data_1BEY
# 
_entry.id   1BEY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BEY         
WWPDB D_1000171675 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BEY 
_pdbx_database_status.recvd_initial_deposition_date   1998-05-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheetham, G.M.T.' 1 
'Hale, G.'         2 
'Waldmann, H.'     3 
'Bloomer, A.C.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of a rat anti-CD52 (CAMPATH-1) therapeutic antibody Fab fragment and its humanized counterpart.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            284 
_citation.page_first                85 
_citation.page_last                 99 
_citation.year                      1998 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9811544 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1998.2157 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cheetham, G.M.' 1 
primary 'Hale, G.'       2 
primary 'Waldmann, H.'   3 
primary 'Bloomer, A.C.'  4 
# 
_cell.entry_id           1BEY 
_cell.length_a           80.060 
_cell.length_b           80.060 
_cell.length_c           347.250 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BEY 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'CAMPATH-1H ANTIBODY' 23596.271 1 ? ? 'FAB FRAGMENT' ? 
2 polymer nat 'CAMPATH-1H ANTIBODY' 23418.307 1 ? ? 'FAB FRAGMENT' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPSRFSGSGSGTDFTFTISSLQP
EDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPSRFSGSGSGTDFTFTISSLQP
EDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
L ? 
2 'polypeptide(L)' no no 
;QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTEYNPSVKGRVTMLVDTSKNQ
FSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
;
;QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTEYNPSVKGRVTMLVDTSKNQ
FSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  ASP n 
1 18  ARG n 
1 19  VAL n 
1 20  THR n 
1 21  ILE n 
1 22  THR n 
1 23  CYS n 
1 24  LYS n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  ASN n 
1 29  ILE n 
1 30  ASP n 
1 31  LYS n 
1 32  TYR n 
1 33  LEU n 
1 34  ASN n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  GLY n 
1 42  LYS n 
1 43  ALA n 
1 44  PRO n 
1 45  LYS n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  TYR n 
1 50  ASN n 
1 51  THR n 
1 52  ASN n 
1 53  ASN n 
1 54  LEU n 
1 55  GLN n 
1 56  THR n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  THR n 
1 73  PHE n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  SER n 
1 78  LEU n 
1 79  GLN n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  ILE n 
1 84  ALA n 
1 85  THR n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  LEU n 
1 90  GLN n 
1 91  HIS n 
1 92  ILE n 
1 93  SER n 
1 94  ARG n 
1 95  PRO n 
1 96  ARG n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLN n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 VAL n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
1 108 ARG n 
1 109 THR n 
1 110 VAL n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 SER n 
1 115 VAL n 
1 116 PHE n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 ASP n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 LYS n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 ARG n 
1 143 GLU n 
1 144 ALA n 
1 145 LYS n 
1 146 VAL n 
1 147 GLN n 
1 148 TRP n 
1 149 LYS n 
1 150 VAL n 
1 151 ASP n 
1 152 ASN n 
1 153 ALA n 
1 154 LEU n 
1 155 GLN n 
1 156 SER n 
1 157 GLY n 
1 158 ASN n 
1 159 SER n 
1 160 GLN n 
1 161 GLU n 
1 162 SER n 
1 163 VAL n 
1 164 THR n 
1 165 GLU n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 LEU n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 SER n 
1 183 LYS n 
1 184 ALA n 
1 185 ASP n 
1 186 TYR n 
1 187 GLU n 
1 188 LYS n 
1 189 HIS n 
1 190 LYS n 
1 191 VAL n 
1 192 TYR n 
1 193 ALA n 
1 194 CYS n 
1 195 GLU n 
1 196 VAL n 
1 197 THR n 
1 198 HIS n 
1 199 GLN n 
1 200 GLY n 
1 201 LEU n 
1 202 SER n 
1 203 SER n 
1 204 PRO n 
1 205 VAL n 
1 206 THR n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
1 212 GLY n 
1 213 GLU n 
1 214 CYS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  ARG n 
2 14  PRO n 
2 15  SER n 
2 16  GLN n 
2 17  THR n 
2 18  LEU n 
2 19  SER n 
2 20  LEU n 
2 21  THR n 
2 22  CYS n 
2 23  THR n 
2 24  VAL n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  PHE n 
2 33  TYR n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  PRO n 
2 41  PRO n 
2 42  GLY n 
2 43  ARG n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  PHE n 
2 51  ILE n 
2 52  ARG n 
2 53  ASP n 
2 54  LYS n 
2 55  ALA n 
2 56  LYS n 
2 57  GLY n 
2 58  TYR n 
2 59  THR n 
2 60  THR n 
2 61  GLU n 
2 62  TYR n 
2 63  ASN n 
2 64  PRO n 
2 65  SER n 
2 66  VAL n 
2 67  LYS n 
2 68  GLY n 
2 69  ARG n 
2 70  VAL n 
2 71  THR n 
2 72  MET n 
2 73  LEU n 
2 74  VAL n 
2 75  ASP n 
2 76  THR n 
2 77  SER n 
2 78  LYS n 
2 79  ASN n 
2 80  GLN n 
2 81  PHE n 
2 82  SER n 
2 83  LEU n 
2 84  ARG n 
2 85  LEU n 
2 86  SER n 
2 87  SER n 
2 88  VAL n 
2 89  THR n 
2 90  ALA n 
2 91  ALA n 
2 92  ASP n 
2 93  THR n 
2 94  ALA n 
2 95  VAL n 
2 96  TYR n 
2 97  TYR n 
2 98  CYS n 
2 99  ALA n 
2 100 ARG n 
2 101 GLU n 
2 102 GLY n 
2 103 HIS n 
2 104 THR n 
2 105 ALA n 
2 106 ALA n 
2 107 PRO n 
2 108 PHE n 
2 109 ASP n 
2 110 TYR n 
2 111 TRP n 
2 112 GLY n 
2 113 GLN n 
2 114 GLY n 
2 115 SER n 
2 116 LEU n 
2 117 VAL n 
2 118 THR n 
2 119 VAL n 
2 120 SER n 
2 121 SER n 
2 122 ALA n 
2 123 SER n 
2 124 THR n 
2 125 LYS n 
2 126 GLY n 
2 127 PRO n 
2 128 SER n 
2 129 VAL n 
2 130 PHE n 
2 131 PRO n 
2 132 LEU n 
2 133 ALA n 
2 134 PRO n 
2 135 SER n 
2 136 SER n 
2 137 LYS n 
2 138 SER n 
2 139 THR n 
2 140 SER n 
2 141 GLY n 
2 142 GLY n 
2 143 THR n 
2 144 ALA n 
2 145 ALA n 
2 146 LEU n 
2 147 GLY n 
2 148 CYS n 
2 149 LEU n 
2 150 VAL n 
2 151 LYS n 
2 152 ASP n 
2 153 TYR n 
2 154 PHE n 
2 155 PRO n 
2 156 GLU n 
2 157 PRO n 
2 158 VAL n 
2 159 THR n 
2 160 VAL n 
2 161 SER n 
2 162 TRP n 
2 163 ASN n 
2 164 SER n 
2 165 GLY n 
2 166 ALA n 
2 167 LEU n 
2 168 THR n 
2 169 SER n 
2 170 GLY n 
2 171 VAL n 
2 172 HIS n 
2 173 THR n 
2 174 PHE n 
2 175 PRO n 
2 176 ALA n 
2 177 VAL n 
2 178 LEU n 
2 179 GLN n 
2 180 SER n 
2 181 SER n 
2 182 GLY n 
2 183 LEU n 
2 184 TYR n 
2 185 SER n 
2 186 LEU n 
2 187 SER n 
2 188 SER n 
2 189 VAL n 
2 190 VAL n 
2 191 THR n 
2 192 VAL n 
2 193 PRO n 
2 194 SER n 
2 195 SER n 
2 196 SER n 
2 197 LEU n 
2 198 GLY n 
2 199 THR n 
2 200 GLN n 
2 201 THR n 
2 202 TYR n 
2 203 ILE n 
2 204 CYS n 
2 205 ASN n 
2 206 VAL n 
2 207 ASN n 
2 208 HIS n 
2 209 LYS n 
2 210 PRO n 
2 211 SER n 
2 212 ASN n 
2 213 THR n 
2 214 LYS n 
2 215 VAL n 
2 216 ASP n 
2 217 LYS n 
2 218 LYS n 
2 219 VAL n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'HYBRIDOMA CULTURE SUPERNATANT' 
2 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'HYBRIDOMA CULTURE SUPERNATANT' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 GB AAB21182 1 243868 1 
;MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPSR
FSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP
REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
? 
2 GB AAB21181 2 243866 1 
;MGWSCIILFLVATATGVHSQVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTE
YNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSG
GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI
AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BEY L 1 ? 214 ? 243868 20 ? 233 ? 1 214 
2 2 1BEY H 1 ? 219 ? 243866 20 ? 238 ? 1 219 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BEY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.4 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1992-12 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MONOCHROMATOR 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.5' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.5 
_diffrn_source.pdbx_wavelength             0.900 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BEY 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            3.25 
_reflns.number_obs                   10139 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.0 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        8 
_reflns.B_iso_Wilson_estimate        39.0 
_reflns.pdbx_redundancy              3.0 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.25 
_reflns_shell.d_res_low              3.42 
_reflns_shell.percent_possible_all   67 
_reflns_shell.Rmerge_I_obs           0.204 
_reflns_shell.pdbx_Rsym_value        0.204 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BEY 
_refine.ls_number_reflns_obs                     8437 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            3.25 
_refine.ls_percent_reflns_obs                    90.9 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.306 
_refine.ls_R_factor_R_free_error                 0.014 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  462 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               54.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 7FAB (CON) 1FDL (VAR)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'GROUPED, UNRESTRAINED' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BEY 
_refine_analyze.Luzzati_coordinate_error_obs    0.39 
_refine_analyze.Luzzati_sigma_a_obs             0.54 
_refine_analyze.Luzzati_d_res_low_obs           6.0 
_refine_analyze.Luzzati_coordinate_error_free   0.59 
_refine_analyze.Luzzati_sigma_a_free            0.90 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3247 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3247 
_refine_hist.d_res_high                       3.25 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.23  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.0   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.25 
_refine_ls_shell.d_res_low                        3.35 
_refine_ls_shell.number_reflns_R_work             604 
_refine_ls_shell.R_factor_R_work                  0.321 
_refine_ls_shell.percent_reflns_obs               68.6 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.R_factor_R_free_error            0.059 
_refine_ls_shell.percent_reflns_R_free            3.5 
_refine_ls_shell.number_reflns_R_free             32 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       CNS_TOPPAR:PROTEIN_REP.PA 
_pdbx_xplor_file.topol_file       CNS_TOPPAR:PROTEIN.TOP 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1BEY 
_struct.title                     'ANTIBODY TO CAMPATH-1H HUMANIZED FAB' 
_struct.pdbx_descriptor           'CAMPATH-1H ANTIBODY' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BEY 
_struct_keywords.pdbx_keywords   ANTIBODY 
_struct_keywords.text            'ANTIBODY, FAB, CAMPATH-1H, CD52' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE B 29  ? ASP B 31  ? PHE H 29  ASP H 31  5 ? 3 
HELX_P HELX_P2 2 TRP B 162 ? SER B 164 ? TRP H 162 SER H 164 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 98  SG ? ? H CYS 22  H CYS 98  1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf4 disulf ? ? B CYS 148 SG ? ? ? 1_555 B CYS 204 SG ? ? H CYS 148 H CYS 204 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   L PRO 8   A ? PRO 8   L 1 -1.68 
2 ARG 94  A . ? ARG 94  L PRO 95  A ? PRO 95  L 1 0.12  
3 TYR 140 A . ? TYR 140 L PRO 141 A ? PRO 141 L 1 0.41  
4 ALA 106 B . ? ALA 106 H PRO 107 B ? PRO 107 H 1 -0.71 
5 PHE 154 B . ? PHE 154 H PRO 155 B ? PRO 155 H 1 1.49  
6 GLU 156 B . ? GLU 156 H PRO 157 B ? PRO 157 H 1 0.37  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? SER A 7   ? MET L 4   SER L 7   
A 2 VAL A 19  ? ALA A 25  ? VAL L 19  ALA L 25  
A 3 THR A 72  ? ILE A 75  ? THR L 72  ILE L 75  
A 4 PHE A 62  ? SER A 65  ? PHE L 62  SER L 65  
B 1 TYR A 86  ? GLN A 90  ? TYR L 86  GLN L 90  
B 2 LEU A 33  ? GLN A 37  ? LEU L 33  GLN L 37  
B 3 LYS A 45  ? ILE A 48  ? LYS L 45  ILE L 48  
C 1 ALA A 144 ? LYS A 149 ? ALA L 144 LYS L 149 
C 2 ALA A 193 ? HIS A 198 ? ALA L 193 HIS L 198 
D 1 GLU A 161 ? VAL A 163 ? GLU L 161 VAL L 163 
D 2 LEU A 175 ? SER A 177 ? LEU L 175 SER L 177 
E 1 GLN B 3   ? GLN B 5   ? GLN H 3   GLN H 5   
E 2 THR B 23  ? SER B 25  ? THR H 23  SER H 25  
F 1 THR B 17  ? LEU B 20  ? THR H 17  LEU H 20  
F 2 LEU B 83  ? SER B 86  ? LEU H 83  SER H 86  
G 1 VAL B 95  ? GLU B 101 ? VAL H 95  GLU H 101 
G 2 TYR B 33  ? GLN B 39  ? TYR H 33  GLN H 39  
G 3 GLU B 46  ? ILE B 51  ? GLU H 46  ILE H 51  
G 4 THR B 60  ? TYR B 62  ? THR H 60  TYR H 62  
H 1 SER B 128 ? LEU B 132 ? SER H 128 LEU H 132 
H 2 GLY B 147 ? TYR B 153 ? GLY H 147 TYR H 153 
H 3 TYR B 184 ? LEU B 186 ? TYR H 184 LEU H 186 
I 1 THR B 159 ? TRP B 162 ? THR H 159 TRP H 162 
I 2 ILE B 203 ? HIS B 208 ? ILE H 203 HIS H 208 
I 3 THR B 213 ? LYS B 218 ? THR H 213 LYS H 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR L 5   N LYS A 24  ? N LYS L 24  
A 2 3 O VAL A 19  ? O VAL L 19  N ILE A 75  ? N ILE L 75  
A 3 4 O THR A 72  ? O THR L 72  N SER A 65  ? N SER L 65  
B 1 2 O TYR A 87  ? O TYR L 87  N TYR A 36  ? N TYR L 36  
B 2 3 O TRP A 35  ? O TRP L 35  N ILE A 48  ? N ILE L 48  
C 1 2 O LYS A 145 ? O LYS L 145 N THR A 197 ? N THR L 197 
D 1 2 O SER A 162 ? O SER L 162 N SER A 176 ? N SER L 176 
E 1 2 O GLN B 3   ? O GLN H 3   N SER B 25  ? N SER H 25  
F 1 2 O LEU B 18  ? O LEU H 18  N LEU B 85  ? N LEU H 85  
G 1 2 O VAL B 95  ? O VAL H 95  N GLN B 39  ? N GLN H 39  
G 2 3 O MET B 34  ? O MET H 34  N ILE B 51  ? N ILE H 51  
G 3 4 O PHE B 50  ? O PHE H 50  N GLU B 61  ? N GLU H 61  
H 1 2 O SER B 128 ? O SER H 128 N LYS B 151 ? N LYS H 151 
H 2 3 O VAL B 150 ? O VAL H 150 N LEU B 186 ? N LEU H 186 
I 1 2 O THR B 159 ? O THR H 159 N ASN B 207 ? N ASN H 207 
