  N   . ASP A 1 703 ? 24.778 50.105 102.851 1.00 41.17 ? 704  ASP A N   1 
ATOM   5401 C  CA  . ASP A 1 703 ? 23.655 49.217 103.063 1.00 40.65 ? 704  ASP A CA  1 
ATOM   5402 C  C   . ASP A 1 703 ? 23.184 48.699 101.705 1.00 38.99 ? 704  ASP A C   1 
ATOM   5403 O  O   . ASP A 1 703 ? 21.976 48.646 101.464 1.00 39.42 ? 704  ASP A O   1 
ATOM   5404 C  CB  . ASP A 1 703 ? 22.525 49.987 103.807 1.00 42.43 ? 704  ASP A CB  1 
ATOM   5405 C  CG  . ASP A 1 703 ? 22.303 51.425 103.317 1.00 44.64 ? 704  ASP A CG  1 
ATOM   5406 O  OD1 . ASP A 1 703 ? 22.146 51.653 102.109 1.00 47.27 ? 704  ASP A OD1 1 
ATOM   5407 O  OD2 . ASP A 1 703 ? 22.333 52.334 104.146 1.00 44.22 ? 704  ASP A OD2 1 
ATOM   5408 N  N   . PHE A 1 704 ? 24.150 48.293 100.846 1.00 36.63 ? 705  PHE A N   1 
ATOM   5409 C  CA  . PHE A 1 704 ? 23.937 47.723 99.498  1.00 33.12 ? 705  PHE A CA  1 
ATOM   5410 C  C   . PHE A 1 704 ? 23.162 46.409 99.722  1.00 30.93 ? 705  PHE A C   1 
ATOM   5411 O  O   . PHE A 1 704 ? 23.600 45.654 100.595 1.00 31.06 ? 705  PHE A O   1 
ATOM   5412 C  CB  . PHE A 1 704 ? 25.381 47.563 98.914  1.00 31.56 ? 705  PHE A CB  1 
ATOM   5413 C  CG  . PHE A 1 704 ? 25.589 47.160 97.464  1.00 29.54 ? 705  PHE A CG  1 
ATOM   5414 C  CD1 . PHE A 1 704 ? 24.557 47.235 96.525  1.00 28.67 ? 705  PHE A CD1 1 
ATOM   5415 C  CD2 . PHE A 1 704 ? 26.835 46.656 97.078  1.00 28.46 ? 705  PHE A CD2 1 
ATOM   5416 C  CE1 . PHE A 1 704 ? 24.793 46.795 95.214  1.00 27.41 ? 705  PHE A CE1 1 
ATOM   5417 C  CE2 . PHE A 1 704 ? 27.055 46.222 95.766  1.00 26.78 ? 705  PHE A CE2 1 
ATOM   5418 C  CZ  . PHE A 1 704 ? 26.032 46.289 94.829  1.00 26.02 ? 705  PHE A CZ  1 
ATOM   5419 N  N   . ALA A 1 705 ? 22.042 46.131 99.027  1.00 28.28 ? 706  ALA A N   1 
ATOM   5420 C  CA  . ALA A 1 705 ? 21.195 44.957 99.278  1.00 26.11 ? 706  ALA A CA  1 
ATOM   5421 C  C   . ALA A 1 705 ? 20.528 44.409 98.035  1.00 25.47 ? 706  ALA A C   1 
ATOM   5422 O  O   . ALA A 1 705 ? 20.202 45.216 97.163  1.00 25.81 ? 706  ALA A O   1 
ATOM   5423 C  CB  . ALA A 1 705 ? 20.055 45.261 100.218 1.00 25.33 ? 706  ALA A CB  1 
ATOM   5424 N  N   . PRO A 1 706 ? 20.258 43.101 97.845  1.00 25.45 ? 707  PRO A N   1 
ATOM   5425 C  CA  . PRO A 1 706 ? 19.550 42.581 96.657  1.00 25.66 ? 707  PRO A CA  1 
ATOM   5426 C  C   . PRO A 1 706 ? 18.131 43.216 96.571  1.00 27.34 ? 707  PRO A C   1 
ATOM   5427 O  O   . PRO A 1 706 ? 17.405 43.303 97.585  1.00 27.66 ? 707  PRO A O   1 
ATOM   5428 C  CB  . PRO A 1 706 ? 19.534 41.089 96.872  1.00 23.85 ? 707  PRO A CB  1 
ATOM   5429 C  CG  . PRO A 1 706 ? 20.655 40.871 97.830  1.00 23.94 ? 707  PRO A CG  1 
ATOM   5430 C  CD  . PRO A 1 706 ? 20.574 42.028 98.785  1.00 24.33 ? 707  PRO A CD  1 
ATOM   5431 N  N   . GLY A 1 707 ? 17.780 43.776 95.394  1.00 27.33 ? 708  GLY A N   1 
ATOM   5432 C  CA  . GLY A 1 707 ? 16.472 44.375 95.194  1.00 28.21 ? 708  GLY A CA  1 
ATOM   5433 C  C   . GLY A 1 707 ? 16.446 45.883 95.450  1.00 28.92 ? 708  GLY A C   1 
ATOM   5434 O  O   . GLY A 1 707 ? 15.657 46.578 94.818  1.00 28.13 ? 708  GLY A O   1 
ATOM   5435 N  N   . LYS A 1 708 ? 17.264 46.391 96.384  1.00 29.59 ? 709  LYS A N   1 
ATOM   5436 C  CA  . LYS A 1 708 ? 17.345 47.797 96.666  1.00 30.54 ? 709  LYS A CA  1 
ATOM   5437 C  C   . LYS A 1 708 ? 18.302 48.491 95.646  1.00 30.37 ? 709  LYS A C   1 
ATOM   5438 O  O   . LYS A 1 708 ? 19.517 48.215 95.670  1.00 31.53 ? 709  LYS A O   1 
ATOM   5439 C  CB  . LYS A 1 708 ? 17.832 47.927 98.132  1.00 32.18 ? 709  LYS A CB  1 
ATOM   5440 C  CG  . LYS A 1 708 ? 18.049 49.380 98.660  1.00 36.23 ? 709  LYS A CG  1 
ATOM   5441 C  CD  . LYS A 1 708 ? 19.389 49.779 99.343  1.00 38.27 ? 709  LYS A CD  1 
ATOM   5442 C  CE  . LYS A 1 708 ? 20.728 49.857 98.532  1.00 39.66 ? 709  LYS A CE  1 
ATOM   5443 N  NZ  . LYS A 1 708 ? 21.732 50.593 99.299  1.00 39.41 ? 709  LYS A NZ  1 
ATOM   5444 N  N   . PRO A 1 709 ? 17.852 49.435 94.782  1.00 29.11 ? 710  PRO A N   1 
ATOM   5445 C  CA  . PRO A 1 709 ? 18.682 50.261 93.900  1.00 28.01 ? 710  PRO A CA  1 
ATOM   5446 C  C   . PRO A 1 709 ? 19.553 51.341 94.577  1.00 27.26 ? 710  PRO A C   1 
ATOM   5447 O  O   . PRO A 1 709 ? 19.361 51.693 95.742  1.00 27.29 ? 710  PRO A O   1 
ATOM   5448 C  CB  . PRO A 1 709 ? 17.680 50.841 92.912  1.00 28.15 ? 710  PRO A CB  1 
ATOM   5449 C  CG  . PRO A 1 709 ? 16.439 51.086 93.746  1.00 28.59 ? 710  PRO A CG  1 
ATOM   5450 C  CD  . PRO A 1 709 ? 16.441 49.830 94.657  1.00 29.24 ? 710  PRO A CD  1 
ATOM   5451 N  N   . LEU A 1 710 ? 20.496 51.911 93.812  1.00 26.15 ? 711  LEU A N   1 
ATOM   5452 C  CA  . LEU A 1 710 ? 21.466 52.865 94.283  1.00 24.99 ? 711  LEU A CA  1 
ATOM   5453 C  C   . LEU A 1 710 ? 21.070 54.182 93.692  1.00 24.89 ? 711  LEU A C   1 
ATOM   5454 O  O   . LEU A 1 710 ? 20.399 54.257 92.669  1.00 23.82 ? 711  LEU A O   1 
ATOM   5455 C  CB  . LEU A 1 710 ? 22.850 52.424 93.824  1.00 23.88 ? 711  LEU A CB  1 
ATOM   5456 C  CG  . LEU A 1 710 ? 23.318 51.112 94.494  1.00 22.99 ? 711  LEU A CG  1 
ATOM   5457 C  CD1 . LEU A 1 710 ? 24.620 50.625 93.898  1.00 23.07 ? 711  LEU A CD1 1 
ATOM   5458 C  CD2 . LEU A 1 710 ? 23.500 51.349 95.985  1.00 22.74 ? 711  LEU A CD2 1 
ATOM   5459 N  N   . LYS A 1 711 ? 21.408 55.240 94.419  1.00 26.29 ? 712  LYS A N   1 
ATOM   5460 C  CA  . LYS A 1 711 ? 21.103 56.594 93.971  1.00 28.02 ? 712  LYS A CA  1 
ATOM   5461 C  C   . LYS A 1 711 ? 22.324 57.157 93.274  1.00 28.07 ? 712  LYS A C   1 
ATOM   5462 O  O   . LYS A 1 711 ? 23.431 56.829 93.733  1.00 28.67 ? 712  LYS A O   1 
ATOM   5463 C  CB  . LYS A 1 711 ? 20.802 57.479 95.138  1.00 30.24 ? 712  LYS A CB  1 
ATOM   5464 C  CG  . LYS A 1 711 ? 19.641 57.043 96.008  1.00 33.71 ? 712  LYS A CG  1 
ATOM   5465 C  CD  . LYS A 1 711 ? 19.293 58.102 97.063  1.00 38.57 ? 712  LYS A CD  1 
ATOM   5466 C  CE  . LYS A 1 711 ? 19.027 59.558 96.549  1.00 41.22 ? 712  LYS A CE  1 
ATOM   5467 N  NZ  . LYS A 1 711 ? 20.247 60.317 96.243  1.00 43.65 ? 712  LYS A NZ  1 
ATOM   5468 N  N   . CYS A 1 712 ? 22.193 57.957 92.196  1.00 28.01 ? 713  CYS A N   1 
ATOM   5469 C  CA  . CYS A 1 712 ? 23.343 58.578 91.542  1.00 27.90 ? 713  CYS A CA  1 
ATOM   5470 C  C   . CYS A 1 712 ? 23.055 60.067 91.476  1.00 28.18 ? 713  CYS A C   1 
ATOM   5471 O  O   . CYS A 1 712 ? 22.067 60.512 90.917  1.00 29.18 ? 713  CYS A O   1 
ATOM   5472 C  CB  . CYS A 1 712 ? 23.568 58.076 90.112  1.00 27.22 ? 713  CYS A CB  1 
ATOM   5473 S  SG  . CYS A 1 712 ? 24.835 58.936 89.108  1.00 28.04 ? 713  CYS A SG  1 
ATOM   5474 N  N   . ILE A 1 713 ? 23.900 60.890 92.091  1.00 29.12 ? 714  ILE A N   1 
ATOM   5475 C  CA  . ILE A 1 713 ? 23.820 62.354 92.071  1.00 28.37 ? 714  ILE A CA  1 
ATOM   5476 C  C   . ILE A 1 713 ? 24.681 62.737 90.897  1.00 28.22 ? 714  ILE A C   1 
ATOM   5477 O  O   . ILE A 1 713 ? 25.894 62.491 90.927  1.00 28.25 ? 714  ILE A O   1 
ATOM   5478 C  CB  . ILE A 1 713 ? 24.414 62.959 93.358  1.00 28.90 ? 714  ILE A CB  1 
ATOM   5479 C  CG1 . ILE A 1 713 ? 23.432 62.790 94.498  1.00 29.54 ? 714  ILE A CG1 1 
ATOM   5480 C  CG2 . ILE A 1 713 ? 24.734 64.423 93.174  1.00 28.70 ? 714  ILE A CG2 1 
ATOM   5481 C  CD1 . ILE A 1 713 ? 23.323 61.347 95.007  1.00 30.67 ? 714  ILE A CD1 1 
ATOM   5482 N  N   . ILE A 1 714 ? 24.017 63.315 89.904  1.00 27.35 ? 715  ILE A N   1 
ATOM   5483 C  CA  . ILE A 1 714 ? 24.665 63.840 88.729  1.00 27.69 ? 715  ILE A CA  1 
ATOM   5484 C  C   . ILE A 1 714 ? 24.991 65.295 89.066  1.00 29.19 ? 715  ILE A C   1 
ATOM   5485 O  O   . ILE A 1 714 ? 24.071 66.092 89.279  1.00 29.48 ? 715  ILE A O   1 
ATOM   5486 C  CB  . ILE A 1 714 ? 23.702 63.774 87.533  1.00 27.07 ? 715  ILE A CB  1 
ATOM   5487 C  CG1 . ILE A 1 714 ? 23.070 62.386 87.345  1.00 25.94 ? 715  ILE A CG1 1 
ATOM   5488 C  CG2 . ILE A 1 714 ? 24.490 64.201 86.302  1.00 25.85 ? 715  ILE A CG2 1 
ATOM   5489 C  CD1 . ILE A 1 714 ? 22.091 62.307 86.162  1.00 25.46 ? 715  ILE A CD1 1 
ATOM   5490 N  N   . LYS A 1 715 ? 26.289 65.657 89.138  1.00 30.84 ? 716  LYS A N   1 
ATOM   5491 C  CA  . LYS A 1 715 ? 26.749 67.014 89.445  1.00 31.49 ? 716  LYS A CA  1 
ATOM   5492 C  C   . LYS A 1 715 ? 27.083 67.715 88.130  1.00 32.48 ? 716  LYS A C   1 
ATOM   5493 O  O   . LYS A 1 715 ? 28.082 67.437 87.493  1.00 31.62 ? 716  LYS A O   1 
ATOM   5494 C  CB  . LYS A 1 715 ? 27.988 66.972 90.328  1.00 31.75 ? 716  LYS A CB  1 
ATOM   5495 C  CG  . LYS A 1 715 ? 27.713 66.491 91.744  1.00 34.41 ? 716  LYS A CG  1 
ATOM   5496 C  CD  . LYS A 1 715 ? 29.029 66.281 92.492  1.00 37.59 ? 716  LYS A CD  1 
ATOM   5497 C  CE  . LYS A 1 715 ? 28.880 65.996 93.995  1.00 39.71 ? 716  LYS A CE  1 
ATOM   5498 N  NZ  . LYS A 1 715 ? 30.144 65.510 94.546  1.00 41.11 ? 716  LYS A NZ  1 
ATOM   5499 N  N   . HIS A 1 716 ? 26.239 68.638 87.678  1.00 34.67 ? 717  HIS A N   1 
ATOM   5500 C  CA  . HIS A 1 716 ? 26.448 69.402 86.450  1.00 36.83 ? 717  HIS A CA  1 
ATOM   5501 C  C   . HIS A 1 716 ? 27.286 70.627 86.805  1.00 39.11 ? 717  HIS A C   1 
ATOM   5502 O  O   . HIS A 1 716 ? 27.080 71.217 87.873  1.00 38.88 ? 717  HIS A O   1 
ATOM   5503 C  CB  . HIS A 1 716 ? 25.175 69.928 85.850  1.00 35.48 ? 717  HIS A CB  1 
ATOM   5504 C  CG  . HIS A 1 716 ? 24.184 68.879 85.419  1.00 36.00 ? 717  HIS A CG  1 
ATOM   5505 N  ND1 . HIS A 1 716 ? 24.269 68.107 84.345  1.00 35.90 ? 717  HIS A ND1 1 
ATOM   5506 C  CD2 . HIS A 1 716 ? 22.995 68.603 86.061  1.00 35.76 ? 717  HIS A CD2 1 
ATOM   5507 C  CE1 . HIS A 1 716 ? 23.169 67.386 84.309  1.00 36.22 ? 717  HIS A CE1 1 
ATOM   5508 N  NE2 . HIS A 1 716 ? 22.418 67.693 85.342  1.00 35.52 ? 717  HIS A NE2 1 
ATOM   5509 N  N   . PRO A 1 717 ? 28.231 71.047 85.947  1.00 40.78 ? 718  PRO A N   1 
ATOM   5510 C  CA  . PRO A 1 717 ? 29.319 71.946 86.291  1.00 42.86 ? 718  PRO A CA  1 
ATOM   5511 C  C   . PRO A 1 717 ? 28.827 73.325 86.744  1.00 45.41 ? 718  PRO A C   1 
ATOM   5512 O  O   . PRO A 1 717 ? 29.505 74.082 87.446  1.00 47.29 ? 718  PRO A O   1 
ATOM   5513 C  CB  . PRO A 1 717 ? 30.130 71.985 85.036  1.00 42.40 ? 718  PRO A CB  1 
ATOM   5514 C  CG  . PRO A 1 717 ? 29.599 70.885 84.158  1.00 41.00 ? 718  PRO A CG  1 
ATOM   5515 C  CD  . PRO A 1 717 ? 28.156 70.912 84.499  1.00 40.59 ? 718  PRO A CD  1 
ATOM   5516 N  N   . ASN A 1 718 ? 27.597 73.645 86.358  1.00 47.08 ? 719  ASN A N   1 
ATOM   5517 C  CA  . ASN A 1 718 ? 26.943 74.889 86.730  1.00 48.48 ? 719  ASN A CA  1 
ATOM   5518 C  C   . ASN A 1 718 ? 26.485 74.942 88.177  1.00 48.56 ? 719  ASN A C   1 
ATOM   5519 O  O   . ASN A 1 718 ? 26.203 76.027 88.668  1.00 49.64 ? 719  ASN A O   1 
ATOM   5520 C  CB  . ASN A 1 718 ? 25.740 75.111 85.791  1.00 49.58 ? 719  ASN A CB  1 
ATOM   5521 C  CG  . ASN A 1 718 ? 24.765 73.932 85.695  1.00 50.87 ? 719  ASN A CG  1 
ATOM   5522 O  OD1 . ASN A 1 718 ? 24.812 72.993 86.492  1.00 51.31 ? 719  ASN A OD1 1 
ATOM   5523 N  ND2 . ASN A 1 718 ? 23.856 73.916 84.723  1.00 50.67 ? 719  ASN A ND2 1 
ATOM   5524 N  N   . GLY A 1 719 ? 26.419 73.819 88.892  1.00 48.44 ? 720  GLY A N   1 
ATOM   5525 C  CA  . GLY A 1 719 ? 25.935 73.796 90.258  1.00 48.08 ? 720  GLY A CA  1 
ATOM   5526 C  C   . GLY A 1 719 ? 24.605 73.060 90.325  1.00 48.07 ? 720  GLY A C   1 
ATOM   5527 O  O   . GLY A 1 719 ? 24.082 72.854 91.414  1.00 48.85 ? 720  GLY A O   1 
ATOM   5528 N  N   . THR A 1 720 ? 23.992 72.703 89.185  1.00 47.56 ? 721  THR A N   1 
ATOM   5529 C  CA  . THR A 1 720 ? 22.773 71.896 89.111  1.00 46.47 ? 721  THR A CA  1 
ATOM   5530 C  C   . THR A 1 720 ? 23.047 70.446 89.505  1.00 44.86 ? 721  THR A C   1 
ATOM   5531 O  O   . THR A 1 720 ? 23.802 69.743 88.839  1.00 45.20 ? 721  THR A O   1 
ATOM   5532 C  CB  . THR A 1 720 ? 22.203 71.842 87.681  1.00 47.62 ? 721  THR A CB  1 
ATOM   5533 O  OG1 . THR A 1 720 ? 22.194 73.201 87.290  1.00 49.11 ? 721  THR A OG1 1 
ATOM   5534 C  CG2 . THR A 1 720 ? 20.814 71.189 87.515  1.00 48.46 ? 721  THR A CG2 1 
ATOM   5535 N  N   . GLN A 1 721 ? 22.484 69.970 90.596  1.00 42.81 ? 722  GLN A N   1 
ATOM   5536 C  CA  . GLN A 1 721 ? 22.557 68.563 90.883  1.00 41.06 ? 722  GLN A CA  1 
ATOM   5537 C  C   . GLN A 1 721 ? 21.343 67.865 90.283  1.00 40.39 ? 722  GLN A C   1 
ATOM   5538 O  O   . GLN A 1 721 ? 20.496 68.533 89.676  1.00 41.35 ? 722  GLN A O   1 
ATOM   5539 C  CB  . GLN A 1 721 ? 22.555 68.362 92.335  1.00 40.46 ? 722  GLN A CB  1 
ATOM   5540 C  CG  . GLN A 1 721 ? 23.893 68.670 92.923  1.00 40.09 ? 722  GLN A CG  1 
ATOM   5541 C  CD  . GLN A 1 721 ? 23.994 67.982 94.275  1.00 40.84 ? 722  GLN A CD  1 
ATOM   5542 O  OE1 . GLN A 1 721 ? 22.987 67.564 94.861  1.00 41.00 ? 722  GLN A OE1 1 
ATOM   5543 N  NE2 . GLN A 1 721 ? 25.211 67.813 94.793  1.00 41.46 ? 722  GLN A NE2 1 
ATOM   5544 N  N   . GLU A 1 722 ? 21.270 66.525 90.344  1.00 38.31 ? 723  GLU A N   1 
ATOM   5545 C  CA  . GLU A 1 722 ? 20.086 65.755 89.969  1.00 35.66 ? 723  GLU A CA  1 
ATOM   5546 C  C   . GLU A 1 722 ? 20.269 64.377 90.560  1.00 34.10 ? 723  GLU A C   1 
ATOM   5547 O  O   . GLU A 1 722 ? 21.318 63.788 90.355  1.00 33.81 ? 723  GLU A O   1 
ATOM   5548 C  CB  . GLU A 1 722 ? 19.883 65.440 88.488  1.00 35.10 ? 723  GLU A CB  1 
ATOM   5549 C  CG  . GLU A 1 722 ? 19.742 66.609 87.563  1.00 34.98 ? 723  GLU A CG  1 
ATOM   5550 C  CD  . GLU A 1 722 ? 19.068 66.283 86.246  1.00 35.20 ? 723  GLU A CD  1 
ATOM   5551 O  OE1 . GLU A 1 722 ? 17.984 65.684 86.257  1.00 34.61 ? 723  GLU A OE1 1 
ATOM   5552 O  OE2 . GLU A 1 722 ? 19.618 66.656 85.208  1.00 34.93 ? 723  GLU A OE2 1 
ATOM   5553 N  N   . THR A 1 723 ? 19.312 63.800 91.277  1.00 31.53 ? 724  THR A N   1 
ATOM   5554 C  CA  . THR A 1 723 ? 19.397 62.418 91.708  1.00 29.10 ? 724  THR A CA  1 
ATOM   5555 C  C   . THR A 1 723 ? 18.662 61.512 90.719  1.00 27.30 ? 724  THR A C   1 
ATOM   5556 O  O   . THR A 1 723 ? 17.570 61.863 90.276  1.00 26.53 ? 724  THR A O   1 
ATOM   5557 C  CB  . THR A 1 723 ? 18.792 62.341 93.113  1.00 30.20 ? 724  THR A CB  1 
ATOM   5558 O  OG1 . THR A 1 723 ? 19.897 62.634 93.992  1.00 32.22 ? 724  THR A OG1 1 
ATOM   5559 C  CG2 . THR A 1 723 ? 18.160 60.993 93.485  1.00 29.93 ? 724  THR A CG2 1 
ATOM   5560 N  N   . ILE A 1 724 ? 19.274 60.383 90.298  1.00 25.00 ? 725  ILE A N   1 
ATOM   5561 C  CA  . ILE A 1 724 ? 18.620 59.350 89.500  1.00 21.83 ? 725  ILE A CA  1 
ATOM   5562 C  C   . ILE A 1 724 ? 18.827 57.987 90.197  1.00 20.65 ? 725  ILE A C   1 
ATOM   5563 O  O   . ILE A 1 724 ? 19.607 57.834 91.137  1.00 18.87 ? 725  ILE A O   1 