I 2 3 O CYS B 204 ? O CYS H 204 N LYS B 217 ? N LYS H 217 
# 
_database_PDB_matrix.entry_id          1BEY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BEY 
_atom_sites.fract_transf_matrix[1][1]   0.012491 
_atom_sites.fract_transf_matrix[1][2]   0.007211 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014423 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002880 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ASP A 1 1   ? -11.979 53.307 56.156 1.00 60.18  ? 1   ASP L N   1 
ATOM 2    C CA  . ASP A 1 1   ? -11.409 53.134 54.804 1.00 60.18  ? 1   ASP L CA  1 
ATOM 3    C C   . ASP A 1 1   ? -12.566 52.994 53.833 1.00 60.18  ? 1   ASP L C   1 
ATOM 4    O O   . ASP A 1 1   ? -13.638 52.533 54.223 1.00 60.18  ? 1   ASP L O   1 
ATOM 5    C CB  . ASP A 1 1   ? -10.548 51.882 54.788 1.00 100.00 ? 1   ASP L CB  1 
ATOM 6    C CG  . ASP A 1 1   ? -9.519  51.885 55.894 1.00 100.00 ? 1   ASP L CG  1 
ATOM 7    O OD1 . ASP A 1 1   ? -9.919  51.955 57.078 1.00 100.00 ? 1   ASP L OD1 1 
ATOM 8    O OD2 . ASP A 1 1   ? -8.311  51.825 55.585 1.00 100.00 ? 1   ASP L OD2 1 
ATOM 9    N N   . ILE A 1 2   ? -12.364 53.415 52.584 1.00 58.20  ? 2   ILE L N   1 
ATOM 10   C CA  . ILE A 1 2   ? -13.404 53.313 51.562 1.00 58.20  ? 2   ILE L CA  1 
ATOM 11   C C   . ILE A 1 2   ? -12.719 52.897 50.278 1.00 58.20  ? 2   ILE L C   1 
ATOM 12   O O   . ILE A 1 2   ? -12.655 53.664 49.326 1.00 58.20  ? 2   ILE L O   1 
ATOM 13   C CB  . ILE A 1 2   ? -14.107 54.648 51.278 1.00 43.72  ? 2   ILE L CB  1 
ATOM 14   C CG1 . ILE A 1 2   ? -14.170 55.508 52.531 1.00 43.72  ? 2   ILE L CG1 1 
ATOM 15   C CG2 . ILE A 1 2   ? -15.519 54.372 50.838 1.00 43.72  ? 2   ILE L CG2 1 
ATOM 16   C CD1 . ILE A 1 2   ? -14.829 56.853 52.312 1.00 43.72  ? 2   ILE L CD1 1 
ATOM 17   N N   . GLN A 1 3   ? -12.207 51.675 50.269 1.00 31.51  ? 3   GLN L N   1 
ATOM 18   C CA  . GLN A 1 3   ? -11.495 51.106 49.123 1.00 31.51  ? 3   GLN L CA  1 
ATOM 19   C C   . GLN A 1 3   ? -11.804 51.816 47.805 1.00 31.51  ? 3   GLN L C   1 
ATOM 20   O O   . GLN A 1 3   ? -12.963 51.967 47.450 1.00 31.51  ? 3   GLN L O   1 
ATOM 21   C CB  . GLN A 1 3   ? -11.833 49.610 48.985 1.00 95.47  ? 3   GLN L CB  1 
ATOM 22   C CG  . GLN A 1 3   ? -10.790 48.788 48.206 1.00 95.47  ? 3   GLN L CG  1 
ATOM 23   C CD  . GLN A 1 3   ? -11.221 47.341 47.950 1.00 95.47  ? 3   GLN L CD  1 
ATOM 24   O OE1 . GLN A 1 3   ? -11.851 46.713 48.801 1.00 95.47  ? 3   GLN L OE1 1 
ATOM 25   N NE2 . GLN A 1 3   ? -10.854 46.802 46.786 1.00 95.47  ? 3   GLN L NE2 1 
ATOM 26   N N   . MET A 1 4   ? -10.767 52.263 47.101 1.00 36.95  ? 4   MET L N   1 
ATOM 27   C CA  . MET A 1 4   ? -10.925 52.919 45.813 1.00 36.95  ? 4   MET L CA  1 
ATOM 28   C C   . MET A 1 4   ? -10.154 52.112 44.786 1.00 36.95  ? 4   MET L C   1 
ATOM 29   O O   . MET A 1 4   ? -8.946  51.944 44.924 1.00 36.95  ? 4   MET L O   1 
ATOM 30   C CB  . MET A 1 4   ? -10.370 54.350 45.827 1.00 46.22  ? 4   MET L CB  1 
ATOM 31   C CG  . MET A 1 4   ? -11.271 55.375 46.473 1.00 46.22  ? 4   MET L CG  1 
ATOM 32   S SD  . MET A 1 4   ? -12.933 55.362 45.736 1.00 46.22  ? 4   MET L SD  1 
ATOM 33   C CE  . MET A 1 4   ? -12.670 55.771 44.084 1.00 46.22  ? 4   MET L CE  1 
ATOM 34   N N   . THR A 1 5   ? -10.835 51.617 43.754 1.00 37.68  ? 5   THR L N   1 
ATOM 35   C CA  . THR A 1 5   ? -10.160 50.833 42.717 1.00 37.68  ? 5   THR L CA  1 
ATOM 36   C C   . THR A 1 5   ? -10.320 51.287 41.246 1.00 37.68  ? 5   THR L C   1 
ATOM 37   O O   . THR A 1 5   ? -11.395 51.257 40.672 1.00 37.68  ? 5   THR L O   1 
ATOM 38   C CB  . THR A 1 5   ? -10.526 49.333 42.888 1.00 53.72  ? 5   THR L CB  1 
ATOM 39   O OG1 . THR A 1 5   ? -10.228 48.611 41.683 1.00 53.72  ? 5   THR L OG1 1 
ATOM 40   C CG2 . THR A 1 5   ? -11.980 49.183 43.284 1.00 53.72  ? 5   THR L CG2 1 
ATOM 41   N N   . GLN A 1 6   ? -9.210  51.718 40.660 1.00 23.18  ? 6   GLN L N   1 
ATOM 42   C CA  . GLN A 1 6   ? -9.132  52.184 39.284 1.00 23.18  ? 6   GLN L CA  1 
ATOM 43   C C   . GLN A 1 6   ? -9.149  51.027 38.333 1.00 23.18  ? 6   GLN L C   1 
ATOM 44   O O   . GLN A 1 6   ? -9.015  49.883 38.733 1.00 23.18  ? 6   GLN L O   1 
ATOM 45   C CB  . GLN A 1 6   ? -7.829  52.895 39.029 1.00 43.52  ? 6   GLN L CB  1 
ATOM 46   C CG  . GLN A 1 6   ? -7.595  54.097 39.825 1.00 43.52  ? 6   GLN L CG  1 
ATOM 47   C CD  . GLN A 1 6   ? -6.210  54.586 39.618 1.00 43.52  ? 6   GLN L CD  1 
ATOM 48   O OE1 . GLN A 1 6   ? -5.777  54.841 38.487 1.00 43.52  ? 6   GLN L OE1 1 
ATOM 49   N NE2 . GLN A 1 6   ? -5.480  54.711 40.711 1.00 43.52  ? 6   GLN L NE2 1 
ATOM 50   N N   . SER A 1 7   ? -9.213  51.350 37.056 1.00 63.56  ? 7   SER L N   1 
ATOM 51   C CA  . SER A 1 7   ? -9.285  50.355 36.014 1.00 63.56  ? 7   SER L CA  1 
ATOM 52   C C   . SER A 1 7   ? -9.122  51.089 34.706 1.00 63.56  ? 7   SER L C   1 
ATOM 53   O O   . SER A 1 7   ? -9.688  52.169 34.533 1.00 63.56  ? 7   SER L O   1 
ATOM 54   C CB  . SER A 1 7   ? -10.667 49.706 36.065 1.00 33.17  ? 7   SER L CB  1 
ATOM 55   O OG  . SER A 1 7   ? -10.942 48.932 34.913 1.00 33.17  ? 7   SER L OG  1 
ATOM 56   N N   . PRO A 1 8   ? -8.344  50.534 33.767 1.00 57.88  ? 8   PRO L N   1 
ATOM 57   C CA  . PRO A 1 8   ? -7.601  49.291 33.895 1.00 57.88  ? 8   PRO L CA  1 
ATOM 58   C C   . PRO A 1 8   ? -6.358  49.623 34.718 1.00 57.88  ? 8   PRO L C   1 
ATOM 59   O O   . PRO A 1 8   ? -6.208  50.771 35.131 1.00 57.88  ? 8   PRO L O   1 
ATOM 60   C CB  . PRO A 1 8   ? -7.312  48.955 32.442 1.00 31.63  ? 8   PRO L CB  1 
ATOM 61   C CG  . PRO A 1 8   ? -7.027  50.310 31.879 1.00 31.63  ? 8   PRO L CG  1 
ATOM 62   C CD  . PRO A 1 8   ? -8.210  51.056 32.389 1.00 31.63  ? 8   PRO L CD  1 
ATOM 63   N N   . SER A 1 9   ? -5.474  48.641 34.938 1.00 53.07  ? 9   SER L N   1 
ATOM 64   C CA  . SER A 1 9   ? -4.260  48.819 35.762 1.00 53.07  ? 9   SER L CA  1 
ATOM 65   C C   . SER A 1 9   ? -2.960  49.289 35.077 1.00 53.07  ? 9   SER L C   1 
ATOM 66   O O   . SER A 1 9   ? -2.238  50.168 35.582 1.00 53.07  ? 9   SER L O   1 
ATOM 67   C CB  . SER A 1 9   ? -3.957  47.514 36.524 1.00 90.60  ? 9   SER L CB  1 
ATOM 68   O OG  . SER A 1 9   ? -5.013  47.131 37.392 1.00 90.60  ? 9   SER L OG  1 
ATOM 69   N N   . SER A 1 10  ? -2.662  48.681 33.940 1.00 39.32  ? 10  SER L N   1 
ATOM 70   C CA  . SER A 1 10  ? -1.459  48.987 33.183 1.00 39.32  ? 10  SER L CA  1 
ATOM 71   C C   . SER A 1 10  ? -1.968  48.879 31.765 1.00 39.32  ? 10  SER L C   1 
ATOM 72   O O   . SER A 1 10  ? -2.083  47.781 31.246 1.00 39.32  ? 10  SER L O   1 
ATOM 73   C CB  . SER A 1 10  ? -0.388  47.912 33.471 1.00 40.59  ? 10  SER L CB  1 
ATOM 74   O OG  . SER A 1 10  ? 0.837   48.157 32.798 1.00 40.59  ? 10  SER L OG  1 
ATOM 75   N N   . LEU A 1 11  ? -2.298  49.997 31.131 1.00 43.10  ? 11  LEU L N   1 
ATOM 76   C CA  . LEU A 1 11  ? -2.834  49.900 29.785 1.00 43.10  ? 11  LEU L CA  1 
ATOM 77   C C   . LEU A 1 11  ? -1.829  50.332 28.729 1.00 43.10  ? 11  LEU L C   1 
ATOM 78   O O   . LEU A 1 11  ? -0.719  50.707 29.079 1.00 43.10  ? 11  LEU L O   1 
ATOM 79   C CB  . LEU A 1 11  ? -4.139  50.681 29.694 1.00 10.00  ? 11  LEU L CB  1 
ATOM 80   C CG  . LEU A 1 11  ? -4.159  52.138 29.337 1.00 10.00  ? 11  LEU L CG  1 
ATOM 81   C CD1 . LEU A 1 11  ? -4.203  52.283 27.821 1.00 10.00  ? 11  LEU L CD1 1 
ATOM 82   C CD2 . LEU A 1 11  ? -5.389  52.742 29.950 1.00 10.00  ? 11  LEU L CD2 1 
ATOM 83   N N   . SER A 1 12  ? -2.207  50.258 27.447 1.00 24.16  ? 12  SER L N   1 
ATOM 84   C CA  . SER A 1 12  ? -1.295  50.611 26.363 1.00 24.16  ? 12  SER L CA  1 
ATOM 85   C C   . SER A 1 12  ? -1.915  51.327 25.160 1.00 24.16  ? 12  SER L C   1 
ATOM 86   O O   . SER A 1 12  ? -1.949  50.789 24.066 1.00 24.16  ? 12  SER L O   1 
ATOM 87   C CB  . SER A 1 12  ? -0.564  49.344 25.894 1.00 40.70  ? 12  SER L CB  1 
ATOM 88   O OG  . SER A 1 12  ? 0.350   49.603 24.834 1.00 40.70  ? 12  SER L OG  1 
ATOM 89   N N   . ALA A 1 13  ? -2.371  52.558 25.341 1.00 30.85  ? 13  ALA L N   1 
ATOM 90   C CA  . ALA A 1 13  ? -2.993  53.273 24.226 1.00 30.85  ? 13  ALA L CA  1 
ATOM 91   C C   . ALA A 1 13  ? -1.953  53.885 23.325 1.00 30.85  ? 13  ALA L C   1 
ATOM 92   O O   . ALA A 1 13  ? -0.781  53.592 23.509 1.00 30.85  ? 13  ALA L O   1 
ATOM 93   C CB  . ALA A 1 13  ? -3.930  54.342 24.749 1.00 76.29  ? 13  ALA L CB  1 
ATOM 94   N N   . SER A 1 14  ? -2.378  54.727 22.377 1.00 99.64  ? 14  SER L N   1 
ATOM 95   C CA  . SER A 1 14  ? -1.472  55.378 21.418 1.00 99.64  ? 14  SER L CA  1 
ATOM 96   C C   . SER A 1 14  ? -1.578  56.913 21.377 1.00 99.64  ? 14  SER L C   1 
ATOM 97   O O   . SER A 1 14  ? -2.470  57.491 21.998 1.00 99.64  ? 14  SER L O   1 
ATOM 98   C CB  . SER A 1 14  ? -1.731  54.840 20.014 1.00 70.74  ? 14  SER L CB  1 
ATOM 99   O OG  . SER A 1 14  ? -1.692  53.425 19.983 1.00 70.74  ? 14  SER L OG  1 
ATOM 100  N N   . VAL A 1 15  ? -0.673  57.551 20.622 1.00 26.55  ? 15  VAL L N   1 
ATOM 101  C CA  . VAL A 1 15  ? -0.593  59.026 20.472 1.00 26.55  ? 15  VAL L CA  1 
ATOM 102  C C   . VAL A 1 15  ? -1.702  59.554 19.573 1.00 26.55  ? 15  VAL L C   1 
ATOM 103  O O   . VAL A 1 15  ? -1.656  59.406 18.351 1.00 26.55  ? 15  VAL L O   1 
ATOM 104  C CB  . VAL A 1 15  ? 0.730   59.438 19.799 1.00 10.00  ? 15  VAL L CB  1 
ATOM 105  C CG1 . VAL A 1 15  ? 0.950   60.901 19.958 1.00 10.00  ? 15  VAL L CG1 1 
ATOM 106  C CG2 . VAL A 1 15  ? 1.883   58.605 20.326 1.00 10.00  ? 15  VAL L CG2 1 
ATOM 107  N N   . GLY A 1 16  ? -2.693  60.200 20.144 1.00 51.28  ? 16  GLY L N   1 
ATOM 108  C CA  . GLY A 1 16  ? -3.778  60.668 19.295 1.00 51.28  ? 16  GLY L CA  1 
ATOM 109  C C   . GLY A 1 16  ? -5.025  59.888 19.660 1.00 51.28  ? 16  GLY L C   1 
ATOM 110  O O   . GLY A 1 16  ? -6.143  60.229 19.271 1.00 51.28  ? 16  GLY L O   1 
ATOM 111  N N   . ASP A 1 17  ? -4.797  58.817 20.413 1.00 45.44  ? 17  ASP L N   1 
ATOM 112  C CA  . ASP A 1 17  ? -5.855  57.970 20.915 1.00 45.44  ? 17  ASP L CA  1 
ATOM 113  C C   . ASP A 1 17  ? -6.323  58.623 22.209 1.00 45.44  ? 17  ASP L C   1 
ATOM 114  O O   . ASP A 1 17  ? -5.590  59.403 22.830 1.00 45.44  ? 17  ASP L O   1 
ATOM 115  C CB  . ASP A 1 17  ? -5.318  56.573 21.239 1.00 44.94  ? 17  ASP L CB  1 
ATOM 116  C CG  . ASP A 1 17  ? -4.864  55.831 20.022 1.00 44.94  ? 17  ASP L CG  1 
ATOM 117  O OD1 . ASP A 1 17  ? -4.011  56.356 19.293 1.00 44.94  ? 17  ASP L OD1 1 
ATOM 118  O OD2 . ASP A 1 17  ? -5.358  54.719 19.788 1.00 44.94  ? 17  ASP L OD2 1 
ATOM 119  N N   . ARG A 1 18  ? -7.543  58.299 22.619 1.00 78.70  ? 18  ARG L N   1 
ATOM 120  C CA  . ARG A 1 18  ? -8.069  58.845 23.852 1.00 78.70  ? 18  ARG L CA  1 
ATOM 121  C C   . ARG A 1 18  ? -7.913  57.722 24.853 1.00 78.70  ? 18  ARG L C   1 
ATOM 122  O O   . ARG A 1 18  ? -8.337  56.601 24.592 1.00 78.70  ? 18  ARG L O   1 
ATOM 123  C CB  . ARG A 1 18  ? -9.546  59.251 23.682 1.00 99.14  ? 18  ARG L CB  1 
ATOM 124  C CG  . ARG A 1 18  ? -10.591 58.134 23.759 1.00 99.14  ? 18  ARG L CG  1 
ATOM 125  C CD  . ARG A 1 18  ? -11.891 58.512 23.012 1.00 99.14  ? 18  ARG L CD  1 
ATOM 126  N NE  . ARG A 1 18  ? -12.362 59.863 23.298 1.00 99.14  ? 18  ARG L NE  1 
ATOM 127  C CZ  . ARG A 1 18  ? -12.736 60.291 24.497 1.00 99.14  ? 18  ARG L CZ  1 
ATOM 128  N NH1 . ARG A 1 18  ? -12.701 59.477 25.538 1.00 99.14  ? 18  ARG L NH1 1 
ATOM 129  N NH2 . ARG A 1 18  ? -13.129 61.543 24.662 1.00 99.14  ? 18  ARG L NH2 1 
ATOM 130  N N   . VAL A 1 19  ? -7.242  58.012 25.964 1.00 77.14  ? 19  VAL L N   1 
ATOM 131  C CA  . VAL A 1 19  ? -7.048  57.030 27.028 1.00 77.14  ? 19  VAL L CA  1 
ATOM 132  C C   . VAL A 1 19  ? -8.161  57.425 28.006 1.00 77.14  ? 19  VAL L C   1 
ATOM 133  O O   . VAL A 1 19  ? -8.313  58.621 28.311 1.00 77.14  ? 19  VAL L O   1 
ATOM 134  C CB  . VAL A 1 19  ? -5.667  57.184 27.760 1.00 40.64  ? 19  VAL L CB  1 
ATOM 135  C CG1 . VAL A 1 19  ? -5.288  55.876 28.436 1.00 40.64  ? 19  VAL L CG1 1 
ATOM 136  C CG2 . VAL A 1 19  ? -4.587  57.637 26.802 1.00 40.64  ? 19  VAL L CG2 1 
ATOM 137  N N   . THR A 1 20  ? -8.948  56.442 28.459 1.00 60.46  ? 20  THR L N   1 
ATOM 138  C CA  . THR A 1 20  ? -10.050 56.683 29.398 1.00 60.46  ? 20  THR L CA  1 
ATOM 139  C C   . THR A 1 20  ? -9.903  55.807 30.618 1.00 60.46  ? 20  THR L C   1 
ATOM 140  O O   . THR A 1 20  ? -10.164 54.620 30.540 1.00 60.46  ? 20  THR L O   1 
ATOM 141  C CB  . THR A 1 20  ? -11.413 56.356 28.765 1.00 80.49  ? 20  THR L CB  1 
ATOM 142  O OG1 . THR A 1 20  ? -11.741 57.347 27.791 1.00 80.49  ? 20  THR L OG1 1 
ATOM 143  C CG2 . THR A 1 20  ? -12.497 56.322 29.814 1.00 80.49  ? 20  THR L CG2 1 
ATOM 144  N N   . ILE A 1 21  ? -9.484  56.368 31.743 1.00 69.23  ? 21  ILE L N   1 
ATOM 145  C CA  . ILE A 1 21  ? -9.343  55.562 32.947 1.00 69.23  ? 21  ILE L CA  1 
ATOM 146  C C   . ILE A 1 21  ? -10.560 55.780 33.828 1.00 69.23  ? 21  ILE L C   1 
ATOM 147  O O   . ILE A 1 21  ? -11.041 56.915 33.938 1.00 69.23  ? 21  ILE L O   1 
ATOM 148  C CB  . ILE A 1 21  ? -8.119  55.940 33.724 1.00 64.30  ? 21  ILE L CB  1 
ATOM 149  C CG1 . ILE A 1 21  ? -6.881  55.660 32.881 1.00 64.30  ? 21  ILE L CG1 1 
ATOM 150  C CG2 . ILE A 1 21  ? -8.108  55.184 35.010 1.00 64.30  ? 21  ILE L CG2 1 
ATOM 151  C CD1 . ILE A 1 21  ? -5.593  56.104 33.497 1.00 64.30  ? 21  ILE L CD1 1 
ATOM 152  N N   . THR A 1 22  ? -11.054 54.702 34.449 1.00 70.75  ? 22  THR L N   1 
ATOM 153  C CA  . THR A 1 22  ? -12.253 54.751 35.295 1.00 70.75  ? 22  THR L CA  1 
ATOM 154  C C   . THR A 1 22  ? -12.027 54.134 36.631 1.00 70.75  ? 22  THR L C   1 
ATOM 155  O O   . THR A 1 22  ? -11.431 53.086 36.717 1.00 70.75  ? 22  THR L O   1 