ATOM   5564 C  CB  . ILE A 1 724 ? 19.145 59.244 87.998  1.00 21.12 ? 725  ILE A CB  1 
ATOM   5565 C  CG1 . ILE A 1 724 ? 20.550 58.728 87.899  1.00 21.15 ? 725  ILE A CG1 1 
ATOM   5566 C  CG2 . ILE A 1 724 ? 19.007 60.614 87.342  1.00 19.71 ? 725  ILE A CG2 1 
ATOM   5567 C  CD1 . ILE A 1 724 ? 20.999 58.522 86.435  1.00 21.65 ? 725  ILE A CD1 1 
ATOM   5568 N  N   . LEU A 1 725 ? 18.039 56.962 89.830  1.00 20.84 ? 726  LEU A N   1 
ATOM   5569 C  CA  . LEU A 1 725 ? 18.149 55.619 90.416  1.00 20.13 ? 726  LEU A CA  1 
ATOM   5570 C  C   . LEU A 1 725 ? 18.698 54.537 89.460  1.00 19.73 ? 726  LEU A C   1 
ATOM   5571 O  O   . LEU A 1 725 ? 18.299 54.397 88.276  1.00 18.50 ? 726  LEU A O   1 
ATOM   5572 C  CB  . LEU A 1 725 ? 16.778 55.217 90.951  1.00 19.81 ? 726  LEU A CB  1 
ATOM   5573 C  CG  . LEU A 1 725 ? 16.181 55.966 92.171  1.00 18.99 ? 726  LEU A CG  1 
ATOM   5574 C  CD1 . LEU A 1 725 ? 15.147 55.060 92.774  1.00 19.55 ? 726  LEU A CD1 1 
ATOM   5575 C  CD2 . LEU A 1 725 ? 17.130 56.157 93.330  1.00 19.25 ? 726  LEU A CD2 1 
ATOM   5576 N  N   . LEU A 1 726 ? 19.601 53.738 90.076  1.00 17.84 ? 727  LEU A N   1 
ATOM   5577 C  CA  . LEU A 1 726 ? 20.335 52.729 89.333  1.00 17.25 ? 727  LEU A CA  1 
ATOM   5578 C  C   . LEU A 1 726 ? 20.072 51.341 89.872  1.00 17.51 ? 727  LEU A C   1 
ATOM   5579 O  O   . LEU A 1 726 ? 20.334 51.079 91.035  1.00 17.43 ? 727  LEU A O   1 
ATOM   5580 C  CB  . LEU A 1 726 ? 21.828 53.066 89.405  1.00 15.82 ? 727  LEU A CB  1 
ATOM   5581 C  CG  . LEU A 1 726 ? 22.312 54.409 88.791  1.00 13.59 ? 727  LEU A CG  1 
ATOM   5582 C  CD1 . LEU A 1 726 ? 23.811 54.474 88.954  1.00 11.03 ? 727  LEU A CD1 1 
ATOM   5583 C  CD2 . LEU A 1 726 ? 21.980 54.534 87.335  1.00 10.20 ? 727  LEU A CD2 1 
ATOM   5584 N  N   . ASN A 1 727 ? 19.584 50.410 89.060  1.00 18.49 ? 728  ASN A N   1 
ATOM   5585 C  CA  . ASN A 1 727 ? 19.364 49.021 89.494  1.00 19.40 ? 728  ASN A CA  1 
ATOM   5586 C  C   . ASN A 1 727 ? 20.605 48.107 89.288  1.00 19.36 ? 728  ASN A C   1 
ATOM   5587 O  O   . ASN A 1 727 ? 21.440 48.266 88.393  1.00 17.95 ? 728  ASN A O   1 
ATOM   5588 C  CB  . ASN A 1 727 ? 18.183 48.358 88.722  1.00 19.42 ? 728  ASN A CB  1 
ATOM   5589 C  CG  . ASN A 1 727 ? 16.849 49.026 88.968  1.00 20.66 ? 728  ASN A CG  1 
ATOM   5590 O  OD1 . ASN A 1 727 ? 16.491 49.350 90.090  1.00 22.99 ? 728  ASN A OD1 1 
ATOM   5591 N  ND2 . ASN A 1 727 ? 16.059 49.383 87.983  1.00 20.20 ? 728  ASN A ND2 1 
ATOM   5592 N  N   . HIS A 1 728 ? 20.683 47.080 90.126  1.00 19.62 ? 729  HIS A N   1 
ATOM   5593 C  CA  . HIS A 1 728 ? 21.727 46.073 90.034  1.00 21.14 ? 729  HIS A CA  1 
ATOM   5594 C  C   . HIS A 1 728 ? 21.170 44.650 90.138  1.00 21.47 ? 729  HIS A C   1 
ATOM   5595 O  O   . HIS A 1 728 ? 20.143 44.502 90.810  1.00 22.59 ? 729  HIS A O   1 
ATOM   5596 C  CB  . HIS A 1 728 ? 22.734 46.222 91.140  1.00 21.87 ? 729  HIS A CB  1 
ATOM   5597 C  CG  . HIS A 1 728 ? 22.083 46.255 92.504  1.00 23.02 ? 729  HIS A CG  1 
ATOM   5598 N  ND1 . HIS A 1 728 ? 21.612 45.229 93.226  1.00 23.35 ? 729  HIS A ND1 1 
ATOM   5599 C  CD2 . HIS A 1 728 ? 21.896 47.423 93.188  1.00 22.23 ? 729  HIS A CD2 1 
ATOM   5600 C  CE1 . HIS A 1 728 ? 21.157 45.753 94.352  1.00 24.23 ? 729  HIS A CE1 1 
ATOM   5601 N  NE2 . HIS A 1 728 ? 21.337 47.060 94.311  1.00 24.49 ? 729  HIS A NE2 1 
ATOM   5602 N  N   . THR A 1 729 ? 21.751 43.606 89.493  1.00 20.02 ? 730  THR A N   1 
ATOM   5603 C  CA  . THR A 1 729 ? 21.310 42.273 89.808  1.00 18.20 ? 730  THR A CA  1 
ATOM   5604 C  C   . THR A 1 729 ? 22.166 41.547 90.864  1.00 18.18 ? 730  THR A C   1 
ATOM   5605 O  O   . THR A 1 729 ? 22.227 40.324 90.833  1.00 18.77 ? 730  THR A O   1 
ATOM   5606 C  CB  . THR A 1 729 ? 21.264 41.488 88.517  1.00 17.73 ? 730  THR A CB  1 
ATOM   5607 O  OG1 . THR A 1 729 ? 22.629 41.383 88.117  1.00 18.79 ? 730  THR A OG1 1 
ATOM   5608 C  CG2 . THR A 1 729 ? 20.475 42.107 87.398  1.00 16.31 ? 730  THR A CG2 1 
ATOM   5609 N  N   . PHE A 1 730 ? 22.842 42.172 91.844  1.00 18.62 ? 731  PHE A N   1 
ATOM   5610 C  CA  . PHE A 1 730 ? 23.653 41.421 92.809  1.00 19.43 ? 731  PHE A CA  1 
ATOM   5611 C  C   . PHE A 1 730 ? 22.752 40.662 93.797  1.00 21.71 ? 731  PHE A C   1 
ATOM   5612 O  O   . PHE A 1 730 ? 21.673 41.100 94.204  1.00 22.61 ? 731  PHE A O   1 
ATOM   5613 C  CB  . PHE A 1 730 ? 24.616 42.352 93.627  1.00 15.54 ? 731  PHE A CB  1 
ATOM   5614 C  CG  . PHE A 1 730 ? 25.850 42.902 92.911  1.00 15.64 ? 731  PHE A CG  1 
ATOM   5615 C  CD1 . PHE A 1 730 ? 25.757 43.640 91.731  1.00 15.56 ? 731  PHE A CD1 1 
ATOM   5616 C  CD2 . PHE A 1 730 ? 27.137 42.687 93.438  1.00 16.88 ? 731  PHE A CD2 1 
ATOM   5617 C  CE1 . PHE A 1 730 ? 26.910 44.145 91.104  1.00 16.17 ? 731  PHE A CE1 1 
ATOM   5618 C  CE2 . PHE A 1 730 ? 28.299 43.192 92.806  1.00 15.85 ? 731  PHE A CE2 1 
ATOM   5619 C  CZ  . PHE A 1 730 ? 28.187 43.930 91.626  1.00 15.64 ? 731  PHE A CZ  1 
ATOM   5620 N  N   . ASN A 1 731 ? 23.132 39.429 94.106  1.00 24.13 ? 732  ASN A N   1 
ATOM   5621 C  CA  . ASN A 1 731 ? 22.542 38.681 95.220  1.00 25.75 ? 732  ASN A CA  1 
ATOM   5622 C  C   . ASN A 1 731 ? 23.559 38.805 96.379  1.00 27.13 ? 732  ASN A C   1 
ATOM   5623 O  O   . ASN A 1 731 ? 24.565 39.500 96.179  1.00 27.61 ? 732  ASN A O   1 
ATOM   5624 C  CB  . ASN A 1 731 ? 22.318 37.202 94.811  1.00 25.38 ? 732  ASN A CB  1 
ATOM   5625 C  CG  . ASN A 1 731 ? 23.553 36.354 94.508  1.00 26.97 ? 732  ASN A CG  1 
ATOM   5626 O  OD1 . ASN A 1 731 ? 24.689 36.802 94.649  1.00 27.55 ? 732  ASN A OD1 1 
ATOM   5627 N  ND2 . ASN A 1 731 ? 23.444 35.106 94.059  1.00 27.02 ? 732  ASN A ND2 1 
ATOM   5628 N  N   . GLU A 1 732 ? 23.446 38.214 97.585  1.00 28.57 ? 733  GLU A N   1 
ATOM   5629 C  CA  . GLU A 1 732 ? 24.474 38.425 98.596  1.00 31.29 ? 733  GLU A CA  1 
ATOM   5630 C  C   . GLU A 1 732 ? 25.815 37.749 98.397  1.00 30.42 ? 733  GLU A C   1 
ATOM   5631 O  O   . GLU A 1 732 ? 26.791 38.177 99.012  1.00 29.92 ? 733  GLU A O   1 
ATOM   5632 C  CB  . GLU A 1 732 ? 23.943 38.052 100.002 1.00 35.80 ? 733  GLU A CB  1 
ATOM   5633 C  CG  . GLU A 1 732 ? 23.716 39.329 100.901 1.00 43.20 ? 733  GLU A CG  1 
ATOM   5634 C  CD  . GLU A 1 732 ? 24.922 40.229 101.280 1.00 47.12 ? 733  GLU A CD  1 
ATOM   5635 O  OE1 . GLU A 1 732 ? 26.074 39.772 101.190 1.00 48.96 ? 733  GLU A OE1 1 
ATOM   5636 O  OE2 . GLU A 1 732 ? 24.686 41.385 101.681 1.00 48.87 ? 733  GLU A OE2 1 
ATOM   5637 N  N   . THR A 1 733 ? 25.912 36.744 97.508  1.00 28.91 ? 734  THR A N   1 
ATOM   5638 C  CA  . THR A 1 733 ? 27.173 36.079 97.152  1.00 26.83 ? 734  THR A CA  1 
ATOM   5639 C  C   . THR A 1 733 ? 28.097 37.108 96.504  1.00 25.60 ? 734  THR A C   1 
ATOM   5640 O  O   . THR A 1 733 ? 29.267 37.230 96.841  1.00 25.55 ? 734  THR A O   1 
ATOM   5641 C  CB  . THR A 1 733 ? 26.865 34.934 96.168  1.00 26.85 ? 734  THR A CB  1 
ATOM   5642 O  OG1 . THR A 1 733 ? 26.277 33.903 96.957  1.00 28.89 ? 734  THR A OG1 1 
ATOM   5643 C  CG2 . THR A 1 733 ? 28.072 34.378 95.439  1.00 25.66 ? 734  THR A CG2 1 
ATOM   5644 N  N   . GLN A 1 734 ? 27.471 37.824 95.567  1.00 23.30 ? 735  GLN A N   1 
ATOM   5645 C  CA  . GLN A 1 734 ? 28.063 38.815 94.723  1.00 20.83 ? 735  GLN A CA  1 
ATOM   5646 C  C   . GLN A 1 734 ? 28.457 40.062 95.480  1.00 21.10 ? 735  GLN A C   1 
ATOM   5647 O  O   . GLN A 1 734 ? 29.477 40.687 95.149  1.00 20.33 ? 735  GLN A O   1 
ATOM   5648 C  CB  . GLN A 1 734 ? 27.056 39.098 93.624  1.00 20.31 ? 735  GLN A CB  1 
ATOM   5649 C  CG  . GLN A 1 734 ? 26.819 37.803 92.840  1.00 19.61 ? 735  GLN A CG  1 
ATOM   5650 C  CD  . GLN A 1 734 ? 25.927 37.841 91.617  1.00 19.59 ? 735  GLN A CD  1 
ATOM   5651 O  OE1 . GLN A 1 734 ? 25.355 38.868 91.282  1.00 20.91 ? 735  GLN A OE1 1 
ATOM   5652 N  NE2 . GLN A 1 734 ? 25.771 36.708 90.927  1.00 20.11 ? 735  GLN A NE2 1 
ATOM   5653 N  N   . ILE A 1 735 ? 27.730 40.414 96.551  1.00 21.29 ? 736  ILE A N   1 
ATOM   5654 C  CA  . ILE A 1 735 ? 28.089 41.638 97.272  1.00 22.26 ? 736  ILE A CA  1 
ATOM   5655 C  C   . ILE A 1 735 ? 29.358 41.379 98.095  1.00 22.92 ? 736  ILE A C   1 
ATOM   5656 O  O   . ILE A 1 735 ? 30.200 42.266 98.306  1.00 23.37 ? 736  ILE A O   1 
ATOM   5657 C  CB  . ILE A 1 735 ? 26.852 42.114 98.158  1.00 21.51 ? 736  ILE A CB  1 
ATOM   5658 C  CG1 . ILE A 1 735 ? 25.759 42.678 97.268  1.00 19.10 ? 736  ILE A CG1 1 
ATOM   5659 C  CG2 . ILE A 1 735 ? 27.242 43.233 99.112  1.00 21.53 ? 736  ILE A CG2 1 
ATOM   5660 C  CD1 . ILE A 1 735 ? 24.438 42.574 98.004  1.00 17.24 ? 736  ILE A CD1 1 
ATOM   5661 N  N   . GLU A 1 736 ? 29.554 40.134 98.539  1.00 23.06 ? 737  GLU A N   1 
ATOM   5662 C  CA  . GLU A 1 736 ? 30.794 39.789 99.209  1.00 22.82 ? 737  GLU A CA  1 
ATOM   5663 C  C   . GLU A 1 736 ? 32.002 39.862 98.275  1.00 20.56 ? 737  GLU A C   1 
ATOM   5664 O  O   . GLU A 1 736 ? 33.115 40.091 98.735  1.00 20.69 ? 737  GLU A O   1 
ATOM   5665 C  CB  . GLU A 1 736 ? 30.633 38.400 99.813  1.00 26.03 ? 737  GLU A CB  1 
ATOM   5666 C  CG  . GLU A 1 736 ? 29.615 38.398 100.969 1.00 32.24 ? 737  GLU A CG  1 
ATOM   5667 C  CD  . GLU A 1 736 ? 30.092 38.947 102.314 1.00 37.29 ? 737  GLU A CD  1 
ATOM   5668 O  OE1 . GLU A 1 736 ? 31.291 39.225 102.442 1.00 41.02 ? 737  GLU A OE1 1 
ATOM   5669 O  OE2 . GLU A 1 736 ? 29.271 39.086 103.240 1.00 39.62 ? 737  GLU A OE2 1 
ATOM   5670 N  N   . TRP A 1 737 ? 31.800 39.710 96.965  1.00 20.04 ? 738  TRP A N   1 
ATOM   5671 C  CA  . TRP A 1 737 ? 32.874 39.752 95.980  1.00 19.11 ? 738  TRP A CA  1 
ATOM   5672 C  C   . TRP A 1 737 ? 33.363 41.207 95.889  1.00 19.96 ? 738  TRP A C   1 
ATOM   5673 O  O   . TRP A 1 737 ? 34.571 41.459 95.982  1.00 20.56 ? 738  TRP A O   1 
ATOM   5674 C  CB  . TRP A 1 737 ? 32.403 39.322 94.562  1.00 17.08 ? 738  TRP A CB  1 
ATOM   5675 C  CG  . TRP A 1 737 ? 31.947 37.878 94.283  1.00 14.71 ? 738  TRP A CG  1 
ATOM   5676 C  CD1 . TRP A 1 737 ? 32.136 36.859 95.192  1.00 13.26 ? 738  TRP A CD1 1 
ATOM   5677 C  CD2 . TRP A 1 737 ? 31.293 37.451 93.132  1.00 10.93 ? 738  TRP A CD2 1 
ATOM   5678 N  NE1 . TRP A 1 737 ? 31.588 35.811 94.621  1.00 12.80 ? 738  TRP A NE1 1 
ATOM   5679 C  CE2 . TRP A 1 737 ? 31.083 36.101 93.407  1.00 9.89  ? 738  TRP A CE2 1 
ATOM   5680 C  CE3 . TRP A 1 737 ? 30.836 37.991 91.915  1.00 10.13 ? 738  TRP A CE3 1 
ATOM   5681 C  CZ2 . TRP A 1 737 ? 30.430 35.280 92.492  1.00 6.83  ? 738  TRP A CZ2 1 
ATOM   5682 C  CZ3 . TRP A 1 737 ? 30.159 37.171 90.971  1.00 8.43  ? 738  TRP A CZ3 1 
ATOM   5683 C  CH2 . TRP A 1 737 ? 29.962 35.807 91.272  1.00 7.57  ? 738  TRP A CH2 1 
ATOM   5684 N  N   . PHE A 1 738 ? 32.397 42.138 95.720  1.00 20.18 ? 739  PHE A N   1 
ATOM   5685 C  CA  . PHE A 1 738 ? 32.619 43.560 95.669  1.00 19.97 ? 739  PHE A CA  1 
ATOM   5686 C  C   . PHE A 1 738 ? 33.285 44.070 96.940  1.00 21.17 ? 739  PHE A C   1 
ATOM   5687 O  O   . PHE A 1 738 ? 34.315 44.744 96.833  1.00 20.33 ? 739  PHE A O   1 
ATOM   5688 C  CB  . PHE A 1 738 ? 31.277 44.271 95.462  1.00 19.97 ? 739  PHE A CB  1 
ATOM   5689 C  CG  . PHE A 1 738 ? 31.401 45.788 95.609  1.00 20.48 ? 739  PHE A CG  1 
ATOM   5690 C  CD1 . PHE A 1 738 ? 32.097 46.572 94.662  1.00 20.33 ? 739  PHE A CD1 1 
ATOM   5691 C  CD2 . PHE A 1 738 ? 30.930 46.395 96.789  1.00 21.13 ? 739  PHE A CD2 1 
ATOM   5692 C  CE1 . PHE A 1 738 ? 32.331 47.939 94.916  1.00 20.78 ? 739  PHE A CE1 1 
ATOM   5693 C  CE2 . PHE A 1 738 ? 31.170 47.754 97.026  1.00 20.63 ? 739  PHE A CE2 1 
ATOM   5694 C  CZ  . PHE A 1 738 ? 31.876 48.537 96.097  1.00 20.41 ? 739  PHE A CZ  1 
ATOM   5695 N  N   . ARG A 1 739 ? 32.735 43.833 98.151  1.00 23.14 ? 740  ARG A N   1 
ATOM   5696 C  CA  . ARG A 1 739 ? 33.355 44.339 99.387  1.00 24.70 ? 740  ARG A CA  1 
ATOM   5697 C  C   . ARG A 1 739 ? 34.830 43.889 99.521  1.00 23.82 ? 740  ARG A C   1 
ATOM   5698 O  O   . ARG A 1 739 ? 35.671 44.673 99.957  1.00 23.72 ? 740  ARG A O   1 
ATOM   5699 C  CB  . ARG A 1 739 ? 32.575 43.869 100.638 1.00 27.81 ? 740  ARG A CB  1 
ATOM   5700 C  CG  . ARG A 1 739 ? 31.152 44.377 100.815 1.00 33.23 ? 740  ARG A CG  1 
ATOM   5701 C  CD  . ARG A 1 739 ? 30.550 44.129 102.231 1.00 38.66 ? 740  ARG A CD  1 
ATOM   5702 N  NE  . ARG A 1 739 ? 29.863 42.848 102.431 1.00 45.13 ? 740  ARG A NE  1 
ATOM   5703 C  CZ  . ARG A 1 739 ? 28.527 42.721 102.408 1.00 48.07 ? 740  ARG A CZ  1 
ATOM   5704 N  NH1 . ARG A 1 739 ? 27.677 43.727 102.259 1.00 49.30 ? 740  ARG A NH1 1 
ATOM   5705 N  NH2 . ARG A 1 739 ? 27.974 41.526 102.539 1.00 49.85 ? 740  ARG A NH2 1 
ATOM   5706 N  N   . ALA A 1 740 ? 35.179 42.653 99.072  1.00 21.85 ? 741  ALA A N   1 
ATOM   5707 C  CA  . ALA A 1 740 ? 36.520 42.082 99.117  1.00 18.86 ? 741  ALA A CA  1 
ATOM   5708 C  C   . ALA A 1 740 ? 37.480 42.554 98.021  1.00 17.82 ? 741  ALA A C   1 
ATOM   5709 O  O   . ALA A 1 740 ? 38.707 42.448 98.119  1.00 17.72 ? 741  ALA A O   1 
ATOM   5710 C  CB  . ALA A 1 740 ? 36.331 40.566 99.058  1.00 16.83 ? 741  ALA A CB  1 
ATOM   5711 N  N   . GLY A 1 741 ? 36.948 43.002 96.898  1.00 16.69 ? 742  GLY A N   1 
ATOM   5712 C  CA  . GLY A 1 741 ? 37.796 43.478 95.828  1.00 17.86 ? 742  GLY A CA  1 
ATOM   5713 C  C   . GLY A 1 741 ? 37.679 42.714 94.526  1.00 18.45 ? 742  GLY A C   1 
ATOM   5714 O  O   . GLY A 1 741 ? 37.955 43.231 93.441  1.00 17.92 ? 742  GLY A O   1 
ATOM   5715 N  N   . SER A 1 742 ? 37.290 41.448 94.663  1.00 19.44 ? 743  SER A N   1 
ATOM   5716 C  CA  . SER A 1 742 ? 37.139 40.521 93.545  1.00 19.35 ? 743  SER A CA  1 
ATOM   5717 C  C   . SER A 1 742 ? 36.713 39.199 94.184  1.00 19.56 ? 743  SER A C   1 
ATOM   5718 O  O   . SER A 1 742 ? 36.854 38.952 95.391  1.00 20.14 ? 743  SER A O   1 
ATOM   5719 C  CB  . SER A 1 742 ? 38.471 40.285 92.782  1.00 18.91 ? 743  SER A CB  1 
ATOM   5720 O  OG  . SER A 1 742 ? 39.453 39.720 93.643  1.00 17.72 ? 743  SER A OG  1 
ATOM   5721 N  N   . ALA A 1 743 ? 36.157 38.350 93.330  1.00 19.83 ? 744  ALA A N   1 
ATOM   5722 C  CA  . ALA A 1 743 ? 35.690 37.042 93.707  1.00 19.58 ? 744  ALA A CA  1 
ATOM   5723 C  C   . ALA A 1 743 ? 36.820 36.208 94.266  1.00 19.51 ? 744  ALA A C   1 
ATOM   5724 O  O   . ALA A 1 743 ? 36.613 35.521 95.255  1.00 20.23 ? 744  ALA A O   1 
ATOM   5725 C  CB  . ALA A 1 743 ? 35.105 36.384 92.495  1.00 18.50 ? 744  ALA A CB  1 
ATOM   5726 N  N   . LEU A 1 744 ? 37.993 36.288 93.638  1.00 19.81 ? 745  LEU A N   1 
ATOM   5727 C  CA  . LEU A 1 744 ? 39.199 35.615 94.057  1.00 20.00 ? 745  LEU A CA  1 
ATOM   5728 C  C   . LEU A 1 744 ? 39.749 36.138 95.351  1.00 20.04 ? 745  LEU A C   1 
ATOM   5729 O  O   . LEU A 1 744 ? 40.261 35.290 96.074  1.00 20.15 ? 745  LEU A O   1 
ATOM   5730 C  CB  . LEU A 1 744 ? 40.231 35.749 92.959  1.00 20.53 ? 745  LEU A CB  1 
ATOM   5731 C  CG  . LEU A 1 744 ? 41.546 34.973 92.875  1.00 21.56 ? 745  LEU A CG  1 
ATOM   5732 C  CD1 . LEU A 1 744 ? 41.516 33.544 93.362  1.00 20.71 ? 745  LEU A CD1 1 
ATOM   5733 C  CD2 . LEU A 1 744 ? 41.825 34.901 91.398  1.00 22.70 ? 745  LEU A CD2 1 
ATOM   5734 N  N   . ASN A 1 745 ? 39.718 37.453 95.676  1.00 20.09 ? 746  ASN A N   1 
ATOM   5735 C  CA  . ASN A 1 745 ? 40.146 37.917 96.999  1.00 19.78 ? 746  ASN A CA  1 
ATOM   5736 C  C   . ASN A 1 745 ? 39.184 37.377 98.071  1.00 21.12 ? 746  ASN A C   1 
ATOM   5737 O  O   . ASN A 1 745 ? 39.633 37.090 99.176  1.00 21.39 ? 746  ASN A O   1 
ATOM   5738 C  CB  . ASN A 1 745 ? 40.124 39.424 97.125  1.00 18.31 ? 746  ASN A CB  1 
ATOM   5739 C  CG  . ASN A 1 745 ? 41.131 40.286 96.393  1.00 17.28 ? 746  ASN A CG  1 
ATOM   5740 O  OD1 . ASN A 1 745 ? 42.068 39.836 95.770  1.00 17.62 ? 746  ASN A OD1 1 
ATOM   5741 N  ND2 . ASN A 1 745 ? 40.943 41.595 96.397  1.00 18.20 ? 746  ASN A ND2 1 
ATOM   5742 N  N   . ARG A 1 746 ? 37.870 37.254 97.808  1.00 22.13 ? 747  ARG A N   1 
ATOM   5743 C  CA  . ARG A 1 746 ? 36.890 36.618 98.692  1.00 24.44 ? 747  ARG A CA  1 
ATOM   5744 C  C   . ARG A 1 746 ? 37.208 35.147 98.937  1.00 25.92 ? 747  ARG A C   1 
ATOM   5745 O  O   . ARG A 1 746 ? 37.109 34.669 100.062 1.00 25.94 ? 747  ARG A O   1 
ATOM   5746 C  CB  . ARG A 1 746 ? 35.492 36.646 98.095  1.00 25.20 ? 747  ARG A CB  1 
ATOM   5747 C  CG  . ARG A 1 746 ? 34.341 36.920 99.038  1.00 28.30 ? 747  ARG A CG  1 
ATOM   5748 C  CD  . ARG A 1 746 ? 33.988 35.934 100.130 1.00 29.91 ? 747  ARG A CD  1 
ATOM   5749 N  NE  . ARG A 1 746 ? 34.337 36.482 101.440 1.00 34.04 ? 747  ARG A NE  1 
ATOM   5750 C  CZ  . ARG A 1 746 ? 33.603 36.314 102.565 1.00 35.05 ? 747  ARG A CZ  1 
ATOM   5751 N  NH1 . ARG A 1 746 ? 32.401 35.761 102.571 1.00 33.68 ? 747  ARG A NH1 1 
ATOM   5752 N  NH2 . ARG A 1 746 ? 34.077 36.789 103.725 1.00 36.13 ? 747  ARG A NH2 1 
ATOM   5753 N  N   . MET A 1 747 ? 37.531 34.375 97.892  1.00 28.39 ? 748  MET A N   1 
ATOM   5754 C  CA  . MET A 1 747 ? 37.825 32.964 97.991  1.00 31.64 ? 748  MET A CA  1 
ATOM   5755 C  C   . MET A 1 747 ? 39.041 32.720 98.887  1.00 34.50 ? 748  MET A C   1 
ATOM   5756 O  O   . MET A 1 747 ? 39.018 31.810 99.727  1.00 35.41 ? 748  MET A O   1 
ATOM   5757 C  CB  . MET A 1 747 ? 38.067 32.455 96.615  1.00 32.53 ? 748  MET A CB  1 
ATOM   5758 C  CG  . MET A 1 747 ? 38.390 30.975 96.593  1.00 35.67 ? 748  MET A CG  1 
ATOM   5759 S  SD  . MET A 1 747 ? 39.053 30.415 94.996  1.00 36.57 ? 748  MET A SD  1 
ATOM   5760 C  CE  . MET A 1 747 ? 37.655 30.808 93.980  1.00 36.97 ? 748  MET A CE  1 
ATOM   5761 N  N   . LYS A 1 748 ? 40.072 33.587 98.765  1.00 36.12 ? 749  LYS A N   1 
ATOM   5762 C  CA  . LYS A 1 748 ? 41.264 33.493 99.593  1.00 37.07 ? 749  LYS A CA  1 
ATOM   5763 C  C   . LYS A 1 748 ? 40.987 33.851 101.036 1.00 37.88 ? 749  LYS A C   1 
ATOM   5764 O  O   . LYS A 1 748 ? 41.544 33.155 101.869 1.00 38.49 ? 749  LYS A O   1 
ATOM   5765 C  CB  . LYS A 1 748 ? 42.387 34.389 99.056  1.00 37.01 ? 749  LYS A CB  1 
ATOM   5766 C  CG  . LYS A 1 748 ? 42.837 33.714 97.754  1.00 38.48 ? 749  LYS A CG  1 
ATOM   5767 C  CD  . LYS A 1 748 ? 44.351 33.703 97.570  1.00 40.18 ? 749  LYS A CD  1 
ATOM   5768 C  CE  . LYS A 1 748 ? 45.211 32.953 98.670  1.00 41.60 ? 749  LYS A CE  1 
ATOM   5769 N  NZ  . LYS A 1 748 ? 45.217 31.488 98.660  1.00 40.97 ? 749  LYS A NZ  1 
ATOM   5770 N  N   . GLU A 1 749 ? 40.160 34.827 101.435 1.00 39.06 ? 750  GLU A N   1 
ATOM   5771 C  CA  . GLU A 1 749 ? 39.836 35.064 102.840 1.00 40.52 ? 750  GLU A CA  1 
ATOM   5772 C  C   . GLU A 1 749 ? 39.233 33.800 103.468 1.00 42.92 ? 750  GLU A C   1 
ATOM   5773 O  O   . GLU A 1 749 ? 39.619 33.416 104.573 1.00 42.85 ? 750  GLU A O   1 
ATOM   5774 C  CB  . GLU A 1 749 ? 38.806 36.152 103.038 1.00 38.97 ? 750  GLU A CB  1 
ATOM   5775 C  CG  . GLU A 1 749 ? 38.868 37.460 102.252 1.00 39.35 ? 750  GLU A CG  1 
ATOM   5776 C  CD  . GLU A 1 749 ? 37.671 38.432 102.524 1.00 40.61 ? 750  GLU A CD  1 
ATOM   5777 O  OE1 . GLU A 1 749 ? 36.573 37.987 102.887 1.00 40.69 ? 750  GLU A OE1 1 
ATOM   5778 O  OE2 . GLU A 1 749 ? 37.802 39.655 102.374 1.00 40.43 ? 750  GLU A OE2 1 
ATOM   5779 N  N   . LEU A 1 750 ? 38.322 33.109 102.746 1.00 46.00 ? 751  LEU A N   1 
ATOM   5780 C  CA  . LEU A 1 750 ? 37.677 31.898 103.217 1.00 48.91 ? 751  LEU A CA  1 
ATOM   5781 C  C   . LEU A 1 750 ? 38.579 30.711 103.522 1.00 52.33 ? 751  LEU A C   1 
ATOM   5782 O  O   . LEU A 1 750 ? 38.218 29.863 104.341 1.00 52.34 ? 751  LEU A O   1 
ATOM   5783 C  CB  . LEU A 1 750 ? 36.634 31.511 102.203 1.00 47.19 ? 751  LEU A CB  1 
ATOM   5784 C  CG  . LEU A 1 750 ? 35.347 32.322 102.218 1.00 45.27 ? 751  LEU A CG  1 
ATOM   5785 C  CD1 . LEU A 1 750 ? 34.428 31.827 101.111 1.00 44.83 ? 751  LEU A CD1 1 
ATOM   5786 C  CD2 . LEU A 1 750 ? 34.648 32.166 103.557 1.00 44.81 ? 751  LEU A CD2 1 
ATOM   5787 N  N   . GLN A 1 751 ? 39.753 30.642 102.898 1.00 56.78 ? 752  GLN A N   1 
ATOM   5788 C  CA  . GLN A 1 751 ? 40.733 29.643 103.275 1.00 61.92 ? 752  GLN A CA  1 
ATOM   5789 C  C   . GLN A 1 751 ? 41.421 30.131 104.579 1.00 66.12 ? 752  GLN A C   1 
ATOM   5790 O  O   . GLN A 1 751 ? 42.604 30.459 104.564 1.00 66.67 ? 752  GLN A O   1 
ATOM   5791 C  CB  . GLN A 1 751 ? 41.728 29.501 102.131 1.00 61.57 ? 752  GLN A CB  1 
ATOM   5792 C  CG  . GLN A 1 751 ? 41.186 29.269 100.706 1.00 61.56 ? 752  GLN A CG  1 
ATOM   5793 C  CD  . GLN A 1 751 ? 42.254 29.558 99.644  1.00 61.68 ? 752  GLN A CD  1 
ATOM   5794 O  OE1 . GLN A 1 751 ? 43.383 29.933 99.967  1.00 62.22 ? 752  GLN A OE1 1 
ATOM   5795 N  NE2 . GLN A 1 751 ? 41.959 29.443 98.350  1.00 61.38 ? 752  GLN A NE2 1 
ATOM   5796 N  N   . GLN A 1 752 ? 40.696 30.264 105.717 1.00 71.30 ? 753  GLN A N   1 
ATOM   5797 C  CA  . GLN A 1 752 ? 41.108 30.647 107.088 1.00 76.18 ? 753  GLN A CA  1 
ATOM   5798 C  C   . GLN A 1 752 ? 42.401 31.419 107.429 1.00 79.24 ? 753  GLN A C   1 
ATOM   5799 O  O   . GLN A 1 752 ? 43.115 31.155 108.409 1.00 80.47 ? 753  GLN A O   1 
ATOM   5800 C  CB  . GLN A 1 752 ? 41.031 29.344 107.944 1.00 76.84 ? 753  GLN A CB  1 
ATOM   5801 C  CG  . GLN A 1 752 ? 42.158 28.319 107.814 1.00 78.18 ? 753  GLN A CG  1 
ATOM   5802 C  CD  . GLN A 1 752 ? 41.788 26.876 108.165 1.00 79.05 ? 753  GLN A CD  1 
ATOM   5803 O  OE1 . GLN A 1 752 ? 40.885 26.284 107.597 1.00 79.78 ? 753  GLN A OE1 1 
ATOM   5804 N  NE2 . GLN A 1 752 ? 42.429 26.166 109.079 1.00 79.14 ? 753  GLN A NE2 1 
ATOM   5805 N  N   . LYS A 1 753 ? 42.641 32.457 106.614 1.00 82.05 ? 754  LYS A N   1 
ATOM   5806 C  CA  . LYS A 1 753 ? 43.778 33.382 106.664 1.00 84.29 ? 754  LYS A CA  1 
ATOM   5807 C  C   . LYS A 1 753 ? 43.671 34.442 105.539 1.00 84.62 ? 754  LYS A C   1 
ATOM   5808 O  O   . LYS A 1 753 ? 42.609 34.566 104.922 1.00 84.84 ? 754  LYS A O   1 
ATOM   5809 C  CB  . LYS A 1 753 ? 45.147 32.567 106.588 1.00 85.86 ? 754  LYS A CB  1 
ATOM   5810 C  CG  . LYS A 1 753 ? 45.493 31.506 105.519 1.00 87.63 ? 754  LYS A CG  1 
ATOM   5811 C  CD  . LYS A 1 753 ? 45.984 32.086 104.178 1.00 89.30 ? 754  LYS A CD  1 
ATOM   5812 C  CE  . LYS A 1 753 ? 45.002 31.970 103.006 1.00 89.95 ? 754  LYS A CE  1 
ATOM   5813 N  NZ  . LYS A 1 753 ? 43.736 32.613 103.280 1.00 89.65 ? 754  LYS A NZ  1 
ATOM   5814 O  OXT . LYS A 1 753 ? 44.631 35.165 105.280 1.00 84.85 ? 754  LYS A OXT 1 
HETATM 5815 C  CAC . FLC B 2 .   ? 34.563 34.058 72.563  1.00 19.85 ? 756  FLC A CAC 1 
HETATM 5816 C  CA  . FLC B 2 .   ? 35.802 33.947 72.064  1.00 21.40 ? 756  FLC A CA  1 
HETATM 5817 C  CB  . FLC B 2 .   ? 36.532 34.276 70.927  1.00 22.78 ? 756  FLC A CB  1 
HETATM 5818 C  CBC . FLC B 2 .   ? 35.803 34.949 69.839  1.00 21.65 ? 756  FLC A CBC 1 
HETATM 5819 C  CG  . FLC B 2 .   ? 37.723 35.097 71.435  1.00 24.59 ? 756  FLC A CG  1 
HETATM 5820 C  CGC . FLC B 2 .   ? 38.147 35.204 72.807  1.00 17.19 ? 756  FLC A CGC 1 
HETATM 5821 O  OA1 . FLC B 2 .   ? 34.532 34.322 73.772  1.00 20.73 ? 756  FLC A OA1 1 
HETATM 5822 O  OA2 . FLC B 2 .   ? 33.564 33.926 71.805  1.00 16.47 ? 756  FLC A OA2 1 
HETATM 5823 O  OB1 . FLC B 2 .   ? 35.471 34.302 68.785  1.00 21.20 ? 756  FLC A OB1 1 
HETATM 5824 O  OB2 . FLC B 2 .   ? 35.571 36.185 70.089  1.00 20.97 ? 756  FLC A OB2 1 
HETATM 5825 O  OG1 . FLC B 2 .   ? 39.272 34.829 73.168  1.00 20.75 ? 756  FLC A OG1 1 
HETATM 5826 O  OG2 . FLC B 2 .   ? 37.325 35.662 73.574  1.00 19.16 ? 756  FLC A OG2 1 
HETATM 5827 O  OHB . FLC B 2 .   ? 37.121 32.929 70.582  1.00 16.27 ? 756  FLC A OHB 1 
HETATM 5828 FE FE1 . SF4 C 3 .   ? 34.874 29.815 66.730  1.00 23.85 ? 755  SF4 A FE1 1 
HETATM 5829 FE FE2 . SF4 C 3 .   ? 36.069 31.865 65.590  1.00 20.46 ? 755  SF4 A FE2 1 
HETATM 5830 FE FE3 . SF4 C 3 .   ? 37.722 30.282 67.079  1.00 22.10 ? 755  SF4 A FE3 1 
HETATM 5831 FE FE4 . SF4 C 3 .   ? 35.738 32.220 68.523  1.00 27.65 ? 755  SF4 A FE4 1 
HETATM 5832 S  S1  . SF4 C 3 .   ? 37.607 32.604 67.199  1.00 17.75 ? 755  SF4 A S1  1 
HETATM 5833 S  S2  . SF4 C 3 .   ? 36.081 29.894 68.733  1.00 28.43 ? 755  SF4 A S2  1 
HETATM 5834 S  S3  . SF4 C 3 .   ? 34.084 31.976 66.856  1.00 21.04 ? 755  SF4 A S3  1 
HETATM 5835 S  S4  . SF4 C 3 .   ? 36.572 29.631 65.152  1.00 21.87 ? 755  SF4 A S4  1 
HETATM 5836 O  O   . O   D 4 .   ? 34.336 31.740 69.870  1.00 20.82 ? 1100 O   A O   1 
HETATM 5837 O  O   . HOH E 5 .   ? 31.332 23.115 72.895  1.00 2.02  ? 757  HOH A O   1 
HETATM 5838 O  O   . HOH E 5 .   ? 23.384 29.119 71.791  1.00 2.40  ? 758  HOH A O   1 
HETATM 5839 O  O   . HOH E 5 .   ? 44.299 34.388 78.633  1.00 4.02  ? 759  HOH A O   1 
HETATM 5840 O  O   . HOH E 5 .   ? 43.805 41.401 62.863  1.00 6.16  ? 760  HOH A O   1 
HETATM 5841 O  O   . HOH E 5 .   ? 24.164 23.194 74.895  1.00 6.63  ? 761  HOH A O   1 
HETATM 5842 O  O   . HOH E 5 .   ? 37.673 34.702 79.800  1.00 6.79  ? 762  HOH A O   1 
HETATM 5843 O  O   . HOH E 5 .   ? 30.537 52.035 70.005  1.00 7.74  ? 763  HOH A O   1 
HETATM 5844 O  O   . HOH E 5 .   ? 40.480 38.058 89.708  1.00 8.37  ? 764  HOH A O   1 
HETATM 5845 O  O   . HOH E 5 .   ? 24.273 44.532 88.197  1.00 8.49  ? 765  HOH A O   1 
HETATM 5846 O  O   . HOH E 5 .   ? 16.442 25.684 81.254  1.00 8.69  ? 766  HOH A O   1 
HETATM 5847 O  O   . HOH E 5 .   ? 24.578 31.135 73.187  1.00 8.78  ? 767  HOH A O   1 
HETATM 5848 O  O   . HOH E 5 .   ? 20.151 28.972 68.608  1.00 8.89  ? 768  HOH A O   1 
HETATM 5849 O  O   . HOH E 5 .   ? 36.438 33.100 91.084  1.00 8.93  ? 769  HOH A O   1 
HETATM 5850 O  O   . HOH E 5 .   ? 26.373 36.769 77.046  1.00 9.23  ? 770  HOH A O   1 
HETATM 5851 O  O   . HOH E 5 .   ? 21.758 34.892 78.305  1.00 9.53  ? 771  HOH A O   1 
HETATM 5852 O  O   . HOH E 5 .   ? 46.942 28.434 58.448  1.00 9.67  ? 772  HOH A O   1 
HETATM 5853 O  O   . HOH E 5 .   ? 31.053 21.061 70.935  1.00 9.79  ? 773  HOH A O   1 
HETATM 5854 O  O   . HOH E 5 .   ? 33.074 13.889 78.690  1.00 10.11 ? 774  HOH A O   1 
HETATM 5855 O  O   . HOH E 5 .   ? 45.431 29.632 60.542  1.00 10.49 ? 775  HOH A O   1 
HETATM 5856 O  O   . HOH E 5 .   ? 20.867 44.099 81.836  1.00 10.60 ? 776  HOH A O   1 
HETATM 5857 O  O   . HOH E 5 .   ? 36.886 19.441 79.103  1.00 11.01 ? 777  HOH A O   1 
HETATM 5858 O  O   . HOH E 5 .   ? 41.995 40.430 93.217  1.00 11.21 ? 778  HOH A O   1 
HETATM 5859 O  O   . HOH E 5 .   ? 40.192 47.626 71.782  1.00 11.33 ? 779  HOH A O   1 
HETATM 5860 O  O   . HOH E 5 .   ? 34.033 46.925 79.959  1.00 11.34 ? 780  HOH A O   1 
HETATM 5861 O  O   . HOH E 5 .   ? 26.338 22.543 59.510  1.00 11.62 ? 781  HOH A O   1 
HETATM 5862 O  O   . HOH E 5 .   ? 32.642 60.799 76.373  1.00 12.53 ? 782  HOH A O   1 
HETATM 5863 O  O   . HOH E 5 .   ? 32.120 11.613 75.273  1.00 12.82 ? 783  HOH A O   1 
HETATM 5864 O  O   . HOH E 5 .   ? 32.345 15.830 61.091  1.00 13.19 ? 784  HOH A O   1 
HETATM 5865 O  O   . HOH E 5 .   ? 17.726 51.192 81.773  1.00 13.40 ? 785  HOH A O   1 
HETATM 5866 O  O   . HOH E 5 .   ? 38.029 61.637 79.662  1.00 13.43 ? 786  HOH A O   1 
HETATM 5867 O  O   . HOH E 5 .   ? 20.538 32.588 82.024  1.00 13.46 ? 787  HOH A O   1 
HETATM 5868 O  O   . HOH E 5 .   ? 44.780 23.829 66.853  1.00 13.53 ? 788  HOH A O   1 
HETATM 5869 O  O   . HOH E 5 .   ? 33.095 40.281 70.962  1.00 13.81 ? 789  HOH A O   1 
HETATM 5870 O  O   . HOH E 5 .   ? 48.504 17.491 80.316  1.00 14.12 ? 790  HOH A O   1 
HETATM 5871 O  O   . HOH E 5 .   ? 26.889 32.526 74.352  1.00 14.12 ? 791  HOH A O   1 
HETATM 5872 O  O   . HOH E 5 .   ? 48.709 39.368 83.883  1.00 14.17 ? 792  HOH A O   1 
HETATM 5873 O  O   . HOH E 5 .   ? 21.714 43.843 84.393  1.00 14.22 ? 793  HOH A O   1 
HETATM 5874 O  O   . HOH E 5 .   ? 41.805 40.935 73.518  1.00 14.92 ? 794  HOH A O   1 
HETATM 5875 O  O   . HOH E 5 .   ? 26.988 19.492 59.320  1.00 14.99 ? 795  HOH A O   1 
HETATM 5876 O  O   . HOH E 5 .   ? 49.615 34.984 74.254  1.00 15.02 ? 796  HOH A O   1 
HETATM 5877 O  O   . HOH E 5 .   ? 48.990 34.750 89.271  1.00 15.69 ? 797  HOH A O   1 
HETATM 5878 O  O   . HOH E 5 .   ? 41.300 16.927 84.594  1.00 15.85 ? 798  HOH A O   1 
HETATM 5879 O  O   . HOH E 5 .   ? 27.088 32.424 85.710  1.00 15.85 ? 799  HOH A O   1 
HETATM 5880 O  O   . HOH E 5 .   ? 29.667 15.942 59.685  1.00 15.86 ? 800  HOH A O   1 
HETATM 5881 O  O   . HOH E 5 .   ? 23.927 39.974 72.809  1.00 16.01 ? 801  HOH A O   1 
HETATM 5882 O  O   . HOH E 5 .   ? 31.014 34.505 83.163  1.00 16.21 ? 802  HOH A O   1 
HETATM 5883 O  O   . HOH E 5 .   ? 36.324 37.259 85.361  1.00 16.50 ? 803  HOH A O   1 
HETATM 5884 O  O   . HOH E 5 .   ? 43.203 28.301 60.021  1.00 16.52 ? 804  HOH A O   1 
HETATM 5885 O  O   . HOH E 5 .   ? 38.865 42.279 67.763  1.00 16.57 ? 805  HOH A O   1 
HETATM 5886 O  O   . HOH E 5 .   ? 25.963 38.127 72.736  1.00 16.90 ? 806  HOH A O   1 
HETATM 5887 O  O   . HOH E 5 .   ? 42.938 68.784 71.605  1.00 17.22 ? 807  HOH A O   1 
HETATM 5888 O  O   . HOH E 5 .   ? 23.832 37.869 76.807  1.00 17.47 ? 808  HOH A O   1 
HETATM 5889 O  O   . HOH E 5 .   ? 35.376 62.901 75.237  1.00 17.50 ? 809  HOH A O   1 
HETATM 5890 O  O   . HOH E 5 .   ? 27.966 5.207  84.458  1.00 17.84 ? 810  HOH A O   1 
HETATM 5891 O  O   . HOH E 5 .   ? 19.438 43.197 93.145  1.00 18.09 ? 811  HOH A O   1 