ATOM 156  C CB  . THR A 1 22  ? -13.407 53.939 34.707 1.00 56.68  ? 22  THR L CB  1 
ATOM 157  O OG1 . THR A 1 22  ? -12.933 52.631 34.382 1.00 56.68  ? 22  THR L OG1 1 
ATOM 158  C CG2 . THR A 1 22  ? -13.962 54.589 33.472 1.00 56.68  ? 22  THR L CG2 1 
ATOM 159  N N   . CYS A 1 23  ? -12.515 54.759 37.684 1.00 19.74  ? 23  CYS L N   1 
ATOM 160  C CA  . CYS A 1 23  ? -12.357 54.143 38.985 1.00 19.74  ? 23  CYS L CA  1 
ATOM 161  C C   . CYS A 1 23  ? -13.601 54.198 39.854 1.00 19.74  ? 23  CYS L C   1 
ATOM 162  O O   . CYS A 1 23  ? -14.024 55.255 40.247 1.00 19.74  ? 23  CYS L O   1 
ATOM 163  C CB  . CYS A 1 23  ? -11.157 54.716 39.753 1.00 50.00  ? 23  CYS L CB  1 
ATOM 164  S SG  . CYS A 1 23  ? -11.212 56.373 40.519 1.00 50.00  ? 23  CYS L SG  1 
ATOM 165  N N   . LYS A 1 24  ? -14.178 53.027 40.118 1.00 44.68  ? 24  LYS L N   1 
ATOM 166  C CA  . LYS A 1 24  ? -15.359 52.839 40.952 1.00 44.68  ? 24  LYS L CA  1 
ATOM 167  C C   . LYS A 1 24  ? -14.946 53.165 42.380 1.00 44.68  ? 24  LYS L C   1 
ATOM 168  O O   . LYS A 1 24  ? -13.786 53.449 42.634 1.00 44.68  ? 24  LYS L O   1 
ATOM 169  C CB  . LYS A 1 24  ? -15.779 51.376 40.853 1.00 56.93  ? 24  LYS L CB  1 
ATOM 170  C CG  . LYS A 1 24  ? -16.851 50.934 41.817 1.00 56.93  ? 24  LYS L CG  1 
ATOM 171  C CD  . LYS A 1 24  ? -16.739 49.427 42.137 1.00 56.93  ? 24  LYS L CD  1 
ATOM 172  C CE  . LYS A 1 24  ? -17.655 49.039 43.310 1.00 56.93  ? 24  LYS L CE  1 
ATOM 173  N NZ  . LYS A 1 24  ? -17.345 47.705 43.876 1.00 56.93  ? 24  LYS L NZ  1 
ATOM 174  N N   . ALA A 1 25  ? -15.885 53.138 43.317 1.00 45.12  ? 25  ALA L N   1 
ATOM 175  C CA  . ALA A 1 25  ? -15.570 53.417 44.722 1.00 45.12  ? 25  ALA L CA  1 
ATOM 176  C C   . ALA A 1 25  ? -16.415 52.499 45.596 1.00 45.12  ? 25  ALA L C   1 
ATOM 177  O O   . ALA A 1 25  ? -17.609 52.382 45.380 1.00 45.12  ? 25  ALA L O   1 
ATOM 178  C CB  . ALA A 1 25  ? -15.865 54.850 45.041 1.00 25.22  ? 25  ALA L CB  1 
ATOM 179  N N   . SER A 1 26  ? -15.805 51.833 46.571 1.00 45.41  ? 26  SER L N   1 
ATOM 180  C CA  . SER A 1 26  ? -16.561 50.913 47.423 1.00 45.41  ? 26  SER L CA  1 
ATOM 181  C C   . SER A 1 26  ? -17.861 51.588 47.852 1.00 45.41  ? 26  SER L C   1 
ATOM 182  O O   . SER A 1 26  ? -18.958 51.137 47.476 1.00 45.41  ? 26  SER L O   1 
ATOM 183  C CB  . SER A 1 26  ? -15.732 50.475 48.646 1.00 51.62  ? 26  SER L CB  1 
ATOM 184  O OG  . SER A 1 26  ? -15.396 51.563 49.484 1.00 51.62  ? 26  SER L OG  1 
ATOM 185  N N   . GLN A 1 27  ? -17.740 52.678 48.615 1.00 70.36  ? 27  GLN L N   1 
ATOM 186  C CA  . GLN A 1 27  ? -18.908 53.434 49.053 1.00 70.36  ? 27  GLN L CA  1 
ATOM 187  C C   . GLN A 1 27  ? -19.106 54.668 48.189 1.00 70.36  ? 27  GLN L C   1 
ATOM 188  O O   . GLN A 1 27  ? -18.596 54.773 47.074 1.00 70.36  ? 27  GLN L O   1 
ATOM 189  C CB  . GLN A 1 27  ? -18.780 53.904 50.492 1.00 97.53  ? 27  GLN L CB  1 
ATOM 190  C CG  . GLN A 1 27  ? -18.555 52.834 51.509 1.00 97.53  ? 27  GLN L CG  1 
ATOM 191  C CD  . GLN A 1 27  ? -18.797 53.366 52.899 1.00 97.53  ? 27  GLN L CD  1 
ATOM 192  O OE1 . GLN A 1 27  ? -18.421 54.502 53.201 1.00 97.53  ? 27  GLN L OE1 1 
ATOM 193  N NE2 . GLN A 1 27  ? -19.413 52.554 53.761 1.00 97.53  ? 27  GLN L NE2 1 
ATOM 194  N N   . ASN A 1 28  ? -19.828 55.622 48.747 1.00 21.78  ? 28  ASN L N   1 
ATOM 195  C CA  . ASN A 1 28  ? -20.140 56.853 48.051 1.00 21.78  ? 28  ASN L CA  1 
ATOM 196  C C   . ASN A 1 28  ? -19.026 57.924 48.162 1.00 21.78  ? 28  ASN L C   1 
ATOM 197  O O   . ASN A 1 28  ? -18.300 58.007 49.158 1.00 21.78  ? 28  ASN L O   1 
ATOM 198  C CB  . ASN A 1 28  ? -21.473 57.346 48.577 1.00 57.56  ? 28  ASN L CB  1 
ATOM 199  C CG  . ASN A 1 28  ? -22.107 58.332 47.674 1.00 57.56  ? 28  ASN L CG  1 
ATOM 200  O OD1 . ASN A 1 28  ? -21.649 59.469 47.569 1.00 57.56  ? 28  ASN L OD1 1 
ATOM 201  N ND2 . ASN A 1 28  ? -23.171 57.906 46.988 1.00 57.56  ? 28  ASN L ND2 1 
ATOM 202  N N   . ILE A 1 29  ? -18.907 58.748 47.127 1.00 31.80  ? 29  ILE L N   1 
ATOM 203  C CA  . ILE A 1 29  ? -17.841 59.754 47.028 1.00 31.80  ? 29  ILE L CA  1 
ATOM 204  C C   . ILE A 1 29  ? -18.312 61.205 46.864 1.00 31.80  ? 29  ILE L C   1 
ATOM 205  O O   . ILE A 1 29  ? -17.743 62.129 47.430 1.00 31.80  ? 29  ILE L O   1 
ATOM 206  C CB  . ILE A 1 29  ? -16.868 59.368 45.814 1.00 34.23  ? 29  ILE L CB  1 
ATOM 207  C CG1 . ILE A 1 29  ? -15.931 58.218 46.210 1.00 34.23  ? 29  ILE L CG1 1 
ATOM 208  C CG2 . ILE A 1 29  ? -16.104 60.560 45.324 1.00 34.23  ? 29  ILE L CG2 1 
ATOM 209  C CD1 . ILE A 1 29  ? -15.195 58.421 47.486 1.00 34.23  ? 29  ILE L CD1 1 
ATOM 210  N N   . ASP A 1 30  ? -19.345 61.372 46.055 1.00 57.99  ? 30  ASP L N   1 
ATOM 211  C CA  . ASP A 1 30  ? -19.938 62.665 45.745 1.00 57.99  ? 30  ASP L CA  1 
ATOM 212  C C   . ASP A 1 30  ? -18.996 63.370 44.770 1.00 57.99  ? 30  ASP L C   1 
ATOM 213  O O   . ASP A 1 30  ? -18.637 62.801 43.752 1.00 57.99  ? 30  ASP L O   1 
ATOM 214  C CB  . ASP A 1 30  ? -20.168 63.502 47.028 1.00 80.14  ? 30  ASP L CB  1 
ATOM 215  C CG  . ASP A 1 30  ? -21.355 64.481 46.902 1.00 80.14  ? 30  ASP L CG  1 
ATOM 216  O OD1 . ASP A 1 30  ? -22.467 64.003 46.614 1.00 80.14  ? 30  ASP L OD1 1 
ATOM 217  O OD2 . ASP A 1 30  ? -21.195 65.711 47.094 1.00 80.14  ? 30  ASP L OD2 1 
ATOM 218  N N   . LYS A 1 31  ? -18.594 64.593 45.086 1.00 64.27  ? 31  LYS L N   1 
ATOM 219  C CA  . LYS A 1 31  ? -17.729 65.361 44.216 1.00 64.27  ? 31  LYS L CA  1 
ATOM 220  C C   . LYS A 1 31  ? -16.315 65.308 44.745 1.00 64.27  ? 31  LYS L C   1 
ATOM 221  O O   . LYS A 1 31  ? -15.405 65.945 44.202 1.00 64.27  ? 31  LYS L O   1 
ATOM 222  C CB  . LYS A 1 31  ? -18.189 66.825 44.171 1.00 89.74  ? 31  LYS L CB  1 
ATOM 223  C CG  . LYS A 1 31  ? -18.022 67.603 45.491 1.00 89.74  ? 31  LYS L CG  1 
ATOM 224  C CD  . LYS A 1 31  ? -18.517 69.053 45.383 1.00 89.74  ? 31  LYS L CD  1 
ATOM 225  C CE  . LYS A 1 31  ? -17.729 69.868 44.366 1.00 89.74  ? 31  LYS L CE  1 
ATOM 226  N NZ  . LYS A 1 31  ? -18.252 71.251 44.221 1.00 89.74  ? 31  LYS L NZ  1 
ATOM 227  N N   . TYR A 1 32  ? -16.127 64.515 45.789 1.00 91.14  ? 32  TYR L N   1 
ATOM 228  C CA  . TYR A 1 32  ? -14.840 64.425 46.452 1.00 91.14  ? 32  TYR L CA  1 
ATOM 229  C C   . TYR A 1 32  ? -13.825 63.411 45.932 1.00 91.14  ? 32  TYR L C   1 
ATOM 230  O O   . TYR A 1 32  ? -13.283 62.644 46.713 1.00 91.14  ? 32  TYR L O   1 
ATOM 231  C CB  . TYR A 1 32  ? -15.107 64.206 47.941 1.00 71.02  ? 32  TYR L CB  1 
ATOM 232  C CG  . TYR A 1 32  ? -15.939 65.329 48.552 1.00 71.02  ? 32  TYR L CG  1 
ATOM 233  C CD1 . TYR A 1 32  ? -17.230 65.615 48.085 1.00 71.02  ? 32  TYR L CD1 1 
ATOM 234  C CD2 . TYR A 1 32  ? -15.400 66.167 49.527 1.00 71.02  ? 32  TYR L CD2 1 
ATOM 235  C CE1 . TYR A 1 32  ? -17.943 66.698 48.561 1.00 71.02  ? 32  TYR L CE1 1 
ATOM 236  C CE2 . TYR A 1 32  ? -16.115 67.257 50.006 1.00 71.02  ? 32  TYR L CE2 1 
ATOM 237  C CZ  . TYR A 1 32  ? -17.377 67.513 49.515 1.00 71.02  ? 32  TYR L CZ  1 
ATOM 238  O OH  . TYR A 1 32  ? -18.043 68.611 49.980 1.00 71.02  ? 32  TYR L OH  1 
ATOM 239  N N   . LEU A 1 33  ? -13.538 63.424 44.631 1.00 37.85  ? 33  LEU L N   1 
ATOM 240  C CA  . LEU A 1 33  ? -12.582 62.484 44.060 1.00 37.85  ? 33  LEU L CA  1 
ATOM 241  C C   . LEU A 1 33  ? -11.670 63.189 43.093 1.00 37.85  ? 33  LEU L C   1 
ATOM 242  O O   . LEU A 1 33  ? -12.091 63.482 41.993 1.00 37.85  ? 33  LEU L O   1 
ATOM 243  C CB  . LEU A 1 33  ? -13.301 61.349 43.339 1.00 70.86  ? 33  LEU L CB  1 
ATOM 244  C CG  . LEU A 1 33  ? -12.415 60.343 42.602 1.00 70.86  ? 33  LEU L CG  1 
ATOM 245  C CD1 . LEU A 1 33  ? -13.166 59.072 42.338 1.00 70.86  ? 33  LEU L CD1 1 
ATOM 246  C CD2 . LEU A 1 33  ? -11.937 60.922 41.309 1.00 70.86  ? 33  LEU L CD2 1 
ATOM 247  N N   . ASN A 1 34  ? -10.421 63.450 43.497 1.00 32.82  ? 34  ASN L N   1 
ATOM 248  C CA  . ASN A 1 34  ? -9.434  64.137 42.652 1.00 32.82  ? 34  ASN L CA  1 
ATOM 249  C C   . ASN A 1 34  ? -8.789  63.171 41.671 1.00 32.82  ? 34  ASN L C   1 
ATOM 250  O O   . ASN A 1 34  ? -9.308  62.098 41.406 1.00 32.82  ? 34  ASN L O   1 
ATOM 251  C CB  . ASN A 1 34  ? -8.293  64.713 43.483 1.00 38.88  ? 34  ASN L CB  1 
ATOM 252  C CG  . ASN A 1 34  ? -8.729  65.736 44.474 1.00 38.88  ? 34  ASN L CG  1 
ATOM 253  O OD1 . ASN A 1 34  ? -7.913  66.242 45.225 1.00 38.88  ? 34  ASN L OD1 1 
ATOM 254  N ND2 . ASN A 1 34  ? -9.999  66.053 44.493 1.00 38.88  ? 34  ASN L ND2 1 
ATOM 255  N N   . TRP A 1 35  ? -7.631  63.575 41.156 1.00 61.39  ? 35  TRP L N   1 
ATOM 256  C CA  . TRP A 1 35  ? -6.827  62.782 40.235 1.00 61.39  ? 35  TRP L CA  1 
ATOM 257  C C   . TRP A 1 35  ? -5.390  63.253 40.232 1.00 61.39  ? 35  TRP L C   1 
ATOM 258  O O   . TRP A 1 35  ? -5.135  64.435 40.386 1.00 61.39  ? 35  TRP L O   1 
ATOM 259  C CB  . TRP A 1 35  ? -7.338  62.887 38.815 1.00 21.46  ? 35  TRP L CB  1 
ATOM 260  C CG  . TRP A 1 35  ? -8.563  62.146 38.594 1.00 21.46  ? 35  TRP L CG  1 
ATOM 261  C CD1 . TRP A 1 35  ? -9.841  62.629 38.630 1.00 21.46  ? 35  TRP L CD1 1 
ATOM 262  C CD2 . TRP A 1 35  ? -8.672  60.735 38.365 1.00 21.46  ? 35  TRP L CD2 1 
ATOM 263  N NE1 . TRP A 1 35  ? -10.739 61.602 38.438 1.00 21.46  ? 35  TRP L NE1 1 
ATOM 264  C CE2 . TRP A 1 35  ? -10.045 60.429 38.273 1.00 21.46  ? 35  TRP L CE2 1 
ATOM 265  C CE3 . TRP A 1 35  ? -7.737  59.696 38.231 1.00 21.46  ? 35  TRP L CE3 1 
ATOM 266  C CZ2 . TRP A 1 35  ? -10.506 59.129 38.055 1.00 21.46  ? 35  TRP L CZ2 1 
ATOM 267  C CZ3 . TRP A 1 35  ? -8.199  58.404 38.014 1.00 21.46  ? 35  TRP L CZ3 1 
ATOM 268  C CH2 . TRP A 1 35  ? -9.566  58.134 37.929 1.00 21.46  ? 35  TRP L CH2 1 
ATOM 269  N N   . TYR A 1 36  ? -4.444  62.330 40.083 1.00 17.88  ? 36  TYR L N   1 
ATOM 270  C CA  . TYR A 1 36  ? -3.047  62.712 40.004 1.00 17.88  ? 36  TYR L CA  1 
ATOM 271  C C   . TYR A 1 36  ? -2.294  62.016 38.897 1.00 17.88  ? 36  TYR L C   1 
ATOM 272  O O   . TYR A 1 36  ? -2.629  60.910 38.469 1.00 17.88  ? 36  TYR L O   1 
ATOM 273  C CB  . TYR A 1 36  ? -2.373  62.429 41.293 1.00 17.53  ? 36  TYR L CB  1 
ATOM 274  C CG  . TYR A 1 36  ? -3.107  63.043 42.433 1.00 17.53  ? 36  TYR L CG  1 
ATOM 275  C CD1 . TYR A 1 36  ? -4.381  62.596 42.781 1.00 17.53  ? 36  TYR L CD1 1 
ATOM 276  C CD2 . TYR A 1 36  ? -2.506  64.042 43.219 1.00 17.53  ? 36  TYR L CD2 1 
ATOM 277  C CE1 . TYR A 1 36  ? -5.034  63.115 43.872 1.00 17.53  ? 36  TYR L CE1 1 
ATOM 278  C CE2 . TYR A 1 36  ? -3.143  64.562 44.306 1.00 17.53  ? 36  TYR L CE2 1 
ATOM 279  C CZ  . TYR A 1 36  ? -4.409  64.098 44.631 1.00 17.53  ? 36  TYR L CZ  1 
ATOM 280  O OH  . TYR A 1 36  ? -5.062  64.641 45.707 1.00 17.53  ? 36  TYR L OH  1 
ATOM 281  N N   . GLN A 1 37  ? -1.274  62.693 38.414 1.00 60.35  ? 37  GLN L N   1 
ATOM 282  C CA  . GLN A 1 37  ? -0.423  62.139 37.387 1.00 60.35  ? 37  GLN L CA  1 
ATOM 283  C C   . GLN A 1 37  ? 0.933   61.970 38.055 1.00 60.35  ? 37  GLN L C   1 
ATOM 284  O O   . GLN A 1 37  ? 1.458   62.933 38.603 1.00 60.35  ? 37  GLN L O   1 
ATOM 285  C CB  . GLN A 1 37  ? -0.287  63.110 36.205 1.00 18.31  ? 37  GLN L CB  1 
ATOM 286  C CG  . GLN A 1 37  ? 1.058   63.005 35.585 1.00 18.31  ? 37  GLN L CG  1 
ATOM 287  C CD  . GLN A 1 37  ? 1.331   63.973 34.500 1.00 18.31  ? 37  GLN L CD  1 
ATOM 288  O OE1 . GLN A 1 37  ? 0.908   63.778 33.364 1.00 18.31  ? 37  GLN L OE1 1 
ATOM 289  N NE2 . GLN A 1 37  ? 2.053   65.036 34.829 1.00 18.31  ? 37  GLN L NE2 1 
ATOM 290  N N   . GLN A 1 38  ? 1.508   60.772 38.040 1.00 38.62  ? 38  GLN L N   1 
ATOM 291  C CA  . GLN A 1 38  ? 2.825   60.634 38.639 1.00 38.62  ? 38  GLN L CA  1 
ATOM 292  C C   . GLN A 1 38  ? 3.922   60.252 37.626 1.00 38.62  ? 38  GLN L C   1 
ATOM 293  O O   . GLN A 1 38  ? 4.299   59.089 37.545 1.00 38.62  ? 38  GLN L O   1 
ATOM 294  C CB  . GLN A 1 38  ? 2.789   59.608 39.751 1.00 49.82  ? 38  GLN L CB  1 
ATOM 295  C CG  . GLN A 1 38  ? 4.071   59.602 40.531 1.00 49.82  ? 38  GLN L CG  1 
ATOM 296  C CD  . GLN A 1 38  ? 4.248   58.365 41.347 1.00 49.82  ? 38  GLN L CD  1 
ATOM 297  O OE1 . GLN A 1 38  ? 5.328   58.106 41.857 1.00 49.82  ? 38  GLN L OE1 1 
ATOM 298  N NE2 . GLN A 1 38  ? 3.185   57.586 41.484 1.00 49.82  ? 38  GLN L NE2 1 
ATOM 299  N N   . LYS A 1 39  ? 4.444   61.214 36.858 1.00 48.93  ? 39  LYS L N   1 
ATOM 300  C CA  . LYS A 1 39  ? 5.485   60.910 35.868 1.00 48.93  ? 39  LYS L CA  1 
ATOM 301  C C   . LYS A 1 39  ? 6.544   59.985 36.454 1.00 48.93  ? 39  LYS L C   1 
ATOM 302  O O   . LYS A 1 39  ? 6.781   59.995 37.648 1.00 48.93  ? 39  LYS L O   1 
ATOM 303  C CB  . LYS A 1 39  ? 6.155   62.181 35.349 1.00 69.20  ? 39  LYS L CB  1 
ATOM 304  C CG  . LYS A 1 39  ? 5.416   62.904 34.239 1.00 69.20  ? 39  LYS L CG  1 
ATOM 305  C CD  . LYS A 1 39  ? 6.364   63.927 33.594 1.00 69.20  ? 39  LYS L CD  1 
ATOM 306  C CE  . LYS A 1 39  ? 5.776   64.597 32.343 1.00 69.20  ? 39  LYS L CE  1 
ATOM 307  N NZ  . LYS A 1 39  ? 6.758   65.497 31.629 1.00 69.20  ? 39  LYS L NZ  1 
ATOM 308  N N   . PRO A 1 40  ? 7.228   59.201 35.609 1.00 24.47  ? 40  PRO L N   1 
ATOM 309  C CA  . PRO A 1 40  ? 8.265   58.251 36.046 1.00 24.47  ? 40  PRO L CA  1 
ATOM 310  C C   . PRO A 1 40  ? 9.381   58.717 36.978 1.00 24.47  ? 40  PRO L C   1 
ATOM 311  O O   . PRO A 1 40  ? 10.261  59.468 36.588 1.00 24.47  ? 40  PRO L O   1 
ATOM 312  C CB  . PRO A 1 40  ? 8.809   57.712 34.713 1.00 48.08  ? 40  PRO L CB  1 
ATOM 313  C CG  . PRO A 1 40  ? 7.572   57.758 33.813 1.00 48.08  ? 40  PRO L CG  1 
ATOM 314  C CD  . PRO A 1 40  ? 7.123   59.177 34.137 1.00 48.08  ? 40  PRO L CD  1 
ATOM 315  N N   . GLY A 1 41  ? 9.341   58.256 38.215 1.00 40.06  ? 41  GLY L N   1 
ATOM 316  C CA  . GLY A 1 41  ? 10.381  58.626 39.142 1.00 40.06  ? 41  GLY L CA  1 
ATOM 317  C C   . GLY A 1 41  ? 10.085  59.788 40.046 1.00 40.06  ? 41  GLY L C   1 
ATOM 318  O O   . GLY A 1 41  ? 10.751  59.931 41.058 1.00 40.06  ? 41  GLY L O   1 
ATOM 319  N N   . LYS A 1 42  ? 9.097   60.608 39.710 1.00 26.77  ? 42  LYS L N   1 
ATOM 320  C CA  . LYS A 1 42  ? 8.774   61.765 40.540 1.00 26.77  ? 42  LYS L CA  1 
ATOM 321  C C   . LYS A 1 42  ? 7.723   61.550 41.637 1.00 26.77  ? 42  LYS L C   1 
ATOM 322  O O   . LYS A 1 42  ? 7.513   60.444 42.137 1.00 26.77  ? 42  LYS L O   1 
ATOM 323  C CB  . LYS A 1 42  ? 8.342   62.939 39.660 1.00 38.23  ? 42  LYS L CB  1 
ATOM 324  C CG  . LYS A 1 42  ? 9.392   63.354 38.660 1.00 38.23  ? 42  LYS L CG  1 
ATOM 325  C CD  . LYS A 1 42  ? 8.855   64.353 37.672 1.00 38.23  ? 42  LYS L CD  1 
ATOM 326  C CE  . LYS A 1 42  ? 9.832   64.603 36.536 1.00 38.23  ? 42  LYS L CE  1 
ATOM 327  N NZ  . LYS A 1 42  ? 9.132   65.175 35.315 1.00 38.23  ? 42  LYS L NZ  1 
ATOM 328  N N   . ALA A 1 43  ? 7.078   62.646 42.019 1.00 58.00  ? 43  ALA L N   1 
ATOM 329  C CA  . ALA A 1 43  ? 6.064   62.626 43.054 1.00 58.00  ? 43  ALA L CA  1 
ATOM 330  C C   . ALA A 1 43  ? 4.735   62.899 42.397 1.00 58.00  ? 43  ALA L C   1 
ATOM 331  O O   . ALA A 1 43  ? 4.690   63.433 41.295 1.00 58.00  ? 43  ALA L O   1 
ATOM 332  C CB  . ALA A 1 43  ? 6.357   63.690 44.081 1.00 74.81  ? 43  ALA L CB  1 
ATOM 333  N N   . PRO A 1 44  ? 3.628   62.535 43.066 1.00 46.34  ? 44  PRO L N   1 
ATOM 334  C CA  . PRO A 1 44  ? 2.312   62.771 42.493 1.00 46.34  ? 44  PRO L CA  1 
ATOM 335  C C   . PRO A 1 44  ? 2.125   64.253 42.211 1.00 46.34  ? 44  PRO L C   1 
ATOM 336  O O   . PRO A 1 44  ? 2.772   65.091 42.821 1.00 46.34  ? 44  PRO L O   1 
ATOM 337  C CB  . PRO A 1 44  ? 1.387   62.274 43.596 1.00 47.78  ? 44  PRO L CB  1 
ATOM 338  C CG  . PRO A 1 44  ? 2.191   61.176 44.213 1.00 47.78  ? 44  PRO L CG  1 
ATOM 339  C CD  . PRO A 1 44  ? 3.473   61.908 44.393 1.00 47.78  ? 44  PRO L CD  1 
ATOM 340  N N   . LYS A 1 45  ? 1.261   64.551 41.252 1.00 36.78  ? 45  LYS L N   1 
ATOM 341  C CA  . LYS A 1 45  ? 0.911   65.908 40.896 1.00 36.78  ? 45  LYS L CA  1 
ATOM 342  C C   . LYS A 1 45  ? -0.610  65.884 40.783 1.00 36.78  ? 45  LYS L C   1 
ATOM 343  O O   . LYS A 1 45  ? -1.180  64.858 40.405 1.00 36.78  ? 45  LYS L O   1 
ATOM 344  C CB  . LYS A 1 45  ? 1.496   66.286 39.561 1.00 48.01  ? 45  LYS L CB  1 
ATOM 345  C CG  . LYS A 1 45  ? 1.103   67.667 39.183 1.00 48.01  ? 45  LYS L CG  1 
ATOM 346  C CD  . LYS A 1 45  ? 1.490   68.003 37.787 1.00 48.01  ? 45  LYS L CD  1 
ATOM 347  C CE  . LYS A 1 45  ? 0.986   69.382 37.490 1.00 48.01  ? 45  LYS L CE  1 
ATOM 348  N NZ  . LYS A 1 45  ? 1.223   69.734 36.069 1.00 48.01  ? 45  LYS L NZ  1 
ATOM 349  N N   . LEU A 1 46  ? -1.271  66.989 41.123 1.00 43.82  ? 46  LEU L N   1 
ATOM 350  C CA  . LEU A 1 46  ? -2.732  67.063 41.034 1.00 43.82  ? 46  LEU L CA  1 
ATOM 351  C C   . LEU A 1 46  ? -3.234  67.506 39.643 1.00 43.82  ? 46  LEU L C   1 
ATOM 352  O O   . LEU A 1 46  ? -2.945  68.617 39.173 1.00 43.82  ? 46  LEU L O   1 
ATOM 353  C CB  . LEU A 1 46  ? -3.275  67.996 42.106 1.00 17.03  ? 46  LEU L CB  1 
ATOM 354  C CG  . LEU A 1 46  ? -4.788  68.176 42.127 1.00 17.03  ? 46  LEU L CG  1 
ATOM 355  C CD1 . LEU A 1 46  ? -5.504  66.969 42.660 1.00 17.03  ? 46  LEU L CD1 1 
ATOM 356  C CD2 . LEU A 1 46  ? -5.062  69.336 43.019 1.00 17.03  ? 46  LEU L CD2 1 
ATOM 357  N N   . LEU A 1 47  ? -3.990  66.609 39.003 1.00 50.49  ? 47  LEU L N   1 
ATOM 358  C CA  . LEU A 1 47  ? -4.547  66.790 37.658 1.00 50.49  ? 47  LEU L CA  1 
ATOM 359  C C   . LEU A 1 47  ? -5.983  67.220 37.568 1.00 50.49  ? 47  LEU L C   1 
ATOM 360  O O   . LEU A 1 47  ? -6.386  67.726 36.538 1.00 50.49  ? 47  LEU L O   1 
ATOM 361  C CB  . LEU A 1 47  ? -4.472  65.490 36.886 1.00 57.34  ? 47  LEU L CB  1 
ATOM 362  C CG  . LEU A 1 47  ? -3.149  65.024 36.348 1.00 57.34  ? 47  LEU L CG  1 
ATOM 363  C CD1 . LEU A 1 47  ? -3.206  63.543 36.113 1.00 57.34  ? 47  LEU L CD1 1 
ATOM 364  C CD2 . LEU A 1 47  ? -2.851  65.796 35.078 1.00 57.34  ? 47  LEU L CD2 1 
ATOM 365  N N   . ILE A 1 48  ? -6.752  66.978 38.622 1.00 48.03  ? 48  ILE L N   1 
ATOM 366  C CA  . ILE A 1 48  ? -8.171  67.282 38.638 1.00 48.03  ? 48  ILE L CA  1 
ATOM 367  C C   . ILE A 1 48  ? -8.678  67.244 40.072 1.00 48.03  ? 48  ILE L C   1 
ATOM 368  O O   . ILE A 1 48  ? -8.490  66.245 40.751 1.00 48.03  ? 48  ILE L O   1 
ATOM 369  C CB  . ILE A 1 48  ? -8.955  66.206 37.880 1.00 25.40  ? 48  ILE L CB  1 
ATOM 370  C CG1 . ILE A 1 48  ? -8.569  66.170 36.420 1.00 25.40  ? 48  ILE L CG1 1 
ATOM 371  C CG2 . ILE A 1 48  ? -10.399 66.501 37.910 1.00 25.40  ? 48  ILE L CG2 1 
ATOM 372  C CD1 . ILE A 1 48  ? -9.304  65.093 35.633 1.00 25.40  ? 48  ILE L CD1 1 
ATOM 373  N N   . TYR A 1 49  ? -9.340  68.288 40.551 1.00 84.74  ? 49  TYR L N   1 
ATOM 374  C CA  . TYR A 1 49  ? -9.837  68.218 41.915 1.00 84.74  ? 49  TYR L CA  1 
ATOM 375  C C   . TYR A 1 49  ? -11.363 68.318 41.988 1.00 84.74  ? 49  TYR L C   1 
ATOM 376  O O   . TYR A 1 49  ? -11.973 69.084 41.254 1.00 84.74  ? 49  TYR L O   1 
ATOM 377  C CB  . TYR A 1 49  ? -9.173  69.292 42.760 1.00 39.18  ? 49  TYR L CB  1 
ATOM 378  C CG  . TYR A 1 49  ? -9.477  70.688 42.338 1.00 39.18  ? 49  TYR L CG  1 
ATOM 379  C CD1 . TYR A 1 49  ? -9.218  71.130 41.032 1.00 39.18  ? 49  TYR L CD1 1 
ATOM 380  C CD2 . TYR A 1 49  ? -10.019 71.590 43.244 1.00 39.18  ? 49  TYR L CD2 1 
ATOM 381  C CE1 . TYR A 1 49  ? -9.497  72.458 40.649 1.00 39.18  ? 49  TYR L CE1 1 
ATOM 382  C CE2 . TYR A 1 49  ? -10.301 72.908 42.874 1.00 39.18  ? 49  TYR L CE2 1 
ATOM 383  C CZ  . TYR A 1 49  ? -10.039 73.336 41.586 1.00 39.18  ? 49  TYR L CZ  1 
ATOM 384  O OH  . TYR A 1 49  ? -10.308 74.641 41.270 1.00 39.18  ? 49  TYR L OH  1 
ATOM 385  N N   . ASN A 1 50  ? -11.958 67.512 42.868 1.00 35.66  ? 50  ASN L N   1 
ATOM 386  C CA  . ASN A 1 50  ? -13.412 67.413 43.111 1.00 35.66  ? 50  ASN L CA  1 
ATOM 387  C C   . ASN A 1 50  ? -14.307 67.005 41.968 1.00 35.66  ? 50  ASN L C   1 
ATOM 388  O O   . ASN A 1 50  ? -15.182 67.728 41.576 1.00 35.66  ? 50  ASN L O   1 
ATOM 389  C CB  . ASN A 1 50  ? -13.939 68.686 43.751 1.00 30.54  ? 50  ASN L CB  1 
ATOM 390  C CG  . ASN A 1 50  ? -13.629 68.742 45.229 1.00 30.54  ? 50  ASN L CG  1 
ATOM 391  O OD1 . ASN A 1 50  ? -14.230 68.015 46.016 1.00 30.54  ? 50  ASN L OD1 1 
ATOM 392  N ND2 . ASN A 1 50  ? -12.668 69.578 45.614 1.00 30.54  ? 50  ASN L ND2 1 
ATOM 393  N N   . THR A 1 51  ? -14.072 65.802 41.480 1.00 57.41  ? 51  THR L N   1 
ATOM 394  C CA  . THR A 1 51  ? -14.803 65.170 40.395 1.00 57.41  ? 51  THR L CA  1 
ATOM 395  C C   . THR A 1 51  ? -14.603 65.686 38.988 1.00 57.41  ? 51  THR L C   1 
ATOM 396  O O   . THR A 1 51  ? -14.346 64.874 38.069 1.00 57.41  ? 51  THR L O   1 
ATOM 397  C CB  . THR A 1 51  ? -16.297 65.110 40.679 1.00 100.00 ? 51  THR L CB  1 
ATOM 398  O OG1 . THR A 1 51  ? -16.778 66.408 41.018 1.00 100.00 ? 51  THR L OG1 1 
ATOM 399  C CG2 . THR A 1 51  ? -16.565 64.152 41.798 1.00 100.00 ? 51  THR L CG2 1 
ATOM 400  N N   . ASN A 1 52  ? -14.719 67.001 38.794 1.00 38.58  ? 52  ASN L N   1 
ATOM 401  C CA  . ASN A 1 52  ? -14.538 67.548 37.449 1.00 38.58  ? 52  ASN L CA  1 
ATOM 402  C C   . ASN A 1 52  ? -13.872 68.894 37.382 1.00 38.58  ? 52  ASN L C   1 
ATOM 403  O O   . ASN A 1 52  ? -14.057 69.600 36.409 1.00 38.58  ? 52  ASN L O   1 
ATOM 404  C CB  . ASN A 1 52  ? -15.864 67.658 36.685 1.00 48.92  ? 52  ASN L CB  1 
ATOM 405  C CG  . ASN A 1 52  ? -16.657 68.897 37.058 1.00 48.92  ? 52  ASN L CG  1 
ATOM 406  O OD1 . ASN A 1 52  ? -17.239 68.982 38.145 1.00 48.92  ? 52  ASN L OD1 1 
ATOM 407  N ND2 . ASN A 1 52  ? -16.668 69.882 36.156 1.00 48.92  ? 52  ASN L ND2 1 
ATOM 408  N N   . ASN A 1 53  ? -13.116 69.268 38.401 1.00 61.90  ? 53  ASN L N   1 
ATOM 409  C CA  . ASN A 1 53  ? -12.434 70.546 38.342 1.00 61.90  ? 53  ASN L CA  1 
ATOM 410  C C   . ASN A 1 53  ? -10.989 70.380 37.840 1.00 61.90  ? 53  ASN L C   1 
ATOM 411  O O   . ASN A 1 53  ? -10.263 69.504 38.287 1.00 61.90  ? 53  ASN L O   1 
ATOM 412  C CB  . ASN A 1 53  ? -12.437 71.240 39.709 1.00 99.51  ? 53  ASN L CB  1 
ATOM 413  C CG  . ASN A 1 53  ? -13.832 71.587 40.190 1.00 99.51  ? 53  ASN L CG  1 
ATOM 414  O OD1 . ASN A 1 53  ? -14.594 72.269 39.502 1.00 99.51  ? 53  ASN L OD1 1 
ATOM 415  N ND2 . ASN A 1 53  ? -14.169 71.131 41.387 1.00 99.51  ? 53  ASN L ND2 1 
ATOM 416  N N   . LEU A 1 54  ? -10.596 71.242 36.910 1.00 30.99  ? 54  LEU L N   1 
ATOM 417  C CA  . LEU A 1 54  ? -9.271  71.260 36.320 1.00 30.99  ? 54  LEU L CA  1 
ATOM 418  C C   . LEU A 1 54  ? -8.305  72.145 37.130 1.00 30.99  ? 54  LEU L C   1 
ATOM 419  O O   . LEU A 1 54  ? -8.708  73.104 37.765 1.00 30.99  ? 54  LEU L O   1 
ATOM 420  C CB  . LEU A 1 54  ? -9.396  71.778 34.901 1.00 26.29  ? 54  LEU L CB  1 
ATOM 421  C CG  . LEU A 1 54  ? -8.444  71.140 33.909 1.00 26.29  ? 54  LEU L CG  1 
ATOM 422  C CD1 . LEU A 1 54  ? -7.039  71.488 34.362 1.00 26.29  ? 54  LEU L CD1 1 
ATOM 423  C CD2 . LEU A 1 54  ? -8.667  69.599 33.811 1.00 26.29  ? 54  LEU L CD2 1 
ATOM 424  N N   . GLN A 1 55  ? -7.026  71.806 37.135 1.00 50.45  ? 55  GLN L N   1 
ATOM 425  C CA  . GLN A 1 55  ? -6.048  72.593 37.869 1.00 50.45  ? 55  GLN L CA  1 
ATOM 426  C C   . GLN A 1 55  ? -5.514  73.681 36.958 1.00 50.45  ? 55  GLN L C   1 
ATOM 427  O O   . GLN A 1 55  ? -5.861  73.719 35.767 1.00 50.45  ? 55  GLN L O   1 
ATOM 428  C CB  . GLN A 1 55  ? -4.887  71.710 38.299 1.00 35.52  ? 55  GLN L CB  1 
ATOM 429  C CG  . GLN A 1 55  ? -3.649  72.465 38.825 1.00 35.52  ? 55  GLN L CG  1 
ATOM 430  C CD  . GLN A 1 55  ? -3.930  73.193 40.108 1.00 35.52  ? 55  GLN L CD  1 
ATOM 431  O OE1 . GLN A 1 55  ? -3.031  73.495 40.892 1.00 35.52  ? 55  GLN L OE1 1 
ATOM 432  N NE2 . GLN A 1 55  ? -5.194  73.490 40.332 1.00 35.52  ? 55  GLN L NE2 1 
ATOM 433  N N   . THR A 1 56  ? -4.688  74.574 37.509 1.00 62.03  ? 56  THR L N   1 
ATOM 434  C CA  . THR A 1 56  ? -4.081  75.623 36.698 1.00 62.03  ? 56  THR L CA  1 
ATOM 435  C C   . THR A 1 56  ? -2.795  74.975 36.260 1.00 62.03  ? 56  THR L C   1 
ATOM 436  O O   . THR A 1 56  ? -2.143  74.286 37.043 1.00 62.03  ? 56  THR L O   1 
ATOM 437  C CB  . THR A 1 56  ? -3.750  76.899 37.480 1.00 64.07  ? 56  THR L CB  1 
ATOM 438  O OG1 . THR A 1 56  ? -2.813  76.590 38.508 1.00 64.07  ? 56  THR L OG1 1 
ATOM 439  C CG2 . THR A 1 56  ? -4.999  77.498 38.097 1.00 64.07  ? 56  THR L CG2 1 
ATOM 440  N N   . GLY A 1 57  ? -2.455  75.177 34.997 1.00 79.13  ? 57  GLY L N   1 
ATOM 441  C CA  . GLY A 1 57  ? -1.269  74.569 34.444 1.00 79.13  ? 57  GLY L CA  1 
ATOM 442  C C   . GLY A 1 57  ? -1.648  73.328 33.656 1.00 79.13  ? 57  GLY L C   1 
ATOM 443  O O   . GLY A 1 57  ? -1.321  73.237 32.473 1.00 79.13  ? 57  GLY L O   1 
ATOM 444  N N   . VAL A 1 58  ? -2.355  72.389 34.297 1.00 20.97  ? 58  VAL L N   1 
ATOM 445  C CA  . VAL A 1 58  ? -2.758  71.133 33.648 1.00 20.97  ? 58  VAL L CA  1 
ATOM 446  C C   . VAL A 1 58  ? -3.484  71.356 32.335 1.00 20.97  ? 58  VAL L C   1 
ATOM 447  O O   . VAL A 1 58  ? -4.388  72.164 32.234 1.00 20.97  ? 58  VAL L O   1 
ATOM 448  C CB  . VAL A 1 58  ? -3.654  70.243 34.555 1.00 35.11  ? 58  VAL L CB  1 
ATOM 449  C CG1 . VAL A 1 58  ? -4.097  69.014 33.780 1.00 35.11  ? 58  VAL L CG1 1 
ATOM 450  C CG2 . VAL A 1 58  ? -2.888  69.796 35.810 1.00 35.11  ? 58  VAL L CG2 1 
ATOM 451  N N   . PRO A 1 59  ? -3.086  70.615 31.306 1.00 50.91  ? 59  PRO L N   1 
ATOM 452  C CA  . PRO A 1 59  ? -3.700  70.737 29.990 1.00 50.91  ? 59  PRO L CA  1 
ATOM 453  C C   . PRO A 1 59  ? -5.235  70.666 29.967 1.00 50.91  ? 59  PRO L C   1 
ATOM 454  O O   . PRO A 1 59  ? -5.890  70.583 31.013 1.00 50.91  ? 59  PRO L O   1 
ATOM 455  C CB  . PRO A 1 59  ? -3.027  69.598 29.216 1.00 69.64  ? 59  PRO L CB  1 
ATOM 456  C CG  . PRO A 1 59  ? -1.636  69.586 29.827 1.00 69.64  ? 59  PRO L CG  1 
ATOM 457  C CD  . PRO A 1 59  ? -2.039  69.577 31.285 1.00 69.64  ? 59  PRO L CD  1 
ATOM 458  N N   . SER A 1 60  ? -5.785  70.692 28.755 1.00 59.78  ? 60  SER L N   1 
ATOM 459  C CA  . SER A 1 60  ? -7.224  70.650 28.527 1.00 59.78  ? 60  SER L CA  1 
ATOM 460  C C   . SER A 1 60  ? -7.661  69.326 27.926 1.00 59.78  ? 60  SER L C   1 
ATOM 461  O O   . SER A 1 60  ? -8.858  69.052 27.818 1.00 59.78  ? 60  SER L O   1 
ATOM 462  C CB  . SER A 1 60  ? -7.628  71.770 27.573 1.00 100.00 ? 60  SER L CB  1 
ATOM 463  O OG  . SER A 1 60  ? -6.974  71.609 26.321 1.00 100.00 ? 60  SER L OG  1 
ATOM 464  N N   . ARG A 1 61  ? -6.690  68.522 27.502 1.00 100.00 ? 61  ARG L N   1 
ATOM 465  C CA  . ARG A 1 61  ? -6.992  67.224 26.914 1.00 100.00 ? 61  ARG L CA  1 
ATOM 466  C C   . ARG A 1 61  ? -7.215  66.291 28.096 1.00 100.00 ? 61  ARG L C   1 
ATOM 467  O O   . ARG A 1 61  ? -7.425  65.092 27.924 1.00 100.00 ? 61  ARG L O   1 
ATOM 468  C CB  . ARG A 1 61  ? -5.832  66.734 26.033 1.00 35.56  ? 61  ARG L CB  1 
ATOM 469  C CG  . ARG A 1 61  ? -4.620  66.413 26.840 1.00 35.56  ? 61  ARG L CG  1 
ATOM 470  C CD  . ARG A 1 61  ? -3.309  66.275 26.081 1.00 35.56  ? 61  ARG L CD  1 
ATOM 471  N NE  . ARG A 1 61  ? -2.260  66.173 27.097 1.00 35.56  ? 61  ARG L NE  1 
ATOM 472  C CZ  . ARG A 1 61  ? -1.007  66.547 26.921 1.00 35.56  ? 61  ARG L CZ  1 
ATOM 473  N NH1 . ARG A 1 61  ? -0.642  67.044 25.764 1.00 35.56  ? 61  ARG L NH1 1 
ATOM 474  N NH2 . ARG A 1 61  ? -0.135  66.472 27.912 1.00 35.56  ? 61  ARG L NH2 1 
ATOM 475  N N   . PHE A 1 62  ? -7.140  66.848 29.303 1.00 48.97  ? 62  PHE L N   1 