HETATM 5892 O  O   . HOH E 5 .   ? 17.843 55.655 85.917  1.00 18.12 ? 812  HOH A O   1 
HETATM 5893 O  O   . HOH E 5 .   ? 38.010 37.488 90.923  1.00 18.19 ? 813  HOH A O   1 
HETATM 5894 O  O   . HOH E 5 .   ? 34.935 61.522 77.747  1.00 18.32 ? 814  HOH A O   1 
HETATM 5895 O  O   . HOH E 5 .   ? 41.507 42.489 64.011  1.00 18.57 ? 815  HOH A O   1 
HETATM 5896 O  O   . HOH E 5 .   ? 26.694 22.955 54.946  1.00 18.60 ? 816  HOH A O   1 
HETATM 5897 O  O   . HOH E 5 .   ? 28.927 39.203 77.023  1.00 18.69 ? 817  HOH A O   1 
HETATM 5898 O  O   . HOH E 5 .   ? 35.772 46.072 94.804  1.00 19.08 ? 818  HOH A O   1 
HETATM 5899 O  O   . HOH E 5 .   ? 43.260 39.257 91.002  1.00 19.13 ? 819  HOH A O   1 
HETATM 5900 O  O   . HOH E 5 .   ? 29.760 31.542 90.482  1.00 19.54 ? 820  HOH A O   1 
HETATM 5901 O  O   . HOH E 5 .   ? 34.492 41.672 60.089  1.00 20.16 ? 821  HOH A O   1 
HETATM 5902 O  O   . HOH E 5 .   ? 37.386 65.858 69.754  1.00 20.91 ? 822  HOH A O   1 
HETATM 5903 O  O   . HOH E 5 .   ? 22.846 61.392 75.041  1.00 20.93 ? 823  HOH A O   1 
HETATM 5904 O  O   . HOH E 5 .   ? 26.939 30.921 76.701  1.00 21.18 ? 824  HOH A O   1 
HETATM 5905 O  O   . HOH E 5 .   ? 33.196 16.530 63.679  1.00 21.30 ? 825  HOH A O   1 
HETATM 5906 O  O   . HOH E 5 .   ? 34.868 49.743 92.203  1.00 21.59 ? 826  HOH A O   1 
HETATM 5907 O  O   . HOH E 5 .   ? 29.248 23.564 64.480  1.00 21.59 ? 827  HOH A O   1 
HETATM 5908 O  O   . HOH E 5 .   ? 26.018 69.246 82.198  1.00 21.60 ? 828  HOH A O   1 
HETATM 5909 O  O   . HOH E 5 .   ? 36.245 57.017 64.302  1.00 21.68 ? 829  HOH A O   1 
HETATM 5910 O  O   . HOH E 5 .   ? 30.694 21.083 65.535  1.00 21.83 ? 830  HOH A O   1 
HETATM 5911 O  O   . HOH E 5 .   ? 17.497 33.305 48.856  1.00 21.92 ? 831  HOH A O   1 
HETATM 5912 O  O   . HOH E 5 .   ? 24.016 34.804 85.627  1.00 22.19 ? 832  HOH A O   1 
HETATM 5913 O  O   . HOH E 5 .   ? 35.980 9.939  72.887  1.00 22.19 ? 833  HOH A O   1 
HETATM 5914 O  O   . HOH E 5 .   ? 31.520 11.221 87.761  1.00 22.24 ? 834  HOH A O   1 
HETATM 5915 O  O   . HOH E 5 .   ? 14.194 23.981 52.535  1.00 22.51 ? 835  HOH A O   1 
HETATM 5916 O  O   . HOH E 5 .   ? 31.699 38.624 77.589  1.00 22.57 ? 836  HOH A O   1 
HETATM 5917 O  O   . HOH E 5 .   ? 24.332 12.722 62.208  1.00 22.94 ? 837  HOH A O   1 
HETATM 5918 O  O   . HOH E 5 .   ? 30.656 15.189 53.073  1.00 22.94 ? 838  HOH A O   1 
HETATM 5919 O  O   . HOH E 5 .   ? 40.566 14.308 78.352  1.00 22.99 ? 839  HOH A O   1 
HETATM 5920 O  O   . HOH E 5 .   ? 44.438 30.895 65.094  1.00 23.13 ? 840  HOH A O   1 
HETATM 5921 O  O   . HOH E 5 .   ? 39.111 14.619 67.957  1.00 23.20 ? 841  HOH A O   1 
HETATM 5922 O  O   . HOH E 5 .   ? 32.518 15.142 86.506  1.00 23.60 ? 842  HOH A O   1 
HETATM 5923 O  O   . HOH E 5 .   ? 40.293 34.454 80.364  1.00 23.72 ? 843  HOH A O   1 
HETATM 5924 O  O   . HOH E 5 .   ? 42.226 21.485 70.540  1.00 23.79 ? 844  HOH A O   1 
HETATM 5925 O  O   . HOH E 5 .   ? 39.924 49.839 89.739  1.00 23.91 ? 845  HOH A O   1 
HETATM 5926 O  O   . HOH E 5 .   ? 46.763 21.937 62.097  1.00 24.03 ? 846  HOH A O   1 
HETATM 5927 O  O   . HOH E 5 .   ? 13.037 32.447 53.818  1.00 24.13 ? 847  HOH A O   1 
HETATM 5928 O  O   . HOH E 5 .   ? 24.829 33.822 76.947  1.00 24.17 ? 848  HOH A O   1 
HETATM 5929 O  O   . HOH E 5 .   ? 15.471 57.660 87.479  1.00 24.23 ? 849  HOH A O   1 
HETATM 5930 O  O   . HOH E 5 .   ? 23.170 15.718 88.268  1.00 24.35 ? 850  HOH A O   1 
HETATM 5931 O  O   . HOH E 5 .   ? 33.754 39.965 79.180  1.00 24.93 ? 851  HOH A O   1 
HETATM 5932 O  O   . HOH E 5 .   ? 57.951 33.250 80.839  1.00 25.11 ? 852  HOH A O   1 
HETATM 5933 O  O   . HOH E 5 .   ? 19.435 15.231 75.479  1.00 25.15 ? 853  HOH A O   1 
HETATM 5934 O  O   . HOH E 5 .   ? 29.060 48.589 64.126  1.00 25.45 ? 854  HOH A O   1 
HETATM 5935 O  O   . HOH E 5 .   ? 4.710  15.854 81.776  1.00 25.56 ? 855  HOH A O   1 
HETATM 5936 O  O   . HOH E 5 .   ? 36.003 33.082 78.462  1.00 26.23 ? 856  HOH A O   1 
HETATM 5937 O  O   . HOH E 5 .   ? 31.717 43.803 58.472  1.00 26.54 ? 857  HOH A O   1 
HETATM 5938 O  O   . HOH E 5 .   ? 31.332 22.763 62.400  1.00 26.70 ? 858  HOH A O   1 
HETATM 5939 O  O   . HOH E 5 .   ? 38.382 47.959 69.714  1.00 26.75 ? 859  HOH A O   1 
HETATM 5940 O  O   . HOH E 5 .   ? 21.356 24.276 94.518  1.00 27.08 ? 860  HOH A O   1 
HETATM 5941 O  O   . HOH E 5 .   ? 30.594 46.049 64.830  1.00 27.18 ? 861  HOH A O   1 
HETATM 5942 O  O   . HOH E 5 .   ? 50.305 35.003 91.980  1.00 27.31 ? 862  HOH A O   1 
HETATM 5943 O  O   . HOH E 5 .   ? 42.339 15.129 48.610  1.00 27.64 ? 863  HOH A O   1 
HETATM 5944 O  O   . HOH E 5 .   ? 36.697 57.799 71.672  1.00 27.83 ? 864  HOH A O   1 
HETATM 5945 O  O   . HOH E 5 .   ? 50.656 44.677 86.066  1.00 27.90 ? 865  HOH A O   1 
HETATM 5946 O  O   . HOH E 5 .   ? 47.321 27.727 68.840  1.00 27.90 ? 866  HOH A O   1 
HETATM 5947 O  O   . HOH E 5 .   ? 43.097 31.403 46.965  1.00 27.98 ? 867  HOH A O   1 
HETATM 5948 O  O   . HOH E 5 .   ? 49.402 40.638 86.199  1.00 28.88 ? 868  HOH A O   1 
HETATM 5949 O  O   . HOH E 5 .   ? 41.523 31.628 44.099  1.00 29.14 ? 869  HOH A O   1 
HETATM 5950 O  O   . HOH E 5 .   ? 6.599  18.866 75.233  1.00 29.15 ? 870  HOH A O   1 
HETATM 5951 O  O   . HOH E 5 .   ? 24.697 38.275 84.832  1.00 29.90 ? 871  HOH A O   1 
HETATM 5952 O  O   . HOH E 5 .   ? 25.994 34.266 83.652  1.00 29.99 ? 872  HOH A O   1 
HETATM 5953 O  O   . HOH E 5 .   ? 24.439 6.468  85.019  1.00 30.13 ? 873  HOH A O   1 
HETATM 5954 O  O   . HOH E 5 .   ? 37.747 48.149 95.412  1.00 30.25 ? 874  HOH A O   1 
HETATM 5955 O  O   . HOH E 5 .   ? 33.407 37.014 59.428  1.00 30.28 ? 875  HOH A O   1 
HETATM 5956 O  O   . HOH E 5 .   ? 52.468 41.603 89.188  1.00 30.59 ? 876  HOH A O   1 
HETATM 5957 O  O   . HOH E 5 .   ? 25.246 24.726 57.350  1.00 30.67 ? 877  HOH A O   1 
HETATM 5958 O  O   . HOH E 5 .   ? 27.831 46.538 102.433 1.00 30.69 ? 878  HOH A O   1 
HETATM 5959 O  O   . HOH E 5 .   ? 37.116 54.975 71.989  1.00 30.82 ? 879  HOH A O   1 
HETATM 5960 O  O   . HOH E 5 .   ? 33.502 -0.272 83.327  1.00 30.84 ? 880  HOH A O   1 
HETATM 5961 O  O   . HOH E 5 .   ? 15.142 27.294 83.693  1.00 31.06 ? 881  HOH A O   1 
HETATM 5962 O  O   . HOH E 5 .   ? 32.852 32.960 93.725  1.00 31.07 ? 882  HOH A O   1 
HETATM 5963 O  O   . HOH E 5 .   ? 34.818 31.517 37.449  1.00 31.86 ? 883  HOH A O   1 
HETATM 5964 O  O   . HOH E 5 .   ? 29.700 67.695 78.605  1.00 31.90 ? 884  HOH A O   1 
HETATM 5965 O  O   . HOH E 5 .   ? 51.522 32.324 64.198  1.00 32.02 ? 885  HOH A O   1 
HETATM 5966 O  O   . HOH E 5 .   ? 31.577 43.355 92.492  1.00 32.19 ? 886  HOH A O   1 
HETATM 5967 O  O   . HOH E 5 .   ? 9.666  37.065 79.837  1.00 32.32 ? 887  HOH A O   1 
HETATM 5968 O  O   . HOH E 5 .   ? 39.813 40.131 66.066  1.00 32.34 ? 888  HOH A O   1 
HETATM 5969 O  O   . HOH E 5 .   ? 20.392 45.709 86.375  1.00 32.35 ? 889  HOH A O   1 
HETATM 5970 O  O   . HOH E 5 .   ? 31.568 1.035  78.345  1.00 32.40 ? 890  HOH A O   1 
HETATM 5971 O  O   . HOH E 5 .   ? 48.823 51.355 71.127  1.00 32.51 ? 891  HOH A O   1 
HETATM 5972 O  O   . HOH E 5 .   ? 38.363 30.349 109.042 1.00 32.54 ? 892  HOH A O   1 
HETATM 5973 O  O   . HOH E 5 .   ? 16.836 41.905 52.930  1.00 32.92 ? 893  HOH A O   1 
HETATM 5974 O  O   . HOH E 5 .   ? 11.732 15.114 71.403  1.00 32.95 ? 894  HOH A O   1 
HETATM 5975 O  O   . HOH E 5 .   ? 58.219 38.036 76.018  1.00 33.15 ? 895  HOH A O   1 
HETATM 5976 O  O   . HOH E 5 .   ? 16.595 48.866 85.250  1.00 33.65 ? 896  HOH A O   1 
HETATM 5977 O  O   . HOH E 5 .   ? 21.219 28.002 96.514  1.00 33.74 ? 897  HOH A O   1 
HETATM 5978 O  O   . HOH E 5 .   ? 47.932 18.975 62.412  1.00 33.76 ? 898  HOH A O   1 
HETATM 5979 O  O   . HOH E 5 .   ? 20.730 1.039  73.334  1.00 33.86 ? 899  HOH A O   1 
HETATM 5980 O  O   . HOH E 5 .   ? 56.129 24.599 71.864  1.00 34.11 ? 900  HOH A O   1 
HETATM 5981 O  O   . HOH E 5 .   ? 38.156 44.675 66.553  1.00 34.37 ? 901  HOH A O   1 
HETATM 5982 O  O   . HOH E 5 .   ? 16.681 65.320 90.951  1.00 34.52 ? 902  HOH A O   1 
HETATM 5983 O  O   . HOH E 5 .   ? 25.006 59.003 67.208  1.00 34.53 ? 903  HOH A O   1 
HETATM 5984 O  O   . HOH E 5 .   ? 25.527 36.969 87.696  1.00 34.86 ? 904  HOH A O   1 
HETATM 5985 O  O   . HOH E 5 .   ? 27.231 37.950 70.187  1.00 34.87 ? 905  HOH A O   1 
HETATM 5986 O  O   . HOH E 5 .   ? 25.501 27.754 99.681  1.00 35.07 ? 906  HOH A O   1 
HETATM 5987 O  O   . HOH E 5 .   ? 48.565 58.562 70.435  1.00 35.22 ? 907  HOH A O   1 
HETATM 5988 O  O   . HOH E 5 .   ? 8.058  18.940 71.610  1.00 35.46 ? 908  HOH A O   1 
HETATM 5989 O  O   . HOH E 5 .   ? 43.096 39.831 98.540  1.00 35.53 ? 909  HOH A O   1 
HETATM 5990 O  O   . HOH E 5 .   ? 18.778 31.431 47.204  1.00 35.82 ? 910  HOH A O   1 
HETATM 5991 O  O   . HOH E 5 .   ? 29.958 30.760 93.775  1.00 35.86 ? 911  HOH A O   1 
HETATM 5992 O  O   . HOH E 5 .   ? 9.730  38.835 64.202  1.00 35.90 ? 912  HOH A O   1 
HETATM 5993 O  O   . HOH E 5 .   ? 21.214 19.350 49.133  1.00 36.25 ? 913  HOH A O   1 
HETATM 5994 O  O   . HOH E 5 .   ? 55.997 38.700 84.459  1.00 36.52 ? 914  HOH A O   1 
HETATM 5995 O  O   . HOH E 5 .   ? 2.654  26.759 54.545  1.00 36.54 ? 915  HOH A O   1 
HETATM 5996 O  O   . HOH E 5 .   ? 20.529 34.506 95.733  1.00 36.73 ? 916  HOH A O   1 
HETATM 5997 O  O   . HOH E 5 .   ? 19.424 53.183 71.017  1.00 36.91 ? 917  HOH A O   1 
HETATM 5998 O  O   . HOH E 5 .   ? 35.498 44.915 59.345  1.00 37.03 ? 918  HOH A O   1 
HETATM 5999 O  O   . HOH E 5 .   ? 60.794 44.444 83.878  1.00 37.34 ? 919  HOH A O   1 
HETATM 6000 O  O   . HOH E 5 .   ? 45.563 61.756 78.124  1.00 37.39 ? 920  HOH A O   1 
HETATM 6001 O  O   . HOH E 5 .   ? 28.384 65.228 73.850  1.00 37.45 ? 921  HOH A O   1 
HETATM 6002 O  O   . HOH E 5 .   ? 41.370 15.431 65.635  1.00 37.48 ? 922  HOH A O   1 
HETATM 6003 O  O   . HOH E 5 .   ? 26.724 50.005 73.963  1.00 37.48 ? 923  HOH A O   1 
HETATM 6004 O  O   . HOH E 5 .   ? 38.486 29.160 60.704  1.00 37.74 ? 924  HOH A O   1 
HETATM 6005 O  O   . HOH E 5 .   ? 9.087  11.803 78.827  1.00 37.76 ? 925  HOH A O   1 
HETATM 6006 O  O   . HOH E 5 .   ? 16.307 39.873 95.444  1.00 37.79 ? 926  HOH A O   1 
HETATM 6007 O  O   . HOH E 5 .   ? 61.894 25.333 64.344  1.00 37.81 ? 927  HOH A O   1 
HETATM 6008 O  O   . HOH E 5 .   ? 1.229  25.970 82.943  1.00 37.90 ? 928  HOH A O   1 
HETATM 6009 O  O   . HOH E 5 .   ? 34.371 7.474  53.583  1.00 38.19 ? 929  HOH A O   1 
HETATM 6010 O  O   . HOH E 5 .   ? 27.819 53.253 55.041  1.00 38.21 ? 930  HOH A O   1 
HETATM 6011 O  O   . HOH E 5 .   ? 36.219 11.510 67.635  1.00 38.30 ? 931  HOH A O   1 
HETATM 6012 O  O   . HOH E 5 .   ? 50.456 66.503 82.719  1.00 38.35 ? 932  HOH A O   1 
HETATM 6013 O  O   . HOH E 5 .   ? 33.871 5.377  75.006  1.00 38.52 ? 933  HOH A O   1 
HETATM 6014 O  O   . HOH E 5 .   ? 46.871 51.628 68.867  1.00 38.56 ? 934  HOH A O   1 
HETATM 6015 O  O   . HOH E 5 .   ? 46.099 35.702 99.636  1.00 38.56 ? 935  HOH A O   1 
HETATM 6016 O  O   . HOH E 5 .   ? 8.260  12.556 81.695  1.00 38.74 ? 936  HOH A O   1 
HETATM 6017 O  O   . HOH E 5 .   ? 12.215 12.636 82.701  1.00 38.78 ? 937  HOH A O   1 
HETATM 6018 O  O   . HOH E 5 .   ? 54.030 40.299 56.959  1.00 38.87 ? 938  HOH A O   1 
HETATM 6019 O  O   . HOH E 5 .   ? 35.620 68.215 69.014  1.00 39.12 ? 939  HOH A O   1 
HETATM 6020 O  O   . HOH E 5 .   ? 51.484 47.457 71.825  1.00 39.40 ? 940  HOH A O   1 
HETATM 6021 O  O   . HOH E 5 .   ? 19.029 43.957 39.905  1.00 39.43 ? 941  HOH A O   1 
HETATM 6022 O  O   . HOH E 5 .   ? 17.024 19.064 46.598  1.00 39.51 ? 942  HOH A O   1 
HETATM 6023 O  O   . HOH E 5 .   ? 34.011 -0.272 80.399  1.00 39.52 ? 943  HOH A O   1 
HETATM 6024 O  O   . HOH E 5 .   ? 56.000 38.245 54.557  1.00 39.69 ? 944  HOH A O   1 
HETATM 6025 O  O   . HOH E 5 .   ? 31.429 68.925 86.982  1.00 39.73 ? 945  HOH A O   1 
HETATM 6026 O  O   . HOH E 5 .   ? 27.944 8.012  55.034  1.00 39.76 ? 946  HOH A O   1 
HETATM 6027 O  O   . HOH E 5 .   ? 44.421 43.677 98.569  1.00 39.96 ? 947  HOH A O   1 
HETATM 6028 O  O   . HOH E 5 .   ? 20.247 -0.691 87.567  1.00 39.98 ? 948  HOH A O   1 
HETATM 6029 O  O   . HOH E 5 .   ? 23.362 17.024 92.280  1.00 40.05 ? 949  HOH A O   1 
HETATM 6030 O  O   . HOH E 5 .   ? 12.751 9.389  89.026  1.00 40.21 ? 950  HOH A O   1 
HETATM 6031 O  O   . HOH E 5 .   ? 58.162 42.641 85.196  1.00 40.31 ? 951  HOH A O   1 
HETATM 6032 O  O   . HOH E 5 .   ? 22.751 27.802 52.873  1.00 40.41 ? 952  HOH A O   1 
HETATM 6033 O  O   . HOH E 5 .   ? 20.266 16.583 53.150  1.00 40.73 ? 953  HOH A O   1 
HETATM 6034 O  O   . HOH E 5 .   ? 34.268 36.049 62.877  1.00 40.85 ? 954  HOH A O   1 
HETATM 6035 O  O   . HOH E 5 .   ? 46.628 46.140 62.102  1.00 41.12 ? 955  HOH A O   1 
HETATM 6036 O  O   . HOH E 5 .   ? 29.715 13.525 86.309  1.00 41.17 ? 956  HOH A O   1 
HETATM 6037 O  O   . HOH E 5 .   ? 50.698 34.048 66.157  1.00 41.42 ? 957  HOH A O   1 
HETATM 6038 O  O   . HOH E 5 .   ? 30.725 52.564 64.064  1.00 41.43 ? 958  HOH A O   1 
HETATM 6039 O  O   . HOH E 5 .   ? 27.602 12.671 84.334  1.00 41.55 ? 959  HOH A O   1 
HETATM 6040 O  O   . HOH E 5 .   ? 42.536 37.511 42.437  1.00 41.57 ? 960  HOH A O   1 
HETATM 6041 O  O   . HOH E 5 .   ? 40.251 16.341 42.530  1.00 41.80 ? 961  HOH A O   1 
HETATM 6042 O  O   . HOH E 5 .   ? 20.673 36.386 81.802  1.00 41.80 ? 962  HOH A O   1 
HETATM 6043 O  O   . HOH E 5 .   ? 48.707 61.581 73.229  1.00 41.81 ? 963  HOH A O   1 
HETATM 6044 O  O   . HOH E 5 .   ? 20.021 1.465  90.874  1.00 42.17 ? 964  HOH A O   1 
HETATM 6045 O  O   . HOH E 5 .   ? 45.687 25.883 109.606 1.00 42.27 ? 965  HOH A O   1 
HETATM 6046 O  O   . HOH E 5 .   ? 24.355 36.138 103.097 1.00 42.28 ? 966  HOH A O   1 
HETATM 6047 O  O   . HOH E 5 .   ? 17.410 29.414 96.411  1.00 42.37 ? 967  HOH A O   1 
HETATM 6048 O  O   . HOH E 5 .   ? 18.841 41.104 81.361  1.00 42.39 ? 968  HOH A O   1 
HETATM 6049 O  O   . HOH E 5 .   ? 35.178 6.617  63.373  1.00 42.42 ? 969  HOH A O   1 
HETATM 6050 O  O   . HOH E 5 .   ? 56.790 43.321 72.891  1.00 42.43 ? 970  HOH A O   1 
HETATM 6051 O  O   . HOH E 5 .   ? 39.109 27.753 24.538  1.00 42.47 ? 971  HOH A O   1 
HETATM 6052 O  O   . HOH E 5 .   ? 42.157 49.934 63.048  1.00 42.50 ? 972  HOH A O   1 
HETATM 6053 O  O   . HOH E 5 .   ? 12.643 19.372 72.501  1.00 42.69 ? 973  HOH A O   1 
HETATM 6054 O  O   . HOH E 5 .   ? 48.530 41.933 62.087  1.00 42.77 ? 974  HOH A O   1 
HETATM 6055 O  O   . HOH E 5 .   ? 2.636  23.326 57.535  1.00 42.86 ? 975  HOH A O   1 