ATOM 476  C CA  . PHE A 1 62  ? -7.408  66.065 30.500 1.00 48.97  ? 62  PHE L CA  1 
ATOM 477  C C   . PHE A 1 62  ? -8.735  66.586 31.044 1.00 48.97  ? 62  PHE L C   1 
ATOM 478  O O   . PHE A 1 62  ? -9.022  67.771 30.876 1.00 48.97  ? 62  PHE L O   1 
ATOM 479  C CB  . PHE A 1 62  ? -6.314  66.241 31.543 1.00 45.52  ? 62  PHE L CB  1 
ATOM 480  C CG  . PHE A 1 62  ? -4.986  65.707 31.129 1.00 45.52  ? 62  PHE L CG  1 
ATOM 481  C CD1 . PHE A 1 62  ? -4.888  64.494 30.482 1.00 45.52  ? 62  PHE L CD1 1 
ATOM 482  C CD2 . PHE A 1 62  ? -3.830  66.420 31.401 1.00 45.52  ? 62  PHE L CD2 1 
ATOM 483  C CE1 . PHE A 1 62  ? -3.658  64.006 30.105 1.00 45.52  ? 62  PHE L CE1 1 
ATOM 484  C CE2 . PHE A 1 62  ? -2.598  65.943 31.033 1.00 45.52  ? 62  PHE L CE2 1 
ATOM 485  C CZ  . PHE A 1 62  ? -2.506  64.739 30.383 1.00 45.52  ? 62  PHE L CZ  1 
ATOM 486  N N   . SER A 1 63  ? -9.528  65.718 31.700 1.00 32.55  ? 63  SER L N   1 
ATOM 487  C CA  . SER A 1 63  ? -10.860 66.103 32.225 1.00 32.55  ? 63  SER L CA  1 
ATOM 488  C C   . SER A 1 63  ? -11.567 65.006 33.016 1.00 32.55  ? 63  SER L C   1 
ATOM 489  O O   . SER A 1 63  ? -11.393 63.848 32.720 1.00 32.55  ? 63  SER L O   1 
ATOM 490  C CB  . SER A 1 63  ? -11.754 66.471 31.047 1.00 35.68  ? 63  SER L CB  1 
ATOM 491  O OG  . SER A 1 63  ? -11.871 65.327 30.216 1.00 35.68  ? 63  SER L OG  1 
ATOM 492  N N   . GLY A 1 64  ? -12.387 65.393 33.986 1.00 64.50  ? 64  GLY L N   1 
ATOM 493  C CA  . GLY A 1 64  ? -13.125 64.430 34.794 1.00 64.50  ? 64  GLY L CA  1 
ATOM 494  C C   . GLY A 1 64  ? -14.603 64.332 34.414 1.00 64.50  ? 64  GLY L C   1 
ATOM 495  O O   . GLY A 1 64  ? -15.109 65.210 33.713 1.00 64.50  ? 64  GLY L O   1 
ATOM 496  N N   . SER A 1 65  ? -15.305 63.286 34.863 1.00 63.02  ? 65  SER L N   1 
ATOM 497  C CA  . SER A 1 65  ? -16.727 63.117 34.526 1.00 63.02  ? 65  SER L CA  1 
ATOM 498  C C   . SER A 1 65  ? -17.613 62.606 35.658 1.00 63.02  ? 65  SER L C   1 
ATOM 499  O O   . SER A 1 65  ? -17.262 61.665 36.362 1.00 63.02  ? 65  SER L O   1 
ATOM 500  C CB  . SER A 1 65  ? -16.895 62.150 33.354 1.00 87.56  ? 65  SER L CB  1 
ATOM 501  O OG  . SER A 1 65  ? -16.371 62.663 32.150 1.00 87.56  ? 65  SER L OG  1 
ATOM 502  N N   . GLY A 1 66  ? -18.773 63.224 35.822 1.00 88.72  ? 66  GLY L N   1 
ATOM 503  C CA  . GLY A 1 66  ? -19.717 62.782 36.838 1.00 88.72  ? 66  GLY L CA  1 
ATOM 504  C C   . GLY A 1 66  ? -19.405 62.886 38.316 1.00 88.72  ? 66  GLY L C   1 
ATOM 505  O O   . GLY A 1 66  ? -18.880 63.887 38.790 1.00 88.72  ? 66  GLY L O   1 
ATOM 506  N N   . SER A 1 67  ? -19.763 61.825 39.032 1.00 77.61  ? 67  SER L N   1 
ATOM 507  C CA  . SER A 1 67  ? -19.597 61.708 40.479 1.00 77.61  ? 67  SER L CA  1 
ATOM 508  C C   . SER A 1 67  ? -20.661 60.754 41.060 1.00 77.61  ? 67  SER L C   1 
ATOM 509  O O   . SER A 1 67  ? -21.743 60.612 40.485 1.00 77.61  ? 67  SER L O   1 
ATOM 510  C CB  . SER A 1 67  ? -19.709 63.088 41.138 1.00 83.77  ? 67  SER L CB  1 
ATOM 511  O OG  . SER A 1 67  ? -20.780 63.832 40.593 1.00 83.77  ? 67  SER L OG  1 
ATOM 512  N N   . GLY A 1 68  ? -20.362 60.107 42.190 1.00 53.92  ? 68  GLY L N   1 
ATOM 513  C CA  . GLY A 1 68  ? -21.301 59.169 42.802 1.00 53.92  ? 68  GLY L CA  1 
ATOM 514  C C   . GLY A 1 68  ? -20.523 57.984 43.320 1.00 53.92  ? 68  GLY L C   1 
ATOM 515  O O   . GLY A 1 68  ? -20.283 57.846 44.507 1.00 53.92  ? 68  GLY L O   1 
ATOM 516  N N   . THR A 1 69  ? -20.142 57.106 42.415 1.00 83.17  ? 69  THR L N   1 
ATOM 517  C CA  . THR A 1 69  ? -19.315 55.966 42.768 1.00 83.17  ? 69  THR L CA  1 
ATOM 518  C C   . THR A 1 69  ? -18.519 55.633 41.516 1.00 83.17  ? 69  THR L C   1 
ATOM 519  O O   . THR A 1 69  ? -17.294 55.505 41.571 1.00 83.17  ? 69  THR L O   1 
ATOM 520  C CB  . THR A 1 69  ? -20.133 54.746 43.263 1.00 70.79  ? 69  THR L CB  1 
ATOM 521  O OG1 . THR A 1 69  ? -21.266 54.528 42.420 1.00 70.79  ? 69  THR L OG1 1 
ATOM 522  C CG2 . THR A 1 69  ? -20.579 54.963 44.671 1.00 70.79  ? 69  THR L CG2 1 
ATOM 523  N N   . ASP A 1 70  ? -19.221 55.529 40.388 1.00 62.95  ? 70  ASP L N   1 
ATOM 524  C CA  . ASP A 1 70  ? -18.586 55.253 39.110 1.00 62.95  ? 70  ASP L CA  1 
ATOM 525  C C   . ASP A 1 70  ? -17.870 56.546 38.767 1.00 62.95  ? 70  ASP L C   1 
ATOM 526  O O   . ASP A 1 70  ? -18.491 57.593 38.766 1.00 62.95  ? 70  ASP L O   1 
ATOM 527  C CB  . ASP A 1 70  ? -19.656 54.961 38.044 1.00 99.89  ? 70  ASP L CB  1 
ATOM 528  C CG  . ASP A 1 70  ? -19.067 54.695 36.646 1.00 99.89  ? 70  ASP L CG  1 
ATOM 529  O OD1 . ASP A 1 70  ? -18.445 53.629 36.444 1.00 99.89  ? 70  ASP L OD1 1 
ATOM 530  O OD2 . ASP A 1 70  ? -19.226 55.548 35.740 1.00 99.89  ? 70  ASP L OD2 1 
ATOM 531  N N   . PHE A 1 71  ? -16.568 56.499 38.536 1.00 49.71  ? 71  PHE L N   1 
ATOM 532  C CA  . PHE A 1 71  ? -15.870 57.704 38.131 1.00 49.71  ? 71  PHE L CA  1 
ATOM 533  C C   . PHE A 1 71  ? -15.058 57.374 36.899 1.00 49.71  ? 71  PHE L C   1 
ATOM 534  O O   . PHE A 1 71  ? -14.768 56.195 36.658 1.00 49.71  ? 71  PHE L O   1 
ATOM 535  C CB  . PHE A 1 71  ? -14.952 58.246 39.213 1.00 65.27  ? 71  PHE L CB  1 
ATOM 536  C CG  . PHE A 1 71  ? -15.671 58.925 40.330 1.00 65.27  ? 71  PHE L CG  1 
ATOM 537  C CD1 . PHE A 1 71  ? -16.254 58.195 41.353 1.00 65.27  ? 71  PHE L CD1 1 
ATOM 538  C CD2 . PHE A 1 71  ? -15.763 60.312 40.362 1.00 65.27  ? 71  PHE L CD2 1 
ATOM 539  C CE1 . PHE A 1 71  ? -16.915 58.846 42.396 1.00 65.27  ? 71  PHE L CE1 1 
ATOM 540  C CE2 . PHE A 1 71  ? -16.422 60.965 41.394 1.00 65.27  ? 71  PHE L CE2 1 
ATOM 541  C CZ  . PHE A 1 71  ? -16.997 60.235 42.412 1.00 65.27  ? 71  PHE L CZ  1 
ATOM 542  N N   . THR A 1 72  ? -14.700 58.406 36.122 1.00 62.27  ? 72  THR L N   1 
ATOM 543  C CA  . THR A 1 72  ? -13.925 58.234 34.892 1.00 62.27  ? 72  THR L CA  1 
ATOM 544  C C   . THR A 1 72  ? -13.104 59.469 34.578 1.00 62.27  ? 72  THR L C   1 
ATOM 545  O O   . THR A 1 72  ? -13.605 60.592 34.660 1.00 62.27  ? 72  THR L O   1 
ATOM 546  C CB  . THR A 1 72  ? -14.821 57.994 33.698 1.00 58.71  ? 72  THR L CB  1 
ATOM 547  O OG1 . THR A 1 72  ? -15.773 56.985 34.021 1.00 58.71  ? 72  THR L OG1 1 
ATOM 548  C CG2 . THR A 1 72  ? -14.005 57.526 32.521 1.00 58.71  ? 72  THR L CG2 1 
ATOM 549  N N   . PHE A 1 73  ? -11.857 59.218 34.175 1.00 51.12  ? 73  PHE L N   1 
ATOM 550  C CA  . PHE A 1 73  ? -10.830 60.210 33.832 1.00 51.12  ? 73  PHE L CA  1 
ATOM 551  C C   . PHE A 1 73  ? -10.480 59.955 32.361 1.00 51.12  ? 73  PHE L C   1 
ATOM 552  O O   . PHE A 1 73  ? -10.180 58.817 32.001 1.00 51.12  ? 73  PHE L O   1 
ATOM 553  C CB  . PHE A 1 73  ? -9.677  59.982 34.854 1.00 70.90  ? 73  PHE L CB  1 
ATOM 554  C CG  . PHE A 1 73  ? -8.275  60.328 34.383 1.00 70.90  ? 73  PHE L CG  1 
ATOM 555  C CD1 . PHE A 1 73  ? -7.965  61.554 33.815 1.00 70.90  ? 73  PHE L CD1 1 
ATOM 556  C CD2 . PHE A 1 73  ? -7.235  59.420 34.611 1.00 70.90  ? 73  PHE L CD2 1 
ATOM 557  C CE1 . PHE A 1 73  ? -6.645  61.862 33.486 1.00 70.90  ? 73  PHE L CE1 1 
ATOM 558  C CE2 . PHE A 1 73  ? -5.931  59.722 34.288 1.00 70.90  ? 73  PHE L CE2 1 
ATOM 559  C CZ  . PHE A 1 73  ? -5.633  60.940 33.726 1.00 70.90  ? 73  PHE L CZ  1 
ATOM 560  N N   . THR A 1 74  ? -10.566 60.996 31.516 1.00 38.70  ? 74  THR L N   1 
ATOM 561  C CA  . THR A 1 74  ? -10.313 60.874 30.052 1.00 38.70  ? 74  THR L CA  1 
ATOM 562  C C   . THR A 1 74  ? -9.298  61.832 29.386 1.00 38.70  ? 74  THR L C   1 
ATOM 563  O O   . THR A 1 74  ? -9.269  63.017 29.711 1.00 38.70  ? 74  THR L O   1 
ATOM 564  C CB  . THR A 1 74  ? -11.619 61.051 29.240 1.00 36.82  ? 74  THR L CB  1 
ATOM 565  O OG1 . THR A 1 74  ? -12.592 60.096 29.662 1.00 36.82  ? 74  THR L OG1 1 
ATOM 566  C CG2 . THR A 1 74  ? -11.359 60.854 27.760 1.00 36.82  ? 74  THR L CG2 1 
ATOM 567  N N   . ILE A 1 75  ? -8.513  61.319 28.424 1.00 28.61  ? 75  ILE L N   1 
ATOM 568  C CA  . ILE A 1 75  ? -7.515  62.113 27.691 1.00 28.61  ? 75  ILE L CA  1 
ATOM 569  C C   . ILE A 1 75  ? -7.801  62.440 26.185 1.00 28.61  ? 75  ILE L C   1 
ATOM 570  O O   . ILE A 1 75  ? -7.422  61.658 25.295 1.00 28.61  ? 75  ILE L O   1 
ATOM 571  C CB  . ILE A 1 75  ? -6.195  61.419 27.703 1.00 37.84  ? 75  ILE L CB  1 
ATOM 572  C CG1 . ILE A 1 75  ? -5.680  61.290 29.106 1.00 37.84  ? 75  ILE L CG1 1 
ATOM 573  C CG2 . ILE A 1 75  ? -5.189  62.239 26.947 1.00 37.84  ? 75  ILE L CG2 1 
ATOM 574  C CD1 . ILE A 1 75  ? -4.263  60.668 29.127 1.00 37.84  ? 75  ILE L CD1 1 
ATOM 575  N N   . SER A 1 76  ? -8.425  63.589 25.892 1.00 40.93  ? 76  SER L N   1 
ATOM 576  C CA  . SER A 1 76  ? -8.741  63.994 24.502 1.00 40.93  ? 76  SER L CA  1 
ATOM 577  C C   . SER A 1 76  ? -7.891  63.208 23.527 1.00 40.93  ? 76  SER L C   1 
ATOM 578  O O   . SER A 1 76  ? -8.386  62.406 22.758 1.00 40.93  ? 76  SER L O   1 
ATOM 579  C CB  . SER A 1 76  ? -8.458  65.484 24.289 1.00 84.29  ? 76  SER L CB  1 
ATOM 580  O OG  . SER A 1 76  ? -9.202  66.299 25.176 1.00 84.29  ? 76  SER L OG  1 
ATOM 581  N N   . SER A 1 77  ? -6.593  63.460 23.573 1.00 82.22  ? 77  SER L N   1 
ATOM 582  C CA  . SER A 1 77  ? -5.638  62.764 22.730 1.00 82.22  ? 77  SER L CA  1 
ATOM 583  C C   . SER A 1 77  ? -4.379  62.680 23.581 1.00 82.22  ? 77  SER L C   1 
ATOM 584  O O   . SER A 1 77  ? -4.021  63.645 24.267 1.00 82.22  ? 77  SER L O   1 
ATOM 585  C CB  . SER A 1 77  ? -5.348  63.546 21.454 1.00 79.89  ? 77  SER L CB  1 
ATOM 586  O OG  . SER A 1 77  ? -4.627  64.721 21.766 1.00 79.89  ? 77  SER L OG  1 
ATOM 587  N N   . LEU A 1 78  ? -3.718  61.528 23.519 1.00 100.00 ? 78  LEU L N   1 
ATOM 588  C CA  . LEU A 1 78  ? -2.516  61.233 24.295 1.00 100.00 ? 78  LEU L CA  1 
ATOM 589  C C   . LEU A 1 78  ? -1.178  61.616 23.622 1.00 100.00 ? 78  LEU L C   1 
ATOM 590  O O   . LEU A 1 78  ? -0.967  61.324 22.436 1.00 100.00 ? 78  LEU L O   1 
ATOM 591  C CB  . LEU A 1 78  ? -2.525  59.729 24.620 1.00 37.19  ? 78  LEU L CB  1 
ATOM 592  C CG  . LEU A 1 78  ? -1.445  59.098 25.493 1.00 37.19  ? 78  LEU L CG  1 
ATOM 593  C CD1 . LEU A 1 78  ? -1.737  59.442 26.930 1.00 37.19  ? 78  LEU L CD1 1 
ATOM 594  C CD2 . LEU A 1 78  ? -1.432  57.595 25.306 1.00 37.19  ? 78  LEU L CD2 1 
ATOM 595  N N   . GLN A 1 79  ? -0.295  62.276 24.388 1.00 35.26  ? 79  GLN L N   1 
ATOM 596  C CA  . GLN A 1 79  ? 1.049   62.664 23.932 1.00 35.26  ? 79  GLN L CA  1 
ATOM 597  C C   . GLN A 1 79  ? 2.163   61.960 24.747 1.00 35.26  ? 79  GLN L C   1 
ATOM 598  O O   . GLN A 1 79  ? 2.064   61.750 25.962 1.00 35.26  ? 79  GLN L O   1 
ATOM 599  C CB  . GLN A 1 79  ? 1.222   64.178 23.945 1.00 58.28  ? 79  GLN L CB  1 
ATOM 600  C CG  . GLN A 1 79  ? 0.536   64.842 22.766 1.00 58.28  ? 79  GLN L CG  1 
ATOM 601  C CD  . GLN A 1 79  ? 0.804   66.335 22.684 1.00 58.28  ? 79  GLN L CD  1 
ATOM 602  O OE1 . GLN A 1 79  ? 1.959   66.782 22.664 1.00 58.28  ? 79  GLN L OE1 1 
ATOM 603  N NE2 . GLN A 1 79  ? -0.269  67.120 22.632 1.00 58.28  ? 79  GLN L NE2 1 
ATOM 604  N N   . PRO A 1 80  ? 3.261   61.621 24.079 1.00 38.62  ? 80  PRO L N   1 
ATOM 605  C CA  . PRO A 1 80  ? 4.461   60.931 24.557 1.00 38.62  ? 80  PRO L CA  1 
ATOM 606  C C   . PRO A 1 80  ? 4.991   61.460 25.858 1.00 38.62  ? 80  PRO L C   1 
ATOM 607  O O   . PRO A 1 80  ? 5.962   60.930 26.408 1.00 38.62  ? 80  PRO L O   1 
ATOM 608  C CB  . PRO A 1 80  ? 5.438   61.143 23.415 1.00 46.67  ? 80  PRO L CB  1 
ATOM 609  C CG  . PRO A 1 80  ? 4.927   62.502 22.832 1.00 46.67  ? 80  PRO L CG  1 
ATOM 610  C CD  . PRO A 1 80  ? 3.493   62.114 22.721 1.00 46.67  ? 80  PRO L CD  1 
ATOM 611  N N   . GLU A 1 81  ? 4.360   62.527 26.325 1.00 35.03  ? 81  GLU L N   1 
ATOM 612  C CA  . GLU A 1 81  ? 4.741   63.184 27.566 1.00 35.03  ? 81  GLU L CA  1 
ATOM 613  C C   . GLU A 1 81  ? 3.746   62.771 28.624 1.00 35.03  ? 81  GLU L C   1 
ATOM 614  O O   . GLU A 1 81  ? 3.780   63.282 29.744 1.00 35.03  ? 81  GLU L O   1 
ATOM 615  C CB  . GLU A 1 81  ? 4.742   64.701 27.364 1.00 93.55  ? 81  GLU L CB  1 
ATOM 616  C CG  . GLU A 1 81  ? 3.496   65.227 26.677 1.00 93.55  ? 81  GLU L CG  1 
ATOM 617  C CD  . GLU A 1 81  ? 3.659   66.644 26.177 1.00 93.55  ? 81  GLU L CD  1 
ATOM 618  O OE1 . GLU A 1 81  ? 3.875   67.543 27.015 1.00 93.55  ? 81  GLU L OE1 1 
ATOM 619  O OE2 . GLU A 1 81  ? 3.574   66.856 24.945 1.00 93.55  ? 81  GLU L OE2 1 
ATOM 620  N N   . ASP A 1 82  ? 2.868   61.827 28.255 1.00 45.79  ? 82  ASP L N   1 
ATOM 621  C CA  . ASP A 1 82  ? 1.861   61.283 29.172 1.00 45.79  ? 82  ASP L CA  1 
ATOM 622  C C   . ASP A 1 82  ? 2.079   59.836 29.589 1.00 45.79  ? 82  ASP L C   1 
ATOM 623  O O   . ASP A 1 82  ? 1.129   59.117 29.903 1.00 45.79  ? 82  ASP L O   1 
ATOM 624  C CB  . ASP A 1 82  ? 0.478   61.433 28.592 1.00 38.77  ? 82  ASP L CB  1 
ATOM 625  C CG  . ASP A 1 82  ? 0.051   62.837 28.581 1.00 38.77  ? 82  ASP L CG  1 
ATOM 626  O OD1 . ASP A 1 82  ? 0.247   63.503 29.624 1.00 38.77  ? 82  ASP L OD1 1 
ATOM 627  O OD2 . ASP A 1 82  ? -0.480  63.275 27.548 1.00 38.77  ? 82  ASP L OD2 1 
ATOM 628  N N   . ILE A 1 83  ? 3.345   59.430 29.593 1.00 50.26  ? 83  ILE L N   1 
ATOM 629  C CA  . ILE A 1 83  ? 3.737   58.102 29.988 1.00 50.26  ? 83  ILE L CA  1 
ATOM 630  C C   . ILE A 1 83  ? 3.911   58.233 31.463 1.00 50.26  ? 83  ILE L C   1 
ATOM 631  O O   . ILE A 1 83  ? 5.036   58.345 31.904 1.00 50.26  ? 83  ILE L O   1 
ATOM 632  C CB  . ILE A 1 83  ? 5.099   57.731 29.455 1.00 99.92  ? 83  ILE L CB  1 
ATOM 633  C CG1 . ILE A 1 83  ? 5.134   57.923 27.949 1.00 99.92  ? 83  ILE L CG1 1 
ATOM 634  C CG2 . ILE A 1 83  ? 5.408   56.309 29.815 1.00 99.92  ? 83  ILE L CG2 1 
ATOM 635  C CD1 . ILE A 1 83  ? 6.509   57.731 27.340 1.00 99.92  ? 83  ILE L CD1 1 
ATOM 636  N N   . ALA A 1 84  ? 2.816   58.273 32.218 1.00 43.25  ? 84  ALA L N   1 
ATOM 637  C CA  . ALA A 1 84  ? 2.879   58.361 33.680 1.00 43.25  ? 84  ALA L CA  1 
ATOM 638  C C   . ALA A 1 84  ? 2.111   57.190 34.277 1.00 43.25  ? 84  ALA L C   1 
ATOM 639  O O   . ALA A 1 84  ? 1.943   56.148 33.646 1.00 43.25  ? 84  ALA L O   1 
ATOM 640  C CB  . ALA A 1 84  ? 2.279   59.648 34.162 1.00 57.85  ? 84  ALA L CB  1 
ATOM 641  N N   . THR A 1 85  ? 1.639   57.346 35.497 1.00 23.60  ? 85  THR L N   1 
ATOM 642  C CA  . THR A 1 85  ? 0.884   56.295 36.148 1.00 23.60  ? 85  THR L CA  1 
ATOM 643  C C   . THR A 1 85  ? -0.058  57.241 36.803 1.00 23.60  ? 85  THR L C   1 
ATOM 644  O O   . THR A 1 85  ? 0.399   58.102 37.584 1.00 23.60  ? 85  THR L O   1 
ATOM 645  C CB  . THR A 1 85  ? 1.708   55.611 37.250 1.00 48.60  ? 85  THR L CB  1 
ATOM 646  O OG1 . THR A 1 85  ? 2.917   55.085 36.700 1.00 48.60  ? 85  THR L OG1 1 
ATOM 647  C CG2 . THR A 1 85  ? 0.929   54.499 37.910 1.00 48.60  ? 85  THR L CG2 1 
ATOM 648  N N   . TYR A 1 86  ? -1.349  57.138 36.492 1.00 100.00 ? 86  TYR L N   1 
ATOM 649  C CA  . TYR A 1 86  ? -2.322  58.056 37.082 1.00 100.00 ? 86  TYR L CA  1 
ATOM 650  C C   . TYR A 1 86  ? -3.129  57.433 38.206 1.00 100.00 ? 86  TYR L C   1 
ATOM 651  O O   . TYR A 1 86  ? -3.520  56.266 38.157 1.00 100.00 ? 86  TYR L O   1 
ATOM 652  C CB  . TYR A 1 86  ? -3.253  58.637 36.011 1.00 37.38  ? 86  TYR L CB  1 
ATOM 653  C CG  . TYR A 1 86  ? -2.509  59.214 34.808 1.00 37.38  ? 86  TYR L CG  1 
ATOM 654  C CD1 . TYR A 1 86  ? -1.920  58.372 33.856 1.00 37.38  ? 86  TYR L CD1 1 
ATOM 655  C CD2 . TYR A 1 86  ? -2.381  60.594 34.625 1.00 37.38  ? 86  TYR L CD2 1 
ATOM 656  C CE1 . TYR A 1 86  ? -1.234  58.888 32.767 1.00 37.38  ? 86  TYR L CE1 1 
ATOM 657  C CE2 . TYR A 1 86  ? -1.692  61.109 33.537 1.00 37.38  ? 86  TYR L CE2 1 
ATOM 658  C CZ  . TYR A 1 86  ? -1.125  60.249 32.620 1.00 37.38  ? 86  TYR L CZ  1 
ATOM 659  O OH  . TYR A 1 86  ? -0.422  60.740 31.555 1.00 37.38  ? 86  TYR L OH  1 
ATOM 660  N N   . TYR A 1 87  ? -3.362  58.245 39.225 1.00 50.76  ? 87  TYR L N   1 
ATOM 661  C CA  . TYR A 1 87  ? -4.075  57.830 40.418 1.00 50.76  ? 87  TYR L CA  1 
ATOM 662  C C   . TYR A 1 87  ? -5.332  58.612 40.703 1.00 50.76  ? 87  TYR L C   1 
ATOM 663  O O   . TYR A 1 87  ? -5.409  59.809 40.444 1.00 50.76  ? 87  TYR L O   1 
ATOM 664  C CB  . TYR A 1 87  ? -3.173  57.979 41.640 1.00 38.04  ? 87  TYR L CB  1 
ATOM 665  C CG  . TYR A 1 87  ? -2.143  56.905 41.812 1.00 38.04  ? 87  TYR L CG  1 
ATOM 666  C CD1 . TYR A 1 87  ? -2.518  55.615 42.168 1.00 38.04  ? 87  TYR L CD1 1 
ATOM 667  C CD2 . TYR A 1 87  ? -0.799  57.172 41.606 1.00 38.04  ? 87  TYR L CD2 1 
ATOM 668  C CE1 . TYR A 1 87  ? -1.608  54.633 42.309 1.00 38.04  ? 87  TYR L CE1 1 
ATOM 669  C CE2 . TYR A 1 87  ? 0.127   56.183 41.744 1.00 38.04  ? 87  TYR L CE2 1 
ATOM 670  C CZ  . TYR A 1 87  ? -0.295  54.915 42.092 1.00 38.04  ? 87  TYR L CZ  1 
ATOM 671  O OH  . TYR A 1 87  ? 0.616   53.907 42.173 1.00 38.04  ? 87  TYR L OH  1 
ATOM 672  N N   . CYS A 1 88  ? -6.315  57.925 41.262 1.00 46.82  ? 88  CYS L N   1 
ATOM 673  C CA  . CYS A 1 88  ? -7.532  58.592 41.645 1.00 46.82  ? 88  CYS L CA  1 
ATOM 674  C C   . CYS A 1 88  ? -7.556  58.478 43.158 1.00 46.82  ? 88  CYS L C   1 
ATOM 675  O O   . CYS A 1 88  ? -6.860  57.638 43.723 1.00 46.82  ? 88  CYS L O   1 
ATOM 676  C CB  . CYS A 1 88  ? -8.762  57.953 40.991 1.00 60.56  ? 88  CYS L CB  1 
ATOM 677  S SG  . CYS A 1 88  ? -9.486  56.412 41.615 1.00 60.56  ? 88  CYS L SG  1 
ATOM 678  N N   . LEU A 1 89  ? -8.304  59.350 43.819 1.00 64.38  ? 89  LEU L N   1 
ATOM 679  C CA  . LEU A 1 89  ? -8.359  59.314 45.267 1.00 64.38  ? 89  LEU L CA  1 
ATOM 680  C C   . LEU A 1 89  ? -9.556  60.132 45.691 1.00 64.38  ? 89  LEU L C   1 
ATOM 681  O O   . LEU A 1 89  ? -10.051 60.933 44.902 1.00 64.38  ? 89  LEU L O   1 
ATOM 682  C CB  . LEU A 1 89  ? -7.077  59.889 45.851 1.00 30.02  ? 89  LEU L CB  1 
ATOM 683  C CG  . LEU A 1 89  ? -7.230  61.181 46.627 1.00 30.02  ? 89  LEU L CG  1 
ATOM 684  C CD1 . LEU A 1 89  ? -7.746  60.873 47.984 1.00 30.02  ? 89  LEU L CD1 1 
ATOM 685  C CD2 . LEU A 1 89  ? -5.910  61.837 46.764 1.00 30.02  ? 89  LEU L CD2 1 
ATOM 686  N N   . GLN A 1 90  ? -10.009 59.929 46.931 1.00 47.66  ? 90  GLN L N   1 
ATOM 687  C CA  . GLN A 1 90  ? -11.179 60.616 47.460 1.00 47.66  ? 90  GLN L CA  1 
ATOM 688  C C   . GLN A 1 90  ? -10.944 61.167 48.849 1.00 47.66  ? 90  GLN L C   1 
ATOM 689  O O   . GLN A 1 90  ? -10.208 60.586 49.621 1.00 47.66  ? 90  GLN L O   1 
ATOM 690  C CB  . GLN A 1 90  ? -12.360 59.653 47.460 1.00 25.45  ? 90  GLN L CB  1 
ATOM 691  C CG  . GLN A 1 90  ? -12.216 58.456 48.372 1.00 25.45  ? 90  GLN L CG  1 
ATOM 692  C CD  . GLN A 1 90  ? -12.200 58.870 49.824 1.00 25.45  ? 90  GLN L CD  1 
ATOM 693  O OE1 . GLN A 1 90  ? -12.837 59.856 50.192 1.00 25.45  ? 90  GLN L OE1 1 
ATOM 694  N NE2 . GLN A 1 90  ? -11.502 58.106 50.667 1.00 25.45  ? 90  GLN L NE2 1 
ATOM 695  N N   . HIS A 1 91  ? -11.584 62.282 49.174 1.00 62.56  ? 91  HIS L N   1 
ATOM 696  C CA  . HIS A 1 91  ? -11.391 62.907 50.474 1.00 62.56  ? 91  HIS L CA  1 
ATOM 697  C C   . HIS A 1 91  ? -12.633 63.169 51.342 1.00 62.56  ? 91  HIS L C   1 
ATOM 698  O O   . HIS A 1 91  ? -12.584 64.014 52.237 1.00 62.56  ? 91  HIS L O   1 
ATOM 699  C CB  . HIS A 1 91  ? -10.615 64.193 50.264 1.00 70.91  ? 91  HIS L CB  1 
ATOM 700  C CG  . HIS A 1 91  ? -11.123 65.008 49.118 1.00 70.91  ? 91  HIS L CG  1 
ATOM 701  N ND1 . HIS A 1 91  ? -11.437 64.451 47.899 1.00 70.91  ? 91  HIS L ND1 1 
ATOM 702  C CD2 . HIS A 1 91  ? -11.326 66.339 48.986 1.00 70.91  ? 91  HIS L CD2 1 
ATOM 703  C CE1 . HIS A 1 91  ? -11.811 65.403 47.065 1.00 70.91  ? 91  HIS L CE1 1 
ATOM 704  N NE2 . HIS A 1 91  ? -11.753 66.559 47.698 1.00 70.91  ? 91  HIS L NE2 1 
ATOM 705  N N   . ILE A 1 92  ? -13.727 62.439 51.093 1.00 29.06  ? 92  ILE L N   1 
ATOM 706  C CA  . ILE A 1 92  ? -14.956 62.586 51.868 1.00 29.06  ? 92  ILE L CA  1 
ATOM 707  C C   . ILE A 1 92  ? -14.675 62.185 53.293 1.00 29.06  ? 92  ILE L C   1 
ATOM 708  O O   . ILE A 1 92  ? -14.745 62.989 54.205 1.00 29.06  ? 92  ILE L O   1 
ATOM 709  C CB  . ILE A 1 92  ? -16.080 61.635 51.430 1.00 49.35  ? 92  ILE L CB  1 
ATOM 710  C CG1 . ILE A 1 92  ? -16.577 61.952 50.030 1.00 49.35  ? 92  ILE L CG1 1 
ATOM 711  C CG2 . ILE A 1 92  ? -17.247 61.764 52.396 1.00 49.35  ? 92  ILE L CG2 1 
ATOM 712  C CD1 . ILE A 1 92  ? -17.663 61.014 49.633 1.00 49.35  ? 92  ILE L CD1 1 
ATOM 713  N N   . SER A 1 93  ? -14.412 60.905 53.493 1.00 53.54  ? 93  SER L N   1 
ATOM 714  C CA  . SER A 1 93  ? -14.125 60.439 54.834 1.00 53.54  ? 93  SER L CA  1 
ATOM 715  C C   . SER A 1 93  ? -12.623 60.505 55.099 1.00 53.54  ? 93  SER L C   1 
ATOM 716  O O   . SER A 1 93  ? -11.931 61.418 54.663 1.00 53.54  ? 93  SER L O   1 
ATOM 717  C CB  . SER A 1 93  ? -14.640 59.007 55.022 1.00 83.75  ? 93  SER L CB  1 
ATOM 718  O OG  . SER A 1 93  ? -16.055 58.948 54.971 1.00 83.75  ? 93  SER L OG  1 
ATOM 719  N N   . ARG A 1 94  ? -12.141 59.528 55.842 1.00 59.56  ? 94  ARG L N   1 
ATOM 720  C CA  . ARG A 1 94  ? -10.744 59.412 56.189 1.00 59.56  ? 94  ARG L CA  1 
ATOM 721  C C   . ARG A 1 94  ? -10.639 58.062 56.868 1.00 59.56  ? 94  ARG L C   1 
ATOM 722  O O   . ARG A 1 94  ? -11.586 57.590 57.518 1.00 59.56  ? 94  ARG L O   1 
ATOM 723  C CB  . ARG A 1 94  ? -10.320 60.486 57.172 1.00 100.00 ? 94  ARG L CB  1 
ATOM 724  C CG  . ARG A 1 94  ? -10.502 61.884 56.696 1.00 100.00 ? 94  ARG L CG  1 
ATOM 725  C CD  . ARG A 1 94  ? -10.329 62.770 57.870 1.00 100.00 ? 94  ARG L CD  1 
ATOM 726  N NE  . ARG A 1 94  ? -10.745 64.134 57.616 1.00 100.00 ? 94  ARG L NE  1 
ATOM 727  C CZ  . ARG A 1 94  ? -10.827 65.046 58.576 1.00 100.00 ? 94  ARG L CZ  1 
ATOM 728  N NH1 . ARG A 1 94  ? -10.519 64.709 59.823 1.00 100.00 ? 94  ARG L NH1 1 
ATOM 729  N NH2 . ARG A 1 94  ? -11.220 66.286 58.298 1.00 100.00 ? 94  ARG L NH2 1 
ATOM 730  N N   . PRO A 1 95  ? -9.483  57.420 56.738 1.00 39.38  ? 95  PRO L N   1 
ATOM 731  C CA  . PRO A 1 95  ? -8.317  57.898 56.008 1.00 39.38  ? 95  PRO L CA  1 
ATOM 732  C C   . PRO A 1 95  ? -8.606  58.080 54.551 1.00 39.38  ? 95  PRO L C   1 
ATOM 733  O O   . PRO A 1 95  ? -9.595  57.563 54.055 1.00 39.38  ? 95  PRO L O   1 
ATOM 734  C CB  . PRO A 1 95  ? -7.321  56.795 56.247 1.00 16.85  ? 95  PRO L CB  1 
ATOM 735  C CG  . PRO A 1 95  ? -8.236  55.578 56.339 1.00 16.85  ? 95  PRO L CG  1 
ATOM 736  C CD  . PRO A 1 95  ? -9.181  56.124 57.346 1.00 16.85  ? 95  PRO L CD  1 
ATOM 737  N N   . ARG A 1 96  ? -7.745  58.844 53.886 1.00 35.66  ? 96  ARG L N   1 
ATOM 738  C CA  . ARG A 1 96  ? -7.889  59.100 52.473 1.00 35.66  ? 96  ARG L CA  1 
ATOM 739  C C   . ARG A 1 96  ? -7.434  57.825 51.817 1.00 35.66  ? 96  ARG L C   1 
ATOM 740  O O   . ARG A 1 96  ? -6.835  56.982 52.458 1.00 35.66  ? 96  ARG L O   1 
ATOM 741  C CB  . ARG A 1 96  ? -7.066  60.325 52.068 1.00 61.06  ? 96  ARG L CB  1 
ATOM 742  C CG  . ARG A 1 96  ? -7.780  61.596 52.488 1.00 61.06  ? 96  ARG L CG  1 
ATOM 743  C CD  . ARG A 1 96  ? -6.963  62.893 52.465 1.00 61.06  ? 96  ARG L CD  1 
ATOM 744  N NE  . ARG A 1 96  ? -7.791  64.030 52.914 1.00 61.06  ? 96  ARG L NE  1 
ATOM 745  C CZ  . ARG A 1 96  ? -7.354  65.265 53.165 1.00 61.06  ? 96  ARG L CZ  1 
ATOM 746  N NH1 . ARG A 1 96  ? -6.082  65.577 53.023 1.00 61.06  ? 96  ARG L NH1 1 
ATOM 747  N NH2 . ARG A 1 96  ? -8.199  66.191 53.580 1.00 61.06  ? 96  ARG L NH2 1 
ATOM 748  N N   . THR A 1 97  ? -7.747  57.661 50.545 1.00 52.01  ? 97  THR L N   1 
ATOM 749  C CA  . THR A 1 97  ? -7.394  56.450 49.856 1.00 52.01  ? 97  THR L CA  1 
ATOM 750  C C   . THR A 1 97  ? -7.152  56.720 48.382 1.00 52.01  ? 97  THR L C   1 
ATOM 751  O O   . THR A 1 97  ? -7.605  57.721 47.843 1.00 52.01  ? 97  THR L O   1 
ATOM 752  C CB  . THR A 1 97  ? -8.516  55.443 50.049 1.00 58.29  ? 97  THR L CB  1 
ATOM 753  O OG1 . THR A 1 97  ? -8.716  55.241 51.448 1.00 58.29  ? 97  THR L OG1 1 
ATOM 754  C CG2 . THR A 1 97  ? -8.161  54.120 49.429 1.00 58.29  ? 97  THR L CG2 1 
ATOM 755  N N   . PHE A 1 98  ? -6.410  55.827 47.741 1.00 14.12  ? 98  PHE L N   1 
ATOM 756  C CA  . PHE A 1 98  ? -6.084  55.972 46.327 1.00 14.12  ? 98  PHE L CA  1 
ATOM 757  C C   . PHE A 1 98  ? -6.350  54.680 45.591 1.00 14.12  ? 98  PHE L C   1 
ATOM 758  O O   . PHE A 1 98  ? -6.498  53.629 46.202 1.00 14.12  ? 98  PHE L O   1 
ATOM 759  C CB  . PHE A 1 98  ? -4.605  56.315 46.151 1.00 10.00  ? 98  PHE L CB  1 
ATOM 760  C CG  . PHE A 1 98  ? -4.201  57.652 46.702 1.00 10.00  ? 98  PHE L CG  1 
ATOM 761  C CD1 . PHE A 1 98  ? -4.494  58.007 48.011 1.00 10.00  ? 98  PHE L CD1 1 
ATOM 762  C CD2 . PHE A 1 98  ? -3.445  58.509 45.942 1.00 10.00  ? 98  PHE L CD2 1 
ATOM 763  C CE1 . PHE A 1 98  ? -4.031  59.183 48.545 1.00 10.00  ? 98  PHE L CE1 1 
ATOM 764  C CE2 . PHE A 1 98  ? -2.983  59.682 46.475 1.00 10.00  ? 98  PHE L CE2 1 
ATOM 765  C CZ  . PHE A 1 98  ? -3.277  60.017 47.787 1.00 10.00  ? 98  PHE L CZ  1 
ATOM 766  N N   . GLY A 1 99  ? -6.396  54.763 44.274 1.00 41.36  ? 99  GLY L N   1 
ATOM 767  C CA  . GLY A 1 99  ? -6.627  53.576 43.491 1.00 41.36  ? 99  GLY L CA  1 
ATOM 768  C C   . GLY A 1 99  ? -5.338  52.796 43.417 1.00 41.36  ? 99  GLY L C   1 
ATOM 769  O O   . GLY A 1 99  ? -4.269  53.339 43.682 1.00 41.36  ? 99  GLY L O   1 
ATOM 770  N N   . GLN A 1 100 ? -5.418  51.520 43.064 1.00 42.83  ? 100 GLN L N   1 
ATOM 771  C CA  . GLN A 1 100 ? -4.213  50.711 42.978 1.00 42.83  ? 100 GLN L CA  1 
ATOM 772  C C   . GLN A 1 100 ? -3.237  51.251 41.934 1.00 42.83  ? 100 GLN L C   1 
ATOM 773  O O   . GLN A 1 100 ? -2.107  50.800 41.850 1.00 42.83  ? 100 GLN L O   1 
ATOM 774  C CB  . GLN A 1 100 ? -4.592  49.249 42.703 1.00 83.37  ? 100 GLN L CB  1 
ATOM 775  C CG  . GLN A 1 100 ? -5.948  49.056 42.022 1.00 83.37  ? 100 GLN L CG  1 
ATOM 776  C CD  . GLN A 1 100 ? -6.041  49.703 40.649 1.00 83.37  ? 100 GLN L CD  1 
ATOM 777  O OE1 . GLN A 1 100 ? -5.356  49.308 39.705 1.00 83.37  ? 100 GLN L OE1 1 
ATOM 778  N NE2 . GLN A 1 100 ? -6.894  50.705 40.534 1.00 83.37  ? 100 GLN L NE2 1 
ATOM 779  N N   . GLY A 1 101 ? -3.690  52.229 41.153 1.00 25.95  ? 101 GLY L N   1 
ATOM 780  C CA  . GLY A 1 101 ? -2.863  52.846 40.130 1.00 25.95  ? 101 GLY L CA  1 
ATOM 781  C C   . GLY A 1 101 ? -3.058  52.346 38.708 1.00 25.95  ? 101 GLY L C   1 
ATOM 782  O O   . GLY A 1 101 ? -3.326  51.168 38.498 1.00 25.95  ? 101 GLY L O   1 
ATOM 783  N N   . THR A 1 102 ? -2.911  53.231 37.727 1.00 40.35  ? 102 THR L N   1 
ATOM 784  C CA  . THR A 1 102 ? -3.054  52.842 36.325 1.00 40.35  ? 102 THR L CA  1 
ATOM 785  C C   . THR A 1 102 ? -1.821  53.313 35.559 1.00 40.35  ? 102 THR L C   1 
ATOM 786  O O   . THR A 1 102 ? -1.578  54.518 35.448 1.00 40.35  ? 102 THR L O   1 
ATOM 787  C CB  . THR A 1 102 ? -4.310  53.485 35.726 1.00 24.80  ? 102 THR L CB  1 
ATOM 788  O OG1 . THR A 1 102 ? -5.443  53.099 36.516 1.00 24.80  ? 102 THR L OG1 1 
ATOM 789  C CG2 . THR A 1 102 ? -4.489  53.093 34.248 1.00 24.80  ? 102 THR L CG2 1 
ATOM 790  N N   . LYS A 1 103 ? -1.020  52.386 35.047 1.00 17.73  ? 103 LYS L N   1 
ATOM 791  C CA  . LYS A 1 103 ? 0.180   52.833 34.338 1.00 17.73  ? 103 LYS L CA  1 
ATOM 792  C C   . LYS A 1 103 ? -0.349  53.119 32.979 1.00 17.73  ? 103 LYS L C   1 
ATOM 793  O O   . LYS A 1 103 ? -1.494  52.770 32.738 1.00 17.73  ? 103 LYS L O   1 
ATOM 794  C CB  . LYS A 1 103 ? 1.260   51.750 34.288 1.00 99.63  ? 103 LYS L CB  1 