HETATM 6056 O  O   . HOH E 5 .   ? 43.903 55.330 67.618  1.00 42.94 ? 976  HOH A O   1 
HETATM 6057 O  O   . HOH E 5 .   ? 28.978 50.869 53.129  1.00 43.01 ? 977  HOH A O   1 
HETATM 6058 O  O   . HOH E 5 .   ? 19.859 20.062 41.743  1.00 43.04 ? 978  HOH A O   1 
HETATM 6059 O  O   . HOH E 5 .   ? 47.769 48.527 88.717  1.00 43.16 ? 979  HOH A O   1 
HETATM 6060 O  O   . HOH E 5 .   ? 26.845 34.864 88.939  1.00 43.17 ? 980  HOH A O   1 
HETATM 6061 O  O   . HOH E 5 .   ? 34.682 53.402 47.943  1.00 43.21 ? 981  HOH A O   1 
HETATM 6062 O  O   . HOH E 5 .   ? 31.289 15.933 47.451  1.00 43.23 ? 982  HOH A O   1 
HETATM 6063 O  O   . HOH E 5 .   ? -0.233 25.581 78.357  1.00 43.27 ? 983  HOH A O   1 
HETATM 6064 O  O   . HOH E 5 .   ? 33.168 38.876 39.284  1.00 43.32 ? 984  HOH A O   1 
HETATM 6065 O  O   . HOH E 5 .   ? 21.657 19.964 54.058  1.00 43.35 ? 985  HOH A O   1 
HETATM 6066 O  O   . HOH E 5 .   ? 16.043 14.803 99.522  1.00 43.46 ? 986  HOH A O   1 
HETATM 6067 O  O   . HOH E 5 .   ? 20.543 11.867 50.982  1.00 43.50 ? 987  HOH A O   1 
HETATM 6068 O  O   . HOH E 5 .   ? 26.295 21.031 32.237  1.00 43.56 ? 988  HOH A O   1 
HETATM 6069 O  O   . HOH E 5 .   ? 4.335  26.433 75.396  1.00 43.75 ? 989  HOH A O   1 
HETATM 6070 O  O   . HOH E 5 .   ? 43.594 47.231 66.252  1.00 43.78 ? 990  HOH A O   1 
HETATM 6071 O  O   . HOH E 5 .   ? 42.980 62.305 69.650  1.00 44.12 ? 991  HOH A O   1 
HETATM 6072 O  O   . HOH E 5 .   ? 33.826 18.985 93.927  1.00 44.22 ? 992  HOH A O   1 
HETATM 6073 O  O   . HOH E 5 .   ? 42.692 63.778 64.949  1.00 44.25 ? 993  HOH A O   1 
HETATM 6074 O  O   . HOH E 5 .   ? 37.732 70.175 83.981  1.00 44.26 ? 994  HOH A O   1 
HETATM 6075 O  O   . HOH E 5 .   ? 10.429 16.654 68.933  1.00 44.28 ? 995  HOH A O   1 
HETATM 6076 O  O   . HOH E 5 .   ? 45.260 12.712 69.787  1.00 44.32 ? 996  HOH A O   1 
HETATM 6077 O  O   . HOH E 5 .   ? 41.584 13.805 82.937  1.00 44.36 ? 997  HOH A O   1 
HETATM 6078 O  O   . HOH E 5 .   ? 23.430 48.797 71.070  1.00 44.36 ? 998  HOH A O   1 
HETATM 6079 O  O   . HOH E 5 .   ? 35.608 13.223 46.634  1.00 44.43 ? 999  HOH A O   1 
HETATM 6080 O  O   . HOH E 5 .   ? 23.978 63.292 73.222  1.00 44.45 ? 1000 HOH A O   1 
HETATM 6081 O  O   . HOH E 5 .   ? 22.725 71.534 94.680  1.00 44.54 ? 1001 HOH A O   1 
HETATM 6082 O  O   . HOH E 5 .   ? 11.546 37.839 72.136  1.00 44.57 ? 1002 HOH A O   1 
HETATM 6083 O  O   . HOH E 5 .   ? 18.686 18.501 98.216  1.00 44.61 ? 1003 HOH A O   1 
HETATM 6084 O  O   . HOH E 5 .   ? 11.652 11.968 87.258  1.00 44.67 ? 1004 HOH A O   1 
HETATM 6085 O  O   . HOH E 5 .   ? 12.756 44.167 88.914  1.00 44.68 ? 1005 HOH A O   1 
HETATM 6086 O  O   . HOH E 5 .   ? 33.659 34.993 84.982  1.00 44.73 ? 1006 HOH A O   1 
HETATM 6087 O  O   . HOH E 5 .   ? 54.271 44.247 53.072  1.00 44.74 ? 1007 HOH A O   1 
HETATM 6088 O  O   . HOH E 5 .   ? 50.368 48.235 86.530  1.00 44.78 ? 1008 HOH A O   1 
HETATM 6089 O  O   . HOH E 5 .   ? 25.444 16.773 89.666  1.00 44.78 ? 1009 HOH A O   1 
HETATM 6090 O  O   . HOH E 5 .   ? 14.561 9.581  66.859  1.00 44.91 ? 1010 HOH A O   1 
HETATM 6091 O  O   . HOH E 5 .   ? 40.650 14.294 86.218  1.00 45.02 ? 1011 HOH A O   1 
HETATM 6092 O  O   . HOH E 5 .   ? 47.964 43.171 89.076  1.00 45.15 ? 1012 HOH A O   1 
HETATM 6093 O  O   . HOH E 5 .   ? 57.820 9.261  86.840  1.00 45.43 ? 1013 HOH A O   1 
HETATM 6094 O  O   . HOH E 5 .   ? 1.946  23.787 80.398  1.00 45.52 ? 1014 HOH A O   1 
HETATM 6095 O  O   . HOH E 5 .   ? 46.125 63.491 74.619  1.00 45.64 ? 1015 HOH A O   1 
HETATM 6096 O  O   . HOH E 5 .   ? 32.344 55.337 63.021  1.00 45.64 ? 1016 HOH A O   1 
HETATM 6097 O  O   . HOH E 5 .   ? 51.733 35.419 97.109  1.00 45.74 ? 1017 HOH A O   1 
HETATM 6098 O  O   . HOH E 5 .   ? 17.525 32.330 94.527  1.00 45.89 ? 1018 HOH A O   1 
HETATM 6099 O  O   . HOH E 5 .   ? 60.847 34.194 65.640  1.00 46.05 ? 1019 HOH A O   1 
HETATM 6100 O  O   . HOH E 5 .   ? 26.727 50.329 57.204  1.00 46.30 ? 1020 HOH A O   1 
HETATM 6101 O  O   . HOH E 5 .   ? 57.060 41.109 55.639  1.00 46.50 ? 1021 HOH A O   1 
HETATM 6102 O  O   . HOH E 5 .   ? 64.502 30.108 65.216  1.00 46.50 ? 1022 HOH A O   1 
HETATM 6103 O  O   . HOH E 5 .   ? 55.103 39.432 66.908  1.00 46.58 ? 1023 HOH A O   1 
HETATM 6104 O  O   . HOH E 5 .   ? 17.964 40.017 88.011  1.00 46.61 ? 1024 HOH A O   1 
HETATM 6105 O  O   . HOH E 5 .   ? 18.382 36.151 41.931  1.00 46.64 ? 1025 HOH A O   1 
HETATM 6106 O  O   . HOH E 5 .   ? 34.938 32.269 95.873  1.00 46.68 ? 1026 HOH A O   1 
HETATM 6107 O  O   . HOH E 5 .   ? 14.712 41.936 74.040  1.00 46.68 ? 1027 HOH A O   1 
HETATM 6108 O  O   . HOH E 5 .   ? 18.498 47.433 92.060  1.00 46.76 ? 1028 HOH A O   1 
HETATM 6109 O  O   . HOH E 5 .   ? 21.482 40.044 42.066  1.00 46.78 ? 1029 HOH A O   1 
HETATM 6110 O  O   . HOH E 5 .   ? 44.900 11.323 49.523  1.00 46.85 ? 1030 HOH A O   1 
HETATM 6111 O  O   . HOH E 5 .   ? 14.305 40.932 54.074  1.00 46.85 ? 1031 HOH A O   1 
HETATM 6112 O  O   . HOH E 5 .   ? 32.706 35.633 105.757 1.00 46.86 ? 1032 HOH A O   1 
HETATM 6113 O  O   . HOH E 5 .   ? 24.880 46.911 58.765  1.00 46.91 ? 1033 HOH A O   1 
HETATM 6114 O  O   . HOH E 5 .   ? 48.472 48.238 59.837  1.00 47.03 ? 1034 HOH A O   1 
HETATM 6115 O  O   . HOH E 5 .   ? 48.964 45.720 49.149  1.00 47.09 ? 1035 HOH A O   1 
HETATM 6116 O  O   . HOH E 5 .   ? 52.579 22.523 72.000  1.00 47.10 ? 1036 HOH A O   1 
HETATM 6117 O  O   . HOH E 5 .   ? 47.361 23.207 52.037  1.00 47.23 ? 1037 HOH A O   1 
HETATM 6118 O  O   . HOH E 5 .   ? 1.442  23.074 75.607  1.00 47.31 ? 1038 HOH A O   1 
HETATM 6119 O  O   . HOH E 5 .   ? 44.430 30.772 112.880 1.00 47.46 ? 1039 HOH A O   1 
HETATM 6120 O  O   . HOH E 5 .   ? 31.259 19.964 90.090  1.00 47.48 ? 1040 HOH A O   1 
HETATM 6121 O  O   . HOH E 5 .   ? 6.391  12.390 83.929  1.00 47.48 ? 1041 HOH A O   1 
HETATM 6122 O  O   . HOH E 5 .   ? 16.950 45.202 87.286  1.00 47.55 ? 1042 HOH A O   1 
HETATM 6123 O  O   . HOH E 5 .   ? 37.480 18.685 33.093  1.00 47.62 ? 1043 HOH A O   1 
HETATM 6124 O  O   . HOH E 5 .   ? 59.086 31.736 60.438  1.00 47.74 ? 1044 HOH A O   1 
HETATM 6125 O  O   . HOH E 5 .   ? 29.490 13.363 48.550  1.00 47.88 ? 1045 HOH A O   1 
HETATM 6126 O  O   . HOH E 5 .   ? 35.346 64.314 79.786  1.00 48.31 ? 1046 HOH A O   1 
HETATM 6127 O  O   . HOH E 5 .   ? 38.341 65.575 88.500  1.00 48.31 ? 1047 HOH A O   1 
HETATM 6128 O  O   . HOH E 5 .   ? 15.219 49.542 47.217  1.00 48.46 ? 1048 HOH A O   1 
HETATM 6129 O  O   . HOH E 5 .   ? 26.213 14.361 86.848  1.00 48.52 ? 1049 HOH A O   1 
HETATM 6130 O  O   . HOH E 5 .   ? 15.521 66.183 88.476  1.00 48.64 ? 1050 HOH A O   1 
HETATM 6131 O  O   . HOH E 5 .   ? 36.832 8.083  66.132  1.00 48.84 ? 1051 HOH A O   1 
HETATM 6132 O  O   . HOH E 5 .   ? 41.894 31.051 41.179  1.00 49.05 ? 1052 HOH A O   1 
HETATM 6133 O  O   . HOH E 5 .   ? 48.298 38.527 63.398  1.00 49.14 ? 1053 HOH A O   1 
HETATM 6134 O  O   . HOH E 5 .   ? 4.856  23.494 72.607  1.00 49.18 ? 1054 HOH A O   1 
HETATM 6135 O  O   . HOH E 5 .   ? 44.193 43.362 45.153  1.00 49.22 ? 1055 HOH A O   1 
HETATM 6136 O  O   . HOH E 5 .   ? 29.912 51.803 59.204  1.00 49.32 ? 1056 HOH A O   1 
HETATM 6137 O  O   . HOH E 5 .   ? 15.787 39.301 80.589  1.00 49.34 ? 1057 HOH A O   1 
HETATM 6138 O  O   . HOH E 5 .   ? 32.473 11.003 45.450  1.00 49.36 ? 1058 HOH A O   1 
HETATM 6139 O  O   . HOH E 5 .   ? 3.750  20.013 54.644  1.00 49.41 ? 1059 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   2   2   ARG ARG A . n 
A 1 2   ALA 2   3   3   ALA ALA A . n 
A 1 3   LYS 3   4   4   LYS LYS A . n 
A 1 4   VAL 4   5   5   VAL VAL A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   MET 6   7   7   MET MET A . n 
A 1 7   SER 7   8   8   SER SER A . n 
A 1 8   HIS 8   9   9   HIS HIS A . n 
A 1 9   PHE 9   10  10  PHE PHE A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  PRO 11  12  12  PRO PRO A . n 
A 1 12  HIS 12  13  13  HIS HIS A . n 
A 1 13  GLU 13  14  14  GLU GLU A . n 
A 1 14  TYR 14  15  15  TYR TYR A . n 
A 1 15  ILE 15  16  16  ILE ILE A . n 
A 1 16  ARG 16  17  17  ARG ARG A . n 
A 1 17  TYR 17  18  18  TYR TYR A . n 
A 1 18  ASP 18  19  19  ASP ASP A . n 
A 1 19  LEU 19  20  20  LEU LEU A . n 
A 1 20  LEU 20  21  21  LEU LEU A . n 
A 1 21  GLU 21  22  22  GLU GLU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  ASN 23  24  24  ASN ASN A . n 
A 1 24  ILE 24  25  25  ILE ILE A . n 
A 1 25  ASP 25  26  26  ASP ASP A . n 
A 1 26  ILE 26  27  27  ILE ILE A . n 
A 1 27  VAL 27  28  28  VAL VAL A . n 
A 1 28  ARG 28  29  29  ARG ARG A . n 
A 1 29  LYS 29  30  30  LYS LYS A . n 
A 1 30  ARG 30  31  31  ARG ARG A . n 
A 1 31  LEU 31  32  32  LEU LEU A . n 
A 1 32  ASN 32  33  33  ASN ASN A . n 
A 1 33  ARG 33  34  34  ARG ARG A . n 
A 1 34  PRO 34  35  35  PRO PRO A . n 
A 1 35  LEU 35  36  36  LEU LEU A . n 
A 1 36  THR 36  37  37  THR THR A . n 
A 1 37  LEU 37  38  38  LEU LEU A . n 
A 1 38  SER 38  39  39  SER SER A . n 
A 1 39  GLU 39  40  40  GLU GLU A . n 
A 1 40  LYS 40  41  41  LYS LYS A . n 
A 1 41  ILE 41  42  42  ILE ILE A . n 
A 1 42  VAL 42  43  43  VAL VAL A . n 
A 1 43  TYR 43  44  44  TYR TYR A . n 
A 1 44  GLY 44  45  45  GLY GLY A . n 
A 1 45  HIS 45  46  46  HIS HIS A . n 
A 1 46  LEU 46  47  47  LEU LEU A . n 
A 1 47  ASP 47  48  48  ASP ASP A . n 
A 1 48  ASP 48  49  49  ASP ASP A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  ALA 50  51  51  ALA ALA A . n 
A 1 51  ASN 51  52  52  ASN ASN A . n 
A 1 52  GLN 52  53  53  GLN GLN A . n 
A 1 53  GLU 53  54  54  GLU GLU A . n 
A 1 54  ILE 54  55  55  ILE ILE A . n 
A 1 55  GLU 55  56  56  GLU GLU A . n 
A 1 56  ARG 56  57  57  ARG ARG A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  LYS 58  59  59  LYS LYS A . n 
A 1 59  THR 59  60  60  THR THR A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  LEU 61  62  62  LEU LEU A . n 
A 1 62  ARG 62  63  63  ARG ARG A . n 
A 1 63  LEU 63  64  64  LEU LEU A . n 
A 1 64  ARG 64  65  65  ARG ARG A . n 
A 1 65  PRO 65  66  66  PRO PRO A . n 
A 1 66  ASP 66  67  67  ASP ASP A . n 
A 1 67  ARG 67  68  68  ARG ARG A . n 
A 1 68  VAL 68  69  69  VAL VAL A . n 
A 1 69  ALA 69  70  70  ALA ALA A . n 
A 1 70  MET 70  71  71  MET MET A . n 
A 1 71  GLN 71  72  72  GLN GLN A . n 
A 1 72  ASP 72  73  73  ASP ASP A . n 
A 1 73  ALA 73  74  74  ALA ALA A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  ALA 75  76  76  ALA ALA A . n 
A 1 76  GLN 76  77  77  GLN GLN A . n 
A 1 77  MET 77  78  78  MET MET A . n 
A 1 78  ALA 78  79  79  ALA ALA A . n 
A 1 79  MET 79  80  80  MET MET A . n 
A 1 80  LEU 80  81  81  LEU LEU A . n 
A 1 81  GLN 81  82  82  GLN GLN A . n 
A 1 82  PHE 82  83  83  PHE PHE A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  SER 84  85  85  SER SER A . n 
A 1 85  SER 85  86  86  SER SER A . n 
A 1 86  GLY 86  87  87  GLY GLY A . n 
A 1 87  LEU 87  88  88  LEU LEU A . n 
A 1 88  PRO 88  89  89  PRO PRO A . n 
A 1 89  LYS 89  90  90  LYS LYS A . n 
A 1 90  VAL 90  91  91  VAL VAL A . n 
A 1 91  ALA 91  92  92  ALA ALA A . n 
A 1 92  VAL 92  93  93  VAL VAL A . n 
A 1 93  PRO 93  94  94  PRO PRO A . n 
A 1 94  SER 94  95  95  SER SER A . n 
A 1 95  THR 95  96  96  THR THR A . n 
A 1 96  ILE 96  97  97  ILE ILE A . n 
A 1 97  HIS 97  98  98  HIS HIS A . n 
A 1 98  CYS 98  99  99  CYS CYS A . n 
A 1 99  ASP 99  100 100 ASP ASP A . n 
A 1 100 HIS 100 101 101 HIS HIS A . n 
A 1 101 LEU 101 102 102 LEU LEU A . n 
A 1 102 ILE 102 103 103 ILE ILE A . n 
A 1 103 GLU 103 104 104 GLU GLU A . n 
A 1 104 ALA 104 105 105 ALA ALA A . n 
A 1 105 GLN 105 106 106 GLN GLN A . n 
A 1 106 LEU 106 107 107 LEU LEU A . n 
A 1 107 GLY 107 108 108 GLY GLY A . n 
A 1 108 GLY 108 109 109 GLY GLY A . n 
A 1 109 GLU 109 110 110 GLU GLU A . n 
A 1 110 LYS 110 111 111 LYS LYS A . n 
A 1 111 ASP 111 112 112 ASP ASP A . n 
A 1 112 LEU 112 113 113 LEU LEU A . n 
A 1 113 ARG 113 114 114 ARG ARG A . n 
A 1 114 ARG 114 115 115 ARG ARG A . n 
A 1 115 ALA 115 116 116 ALA ALA A . n 
A 1 116 LYS 116 117 117 LYS LYS A . n 
A 1 117 ASP 117 118 118 ASP ASP A . n 
A 1 118 ILE 118 119 119 ILE ILE A . n 
A 1 119 ASN 119 120 120 ASN ASN A . n 
A 1 120 GLN 120 121 121 GLN GLN A . n 
A 1 121 GLU 121 122 122 GLU GLU A . n 
A 1 122 VAL 122 123 123 VAL VAL A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 ASN 124 125 125 ASN ASN A . n 
A 1 125 PHE 125 126 126 PHE PHE A . n 
A 1 126 LEU 126 127 127 LEU LEU A . n 
A 1 127 ALA 127 128 128 ALA ALA A . n 
A 1 128 THR 128 129 129 THR THR A . n 
A 1 129 ALA 129 130 130 ALA ALA A . n 
A 1 130 GLY 130 131 131 GLY GLY A . n 
A 1 131 ALA 131 132 132 ALA ALA A . n 
A 1 132 LYS 132 133 133 LYS LYS A . n 
A 1 133 TYR 133 134 134 TYR TYR A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 VAL 135 136 136 VAL VAL A . n 
A 1 136 GLY 136 137 137 GLY GLY A . n 
A 1 137 PHE 137 138 138 PHE PHE A . n 
A 1 138 TRP 138 139 139 TRP TRP A . n 
A 1 139 ARG 139 140 140 ARG ARG A . n 
A 1 140 PRO 140 141 141 PRO PRO A . n 
A 1 141 GLY 141 142 142 GLY GLY A . n 
A 1 142 SER 142 143 143 SER SER A . n 
A 1 143 GLY 143 144 144 GLY GLY A . n 
A 1 144 ILE 144 145 145 ILE ILE A . n 
A 1 145 ILE 145 146 146 ILE ILE A . n 
A 1 146 HIS 146 147 147 HIS HIS A . n 
A 1 147 GLN 147 148 148 GLN GLN A . n 
A 1 148 ILE 148 149 149 ILE ILE A . n 
A 1 149 ILE 149 150 150 ILE ILE A . n 
A 1 150 LEU 150 151 151 LEU LEU A . n 
A 1 151 GLU 151 152 152 GLU GLU A . n 
A 1 152 ASN 152 153 153 ASN ASN A . n 
A 1 153 TYR 153 154 154 TYR TYR A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 TYR 155 156 156 TYR TYR A . n 
A 1 156 PRO 156 157 157 PRO PRO A . n 
A 1 157 GLY 157 158 158 GLY GLY A . n 
A 1 158 VAL 158 159 159 VAL VAL A . n 
A 1 159 LEU 159 160 160 LEU LEU A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 ILE 161 162 162 ILE ILE A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 THR 163 164 164 THR THR A . n 
A 1 164 ASP 164 165 165 ASP ASP A . n 
A 1 165 SER 165 166 166 SER SER A . n 
A 1 166 HIS 166 167 167 HIS HIS A . n 
A 1 167 THR 167 168 168 THR THR A . n 
A 1 168 PRO 168 169 169 PRO PRO A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 GLY 170 171 171 GLY GLY A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 GLY 172 173 173 GLY GLY A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 GLY 174 175 175 GLY GLY A . n 
A 1 175 GLY 175 176 176 GLY GLY A . n 
A 1 176 ILE 176 177 177 ILE ILE A . n 
A 1 177 CYS 177 178 178 CYS CYS A . n 
A 1 178 ILE 178 179 179 ILE ILE A . n 
A 1 179 GLY 179 180 180 GLY GLY A . n 
A 1 180 VAL 180 181 181 VAL VAL A . n 
A 1 181 GLY 181 182 182 GLY GLY A . n 
A 1 182 GLY 182 183 183 GLY GLY A . n 
A 1 183 ALA 183 184 184 ALA ALA A . n 
A 1 184 ASP 184 185 185 ASP ASP A . n 
A 1 185 ALA 185 186 186 ALA ALA A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ASP 187 188 188 ASP ASP A . n 
A 1 188 VAL 188 189 189 VAL VAL A . n 
A 1 189 MET 189 190 190 MET MET A . n 
A 1 190 ALA 190 191 191 ALA ALA A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ILE 192 193 193 ILE ILE A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 TRP 194 195 195 TRP TRP A . n 
A 1 195 GLU 195 196 196 GLU GLU A . n 
A 1 196 LEU 196 197 197 LEU LEU A . n 
A 1 197 LYS 197 198 198 LYS LYS A . n 
A 1 198 CYS 198 199 199 CYS CYS A . n 
A 1 199 PRO 199 200 200 PRO PRO A . n 
A 1 200 LYS 200 201 201 LYS LYS A . n 
A 1 201 VAL 201 202 202 VAL VAL A . n 
A 1 202 ILE 202 203 203 ILE ILE A . n 
A 1 203 GLY 203 204 204 GLY GLY A . n 
A 1 204 VAL 204 205 205 VAL VAL A . n 
A 1 205 LYS 205 206 206 LYS LYS A . n 
A 1 206 LEU 206 207 207 LEU LEU A . n 
A 1 207 THR 207 208 208 THR THR A . n 
A 1 208 GLY 208 209 209 GLY GLY A . n 
A 1 209 SER 209 210 210 SER SER A . n 
A 1 210 LEU 210 211 211 LEU LEU A . n 
A 1 211 SER 211 212 212 SER SER A . n 
A 1 212 GLY 212 213 213 GLY GLY A . n 
A 1 213 TRP 213 214 214 TRP TRP A . n 
A 1 214 THR 214 215 215 THR THR A . n 
A 1 215 SER 215 216 216 SER SER A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 LYS 217 218 218 LYS LYS A . n 
A 1 218 ASP 218 219 219 ASP ASP A . n 
A 1 219 VAL 219 220 220 VAL VAL A . n 
A 1 220 ILE 220 221 221 ILE ILE A . n 
A 1 221 LEU 221 222 222 LEU LEU A . n 
A 1 222 LYS 222 223 223 LYS LYS A . n 
A 1 223 VAL 223 224 224 VAL VAL A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 GLY 225 226 226 GLY GLY A . n 
A 1 226 ILE 226 227 227 ILE ILE A . n 
A 1 227 LEU 227 228 228 LEU LEU A . n 
A 1 228 THR 228 229 229 THR THR A . n 
A 1 229 VAL 229 230 230 VAL VAL A . n 
A 1 230 LYS 230 231 231 LYS LYS A . n 
A 1 231 GLY 231 232 232 GLY GLY A . n 
A 1 232 GLY 232 233 233 GLY GLY A . n 
A 1 233 THR 233 234 234 THR THR A . n 
A 1 234 GLY 234 235 235 GLY GLY A . n 
A 1 235 ALA 235 236 236 ALA ALA A . n 
A 1 236 ILE 236 237 237 ILE ILE A . n 
A 1 237 VAL 237 238 238 VAL VAL A . n 
A 1 238 GLU 238 239 239 GLU GLU A . n 
A 1 239 TYR 239 240 240 TYR TYR A . n 
A 1 240 HIS 240 241 241 HIS HIS A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 PRO 242 243 243 PRO PRO A . n 
A 1 243 GLY 243 244 244 GLY GLY A . n 
A 1 244 VAL 244 245 245 VAL VAL A . n 
A 1 245 ASP 245 246 246 ASP ASP A . n 
A 1 246 SER 246 247 247 SER SER A . n 
A 1 247 ILE 247 248 248 ILE ILE A . n 
A 1 248 SER 248 249 249 SER SER A . n 
A 1 249 CYS 249 250 250 CYS CYS A . n 
A 1 250 THR 250 251 251 THR THR A . n 
A 1 251 GLY 251 252 252 GLY GLY A . n 
A 1 252 MET 252 253 253 MET MET A . n 
A 1 253 ALA 253 254 254 ALA ALA A . n 
A 1 254 THR 254 255 255 THR THR A . n 
A 1 255 ILE 255 256 256 ILE ILE A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 ASN 257 258 258 ASN ASN A . n 
A 1 258 MET 258 259 259 MET MET A . n 
A 1 259 GLY 259 260 260 GLY GLY A . n 
A 1 260 ALA 260 261 261 ALA ALA A . n 
A 1 261 GLU 261 262 262 GLU GLU A . n 
A 1 262 ILE 262 263 263 ILE ILE A . n 
A 1 263 GLY 263 264 264 GLY GLY A . n 
A 1 264 ALA 264 265 265 ALA ALA A . n 
A 1 265 THR 265 266 266 THR THR A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 SER 267 268 268 SER SER A . n 
A 1 268 VAL 268 269 269 VAL VAL A . n 
A 1 269 PHE 269 270 270 PHE PHE A . n 
A 1 270 PRO 270 271 271 PRO PRO A . n 
A 1 271 TYR 271 272 272 TYR TYR A . n 
A 1 272 ASN 272 273 273 ASN ASN A . n 
A 1 273 HIS 273 274 274 HIS HIS A . n 
A 1 274 ARG 274 275 275 ARG ARG A . n 
A 1 275 MET 275 276 276 MET MET A . n 
A 1 276 LYS 276 277 277 LYS LYS A . n 
A 1 277 LYS 277 278 278 LYS LYS A . n 
A 1 278 TYR 278 279 279 TYR TYR A . n 
A 1 279 LEU 279 280 280 LEU LEU A . n 
A 1 280 SER 280 281 281 SER SER A . n 
A 1 281 LYS 281 282 282 LYS LYS A . n 
A 1 282 THR 282 283 283 THR THR A . n 
A 1 283 GLY 283 284 284 GLY GLY A . n 
A 1 284 ARG 284 285 285 ARG ARG A . n 
A 1 285 ALA 285 286 286 ALA ALA A . n 
A 1 286 ASP 286 287 287 ASP ASP A . n 
A 1 287 ILE 287 288 288 ILE ILE A . n 
A 1 288 ALA 288 289 289 ALA ALA A . n 
A 1 289 ASN 289 290 290 ASN ASN A . n 
A 1 290 LEU 290 291 291 LEU LEU A . n 
A 1 291 ALA 291 292 292 ALA ALA A . n 
A 1 292 ASP 292 293 293 ASP ASP A . n 
A 1 293 GLU 293 294 294 GLU GLU A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 LYS 295 296 296 LYS LYS A . n 
A 1 296 ASP 296 297 297 ASP ASP A . n 
A 1 297 HIS 297 298 298 HIS HIS A . n 
A 1 298 LEU 298 299 299 LEU LEU A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 ASP 301 302 302 ASP ASP A . n 
A 1 302 PRO 302 303 303 PRO PRO A . n 
A 1 303 GLY 303 304 304 GLY GLY A . n 
A 1 304 CYS 304 305 305 CYS CYS A . n 
A 1 305 HIS 305 306 306 HIS HIS A . n 
A 1 306 TYR 306 307 307 TYR TYR A . n 
A 1 307 ASP 307 308 308 ASP ASP A . n 
A 1 308 GLN 308 309 309 GLN GLN A . n 
A 1 309 VAL 309 310 310 VAL VAL A . n 
A 1 310 ILE 310 311 311 ILE ILE A . n 
A 1 311 GLU 311 312 312 GLU GLU A . n 
A 1 312 ILE 312 313 313 ILE ILE A . n 
A 1 313 ASN 313 314 314 ASN ASN A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 SER 315 316 316 SER SER A . n 
A 1 316 GLU 316 317 317 GLU GLU A . n 
A 1 317 LEU 317 318 318 LEU LEU A . n 
A 1 318 LYS 318 319 319 LYS LYS A . n 
A 1 319 PRO 319 320 320 PRO PRO A . n 
A 1 320 HIS 320 321 321 HIS HIS A . n 
A 1 321 ILE 321 322 322 ILE ILE A . n 
A 1 322 ASN 322 323 323 ASN ASN A . n 
A 1 323 GLY 323 324 324 GLY GLY A . n 
A 1 324 PRO 324 325 325 PRO PRO A . n 
A 1 325 PHE 325 326 326 PHE PHE A . n 
A 1 326 THR 326 327 327 THR THR A . n 
A 1 327 PRO 327 328 328 PRO PRO A . n 
A 1 328 ASP 328 329 329 ASP ASP A . n 
A 1 329 LEU 329 330 330 LEU LEU A . n 
A 1 330 ALA 330 331 331 ALA ALA A . n 
A 1 331 HIS 331 332 332 HIS HIS A . n 
A 1 332 PRO 332 333 333 PRO PRO A . n 
A 1 333 VAL 333 334 334 VAL VAL A . n 
A 1 334 ALA 334 335 335 ALA ALA A . n 
A 1 335 GLU 335 336 336 GLU GLU A . n 
A 1 336 VAL 336 337 337 VAL VAL A . n 
A 1 337 GLY 337 338 338 GLY GLY A . n 
A 1 338 SER 338 339 339 SER SER A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 ALA 340 341 341 ALA ALA A . n 
A 1 341 GLU 341 342 342 GLU GLU A . n 
A 1 342 LYS 342 343 343 LYS LYS A . n 
A 1 343 GLU 343 344 344 GLU GLU A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 TRP 345 346 346 TRP TRP A . n 
A 1 346 PRO 346 347 347 PRO PRO A . n 
A 1 347 LEU 347 348 348 LEU LEU A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ILE 349 350 350 ILE ILE A . n 
A 1 350 ARG 350 351 351 ARG ARG A . n 
A 1 351 VAL 351 352 352 VAL VAL A . n 
A 1 352 GLY 352 353 353 GLY GLY A . n 
A 1 353 LEU 353 354 354 LEU LEU A . n 
A 1 354 ILE 354 355 355 ILE ILE A . n 
A 1 355 GLY 355 356 356 GLY GLY A . n 
A 1 356 SER 356 357 357 SER SER A . n 
A 1 357 CYS 357 358 358 CYS CYS A . n 
A 1 358 THR 358 359 359 THR THR A . n 
A 1 359 ASN 359 360 360 ASN ASN A . n 
A 1 360 SER 360 361 361 SER SER A . n 
A 1 361 SER 361 362 362 SER SER A . n 
A 1 362 TYR 362 363 363 TYR TYR A . n 
A 1 363 GLU 363 364 364 GLU GLU A . n 
A 1 364 ASP 364 365 365 ASP ASP A . n 
A 1 365 MET 365 366 366 MET MET A . n 
A 1 366 GLY 366 367 367 GLY GLY A . n 
A 1 367 ARG 367 368 368 ARG ARG A . n 
A 1 368 SER 368 369 369 SER SER A . n 
A 1 369 ALA 369 370 370 ALA ALA A . n 
A 1 370 ALA 370 371 371 ALA ALA A . n 
A 1 371 VAL 371 372 372 VAL VAL A . n 
A 1 372 ALA 372 373 373 ALA ALA A . n 
A 1 373 LYS 373 374 374 LYS LYS A . n 
A 1 374 GLN 374 375 375 GLN GLN A . n 
A 1 375 ALA 375 376 376 ALA ALA A . n 
A 1 376 LEU 376 377 377 LEU LEU A . n 
A 1 377 ALA 377 378 378 ALA ALA A . n 
A 1 378 HIS 378 379 379 HIS HIS A . n 
A 1 379 GLY 379 380 380 GLY GLY A . n 
A 1 380 LEU 380 381 381 LEU LEU A . n 
A 1 381 LYS 381 382 382 LYS LYS A . n 
A 1 382 CYS 382 383 383 CYS CYS A . n 
A 1 383 LYS 383 384 384 LYS LYS A . n 
A 1 384 SER 384 385 385 SER SER A . n 
A 1 385 GLN 385 386 386 GLN GLN A . n 
A 1 386 PHE 386 387 387 PHE PHE A . n 
A 1 387 THR 387 388 388 THR THR A . n 
A 1 388 ILE 388 389 389 ILE ILE A . n 
A 1 389 THR 389 390 390 THR THR A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 GLY 391 392 392 GLY GLY A . n 
A 1 392 SER 392 393 393 SER SER A . n 
A 1 393 GLU 393 394 394 GLU GLU A . n 
A 1 394 GLN 394 395 395 GLN GLN A . n 
A 1 395 ILE 395 396 396 ILE ILE A . n 
A 1 396 ARG 396 397 397 ARG ARG A . n 
A 1 397 ALA 397 398 398 ALA ALA A . n 
A 1 398 THR 398 399 399 THR THR A . n 
A 1 399 ILE 399 400 400 ILE ILE A . n 
A 1 400 GLU 400 401 401 GLU GLU A . n 
A 1 401 ARG 401 402 402 ARG ARG A . n 
A 1 402 ASP 402 403 403 ASP ASP A . n 
A 1 403 GLY 403 404 404 GLY GLY A . n 
A 1 404 TYR 404 405 405 TYR TYR A . n 
A 1 405 ALA 405 406 406 ALA ALA A . n 
A 1 406 GLN 406 407 407 GLN GLN A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 LEU 408 409 409 LEU LEU A . n 
A 1 409 ARG 409 410 410 ARG ARG A . n 
A 1 410 ASP 410 411 411 ASP ASP A . n 
A 1 411 VAL 411 412 412 VAL VAL A . n 
A 1 412 GLY 412 413 413 GLY GLY A . n 
A 1 413 GLY 413 414 414 GLY GLY A . n 
A 1 414 ILE 414 415 415 ILE ILE A . n 
A 1 415 VAL 415 416 416 VAL VAL A . n 
A 1 416 LEU 416 417 417 LEU LEU A . n 
A 1 417 ALA 417 418 418 ALA ALA A . n 
A 1 418 ASN 418 419 419 ASN ASN A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 CYS 420 421 421 CYS CYS A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 PRO 422 423 423 PRO PRO A . n 
A 1 423 CYS 423 424 424 CYS CYS A . n 
A 1 424 ILE 424 425 425 ILE ILE A . n 
A 1 425 GLY 425 426 426 GLY GLY A . n 
A 1 426 GLN 426 427 427 GLN GLN A . n 
A 1 427 TRP 427 428 428 TRP TRP A . n 
A 1 428 ASP 428 429 429 ASP ASP A . n 
A 1 429 ARG 429 430 430 ARG ARG A . n 
A 1 430 LYS 430 431 431 LYS LYS A . n 
A 1 431 ASP 431 432 432 ASP ASP A . n 
A 1 432 ILE 432 433 433 ILE ILE A . n 
A 1 433 LYS 433 434 434 LYS LYS A . n 
A 1 434 LYS 434 435 435 LYS LYS A . n 
A 1 435 GLY 435 436 436 GLY GLY A . n 
A 1 436 GLU 436 437 437 GLU GLU A . n 
A 1 437 LYS 437 438 438 LYS LYS A . n 
A 1 438 ASN 438 439 439 ASN ASN A . n 
A 1 439 THR 439 440 440 THR THR A . n 
A 1 440 ILE 440 441 441 ILE ILE A . n 
A 1 441 VAL 441 442 442 VAL VAL A . n 
A 1 442 THR 442 443 443 THR THR A . n 
A 1 443 SER 443 444 444 SER SER A . n 
A 1 444 TYR 444 445 445 TYR TYR A . n 
A 1 445 ASN 445 446 446 ASN ASN A . n 
A 1 446 ARG 446 447 447 ARG ARG A . n 
A 1 447 ASN 447 448 448 ASN ASN A . n 
A 1 448 PHE 448 449 449 PHE PHE A . n 
A 1 449 THR 449 450 450 THR THR A . n 
A 1 450 GLY 450 451 451 GLY GLY A . n 
A 1 451 ARG 451 452 452 ARG ARG A . n 
A 1 452 ASN 452 453 453 ASN ASN A . n 
A 1 453 ASP 453 454 454 ASP ASP A . n 
A 1 454 ALA 454 455 455 ALA ALA A . n 
A 1 455 ASN 455 456 456 ASN ASN A . n 
A 1 456 PRO 456 457 457 PRO PRO A . n 
A 1 457 GLU 457 458 458 GLU GLU A . n 
A 1 458 THR 458 459 459 THR THR A . n 
A 1 459 HIS 459 460 460 HIS HIS A . n 
A 1 460 ALA 460 461 461 ALA ALA A . n 
A 1 461 PHE 461 462 462 PHE PHE A . n 
A 1 462 VAL 462 463 463 VAL VAL A . n 
A 1 463 THR 463 464 464 THR THR A . n 
A 1 464 SER 464 465 465 SER SER A . n 
A 1 465 PRO 465 466 466 PRO PRO A . n 
A 1 466 GLU 466 467 467 GLU GLU A . n 
A 1 467 ILE 467 468 468 ILE ILE A . n 
A 1 468 VAL 468 469 469 VAL VAL A . n 
A 1 469 THR 469 470 470 THR THR A . n 
A 1 470 ALA 470 471 471 ALA ALA A . n 
A 1 471 LEU 471 472 472 LEU LEU A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 ILE 473 474 474 ILE ILE A . n 
A 1 474 ALA 474 475 475 ALA ALA A . n 
A 1 475 GLY 475 476 476 GLY GLY A . n 
A 1 476 THR 476 477 477 THR THR A . n 
A 1 477 LEU 477 478 478 LEU LEU A . n 
A 1 478 LYS 478 479 479 LYS LYS A . n 
A 1 479 PHE 479 480 480 PHE PHE A . n 
A 1 480 ASN 480 481 481 ASN ASN A . n 
A 1 481 PRO 481 482 482 PRO PRO A . n 
A 1 482 GLU 482 483 483 GLU GLU A . n 
A 1 483 THR 483 484 484 THR THR A . n 
A 1 484 ASP 484 485 485 ASP ASP A . n 
A 1 485 PHE 485 486 486 PHE PHE A . n 
A 1 486 LEU 486 487 487 LEU LEU A . n 
A 1 487 THR 487 488 488 THR THR A . n 
A 1 488 GLY 488 489 489 GLY GLY A . n 
A 1 489 LYS 489 490 490 LYS LYS A . n 
A 1 490 ASP 490 491 491 ASP ASP A . n 
A 1 491 GLY 491 492 492 GLY GLY A . n 
A 1 492 LYS 492 493 493 LYS LYS A . n 
A 1 493 LYS 493 494 494 LYS LYS A . n 
A 1 494 PHE 494 495 495 PHE PHE A . n 
A 1 495 LYS 495 496 496 LYS LYS A . n 
A 1 496 LEU 496 497 497 LEU LEU A . n 
A 1 497 GLU 497 498 498 GLU GLU A . n 
A 1 498 ALA 498 499 499 ALA ALA A . n 
A 1 499 PRO 499 500 500 PRO PRO A . n 
A 1 500 ASP 500 501 501 ASP ASP A . n 
A 1 501 ALA 501 502 502 ALA ALA A . n 
A 1 502 ASP 502 503 503 ASP ASP A . n 
A 1 503 GLU 503 504 504 GLU GLU A . n 
A 1 504 LEU 504 505 505 LEU LEU A . n 
A 1 505 PRO 505 506 506 PRO PRO A . n 
A 1 506 ARG 506 507 507 ARG ARG A . n 
A 1 507 ALA 507 508 508 ALA ALA A . n 
A 1 508 GLU 508 509 509 GLU GLU A . n 
A 1 509 PHE 509 510 510 PHE PHE A . n 
A 1 510 ASP 510 511 511 ASP ASP A . n 
A 1 511 PRO 511 512 512 PRO PRO A . n 
A 1 512 GLY 512 513 513 GLY GLY A . n 
A 1 513 GLN 513 514 514 GLN GLN A . n 
A 1 514 ASP 514 515 515 ASP ASP A . n 
A 1 515 THR 515 516 516 THR THR A . n 
A 1 516 TYR 516 517 517 TYR TYR A . n 
A 1 517 GLN 517 518 518 GLN GLN A . n 
A 1 518 HIS 518 519 519 HIS HIS A . n 
A 1 519 PRO 519 520 520 PRO PRO A . n 
A 1 520 PRO 520 521 521 PRO PRO A . n 
A 1 521 LYS 521 522 522 LYS LYS A . n 
A 1 522 ASP 522 523 523 ASP ASP A . n 
A 1 523 SER 523 524 524 SER SER A . n 
A 1 524 SER 524 525 525 SER SER A . n 
A 1 525 GLY 525 526 526 GLY GLY A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ARG 527 528 528 ARG ARG A . n 
A 1 528 VAL 528 529 529 VAL VAL A . n 
A 1 529 ASP 529 530 530 ASP ASP A . n 
A 1 530 VAL 530 531 531 VAL VAL A . n 
A 1 531 SER 531 532 532 SER SER A . n 
A 1 532 PRO 532 533 533 PRO PRO A . n 
A 1 533 THR 533 534 534 THR THR A . n 
A 1 534 SER 534 535 535 SER SER A . n 
A 1 535 GLN 535 536 536 GLN GLN A . n 
A 1 536 ARG 536 537 537 ARG ARG A . n 
A 1 537 LEU 537 538 538 LEU LEU A . n 
A 1 538 GLN 538 539 539 GLN GLN A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 LEU 540 541 541 LEU LEU A . n 
A 1 541 GLU 541 542 542 GLU GLU A . n 
A 1 542 PRO 542 543 543 PRO PRO A . n 
A 1 543 PHE 543 544 544 PHE PHE A . n 
A 1 544 ASP 544 545 545 ASP ASP A . n 
A 1 545 LYS 545 546 546 LYS LYS A . n 
A 1 546 TRP 546 547 547 TRP TRP A . n 
A 1 547 ASP 547 548 548 ASP ASP A . n 
A 1 548 GLY 548 549 549 GLY GLY A . n 
A 1 549 LYS 549 550 550 LYS LYS A . n 
A 1 550 ASP 550 551 551 ASP ASP A . n 