ATOM 795  C CG  . LYS A 1 103 ? 2.573   52.303 33.779 1.00 99.63  ? 103 LYS L CG  1 
ATOM 796  C CD  . LYS A 1 103 ? 3.695   51.290 33.735 1.00 99.63  ? 103 LYS L CD  1 
ATOM 797  C CE  . LYS A 1 103 ? 4.920   51.920 33.038 1.00 99.63  ? 103 LYS L CE  1 
ATOM 798  N NZ  . LYS A 1 103 ? 6.080   50.995 32.787 1.00 99.63  ? 103 LYS L NZ  1 
ATOM 799  N N   . VAL A 1 104 ? 0.425   53.783 32.105 1.00 26.03  ? 104 VAL L N   1 
ATOM 800  C CA  . VAL A 1 104 ? -0.031  54.080 30.729 1.00 26.03  ? 104 VAL L CA  1 
ATOM 801  C C   . VAL A 1 104 ? 1.133   54.186 29.759 1.00 26.03  ? 104 VAL L C   1 
ATOM 802  O O   . VAL A 1 104 ? 1.477   55.279 29.381 1.00 26.03  ? 104 VAL L O   1 
ATOM 803  C CB  . VAL A 1 104 ? -0.763  55.426 30.616 1.00 33.23  ? 104 VAL L CB  1 
ATOM 804  C CG1 . VAL A 1 104 ? -1.643  55.392 29.410 1.00 33.23  ? 104 VAL L CG1 1 
ATOM 805  C CG2 . VAL A 1 104 ? -1.546  55.746 31.861 1.00 33.23  ? 104 VAL L CG2 1 
ATOM 806  N N   . GLU A 1 105 ? 1.728   53.071 29.352 1.00 42.52  ? 105 GLU L N   1 
ATOM 807  C CA  . GLU A 1 105 ? 2.865   53.048 28.424 1.00 42.52  ? 105 GLU L CA  1 
ATOM 808  C C   . GLU A 1 105 ? 2.430   53.502 27.007 1.00 42.52  ? 105 GLU L C   1 
ATOM 809  O O   . GLU A 1 105 ? 1.396   53.063 26.533 1.00 42.52  ? 105 GLU L O   1 
ATOM 810  C CB  . GLU A 1 105 ? 3.404   51.615 28.362 1.00 70.90  ? 105 GLU L CB  1 
ATOM 811  C CG  . GLU A 1 105 ? 3.742   50.961 29.724 1.00 70.90  ? 105 GLU L CG  1 
ATOM 812  C CD  . GLU A 1 105 ? 3.316   49.471 29.803 1.00 70.90  ? 105 GLU L CD  1 
ATOM 813  O OE1 . GLU A 1 105 ? 3.645   48.682 28.887 1.00 70.90  ? 105 GLU L OE1 1 
ATOM 814  O OE2 . GLU A 1 105 ? 2.650   49.078 30.789 1.00 70.90  ? 105 GLU L OE2 1 
ATOM 815  N N   . ILE A 1 106 ? 3.195   54.366 26.323 1.00 21.43  ? 106 ILE L N   1 
ATOM 816  C CA  . ILE A 1 106 ? 2.805   54.821 24.969 1.00 21.43  ? 106 ILE L CA  1 
ATOM 817  C C   . ILE A 1 106 ? 3.312   53.953 23.818 1.00 21.43  ? 106 ILE L C   1 
ATOM 818  O O   . ILE A 1 106 ? 4.495   53.611 23.756 1.00 21.43  ? 106 ILE L O   1 
ATOM 819  C CB  . ILE A 1 106 ? 3.253   56.236 24.684 1.00 84.50  ? 106 ILE L CB  1 
ATOM 820  C CG1 . ILE A 1 106 ? 2.368   57.205 25.450 1.00 84.50  ? 106 ILE L CG1 1 
ATOM 821  C CG2 . ILE A 1 106 ? 3.161   56.512 23.205 1.00 84.50  ? 106 ILE L CG2 1 
ATOM 822  C CD1 . ILE A 1 106 ? 2.593   58.651 25.087 1.00 84.50  ? 106 ILE L CD1 1 
ATOM 823  N N   . LYS A 1 107 ? 2.411   53.606 22.898 1.00 48.41  ? 107 LYS L N   1 
ATOM 824  C CA  . LYS A 1 107 ? 2.752   52.756 21.756 1.00 48.41  ? 107 LYS L CA  1 
ATOM 825  C C   . LYS A 1 107 ? 3.129   53.552 20.537 1.00 48.41  ? 107 LYS L C   1 
ATOM 826  O O   . LYS A 1 107 ? 2.404   54.449 20.127 1.00 48.41  ? 107 LYS L O   1 
ATOM 827  C CB  . LYS A 1 107 ? 1.585   51.831 21.408 1.00 87.18  ? 107 LYS L CB  1 
ATOM 828  C CG  . LYS A 1 107 ? 1.790   50.983 20.157 1.00 87.18  ? 107 LYS L CG  1 
ATOM 829  C CD  . LYS A 1 107 ? 0.763   49.862 20.108 1.00 87.18  ? 107 LYS L CD  1 
ATOM 830  C CE  . LYS A 1 107 ? 0.933   48.920 21.314 1.00 87.18  ? 107 LYS L CE  1 
ATOM 831  N NZ  . LYS A 1 107 ? -0.121  47.862 21.428 1.00 87.18  ? 107 LYS L NZ  1 
ATOM 832  N N   . ARG A 1 108 ? 4.270   53.200 19.959 1.00 52.16  ? 108 ARG L N   1 
ATOM 833  C CA  . ARG A 1 108 ? 4.790   53.877 18.784 1.00 52.16  ? 108 ARG L CA  1 
ATOM 834  C C   . ARG A 1 108 ? 5.219   52.851 17.756 1.00 52.16  ? 108 ARG L C   1 
ATOM 835  O O   . ARG A 1 108 ? 4.685   51.745 17.715 1.00 52.16  ? 108 ARG L O   1 
ATOM 836  C CB  . ARG A 1 108 ? 6.005   54.712 19.145 1.00 54.82  ? 108 ARG L CB  1 
ATOM 837  C CG  . ARG A 1 108 ? 7.130   53.866 19.746 1.00 54.82  ? 108 ARG L CG  1 
ATOM 838  C CD  . ARG A 1 108 ? 8.431   54.591 19.661 1.00 54.82  ? 108 ARG L CD  1 
ATOM 839  N NE  . ARG A 1 108 ? 8.754   54.810 18.262 1.00 54.82  ? 108 ARG L NE  1 
ATOM 840  C CZ  . ARG A 1 108 ? 9.767   55.554 17.859 1.00 54.82  ? 108 ARG L CZ  1 
ATOM 841  N NH1 . ARG A 1 108 ? 10.523  56.126 18.773 1.00 54.82  ? 108 ARG L NH1 1 
ATOM 842  N NH2 . ARG A 1 108 ? 10.030  55.720 16.569 1.00 54.82  ? 108 ARG L NH2 1 
ATOM 843  N N   . THR A 1 109 ? 6.215   53.225 16.952 1.00 62.69  ? 109 THR L N   1 
ATOM 844  C CA  . THR A 1 109 ? 6.735   52.380 15.884 1.00 62.69  ? 109 THR L CA  1 
ATOM 845  C C   . THR A 1 109 ? 8.190   52.016 16.113 1.00 62.69  ? 109 THR L C   1 
ATOM 846  O O   . THR A 1 109 ? 8.993   52.867 16.480 1.00 62.69  ? 109 THR L O   1 
ATOM 847  C CB  . THR A 1 109 ? 6.655   53.101 14.559 1.00 64.83  ? 109 THR L CB  1 
ATOM 848  O OG1 . THR A 1 109 ? 5.398   53.783 14.454 1.00 64.83  ? 109 THR L OG1 1 
ATOM 849  C CG2 . THR A 1 109 ? 6.779   52.100 13.441 1.00 64.83  ? 109 THR L CG2 1 
ATOM 850  N N   . VAL A 1 110 ? 8.532   50.759 15.843 1.00 42.12  ? 110 VAL L N   1 
ATOM 851  C CA  . VAL A 1 110 ? 9.898   50.233 16.065 1.00 42.12  ? 110 VAL L CA  1 
ATOM 852  C C   . VAL A 1 110 ? 11.038  51.186 15.727 1.00 42.12  ? 110 VAL L C   1 
ATOM 853  O O   . VAL A 1 110 ? 11.114  51.712 14.626 1.00 42.12  ? 110 VAL L O   1 
ATOM 854  C CB  . VAL A 1 110 ? 10.135  48.922 15.281 1.00 37.50  ? 110 VAL L CB  1 
ATOM 855  C CG1 . VAL A 1 110 ? 11.264  48.152 15.900 1.00 37.50  ? 110 VAL L CG1 1 
ATOM 856  C CG2 . VAL A 1 110 ? 8.856   48.094 15.230 1.00 37.50  ? 110 VAL L CG2 1 
ATOM 857  N N   . ALA A 1 111 ? 11.936  51.388 16.680 1.00 61.87  ? 111 ALA L N   1 
ATOM 858  C CA  . ALA A 1 111 ? 13.066  52.287 16.482 1.00 61.87  ? 111 ALA L CA  1 
ATOM 859  C C   . ALA A 1 111 ? 14.397  51.560 16.676 1.00 61.87  ? 111 ALA L C   1 
ATOM 860  O O   . ALA A 1 111 ? 15.192  51.940 17.538 1.00 61.87  ? 111 ALA L O   1 
ATOM 861  C CB  . ALA A 1 111 ? 12.963  53.478 17.456 1.00 16.66  ? 111 ALA L CB  1 
ATOM 862  N N   . ALA A 1 112 ? 14.628  50.522 15.874 1.00 40.97  ? 112 ALA L N   1 
ATOM 863  C CA  . ALA A 1 112 ? 15.847  49.716 15.931 1.00 40.97  ? 112 ALA L CA  1 
ATOM 864  C C   . ALA A 1 112 ? 16.982  50.376 16.711 1.00 40.97  ? 112 ALA L C   1 
ATOM 865  O O   . ALA A 1 112 ? 17.370  51.514 16.430 1.00 40.97  ? 112 ALA L O   1 
ATOM 866  C CB  . ALA A 1 112 ? 16.307  49.386 14.529 1.00 68.25  ? 112 ALA L CB  1 
ATOM 867  N N   . PRO A 1 113 ? 17.494  49.673 17.728 1.00 26.44  ? 113 PRO L N   1 
ATOM 868  C CA  . PRO A 1 113 ? 18.558  49.931 18.707 1.00 26.44  ? 113 PRO L CA  1 
ATOM 869  C C   . PRO A 1 113 ? 19.909  50.481 18.308 1.00 26.44  ? 113 PRO L C   1 
ATOM 870  O O   . PRO A 1 113 ? 20.337  50.348 17.176 1.00 26.44  ? 113 PRO L O   1 
ATOM 871  C CB  . PRO A 1 113 ? 18.702  48.580 19.412 1.00 24.11  ? 113 PRO L CB  1 
ATOM 872  C CG  . PRO A 1 113 ? 18.032  47.602 18.450 1.00 24.11  ? 113 PRO L CG  1 
ATOM 873  C CD  . PRO A 1 113 ? 16.858  48.389 18.037 1.00 24.11  ? 113 PRO L CD  1 
ATOM 874  N N   . SER A 1 114 ? 20.593  51.087 19.269 1.00 87.81  ? 114 SER L N   1 
ATOM 875  C CA  . SER A 1 114 ? 21.922  51.634 19.039 1.00 87.81  ? 114 SER L CA  1 
ATOM 876  C C   . SER A 1 114 ? 22.836  51.174 20.151 1.00 87.81  ? 114 SER L C   1 
ATOM 877  O O   . SER A 1 114 ? 22.523  51.373 21.318 1.00 87.81  ? 114 SER L O   1 
ATOM 878  C CB  . SER A 1 114 ? 21.881  53.153 19.027 1.00 37.26  ? 114 SER L CB  1 
ATOM 879  O OG  . SER A 1 114 ? 21.176  53.609 17.894 1.00 37.26  ? 114 SER L OG  1 
ATOM 880  N N   . VAL A 1 115 ? 23.967  50.573 19.798 1.00 71.11  ? 115 VAL L N   1 
ATOM 881  C CA  . VAL A 1 115 ? 24.903  50.083 20.806 1.00 71.11  ? 115 VAL L CA  1 
ATOM 882  C C   . VAL A 1 115 ? 26.135  50.960 20.902 1.00 71.11  ? 115 VAL L C   1 
ATOM 883  O O   . VAL A 1 115 ? 26.476  51.645 19.939 1.00 71.11  ? 115 VAL L O   1 
ATOM 884  C CB  . VAL A 1 115 ? 25.384  48.697 20.472 1.00 33.20  ? 115 VAL L CB  1 
ATOM 885  C CG1 . VAL A 1 115 ? 26.115  48.098 21.699 1.00 33.20  ? 115 VAL L CG1 1 
ATOM 886  C CG2 . VAL A 1 115 ? 24.195  47.862 19.932 1.00 33.20  ? 115 VAL L CG2 1 
ATOM 887  N N   . PHE A 1 116 ? 26.797  50.938 22.059 1.00 41.45  ? 116 PHE L N   1 
ATOM 888  C CA  . PHE A 1 116 ? 27.994  51.749 22.282 1.00 41.45  ? 116 PHE L CA  1 
ATOM 889  C C   . PHE A 1 116 ? 29.003  51.082 23.236 1.00 41.45  ? 116 PHE L C   1 
ATOM 890  O O   . PHE A 1 116 ? 29.541  51.742 24.115 1.00 41.45  ? 116 PHE L O   1 
ATOM 891  C CB  . PHE A 1 116 ? 27.615  53.118 22.863 1.00 66.98  ? 116 PHE L CB  1 
ATOM 892  C CG  . PHE A 1 116 ? 26.773  53.954 21.961 1.00 66.98  ? 116 PHE L CG  1 
ATOM 893  C CD1 . PHE A 1 116 ? 25.492  53.566 21.622 1.00 66.98  ? 116 PHE L CD1 1 
ATOM 894  C CD2 . PHE A 1 116 ? 27.271  55.109 21.417 1.00 66.98  ? 116 PHE L CD2 1 
ATOM 895  C CE1 . PHE A 1 116 ? 24.715  54.311 20.744 1.00 66.98  ? 116 PHE L CE1 1 
ATOM 896  C CE2 . PHE A 1 116 ? 26.500  55.860 20.542 1.00 66.98  ? 116 PHE L CE2 1 
ATOM 897  C CZ  . PHE A 1 116 ? 25.219  55.455 20.204 1.00 66.98  ? 116 PHE L CZ  1 
ATOM 898  N N   . ILE A 1 117 ? 29.258  49.787 23.071 1.00 61.96  ? 117 ILE L N   1 
ATOM 899  C CA  . ILE A 1 117 ? 30.198  49.048 23.927 1.00 61.96  ? 117 ILE L CA  1 
ATOM 900  C C   . ILE A 1 117 ? 31.390  49.857 24.496 1.00 61.96  ? 117 ILE L C   1 
ATOM 901  O O   . ILE A 1 117 ? 32.327  50.167 23.781 1.00 61.96  ? 117 ILE L O   1 
ATOM 902  C CB  . ILE A 1 117 ? 30.740  47.877 23.147 1.00 29.13  ? 117 ILE L CB  1 
ATOM 903  C CG1 . ILE A 1 117 ? 31.850  47.194 23.937 1.00 29.13  ? 117 ILE L CG1 1 
ATOM 904  C CG2 . ILE A 1 117 ? 31.205  48.372 21.801 1.00 29.13  ? 117 ILE L CG2 1 
ATOM 905  C CD1 . ILE A 1 117 ? 31.429  46.654 25.286 1.00 29.13  ? 117 ILE L CD1 1 
ATOM 906  N N   . PHE A 1 118 ? 31.374  50.161 25.789 1.00 23.19  ? 118 PHE L N   1 
ATOM 907  C CA  . PHE A 1 118 ? 32.436  50.949 26.411 1.00 23.19  ? 118 PHE L CA  1 
ATOM 908  C C   . PHE A 1 118 ? 33.520  50.136 27.110 1.00 23.19  ? 118 PHE L C   1 
ATOM 909  O O   . PHE A 1 118 ? 33.298  49.668 28.214 1.00 23.19  ? 118 PHE L O   1 
ATOM 910  C CB  . PHE A 1 118 ? 31.878  51.839 27.527 1.00 45.93  ? 118 PHE L CB  1 
ATOM 911  C CG  . PHE A 1 118 ? 30.637  52.584 27.186 1.00 45.93  ? 118 PHE L CG  1 
ATOM 912  C CD1 . PHE A 1 118 ? 29.526  51.933 26.669 1.00 45.93  ? 118 PHE L CD1 1 
ATOM 913  C CD2 . PHE A 1 118 ? 30.542  53.930 27.461 1.00 45.93  ? 118 PHE L CD2 1 
ATOM 914  C CE1 . PHE A 1 118 ? 28.332  52.624 26.429 1.00 45.93  ? 118 PHE L CE1 1 
ATOM 915  C CE2 . PHE A 1 118 ? 29.356  54.615 27.225 1.00 45.93  ? 118 PHE L CE2 1 
ATOM 916  C CZ  . PHE A 1 118 ? 28.252  53.962 26.708 1.00 45.93  ? 118 PHE L CZ  1 
ATOM 917  N N   . PRO A 1 119 ? 34.708  49.975 26.527 1.00 44.83  ? 119 PRO L N   1 
ATOM 918  C CA  . PRO A 1 119 ? 35.669  49.188 27.318 1.00 44.83  ? 119 PRO L CA  1 
ATOM 919  C C   . PRO A 1 119 ? 35.817  49.686 28.779 1.00 44.83  ? 119 PRO L C   1 
ATOM 920  O O   . PRO A 1 119 ? 35.440  50.799 29.101 1.00 44.83  ? 119 PRO L O   1 
ATOM 921  C CB  . PRO A 1 119 ? 36.965  49.315 26.503 1.00 83.72  ? 119 PRO L CB  1 
ATOM 922  C CG  . PRO A 1 119 ? 36.737  50.587 25.657 1.00 83.72  ? 119 PRO L CG  1 
ATOM 923  C CD  . PRO A 1 119 ? 35.303  50.372 25.244 1.00 83.72  ? 119 PRO L CD  1 
ATOM 924  N N   . PRO A 1 120 ? 36.377  48.856 29.672 1.00 81.40  ? 120 PRO L N   1 
ATOM 925  C CA  . PRO A 1 120 ? 36.606  49.127 31.104 1.00 81.40  ? 120 PRO L CA  1 
ATOM 926  C C   . PRO A 1 120 ? 37.310  50.427 31.511 1.00 81.40  ? 120 PRO L C   1 
ATOM 927  O O   . PRO A 1 120 ? 38.002  51.043 30.710 1.00 81.40  ? 120 PRO L O   1 
ATOM 928  C CB  . PRO A 1 120 ? 37.389  47.895 31.549 1.00 100.00 ? 120 PRO L CB  1 
ATOM 929  C CG  . PRO A 1 120 ? 36.777  46.820 30.678 1.00 100.00 ? 120 PRO L CG  1 
ATOM 930  C CD  . PRO A 1 120 ? 36.875  47.512 29.338 1.00 100.00 ? 120 PRO L CD  1 
ATOM 931  N N   . SER A 1 121 ? 37.144  50.827 32.771 1.00 46.28  ? 121 SER L N   1 
ATOM 932  C CA  . SER A 1 121 ? 37.764  52.058 33.255 1.00 46.28  ? 121 SER L CA  1 
ATOM 933  C C   . SER A 1 121 ? 39.089  51.867 33.951 1.00 46.28  ? 121 SER L C   1 
ATOM 934  O O   . SER A 1 121 ? 39.146  51.635 35.173 1.00 46.28  ? 121 SER L O   1 
ATOM 935  C CB  . SER A 1 121 ? 36.863  52.842 34.209 1.00 38.90  ? 121 SER L CB  1 
ATOM 936  O OG  . SER A 1 121 ? 37.591  53.934 34.787 1.00 38.90  ? 121 SER L OG  1 
ATOM 937  N N   . ASP A 1 122 ? 40.142  52.021 33.144 1.00 67.77  ? 122 ASP L N   1 
ATOM 938  C CA  . ASP A 1 122 ? 41.527  51.898 33.554 1.00 67.77  ? 122 ASP L CA  1 
ATOM 939  C C   . ASP A 1 122 ? 41.670  51.707 35.024 1.00 67.77  ? 122 ASP L C   1 
ATOM 940  O O   . ASP A 1 122 ? 42.318  50.771 35.449 1.00 67.77  ? 122 ASP L O   1 
ATOM 941  C CB  . ASP A 1 122 ? 42.305  53.137 33.154 1.00 93.04  ? 122 ASP L CB  1 
ATOM 942  C CG  . ASP A 1 122 ? 42.261  53.388 31.681 1.00 93.04  ? 122 ASP L CG  1 
ATOM 943  O OD1 . ASP A 1 122 ? 41.149  53.626 31.148 1.00 93.04  ? 122 ASP L OD1 1 
ATOM 944  O OD2 . ASP A 1 122 ? 43.348  53.340 31.067 1.00 93.04  ? 122 ASP L OD2 1 
ATOM 945  N N   . GLU A 1 123 ? 41.058  52.581 35.810 1.00 42.57  ? 123 GLU L N   1 
ATOM 946  C CA  . GLU A 1 123 ? 41.202  52.457 37.239 1.00 42.57  ? 123 GLU L CA  1 
ATOM 947  C C   . GLU A 1 123 ? 40.250  51.547 37.971 1.00 42.57  ? 123 GLU L C   1 
ATOM 948  O O   . GLU A 1 123 ? 40.607  51.079 39.045 1.00 42.57  ? 123 GLU L O   1 
ATOM 949  C CB  . GLU A 1 123 ? 41.198  53.822 37.912 1.00 83.36  ? 123 GLU L CB  1 
ATOM 950  C CG  . GLU A 1 123 ? 39.955  54.621 37.708 1.00 83.36  ? 123 GLU L CG  1 
ATOM 951  C CD  . GLU A 1 123 ? 39.906  55.793 38.649 1.00 83.36  ? 123 GLU L CD  1 
ATOM 952  O OE1 . GLU A 1 123 ? 40.150  55.557 39.859 1.00 83.36  ? 123 GLU L OE1 1 
ATOM 953  O OE2 . GLU A 1 123 ? 39.614  56.922 38.185 1.00 83.36  ? 123 GLU L OE2 1 
ATOM 954  N N   . GLN A 1 124 ? 39.052  51.302 37.440 1.00 85.09  ? 124 GLN L N   1 