A 1 551 LEU 551 552 552 LEU LEU A . n 
A 1 552 GLU 552 553 553 GLU GLU A . n 
A 1 553 ASP 553 554 554 ASP ASP A . n 
A 1 554 LEU 554 555 555 LEU LEU A . n 
A 1 555 GLN 555 556 556 GLN GLN A . n 
A 1 556 ILE 556 557 557 ILE ILE A . n 
A 1 557 LEU 557 558 558 LEU LEU A . n 
A 1 558 ILE 558 559 559 ILE ILE A . n 
A 1 559 LYS 559 560 560 LYS LYS A . n 
A 1 560 VAL 560 561 561 VAL VAL A . n 
A 1 561 LYS 561 562 562 LYS LYS A . n 
A 1 562 GLY 562 563 563 GLY GLY A . n 
A 1 563 LYS 563 564 564 LYS LYS A . n 
A 1 564 CYS 564 565 565 CYS CYS A . n 
A 1 565 THR 565 566 566 THR THR A . n 
A 1 566 THR 566 567 567 THR THR A . n 
A 1 567 ASP 567 568 568 ASP ASP A . n 
A 1 568 HIS 568 569 569 HIS HIS A . n 
A 1 569 ILE 569 570 570 ILE ILE A . n 
A 1 570 SER 570 571 571 SER SER A . n 
A 1 571 ALA 571 572 572 ALA ALA A . n 
A 1 572 ALA 572 573 573 ALA ALA A . n 
A 1 573 GLY 573 574 574 GLY GLY A . n 
A 1 574 PRO 574 575 575 PRO PRO A . n 
A 1 575 TRP 575 576 576 TRP TRP A . n 
A 1 576 LEU 576 577 577 LEU LEU A . n 
A 1 577 LYS 577 578 578 LYS LYS A . n 
A 1 578 PHE 578 579 579 PHE PHE A . n 
A 1 579 ARG 579 580 580 ARG ARG A . n 
A 1 580 GLY 580 581 581 GLY GLY A . n 
A 1 581 HIS 581 582 582 HIS HIS A . n 
A 1 582 LEU 582 583 583 LEU LEU A . n 
A 1 583 ASP 583 584 584 ASP ASP A . n 
A 1 584 ASN 584 585 585 ASN ASN A . n 
A 1 585 ILE 585 586 586 ILE ILE A . n 
A 1 586 SER 586 587 587 SER SER A . n 
A 1 587 ASN 587 588 588 ASN ASN A . n 
A 1 588 ASN 588 589 589 ASN ASN A . n 
A 1 589 LEU 589 590 590 LEU LEU A . n 
A 1 590 LEU 590 591 591 LEU LEU A . n 
A 1 591 ILE 591 592 592 ILE ILE A . n 
A 1 592 GLY 592 593 593 GLY GLY A . n 
A 1 593 ALA 593 594 594 ALA ALA A . n 
A 1 594 ILE 594 595 595 ILE ILE A . n 
A 1 595 ASN 595 596 596 ASN ASN A . n 
A 1 596 ILE 596 597 597 ILE ILE A . n 
A 1 597 GLU 597 598 598 GLU GLU A . n 
A 1 598 ASN 598 599 599 ASN ASN A . n 
A 1 599 ARG 599 600 600 ARG ARG A . n 
A 1 600 LYS 600 601 601 LYS LYS A . n 
A 1 601 ALA 601 602 602 ALA ALA A . n 
A 1 602 ASN 602 603 603 ASN ASN A . n 
A 1 603 SER 603 604 604 SER SER A . n 
A 1 604 VAL 604 605 605 VAL VAL A . n 
A 1 605 ARG 605 606 606 ARG ARG A . n 
A 1 606 ASN 606 607 607 ASN ASN A . n 
A 1 607 ALA 607 608 608 ALA ALA A . n 
A 1 608 VAL 608 609 609 VAL VAL A . n 
A 1 609 THR 609 610 610 THR THR A . n 
A 1 610 GLN 610 611 611 GLN GLN A . n 
A 1 611 GLU 611 612 612 GLU GLU A . n 
A 1 612 PHE 612 613 613 PHE PHE A . n 
A 1 613 GLY 613 614 614 GLY GLY A . n 
A 1 614 PRO 614 615 615 PRO PRO A . n 
A 1 615 VAL 615 616 616 VAL VAL A . n 
A 1 616 PRO 616 617 617 PRO PRO A . n 
A 1 617 ASP 617 618 618 ASP ASP A . n 
A 1 618 THR 618 619 619 THR THR A . n 
A 1 619 ALA 619 620 620 ALA ALA A . n 
A 1 620 ARG 620 621 621 ARG ARG A . n 
A 1 621 TYR 621 622 622 TYR TYR A . n 
A 1 622 TYR 622 623 623 TYR TYR A . n 
A 1 623 LYS 623 624 624 LYS LYS A . n 
A 1 624 GLN 624 625 625 GLN GLN A . n 
A 1 625 HIS 625 626 626 HIS HIS A . n 
A 1 626 GLY 626 627 627 GLY GLY A . n 
A 1 627 ILE 627 628 628 ILE ILE A . n 
A 1 628 ARG 628 629 629 ARG ARG A . n 
A 1 629 TRP 629 630 630 TRP TRP A . n 
A 1 630 VAL 630 631 631 VAL VAL A . n 
A 1 631 VAL 631 632 632 VAL VAL A . n 
A 1 632 ILE 632 633 633 ILE ILE A . n 
A 1 633 GLY 633 634 634 GLY GLY A . n 
A 1 634 ASP 634 635 635 ASP ASP A . n 
A 1 635 GLU 635 636 636 GLU GLU A . n 
A 1 636 ASN 636 637 637 ASN ASN A . n 
A 1 637 TYR 637 638 638 TYR TYR A . n 
A 1 638 GLY 638 639 639 GLY GLY A . n 
A 1 639 GLU 639 640 640 GLU GLU A . n 
A 1 640 GLY 640 641 641 GLY GLY A . n 
A 1 641 ALA 641 642 642 ALA ALA A . n 
A 1 642 SER 642 643 643 SER SER A . n 
A 1 643 ARG 643 644 644 ARG ARG A . n 
A 1 644 GLU 644 645 645 GLU GLU A . n 
A 1 645 HIS 645 646 646 HIS HIS A . n 
A 1 646 SER 646 647 647 SER SER A . n 
A 1 647 ALA 647 648 648 ALA ALA A . n 
A 1 648 LEU 648 649 649 LEU LEU A . n 
A 1 649 GLU 649 650 650 GLU GLU A . n 
A 1 650 PRO 650 651 651 PRO PRO A . n 
A 1 651 ARG 651 652 652 ARG ARG A . n 
A 1 652 HIS 652 653 653 HIS HIS A . n 
A 1 653 LEU 653 654 654 LEU LEU A . n 
A 1 654 GLY 654 655 655 GLY GLY A . n 
A 1 655 GLY 655 656 656 GLY GLY A . n 
A 1 656 ARG 656 657 657 ARG ARG A . n 
A 1 657 ALA 657 658 658 ALA ALA A . n 
A 1 658 ILE 658 659 659 ILE ILE A . n 
A 1 659 ILE 659 660 660 ILE ILE A . n 
A 1 660 THR 660 661 661 THR THR A . n 
A 1 661 LYS 661 662 662 LYS LYS A . n 
A 1 662 SER 662 663 663 SER SER A . n 
A 1 663 PHE 663 664 664 PHE PHE A . n 
A 1 664 ALA 664 665 665 ALA ALA A . n 
A 1 665 ARG 665 666 666 ARG ARG A . n 
A 1 666 ILE 666 667 667 ILE ILE A . n 
A 1 667 HIS 667 668 668 HIS HIS A . n 
A 1 668 GLU 668 669 669 GLU GLU A . n 
A 1 669 THR 669 670 670 THR THR A . n 
A 1 670 ASN 670 671 671 ASN ASN A . n 
A 1 671 LEU 671 672 672 LEU LEU A . n 
A 1 672 LYS 672 673 673 LYS LYS A . n 
A 1 673 LYS 673 674 674 LYS LYS A . n 
A 1 674 GLN 674 675 675 GLN GLN A . n 
A 1 675 GLY 675 676 676 GLY GLY A . n 
A 1 676 LEU 676 677 677 LEU LEU A . n 
A 1 677 LEU 677 678 678 LEU LEU A . n 
A 1 678 PRO 678 679 679 PRO PRO A . n 
A 1 679 LEU 679 680 680 LEU LEU A . n 
A 1 680 THR 680 681 681 THR THR A . n 
A 1 681 PHE 681 682 682 PHE PHE A . n 
A 1 682 ALA 682 683 683 ALA ALA A . n 
A 1 683 ASP 683 684 684 ASP ASP A . n 
A 1 684 PRO 684 685 685 PRO PRO A . n 
A 1 685 ALA 685 686 686 ALA ALA A . n 
A 1 686 ASP 686 687 687 ASP ASP A . n 
A 1 687 TYR 687 688 688 TYR TYR A . n 
A 1 688 ASN 688 689 689 ASN ASN A . n 
A 1 689 LYS 689 690 690 LYS LYS A . n 
A 1 690 ILE 690 691 691 ILE ILE A . n 
A 1 691 HIS 691 692 692 HIS HIS A . n 
A 1 692 PRO 692 693 693 PRO PRO A . n 
A 1 693 VAL 693 694 694 VAL VAL A . n 
A 1 694 ASP 694 695 695 ASP ASP A . n 
A 1 695 LYS 695 696 696 LYS LYS A . n 
A 1 696 LEU 696 697 697 LEU LEU A . n 
A 1 697 THR 697 698 698 THR THR A . n 
A 1 698 ILE 698 699 699 ILE ILE A . n 
A 1 699 GLN 699 700 700 GLN GLN A . n 
A 1 700 GLY 700 701 701 GLY GLY A . n 
A 1 701 LEU 701 702 702 LEU LEU A . n 
A 1 702 LYS 702 703 703 LYS LYS A . n 
A 1 703 ASP 703 704 704 ASP ASP A . n 
A 1 704 PHE 704 705 705 PHE PHE A . n 
A 1 705 ALA 705 706 706 ALA ALA A . n 
A 1 706 PRO 706 707 707 PRO PRO A . n 
A 1 707 GLY 707 708 708 GLY GLY A . n 
A 1 708 LYS 708 709 709 LYS LYS A . n 
A 1 709 PRO 709 710 710 PRO PRO A . n 
A 1 710 LEU 710 711 711 LEU LEU A . n 
A 1 711 LYS 711 712 712 LYS LYS A . n 
A 1 712 CYS 712 713 713 CYS CYS A . n 
A 1 713 ILE 713 714 714 ILE ILE A . n 
A 1 714 ILE 714 715 715 ILE ILE A . n 
A 1 715 LYS 715 716 716 LYS LYS A . n 
A 1 716 HIS 716 717 717 HIS HIS A . n 
A 1 717 PRO 717 718 718 PRO PRO A . n 
A 1 718 ASN 718 719 719 ASN ASN A . n 
A 1 719 GLY 719 720 720 GLY GLY A . n 
A 1 720 THR 720 721 721 THR THR A . n 
A 1 721 GLN 721 722 722 GLN GLN A . n 
A 1 722 GLU 722 723 723 GLU GLU A . n 
A 1 723 THR 723 724 724 THR THR A . n 
A 1 724 ILE 724 725 725 ILE ILE A . n 
A 1 725 LEU 725 726 726 LEU LEU A . n 
A 1 726 LEU 726 727 727 LEU LEU A . n 
A 1 727 ASN 727 728 728 ASN ASN A . n 
A 1 728 HIS 728 729 729 HIS HIS A . n 
A 1 729 THR 729 730 730 THR THR A . n 
A 1 730 PHE 730 731 731 PHE PHE A . n 
A 1 731 ASN 731 732 732 ASN ASN A . n 
A 1 732 GLU 732 733 733 GLU GLU A . n 
A 1 733 THR 733 734 734 THR THR A . n 
A 1 734 GLN 734 735 735 GLN GLN A . n 
A 1 735 ILE 735 736 736 ILE ILE A . n 
A 1 736 GLU 736 737 737 GLU GLU A . n 
A 1 737 TRP 737 738 738 TRP TRP A . n 
A 1 738 PHE 738 739 739 PHE PHE A . n 
A 1 739 ARG 739 740 740 ARG ARG A . n 
A 1 740 ALA 740 741 741 ALA ALA A . n 
A 1 741 GLY 741 742 742 GLY GLY A . n 
A 1 742 SER 742 743 743 SER SER A . n 
A 1 743 ALA 743 744 744 ALA ALA A . n 
A 1 744 LEU 744 745 745 LEU LEU A . n 
A 1 745 ASN 745 746 746 ASN ASN A . n 
A 1 746 ARG 746 747 747 ARG ARG A . n 
A 1 747 MET 747 748 748 MET MET A . n 
A 1 748 LYS 748 749 749 LYS LYS A . n 
A 1 749 GLU 749 750 750 GLU GLU A . n 
A 1 750 LEU 750 751 751 LEU LEU A . n 
A 1 751 GLN 751 752 752 GLN GLN A . n 
A 1 752 GLN 752 753 753 GLN GLN A . n 
A 1 753 LYS 753 754 754 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FLC 1   756  756  FLC FLC A . 
C 3 SF4 1   755  755  SF4 FS4 A . 
D 4 O   1   1100 755  O   FS4 A . 
E 5 HOH 1   757  757  HOH HOH A . 
E 5 HOH 2   758  758  HOH HOH A . 
E 5 HOH 3   759  759  HOH HOH A . 
E 5 HOH 4   760  760  HOH HOH A . 
E 5 HOH 5   761  761  HOH HOH A . 
E 5 HOH 6   762  762  HOH HOH A . 
E 5 HOH 7   763  763  HOH HOH A . 
E 5 HOH 8   764  764  HOH HOH A . 
E 5 HOH 9   765  765  HOH HOH A . 
E 5 HOH 10  766  766  HOH HOH A . 
E 5 HOH 11  767  767  HOH HOH A . 
E 5 HOH 12  768  768  HOH HOH A . 
E 5 HOH 13  769  769  HOH HOH A . 
E 5 HOH 14  770  770  HOH HOH A . 
E 5 HOH 15  771  771  HOH HOH A . 
E 5 HOH 16  772  772  HOH HOH A . 
E 5 HOH 17  773  773  HOH HOH A . 
E 5 HOH 18  774  774  HOH HOH A . 
E 5 HOH 19  775  775  HOH HOH A . 
E 5 HOH 20  776  776  HOH HOH A . 
E 5 HOH 21  777  777  HOH HOH A . 
E 5 HOH 22  778  778  HOH HOH A . 
E 5 HOH 23  779  779  HOH HOH A . 
E 5 HOH 24  780  780  HOH HOH A . 
E 5 HOH 25  781  781  HOH HOH A . 
E 5 HOH 26  782  782  HOH HOH A . 
E 5 HOH 27  783  783  HOH HOH A . 
E 5 HOH 28  784  784  HOH HOH A . 
E 5 HOH 29  785  785  HOH HOH A . 
E 5 HOH 30  786  786  HOH HOH A . 
E 5 HOH 31  787  787  HOH HOH A . 
E 5 HOH 32  788  788  HOH HOH A . 
E 5 HOH 33  789  789  HOH HOH A . 
E 5 HOH 34  790  790  HOH HOH A . 
E 5 HOH 35  791  791  HOH HOH A . 
E 5 HOH 36  792  792  HOH HOH A . 
E 5 HOH 37  793  793  HOH HOH A . 
E 5 HOH 38  794  794  HOH HOH A . 
E 5 HOH 39  795  795  HOH HOH A . 
E 5 HOH 40  796  796  HOH HOH A . 
E 5 HOH 41  797  797  HOH HOH A . 
E 5 HOH 42  798  798  HOH HOH A . 
E 5 HOH 43  799  799  HOH HOH A . 
E 5 HOH 44  800  800  HOH HOH A . 
E 5 HOH 45  801  801  HOH HOH A . 
E 5 HOH 46  802  802  HOH HOH A . 
E 5 HOH 47  803  803  HOH HOH A . 
E 5 HOH 48  804  804  HOH HOH A . 
E 5 HOH 49  805  805  HOH HOH A . 
E 5 HOH 50  806  806  HOH HOH A . 
E 5 HOH 51  807  807  HOH HOH A . 
E 5 HOH 52  808  808  HOH HOH A . 
E 5 HOH 53  809  809  HOH HOH A . 
E 5 HOH 54  810  810  HOH HOH A . 
E 5 HOH 55  811  811  HOH HOH A . 
E 5 HOH 56  812  812  HOH HOH A . 
E 5 HOH 57  813  813  HOH HOH A . 
E 5 HOH 58  814  814  HOH HOH A . 
E 5 HOH 59  815  815  HOH HOH A . 
E 5 HOH 60  816  816  HOH HOH A . 
E 5 HOH 61  817  817  HOH HOH A . 
E 5 HOH 62  818  818  HOH HOH A . 
E 5 HOH 63  819  819  HOH HOH A . 
E 5 HOH 64  820  820  HOH HOH A . 
E 5 HOH 65  821  821  HOH HOH A . 
E 5 HOH 66  822  822  HOH HOH A . 
E 5 HOH 67  823  823  HOH HOH A . 
E 5 HOH 68  824  824  HOH HOH A . 
E 5 HOH 69  825  825  HOH HOH A . 
E 5 HOH 70  826  826  HOH HOH A . 
E 5 HOH 71  827  827  HOH HOH A . 
E 5 HOH 72  828  828  HOH HOH A . 
E 5 HOH 73  829  829  HOH HOH A . 
E 5 HOH 74  830  830  HOH HOH A . 
E 5 HOH 75  831  831  HOH HOH A . 
E 5 HOH 76  832  832  HOH HOH A . 
E 5 HOH 77  833  833  HOH HOH A . 
E 5 HOH 78  834  834  HOH HOH A . 
E 5 HOH 79  835  835  HOH HOH A . 
E 5 HOH 80  836  836  HOH HOH A . 
E 5 HOH 81  837  837  HOH HOH A . 
E 5 HOH 82  838  838  HOH HOH A . 
E 5 HOH 83  839  839  HOH HOH A . 
E 5 HOH 84  840  840  HOH HOH A . 
E 5 HOH 85  841  841  HOH HOH A . 
E 5 HOH 86  842  842  HOH HOH A . 
E 5 HOH 87  843  843  HOH HOH A . 
E 5 HOH 88  844  844  HOH HOH A . 
E 5 HOH 89  845  845  HOH HOH A . 
E 5 HOH 90  846  846  HOH HOH A . 
E 5 HOH 91  847  847  HOH HOH A . 
E 5 HOH 92  848  848  HOH HOH A . 
E 5 HOH 93  849  849  HOH HOH A . 
E 5 HOH 94  850  850  HOH HOH A . 
E 5 HOH 95  851  851  HOH HOH A . 
E 5 HOH 96  852  852  HOH HOH A . 
E 5 HOH 97  853  853  HOH HOH A . 
E 5 HOH 98  854  854  HOH HOH A . 
E 5 HOH 99  855  855  HOH HOH A . 
E 5 HOH 100 856  856  HOH HOH A . 
E 5 HOH 101 857  857  HOH HOH A . 
E 5 HOH 102 858  858  HOH HOH A . 
E 5 HOH 103 859  859  HOH HOH A . 
E 5 HOH 104 860  860  HOH HOH A . 
E 5 HOH 105 861  861  HOH HOH A . 
E 5 HOH 106 862  862  HOH HOH A . 
E 5 HOH 107 863  863  HOH HOH A . 
E 5 HOH 108 864  864  HOH HOH A . 
E 5 HOH 109 865  865  HOH HOH A . 
E 5 HOH 110 866  866  HOH HOH A . 
E 5 HOH 111 867  867  HOH HOH A . 
E 5 HOH 112 868  868  HOH HOH A . 
E 5 HOH 113 869  869  HOH HOH A . 
E 5 HOH 114 870  870  HOH HOH A . 
E 5 HOH 115 871  871  HOH HOH A . 
E 5 HOH 116 872  872  HOH HOH A . 
E 5 HOH 117 873  873  HOH HOH A . 
E 5 HOH 118 874  874  HOH HOH A . 
E 5 HOH 119 875  875  HOH HOH A . 
E 5 HOH 120 876  876  HOH HOH A . 
E 5 HOH 121 877  877  HOH HOH A . 
E 5 HOH 122 878  878  HOH HOH A . 
E 5 HOH 123 879  879  HOH HOH A . 
E 5 HOH 124 880  880  HOH HOH A . 
E 5 HOH 125 881  881  HOH HOH A . 
E 5 HOH 126 882  882  HOH HOH A . 
E 5 HOH 127 883  883  HOH HOH A . 
E 5 HOH 128 884  884  HOH HOH A . 
E 5 HOH 129 885  885  HOH HOH A . 
E 5 HOH 130 886  886  HOH HOH A . 
E 5 HOH 131 887  887  HOH HOH A . 
E 5 HOH 132 888  888  HOH HOH A . 
E 5 HOH 133 889  889  HOH HOH A . 
E 5 HOH 134 890  890  HOH HOH A . 
E 5 HOH 135 891  891  HOH HOH A . 
E 5 HOH 136 892  892  HOH HOH A . 
E 5 HOH 137 893  893  HOH HOH A . 
E 5 HOH 138 894  894  HOH HOH A . 
E 5 HOH 139 895  895  HOH HOH A . 
E 5 HOH 140 896  896  HOH HOH A . 
E 5 HOH 141 897  897  HOH HOH A . 
E 5 HOH 142 898  898  HOH HOH A . 
E 5 HOH 143 899  899  HOH HOH A . 
E 5 HOH 144 900  900  HOH HOH A . 
E 5 HOH 145 901  901  HOH HOH A . 
E 5 HOH 146 902  902  HOH HOH A . 
E 5 HOH 147 903  903  HOH HOH A . 
E 5 HOH 148 904  904  HOH HOH A . 
E 5 HOH 149 905  905  HOH HOH A . 
E 5 HOH 150 906  906  HOH HOH A . 
E 5 HOH 151 907  907  HOH HOH A . 
E 5 HOH 152 908  908  HOH HOH A . 
E 5 HOH 153 909  909  HOH HOH A . 
E 5 HOH 154 910  910  HOH HOH A . 
E 5 HOH 155 911  911  HOH HOH A . 
E 5 HOH 156 912  912  HOH HOH A . 
E 5 HOH 157 913  913  HOH HOH A . 
E 5 HOH 158 914  914  HOH HOH A . 
E 5 HOH 159 915  915  HOH HOH A . 
E 5 HOH 160 916  916  HOH HOH A . 
E 5 HOH 161 917  917  HOH HOH A . 
E 5 HOH 162 918  918  HOH HOH A . 
E 5 HOH 163 919  919  HOH HOH A . 
E 5 HOH 164 920  920  HOH HOH A . 
E 5 HOH 165 921  921  HOH HOH A . 
E 5 HOH 166 922  922  HOH HOH A . 
E 5 HOH 167 923  923  HOH HOH A . 
E 5 HOH 168 924  924  HOH HOH A . 
E 5 HOH 169 925  925  HOH HOH A . 
E 5 HOH 170 926  926  HOH HOH A . 
E 5 HOH 171 927  927  HOH HOH A . 
E 5 HOH 172 928  928  HOH HOH A . 
E 5 HOH 173 929  929  HOH HOH A . 
E 5 HOH 174 930  930  HOH HOH A . 
E 5 HOH 175 931  931  HOH HOH A . 
E 5 HOH 176 932  932  HOH HOH A . 
E 5 HOH 177 933  933  HOH HOH A . 
E 5 HOH 178 934  934  HOH HOH A . 
E 5 HOH 179 935  935  HOH HOH A . 
E 5 HOH 180 936  936  HOH HOH A . 
E 5 HOH 181 937  937  HOH HOH A . 
E 5 HOH 182 938  938  HOH HOH A . 
E 5 HOH 183 939  939  HOH HOH A . 
E 5 HOH 184 940  940  HOH HOH A . 
E 5 HOH 185 941  941  HOH HOH A . 
E 5 HOH 186 942  942  HOH HOH A . 
E 5 HOH 187 943  943  HOH HOH A . 
E 5 HOH 188 944  944  HOH HOH A . 
E 5 HOH 189 945  945  HOH HOH A . 
E 5 HOH 190 946  946  HOH HOH A . 
E 5 HOH 191 947  947  HOH HOH A . 
E 5 HOH 192 948  948  HOH HOH A . 
E 5 HOH 193 949  949  HOH HOH A . 
E 5 HOH 194 950  950  HOH HOH A . 
E 5 HOH 195 951  951  HOH HOH A . 
E 5 HOH 196 952  952  HOH HOH A . 
E 5 HOH 197 953  953  HOH HOH A . 
E 5 HOH 198 954  954  HOH HOH A . 
E 5 HOH 199 955  955  HOH HOH A . 
E 5 HOH 200 956  956  HOH HOH A . 
E 5 HOH 201 957  957  HOH HOH A . 
E 5 HOH 202 958  958  HOH HOH A . 
E 5 HOH 203 959  959  HOH HOH A . 
E 5 HOH 204 960  960  HOH HOH A . 
E 5 HOH 205 961  961  HOH HOH A . 
E 5 HOH 206 962  962  HOH HOH A . 
E 5 HOH 207 963  963  HOH HOH A . 
E 5 HOH 208 964  964  HOH HOH A . 
E 5 HOH 209 965  965  HOH HOH A . 
E 5 HOH 210 966  966  HOH HOH A . 
E 5 HOH 211 967  967  HOH HOH A . 
E 5 HOH 212 968  968  HOH HOH A . 
E 5 HOH 213 969  969  HOH HOH A . 
E 5 HOH 214 970  970  HOH HOH A . 
E 5 HOH 215 971  971  HOH HOH A . 
E 5 HOH 216 972  972  HOH HOH A . 
E 5 HOH 217 973  973  HOH HOH A . 
E 5 HOH 218 974  974  HOH HOH A . 
E 5 HOH 219 975  975  HOH HOH A . 
E 5 HOH 220 976  976  HOH HOH A . 
E 5 HOH 221 977  977  HOH HOH A . 
E 5 HOH 222 978  978  HOH HOH A . 
E 5 HOH 223 979  979  HOH HOH A . 
E 5 HOH 224 980  980  HOH HOH A . 
E 5 HOH 225 981  981  HOH HOH A . 
E 5 HOH 226 982  982  HOH HOH A . 
E 5 HOH 227 983  983  HOH HOH A . 
E 5 HOH 228 984  984  HOH HOH A . 
E 5 HOH 229 985  985  HOH HOH A . 
E 5 HOH 230 986  986  HOH HOH A . 
E 5 HOH 231 987  987  HOH HOH A . 
E 5 HOH 232 988  988  HOH HOH A . 
E 5 HOH 233 989  989  HOH HOH A . 
E 5 HOH 234 990  990  HOH HOH A . 
E 5 HOH 235 991  991  HOH HOH A . 
E 5 HOH 236 992  992  HOH HOH A . 
E 5 HOH 237 993  993  HOH HOH A . 
E 5 HOH 238 994  994  HOH HOH A . 
E 5 HOH 239 995  995  HOH HOH A . 
E 5 HOH 240 996  996  HOH HOH A . 
E 5 HOH 241 997  997  HOH HOH A . 
E 5 HOH 242 998  998  HOH HOH A . 
E 5 HOH 243 999  999  HOH HOH A . 
E 5 HOH 244 1000 1000 HOH HOH A . 
E 5 HOH 245 1001 1001 HOH HOH A . 
E 5 HOH 246 1002 1002 HOH HOH A . 
E 5 HOH 247 1003 1003 HOH HOH A . 
E 5 HOH 248 1004 1004 HOH HOH A . 
E 5 HOH 249 1005 1005 HOH HOH A . 
E 5 HOH 250 1006 1006 HOH HOH A . 
E 5 HOH 251 1007 1007 HOH HOH A . 
E 5 HOH 252 1008 1008 HOH HOH A . 
E 5 HOH 253 1009 1009 HOH HOH A . 
E 5 HOH 254 1010 1010 HOH HOH A . 
E 5 HOH 255 1011 1011 HOH HOH A . 
E 5 HOH 256 1012 1012 HOH HOH A . 
E 5 HOH 257 1013 1013 HOH HOH A . 
E 5 HOH 258 1014 1014 HOH HOH A . 
E 5 HOH 259 1015 1015 HOH HOH A . 
E 5 HOH 260 1016 1016 HOH HOH A . 
E 5 HOH 261 1017 1017 HOH HOH A . 
E 5 HOH 262 1018 1018 HOH HOH A . 
E 5 HOH 263 1019 1019 HOH HOH A . 
E 5 HOH 264 1020 1020 HOH HOH A . 
E 5 HOH 265 1021 1021 HOH HOH A . 
E 5 HOH 266 1022 1022 HOH HOH A . 
E 5 HOH 267 1023 1023 HOH HOH A . 
E 5 HOH 268 1024 1024 HOH HOH A . 
E 5 HOH 269 1025 1025 HOH HOH A . 
E 5 HOH 270 1026 1026 HOH HOH A . 
E 5 HOH 271 1027 1027 HOH HOH A . 
E 5 HOH 272 1028 1028 HOH HOH A . 
E 5 HOH 273 1029 1029 HOH HOH A . 
E 5 HOH 274 1030 1030 HOH HOH A . 
E 5 HOH 275 1031 1031 HOH HOH A . 
E 5 HOH 276 1032 1032 HOH HOH A . 
E 5 HOH 277 1033 1033 HOH HOH A . 
E 5 HOH 278 1034 1034 HOH HOH A . 
E 5 HOH 279 1035 1035 HOH HOH A . 
E 5 HOH 280 1036 1036 HOH HOH A . 
E 5 HOH 281 1037 1037 HOH HOH A . 
E 5 HOH 282 1038 1038 HOH HOH A . 
E 5 HOH 283 1039 1039 HOH HOH A . 
E 5 HOH 284 1040 1040 HOH HOH A . 
E 5 HOH 285 1041 1041 HOH HOH A . 
E 5 HOH 286 1042 1042 HOH HOH A . 
E 5 HOH 287 1043 1043 HOH HOH A . 
E 5 HOH 288 1044 1044 HOH HOH A . 
E 5 HOH 289 1045 1045 HOH HOH A . 
E 5 HOH 290 1046 1046 HOH HOH A . 
E 5 HOH 291 1047 1047 HOH HOH A . 
E 5 HOH 292 1048 1048 HOH HOH A . 
E 5 HOH 293 1049 1049 HOH HOH A . 
E 5 HOH 294 1050 1050 HOH HOH A . 
E 5 HOH 295 1051 1051 HOH HOH A . 
E 5 HOH 296 1052 1052 HOH HOH A . 
E 5 HOH 297 1053 1053 HOH HOH A . 
E 5 HOH 298 1054 1054 HOH HOH A . 
E 5 HOH 299 1055 1055 HOH HOH A . 
E 5 HOH 300 1056 1056 HOH HOH A . 
E 5 HOH 301 1057 1057 HOH HOH A . 
E 5 HOH 302 1058 1058 HOH HOH A . 
E 5 HOH 303 1059 1059 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D O   .   ? A O   1100 ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S1  ? C SF4 . ? A SF4 755 ? 1_555 170.6 ? 
2  O   ? D O   .   ? A O   1100 ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S2  ? C SF4 . ? A SF4 755 ? 1_555 78.8  ? 
3  S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S2  ? C SF4 . ? A SF4 755 ? 1_555 95.5  ? 
4  O   ? D O   .   ? A O   1100 ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 87.7  ? 
5  S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 100.3 ? 
6  S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 93.6  ? 
7  O   ? D O   .   ? A O   1100 ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OB1 ? B FLC . ? A FLC 756 ? 1_555 93.7  ? 
8  S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OB1 ? B FLC . ? A FLC 756 ? 1_555 90.5  ? 
9  S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OB1 ? B FLC . ? A FLC 756 ? 1_555 167.7 ? 
10 S3  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OB1 ? B FLC . ? A FLC 756 ? 1_555 95.8  ? 
11 O   ? D O   .   ? A O   1100 ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OHB ? B FLC . ? A FLC 756 ? 1_555 84.5  ? 
12 S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OHB ? B FLC . ? A FLC 756 ? 1_555 88.7  ? 
13 S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OHB ? B FLC . ? A FLC 756 ? 1_555 97.0  ? 
14 S3  ? C SF4 .   ? A SF4 755  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OHB ? B FLC . ? A FLC 756 ? 1_555 165.4 ? 
15 OB1 ? B FLC .   ? A FLC 756  ? 1_555 FE4 ? C SF4 . ? A SF4 755 ? 1_555 OHB ? B FLC . ? A FLC 756 ? 1_555 72.4  ? 
16 SG  ? A CYS 357 ? A CYS 358  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S2  ? C SF4 . ? A SF4 755 ? 1_555 109.3 ? 
17 SG  ? A CYS 357 ? A CYS 358  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 117.8 ? 
18 S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 95.6  ? 
19 SG  ? A CYS 357 ? A CYS 358  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 117.3 ? 
20 S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 101.9 ? 
21 S3  ? C SF4 .   ? A SF4 755  ? 1_555 FE1 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 111.2 ? 
22 SG  ? A CYS 420 ? A CYS 421  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S1  ? C SF4 . ? A SF4 755 ? 1_555 106.2 ? 
23 SG  ? A CYS 420 ? A CYS 421  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S2  ? C SF4 . ? A SF4 755 ? 1_555 133.4 ? 
24 S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S2  ? C SF4 . ? A SF4 755 ? 1_555 95.4  ? 
25 SG  ? A CYS 420 ? A CYS 421  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 110.8 ? 
26 S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 107.2 ? 
27 S2  ? C SF4 .   ? A SF4 755  ? 1_555 FE3 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 100.9 ? 
28 SG  ? A CYS 423 ? A CYS 424  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S1  ? C SF4 . ? A SF4 755 ? 1_555 115.1 ? 
29 SG  ? A CYS 423 ? A CYS 424  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 114.3 ? 
30 S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S3  ? C SF4 . ? A SF4 755 ? 1_555 99.7  ? 
31 SG  ? A CYS 423 ? A CYS 424  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 111.0 ? 
32 S1  ? C SF4 .   ? A SF4 755  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 106.8 ? 
33 S3  ? C SF4 .   ? A SF4 755  ? 1_555 FE2 ? C SF4 . ? A SF4 755 ? 1_555 S4  ? C SF4 . ? A SF4 755 ? 1_555 109.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software      
2 5 'Structure model' diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .   ? 1 
CCP4   'data reduction' .   ? 2 
X-PLOR 'model building' 3.8 ? 3 
X-PLOR refinement       3.8 ? 4 
CCP4   'data scaling'   .   ? 5 
X-PLOR phasing          3.8 ? 6 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 NE2 A HIS 46  ? ? CD2 A HIS 46  ? ? 1.302 1.373 -0.071 0.011 N 
2  1 NE2 A HIS 98  ? ? CD2 A HIS 98  ? ? 1.303 1.373 -0.070 0.011 N 
3  1 NE2 A HIS 101 ? ? CD2 A HIS 101 ? ? 1.300 1.373 -0.073 0.011 N 
4  1 NE2 A HIS 167 ? ? CD2 A HIS 167 ? ? 1.300 1.373 -0.073 0.011 N 
5  1 NE2 A HIS 241 ? ? CD2 A HIS 241 ? ? 1.298 1.373 -0.075 0.011 N 
6  1 NE2 A HIS 298 ? ? CD2 A HIS 298 ? ? 1.305 1.373 -0.068 0.011 N 
7  1 NE2 A HIS 332 ? ? CD2 A HIS 332 ? ? 1.297 1.373 -0.076 0.011 N 
8  1 NE2 A HIS 379 ? ? CD2 A HIS 379 ? ? 1.305 1.373 -0.068 0.011 N 
9  1 CA  A CYS 421 ? ? CB  A CYS 421 ? ? 1.429 1.526 -0.097 0.013 N 
10 1 NE2 A HIS 460 ? ? CD2 A HIS 460 ? ? 1.302 1.373 -0.071 0.011 N 
11 1 NE2 A HIS 519 ? ? CD2 A HIS 519 ? ? 1.303 1.373 -0.070 0.011 N 
12 1 NE2 A HIS 569 ? ? CD2 A HIS 569 ? ? 1.307 1.373 -0.066 0.011 N 
13 1 NE2 A HIS 582 ? ? CD2 A HIS 582 ? ? 1.302 1.373 -0.071 0.011 N 
14 1 NE2 A HIS 626 ? ? CD2 A HIS 626 ? ? 1.301 1.373 -0.072 0.011 N 
15 1 C   A GLY 641 ? ? N   A ALA 642 ? ? 1.166 1.336 -0.170 0.023 Y 
16 1 N   A SER 643 ? ? CA  A SER 643 ? ? 1.322 1.459 -0.137 0.020 N 
17 1 NE2 A HIS 646 ? ? CD2 A HIS 646 ? ? 1.296 1.373 -0.077 0.011 N 
18 1 NE2 A HIS 717 ? ? CD2 A HIS 717 ? ? 1.295 1.373 -0.078 0.011 N 
19 1 NE2 A HIS 729 ? ? CD2 A HIS 729 ? ? 1.306 1.373 -0.067 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 17  ? ? CZ  A ARG 17  ? ? NH2 A ARG 17  ? ? 117.15 120.30 -3.15  0.50 N 
2  1 NE  A ARG 31  ? ? CZ  A ARG 31  ? ? NH1 A ARG 31  ? ? 123.51 120.30 3.21   0.50 N 
3  1 NE  A ARG 57  ? ? CZ  A ARG 57  ? ? NH1 A ARG 57  ? ? 125.65 120.30 5.35   0.50 N 
4  1 CB  A ASP 100 ? ? CG  A ASP 100 ? ? OD1 A ASP 100 ? ? 125.25 118.30 6.95   0.90 N 
5  1 CB  A ASP 100 ? ? CG  A ASP 100 ? ? OD2 A ASP 100 ? ? 112.81 118.30 -5.49  0.90 N 
6  1 CB  A HIS 101 ? ? CG  A HIS 101 ? ? CD2 A HIS 101 ? ? 119.53 129.70 -10.17 1.60 N 
7  1 NE  A ARG 115 ? ? CZ  A ARG 115 ? ? NH1 A ARG 115 ? ? 126.19 120.30 5.89   0.50 N 
8  1 NE  A ARG 115 ? ? CZ  A ARG 115 ? ? NH2 A ARG 115 ? ? 115.19 120.30 -5.11  0.50 N 
9  1 CD1 A TRP 139 ? ? CG  A TRP 139 ? ? CD2 A TRP 139 ? ? 112.64 106.30 6.34   0.80 N 
10 1 CE2 A TRP 139 ? ? CD2 A TRP 139 ? ? CG  A TRP 139 ? ? 101.84 107.30 -5.46  0.80 N 
11 1 CB  A ASP 165 ? ? CG  A ASP 165 ? ? OD1 A ASP 165 ? ? 124.27 118.30 5.97   0.90 N 
12 1 CD1 A TRP 195 ? ? CG  A TRP 195 ? ? CD2 A TRP 195 ? ? 112.88 106.30 6.58   0.80 N 
13 1 CG  A TRP 195 ? ? CD1 A TRP 195 ? ? NE1 A TRP 195 ? ? 103.54 110.10 -6.56  1.00 N 
14 1 CE2 A TRP 195 ? ? CD2 A TRP 195 ? ? CG  A TRP 195 ? ? 101.84 107.30 -5.46  0.80 N 
15 1 CD1 A TRP 214 ? ? CG  A TRP 214 ? ? CD2 A TRP 214 ? ? 112.98 106.30 6.68   0.80 N 
16 1 CE2 A TRP 214 ? ? CD2 A TRP 214 ? ? CG  A TRP 214 ? ? 101.35 107.30 -5.95  0.80 N 
17 1 CB  A TYR 279 ? ? CG  A TYR 279 ? ? CD1 A TYR 279 ? ? 116.83 121.00 -4.17  0.60 N 
18 1 N   A PRO 325 ? ? CA  A PRO 325 ? ? C   A PRO 325 ? ? 130.94 112.10 18.84  2.60 N 
19 1 CA  A PRO 325 ? ? C   A PRO 325 ? ? N   A PHE 326 ? ? 135.72 117.20 18.52  2.20 Y 
20 1 CD1 A TRP 346 ? ? CG  A TRP 346 ? ? CD2 A TRP 346 ? ? 113.11 106.30 6.81   0.80 N 
21 1 CE2 A TRP 346 ? ? CD2 A TRP 346 ? ? CG  A TRP 346 ? ? 101.06 107.30 -6.24  0.80 N 
22 1 NE  A ARG 397 ? ? CZ  A ARG 397 ? ? NH2 A ARG 397 ? ? 117.08 120.30 -3.22  0.50 N 
23 1 NE  A ARG 402 ? ? CZ  A ARG 402 ? ? NH1 A ARG 402 ? ? 124.60 120.30 4.30   0.50 N 
24 1 NE  A ARG 402 ? ? CZ  A ARG 402 ? ? NH2 A ARG 402 ? ? 115.62 120.30 -4.68  0.50 N 
25 1 CB  A TYR 405 ? ? CG  A TYR 405 ? ? CD2 A TYR 405 ? ? 116.87 121.00 -4.13  0.60 N 
26 1 NE  A ARG 410 ? ? CZ  A ARG 410 ? ? NH1 A ARG 410 ? ? 126.59 120.30 6.29   0.50 N 
27 1 NE  A ARG 410 ? ? CZ  A ARG 410 ? ? NH2 A ARG 410 ? ? 116.32 120.30 -3.98  0.50 N 
28 1 CD1 A TRP 428 ? ? CG  A TRP 428 ? ? CD2 A TRP 428 ? ? 113.07 106.30 6.77   0.80 N 
29 1 CE2 A TRP 428 ? ? CD2 A TRP 428 ? ? CG  A TRP 428 ? ? 101.57 107.30 -5.73  0.80 N 
30 1 NE  A ARG 430 ? ? CZ  A ARG 430 ? ? NH2 A ARG 430 ? ? 113.08 120.30 -7.22  0.50 N 
31 1 CG1 A VAL 442 ? ? CB  A VAL 442 ? ? CG2 A VAL 442 ? ? 100.29 110.90 -10.61 1.60 N 
32 1 NE  A ARG 452 ? ? CZ  A ARG 452 ? ? NH1 A ARG 452 ? ? 123.56 120.30 3.26   0.50 N 
33 1 CB  A TYR 517 ? ? CG  A TYR 517 ? ? CD2 A TYR 517 ? ? 116.70 121.00 -4.30  0.60 N 
34 1 CA  A LYS 522 ? ? C   A LYS 522 ? ? N   A ASP 523 ? ? 101.44 117.20 -15.76 2.20 Y 
35 1 NE  A ARG 528 ? ? CZ  A ARG 528 ? ? NH1 A ARG 528 ? ? 124.59 120.30 4.29   0.50 N 
36 1 CD1 A TRP 547 ? ? CG  A TRP 547 ? ? CD2 A TRP 547 ? ? 112.42 106.30 6.12   0.80 N 
37 1 CE2 A TRP 547 ? ? CD2 A TRP 547 ? ? CG  A TRP 547 ? ? 101.64 107.30 -5.66  0.80 N 
38 1 CD1 A TRP 576 ? ? CG  A TRP 576 ? ? CD2 A TRP 576 ? ? 111.78 106.30 5.48   0.80 N 
39 1 CE2 A TRP 576 ? ? CD2 A TRP 576 ? ? CG  A TRP 576 ? ? 102.47 107.30 -4.83  0.80 N 
40 1 NE  A ARG 580 ? ? CZ  A ARG 580 ? ? NH1 A ARG 580 ? ? 126.72 120.30 6.42   0.50 N 
41 1 NE  A ARG 580 ? ? CZ  A ARG 580 ? ? NH2 A ARG 580 ? ? 115.13 120.30 -5.17  0.50 N 
42 1 CB  A HIS 582 ? ? CG  A HIS 582 ? ? CD2 A HIS 582 ? ? 119.21 129.70 -10.49 1.60 N 
43 1 CD1 A TRP 630 ? ? CG  A TRP 630 ? ? CD2 A TRP 630 ? ? 112.58 106.30 6.28   0.80 N 
44 1 CE2 A TRP 630 ? ? CD2 A TRP 630 ? ? CG  A TRP 630 ? ? 101.79 107.30 -5.51  0.80 N 
45 1 O   A ALA 642 ? ? C   A ALA 642 ? ? N   A SER 643 ? ? 111.04 122.70 -11.66 1.60 Y 
46 1 NE  A ARG 666 ? ? CZ  A ARG 666 ? ? NH1 A ARG 666 ? ? 124.50 120.30 4.20   0.50 N 
47 1 NE  A ARG 666 ? ? CZ  A ARG 666 ? ? NH2 A ARG 666 ? ? 114.32 120.30 -5.98  0.50 N 
48 1 CD1 A TRP 738 ? ? CG  A TRP 738 ? ? CD2 A TRP 738 ? ? 112.53 106.30 6.23   0.80 N 
49 1 CE2 A TRP 738 ? ? CD2 A TRP 738 ? ? CG  A TRP 738 ? ? 101.83 107.30 -5.47  0.80 N 
50 1 NE  A ARG 740 ? ? CZ  A ARG 740 ? ? NH1 A ARG 740 ? ? 124.64 120.30 4.34   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 106 ? ? -148.61 -54.98  
2  1 ASP A 165 ? ? -178.29 137.96  
3  1 THR A 229 ? ? 66.97   167.54  
4  1 THR A 267 ? ? -178.77 -171.54 
5  1 LYS A 296 ? ? -29.86  -39.91  
6  1 SER A 357 ? ? 61.29   164.42  
7  1 ASN A 360 ? ? -152.11 58.03   
8  1 ILE A 425 ? ? -100.69 40.69   
9  1 TYR A 445 ? ? -90.22  -145.92 
10 1 ASN A 448 ? ? -146.86 34.78   
11 1 ASP A 454 ? ? -143.38 20.26   
12 1 ALA A 455 ? ? 53.22   16.01   
13 1 THR A 464 ? ? -149.85 -159.78 
14 1 ASP A 523 ? ? -143.37 -95.04  
15 1 SER A 524 ? ? -36.44  -93.42  
16 1 SER A 525 ? ? 56.01   -0.86   
17 1 LEU A 552 ? ? -106.62 70.55   
18 1 ALA A 573 ? ? -106.29 -128.51 
19 1 ASP A 635 ? ? -92.76  -130.13 
20 1 ARG A 644 ? ? -38.20  106.51  
21 1 ASP A 687 ? ? -49.56  -19.57  
22 1 PRO A 693 ? ? -46.56  -17.30  
23 1 SER A 743 ? ? 178.72  161.50  
24 1 GLN A 753 ? ? 20.82   44.26   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     363 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.069 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    641 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   ALA 
_pdbx_validate_polymer_linkage.auth_seq_id_2    642 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.17 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CITRATE ANION'       FLC 
3 'IRON/SULFUR CLUSTER' SF4 
4 'OXYGEN ATOM'         O   
5 water                 HOH 
#