ATOM 955  C CA  . GLN A 1 124 ? 38.139  50.398 38.129 1.00 85.09  ? 124 GLN L CA  1 
ATOM 956  C C   . GLN A 1 124 ? 38.971  49.123 38.255 1.00 85.09  ? 124 GLN L C   1 
ATOM 957  O O   . GLN A 1 124 ? 39.009  48.461 39.303 1.00 85.09  ? 124 GLN L O   1 
ATOM 958  C CB  . GLN A 1 124 ? 36.885  50.116 37.299 1.00 74.27  ? 124 GLN L CB  1 
ATOM 959  C CG  . GLN A 1 124 ? 35.884  49.223 38.049 1.00 74.27  ? 124 GLN L CG  1 
ATOM 960  C CD  . GLN A 1 124 ? 34.744  48.673 37.187 1.00 74.27  ? 124 GLN L CD  1 
ATOM 961  O OE1 . GLN A 1 124 ? 33.897  47.915 37.672 1.00 74.27  ? 124 GLN L OE1 1 
ATOM 962  N NE2 . GLN A 1 124 ? 34.722  49.048 35.911 1.00 74.27  ? 124 GLN L NE2 1 
ATOM 963  N N   . LEU A 1 125 ? 39.652  48.822 37.150 1.00 65.01  ? 125 LEU L N   1 
ATOM 964  C CA  . LEU A 1 125 ? 40.560  47.680 36.971 1.00 65.01  ? 125 LEU L CA  1 
ATOM 965  C C   . LEU A 1 125 ? 41.818  48.002 37.774 1.00 65.01  ? 125 LEU L C   1 
ATOM 966  O O   . LEU A 1 125 ? 42.903  48.201 37.243 1.00 65.01  ? 125 LEU L O   1 
ATOM 967  C CB  . LEU A 1 125 ? 40.856  47.566 35.476 1.00 81.68  ? 125 LEU L CB  1 
ATOM 968  C CG  . LEU A 1 125 ? 41.792  46.643 34.713 1.00 81.68  ? 125 LEU L CG  1 
ATOM 969  C CD1 . LEU A 1 125 ? 41.485  46.879 33.226 1.00 81.68  ? 125 LEU L CD1 1 
ATOM 970  C CD2 . LEU A 1 125 ? 43.260  46.912 35.027 1.00 81.68  ? 125 LEU L CD2 1 
ATOM 971  N N   . LYS A 1 126 ? 41.634  48.069 39.078 1.00 42.49  ? 126 LYS L N   1 
ATOM 972  C CA  . LYS A 1 126 ? 42.696  48.395 39.996 1.00 42.49  ? 126 LYS L CA  1 
ATOM 973  C C   . LYS A 1 126 ? 42.085  47.976 41.316 1.00 42.49  ? 126 LYS L C   1 
ATOM 974  O O   . LYS A 1 126 ? 42.599  48.238 42.407 1.00 42.49  ? 126 LYS L O   1 
ATOM 975  C CB  . LYS A 1 126 ? 42.943  49.905 39.920 1.00 100.00 ? 126 LYS L CB  1 
ATOM 976  C CG  . LYS A 1 126 ? 43.952  50.475 40.892 1.00 100.00 ? 126 LYS L CG  1 
ATOM 977  C CD  . LYS A 1 126 ? 44.480  51.794 40.363 1.00 100.00 ? 126 LYS L CD  1 
ATOM 978  C CE  . LYS A 1 126 ? 45.184  51.558 39.022 1.00 100.00 ? 126 LYS L CE  1 
ATOM 979  N NZ  . LYS A 1 126 ? 45.829  52.774 38.451 1.00 100.00 ? 126 LYS L NZ  1 
ATOM 980  N N   . SER A 1 127 ? 40.966  47.288 41.175 1.00 80.05  ? 127 SER L N   1 
ATOM 981  C CA  . SER A 1 127 ? 40.206  46.820 42.302 1.00 80.05  ? 127 SER L CA  1 
ATOM 982  C C   . SER A 1 127 ? 40.259  45.304 42.373 1.00 80.05  ? 127 SER L C   1 
ATOM 983  O O   . SER A 1 127 ? 39.771  44.693 43.330 1.00 80.05  ? 127 SER L O   1 
ATOM 984  C CB  . SER A 1 127 ? 38.766  47.279 42.120 1.00 63.68  ? 127 SER L CB  1 
ATOM 985  O OG  . SER A 1 127 ? 38.718  48.679 41.923 1.00 63.68  ? 127 SER L OG  1 
ATOM 986  N N   . GLY A 1 128 ? 40.875  44.702 41.360 1.00 96.43  ? 128 GLY L N   1 
ATOM 987  C CA  . GLY A 1 128 ? 40.925  43.253 41.281 1.00 96.43  ? 128 GLY L CA  1 
ATOM 988  C C   . GLY A 1 128 ? 39.559  42.926 40.711 1.00 96.43  ? 128 GLY L C   1 
ATOM 989  O O   . GLY A 1 128 ? 39.199  41.768 40.503 1.00 96.43  ? 128 GLY L O   1 
ATOM 990  N N   . THR A 1 129 ? 38.830  44.007 40.426 1.00 86.16  ? 129 THR L N   1 
ATOM 991  C CA  . THR A 1 129 ? 37.469  43.996 39.909 1.00 86.16  ? 129 THR L CA  1 
ATOM 992  C C   . THR A 1 129 ? 37.430  44.827 38.632 1.00 86.16  ? 129 THR L C   1 
ATOM 993  O O   . THR A 1 129 ? 38.172  45.794 38.515 1.00 86.16  ? 129 THR L O   1 
ATOM 994  C CB  . THR A 1 129 ? 36.525  44.657 40.940 1.00 97.14  ? 129 THR L CB  1 
ATOM 995  O OG1 . THR A 1 129 ? 36.672  44.016 42.217 1.00 97.14  ? 129 THR L OG1 1 
ATOM 996  C CG2 . THR A 1 129 ? 35.080  44.560 40.487 1.00 97.14  ? 129 THR L CG2 1 
ATOM 997  N N   . ALA A 1 130 ? 36.569  44.457 37.684 1.00 66.65  ? 130 ALA L N   1 
ATOM 998  C CA  . ALA A 1 130 ? 36.433  45.200 36.420 1.00 66.65  ? 130 ALA L CA  1 
ATOM 999  C C   . ALA A 1 130 ? 35.175  44.827 35.629 1.00 66.65  ? 130 ALA L C   1 
ATOM 1000 O O   . ALA A 1 130 ? 35.008  43.672 35.243 1.00 66.65  ? 130 ALA L O   1 
ATOM 1001 C CB  . ALA A 1 130 ? 37.669  44.999 35.545 1.00 25.54  ? 130 ALA L CB  1 
ATOM 1002 N N   . SER A 1 131 ? 34.317  45.822 35.376 1.00 36.26  ? 131 SER L N   1 
ATOM 1003 C CA  . SER A 1 131 ? 33.041  45.638 34.652 1.00 36.26  ? 131 SER L CA  1 
ATOM 1004 C C   . SER A 1 131 ? 32.919  46.296 33.271 1.00 36.26  ? 131 SER L C   1 
ATOM 1005 O O   . SER A 1 131 ? 33.015  47.490 33.131 1.00 36.26  ? 131 SER L O   1 
ATOM 1006 C CB  . SER A 1 131 ? 31.881  46.110 35.539 1.00 75.57  ? 131 SER L CB  1 
ATOM 1007 O OG  . SER A 1 131 ? 32.097  47.423 36.041 1.00 75.57  ? 131 SER L OG  1 
ATOM 1008 N N   . VAL A 1 132 ? 32.709  45.486 32.252 1.00 33.18  ? 132 VAL L N   1 
ATOM 1009 C CA  . VAL A 1 132 ? 32.567  45.943 30.880 1.00 33.18  ? 132 VAL L CA  1 
ATOM 1010 C C   . VAL A 1 132 ? 31.096  46.190 30.624 1.00 33.18  ? 132 VAL L C   1 
ATOM 1011 O O   . VAL A 1 132 ? 30.321  45.229 30.528 1.00 33.18  ? 132 VAL L O   1 
ATOM 1012 C CB  . VAL A 1 132 ? 33.046  44.841 29.896 1.00 38.18  ? 132 VAL L CB  1 
ATOM 1013 C CG1 . VAL A 1 132 ? 32.302  44.944 28.580 1.00 38.18  ? 132 VAL L CG1 1 
ATOM 1014 C CG2 . VAL A 1 132 ? 34.557  44.972 29.639 1.00 38.18  ? 132 VAL L CG2 1 
ATOM 1015 N N   . VAL A 1 133 ? 30.717  47.463 30.508 1.00 47.39  ? 133 VAL L N   1 
ATOM 1016 C CA  . VAL A 1 133 ? 29.328  47.900 30.258 1.00 47.39  ? 133 VAL L CA  1 
ATOM 1017 C C   . VAL A 1 133 ? 28.864  47.810 28.793 1.00 47.39  ? 133 VAL L C   1 
ATOM 1018 O O   . VAL A 1 133 ? 29.626  48.012 27.862 1.00 47.39  ? 133 VAL L O   1 
ATOM 1019 C CB  . VAL A 1 133 ? 29.146  49.386 30.723 1.00 18.80  ? 133 VAL L CB  1 
ATOM 1020 C CG1 . VAL A 1 133 ? 28.019  50.070 29.920 1.00 18.80  ? 133 VAL L CG1 1 
ATOM 1021 C CG2 . VAL A 1 133 ? 28.907  49.448 32.241 1.00 18.80  ? 133 VAL L CG2 1 
ATOM 1022 N N   . CYS A 1 134 ? 27.609  47.484 28.579 1.00 50.40  ? 134 CYS L N   1 
ATOM 1023 C CA  . CYS A 1 134 ? 27.126  47.459 27.219 1.00 50.40  ? 134 CYS L CA  1 
ATOM 1024 C C   . CYS A 1 134 ? 25.856  48.312 27.233 1.00 50.40  ? 134 CYS L C   1 
ATOM 1025 O O   . CYS A 1 134 ? 25.090  48.291 28.204 1.00 50.40  ? 134 CYS L O   1 
ATOM 1026 C CB  . CYS A 1 134 ? 26.844  46.043 26.724 1.00 59.52  ? 134 CYS L CB  1 
ATOM 1027 S SG  . CYS A 1 134 ? 26.708  46.072 24.905 1.00 59.52  ? 134 CYS L SG  1 
ATOM 1028 N N   . LEU A 1 135 ? 25.633  49.053 26.150 1.00 21.37  ? 135 LEU L N   1 
ATOM 1029 C CA  . LEU A 1 135 ? 24.527  49.983 26.073 1.00 21.37  ? 135 LEU L CA  1 
ATOM 1030 C C   . LEU A 1 135 ? 23.876  50.011 24.697 1.00 21.37  ? 135 LEU L C   1 
ATOM 1031 O O   . LEU A 1 135 ? 24.559  50.043 23.660 1.00 21.37  ? 135 LEU L O   1 
ATOM 1032 C CB  . LEU A 1 135 ? 25.092  51.379 26.369 1.00 31.11  ? 135 LEU L CB  1 
ATOM 1033 C CG  . LEU A 1 135 ? 24.292  52.632 26.726 1.00 31.11  ? 135 LEU L CG  1 
ATOM 1034 C CD1 . LEU A 1 135 ? 24.001  52.634 28.231 1.00 31.11  ? 135 LEU L CD1 1 
ATOM 1035 C CD2 . LEU A 1 135 ? 25.099  53.877 26.353 1.00 31.11  ? 135 LEU L CD2 1 
ATOM 1036 N N   . LEU A 1 136 ? 22.552  49.978 24.692 1.00 72.55  ? 136 LEU L N   1 
ATOM 1037 C CA  . LEU A 1 136 ? 21.783  50.124 23.465 1.00 72.55  ? 136 LEU L CA  1 
ATOM 1038 C C   . LEU A 1 136 ? 21.168  51.484 23.814 1.00 72.55  ? 136 LEU L C   1 
ATOM 1039 O O   . LEU A 1 136 ? 21.361  51.961 24.931 1.00 72.55  ? 136 LEU L O   1 
ATOM 1040 C CB  . LEU A 1 136 ? 20.712  49.019 23.299 1.00 22.57  ? 136 LEU L CB  1 
ATOM 1041 C CG  . LEU A 1 136 ? 21.094  47.581 22.887 1.00 22.57  ? 136 LEU L CG  1 
ATOM 1042 C CD1 . LEU A 1 136 ? 22.096  47.027 23.874 1.00 22.57  ? 136 LEU L CD1 1 
ATOM 1043 C CD2 . LEU A 1 136 ? 19.872  46.698 22.806 1.00 22.57  ? 136 LEU L CD2 1 
ATOM 1044 N N   . ASN A 1 137 ? 20.458  52.138 22.913 1.00 42.48  ? 137 ASN L N   1 
ATOM 1045 C CA  . ASN A 1 137 ? 19.922  53.435 23.305 1.00 42.48  ? 137 ASN L CA  1 
ATOM 1046 C C   . ASN A 1 137 ? 18.767  53.830 22.411 1.00 42.48  ? 137 ASN L C   1 
ATOM 1047 O O   . ASN A 1 137 ? 18.888  53.871 21.191 1.00 42.48  ? 137 ASN L O   1 
ATOM 1048 C CB  . ASN A 1 137 ? 21.051  54.500 23.252 1.00 61.80  ? 137 ASN L CB  1 
ATOM 1049 C CG  . ASN A 1 137 ? 20.678  55.861 23.921 1.00 61.80  ? 137 ASN L CG  1 
ATOM 1050 O OD1 . ASN A 1 137 ? 19.798  56.595 23.473 1.00 61.80  ? 137 ASN L OD1 1 
ATOM 1051 N ND2 . ASN A 1 137 ? 21.384  56.188 24.985 1.00 61.80  ? 137 ASN L ND2 1 
ATOM 1052 N N   . ASN A 1 138 ? 17.631  54.092 23.029 1.00 48.48  ? 138 ASN L N   1 
ATOM 1053 C CA  . ASN A 1 138 ? 16.489  54.520 22.283 1.00 48.48  ? 138 ASN L CA  1 
ATOM 1054 C C   . ASN A 1 138 ? 16.023  53.471 21.290 1.00 48.48  ? 138 ASN L C   1 
ATOM 1055 O O   . ASN A 1 138 ? 16.476  53.453 20.151 1.00 48.48  ? 138 ASN L O   1 
ATOM 1056 C CB  . ASN A 1 138 ? 16.862  55.811 21.547 1.00 52.69  ? 138 ASN L CB  1 
ATOM 1057 C CG  . ASN A 1 138 ? 17.372  56.898 22.491 1.00 52.69  ? 138 ASN L CG  1 
ATOM 1058 O OD1 . ASN A 1 138 ? 17.794  57.968 22.065 1.00 52.69  ? 138 ASN L OD1 1 
ATOM 1059 N ND2 . ASN A 1 138 ? 17.325  56.620 23.781 1.00 52.69  ? 138 ASN L ND2 1 
ATOM 1060 N N   . PHE A 1 139 ? 15.129  52.590 21.715 1.00 47.31  ? 139 PHE L N   1 
ATOM 1061 C CA  . PHE A 1 139 ? 14.582  51.572 20.817 1.00 47.31  ? 139 PHE L CA  1 
ATOM 1062 C C   . PHE A 1 139 ? 13.138  51.294 21.199 1.00 47.31  ? 139 PHE L C   1 
ATOM 1063 O O   . PHE A 1 139 ? 12.595  51.966 22.070 1.00 47.31  ? 139 PHE L O   1 
ATOM 1064 C CB  . PHE A 1 139 ? 15.413  50.270 20.844 1.00 90.93  ? 139 PHE L CB  1 
ATOM 1065 C CG  . PHE A 1 139 ? 15.642  49.698 22.222 1.00 90.93  ? 139 PHE L CG  1 
ATOM 1066 C CD1 . PHE A 1 139 ? 14.586  49.235 22.988 1.00 90.93  ? 139 PHE L CD1 1 
ATOM 1067 C CD2 . PHE A 1 139 ? 16.925  49.633 22.750 1.00 90.93  ? 139 PHE L CD2 1 
ATOM 1068 C CE1 . PHE A 1 139 ? 14.808  48.722 24.250 1.00 90.93  ? 139 PHE L CE1 1 
ATOM 1069 C CE2 . PHE A 1 139 ? 17.155  49.123 24.009 1.00 90.93  ? 139 PHE L CE2 1 
ATOM 1070 C CZ  . PHE A 1 139 ? 16.100  48.667 24.761 1.00 90.93  ? 139 PHE L CZ  1 
ATOM 1071 N N   . TYR A 1 140 ? 12.519  50.317 20.548 1.00 59.46  ? 140 TYR L N   1 
ATOM 1072 C CA  . TYR A 1 140 ? 11.133  49.973 20.831 1.00 59.46  ? 140 TYR L CA  1 
ATOM 1073 C C   . TYR A 1 140 ? 10.700  48.826 19.934 1.00 59.46  ? 140 TYR L C   1 
ATOM 1074 O O   . TYR A 1 140 ? 10.967  48.831 18.730 1.00 59.46  ? 140 TYR L O   1 
ATOM 1075 C CB  . TYR A 1 140 ? 10.220  51.179 20.586 1.00 81.70  ? 140 TYR L CB  1 
ATOM 1076 C CG  . TYR A 1 140 ? 8.848   51.001 21.176 1.00 81.70  ? 140 TYR L CG  1 
ATOM 1077 C CD1 . TYR A 1 140 ? 7.950   50.096 20.638 1.00 81.70  ? 140 TYR L CD1 1 
ATOM 1078 C CD2 . TYR A 1 140 ? 8.498   51.655 22.352 1.00 81.70  ? 140 TYR L CD2 1 
ATOM 1079 C CE1 . TYR A 1 140 ? 6.749   49.838 21.258 1.00 81.70  ? 140 TYR L CE1 1 
ATOM 1080 C CE2 . TYR A 1 140 ? 7.304   51.405 22.980 1.00 81.70  ? 140 TYR L CE2 1 
ATOM 1081 C CZ  . TYR A 1 140 ? 6.435   50.493 22.433 1.00 81.70  ? 140 TYR L CZ  1 
ATOM 1082 O OH  . TYR A 1 140 ? 5.260   50.217 23.082 1.00 81.70  ? 140 TYR L OH  1 
ATOM 1083 N N   . PRO A 1 141 ? 10.005  47.832 20.493 1.00 58.70  ? 141 PRO L N   1 
ATOM 1084 C CA  . PRO A 1 141 ? 9.558   47.640 21.869 1.00 58.70  ? 141 PRO L CA  1 
ATOM 1085 C C   . PRO A 1 141 ? 10.690  47.554 22.879 1.00 58.70  ? 141 PRO L C   1 
ATOM 1086 O O   . PRO A 1 141 ? 11.819  47.952 22.587 1.00 58.70  ? 141 PRO L O   1 
ATOM 1087 C CB  . PRO A 1 141 ? 8.771   46.342 21.771 1.00 65.48  ? 141 PRO L CB  1 
ATOM 1088 C CG  . PRO A 1 141 ? 9.527   45.594 20.687 1.00 65.48  ? 141 PRO L CG  1 
ATOM 1089 C CD  . PRO A 1 141 ? 9.556   46.699 19.671 1.00 65.48  ? 141 PRO L CD  1 
ATOM 1090 N N   . ARG A 1 142 ? 10.372  47.033 24.065 1.00 53.36  ? 142 ARG L N   1 
ATOM 1091 C CA  . ARG A 1 142 ? 11.342  46.881 25.141 1.00 53.36  ? 142 ARG L CA  1 
ATOM 1092 C C   . ARG A 1 142 ? 12.043  45.551 24.977 1.00 53.36  ? 142 ARG L C   1 
ATOM 1093 O O   . ARG A 1 142 ? 13.082  45.314 25.575 1.00 53.36  ? 142 ARG L O   1 
ATOM 1094 C CB  . ARG A 1 142 ? 10.639  46.912 26.496 1.00 58.00  ? 142 ARG L CB  1 
ATOM 1095 C CG  . ARG A 1 142 ? 11.563  46.895 27.703 1.00 58.00  ? 142 ARG L CG  1 
ATOM 1096 C CD  . ARG A 1 142 ? 10.778  46.878 29.030 1.00 58.00  ? 142 ARG L CD  1 
ATOM 1097 N NE  . ARG A 1 142 ? 11.660  47.080 30.185 1.00 58.00  ? 142 ARG L NE  1 
ATOM 1098 C CZ  . ARG A 1 142 ? 11.265  47.057 31.457 1.00 58.00  ? 142 ARG L CZ  1 
ATOM 1099 N NH1 . ARG A 1 142 ? 9.994   46.837 31.744 1.00 58.00  ? 142 ARG L NH1 1 
ATOM 1100 N NH2 . ARG A 1 142 ? 12.135  47.256 32.441 1.00 58.00  ? 142 ARG L NH2 1 
ATOM 1101 N N   . GLU A 1 143 ? 11.462  44.692 24.152 1.00 69.17  ? 143 GLU L N   1 
ATOM 1102 C CA  . GLU A 1 143 ? 11.981  43.355 23.882 1.00 69.17  ? 143 GLU L CA  1 
ATOM 1103 C C   . GLU A 1 143 ? 13.368  43.362 23.213 1.00 69.17  ? 143 GLU L C   1 
ATOM 1104 O O   . GLU A 1 143 ? 13.476  43.331 21.987 1.00 69.17  ? 143 GLU L O   1 
ATOM 1105 C CB  . GLU A 1 143 ? 10.968  42.606 23.003 1.00 69.28  ? 143 GLU L CB  1 
ATOM 1106 C CG  . GLU A 1 143 ? 9.634   42.220 23.672 1.00 69.28  ? 143 GLU L CG  1 
ATOM 1107 C CD  . GLU A 1 143 ? 9.073   43.276 24.639 1.00 69.28  ? 143 GLU L CD  1 
ATOM 1108 O OE1 . GLU A 1 143 ? 9.074   44.479 24.307 1.00 69.28  ? 143 GLU L OE1 1 
ATOM 1109 O OE2 . GLU A 1 143 ? 8.603   42.902 25.741 1.00 69.28  ? 143 GLU L OE2 1 
ATOM 1110 N N   . ALA A 1 144 ? 14.430  43.388 24.013 1.00 51.67  ? 144 ALA L N   1 
ATOM 1111 C CA  . ALA A 1 144 ? 15.785  43.397 23.463 1.00 51.67  ? 144 ALA L CA  1 
ATOM 1112 C C   . ALA A 1 144 ? 16.711  42.454 24.221 1.00 51.67  ? 144 ALA L C   1 
ATOM 1113 O O   . ALA A 1 144 ? 16.925  42.603 25.418 1.00 51.67  ? 144 ALA L O   1 
ATOM 1114 C CB  . ALA A 1 144 ? 16.348  44.807 23.492 1.00 77.52  ? 144 ALA L CB  1 
ATOM 1115 N N   . LYS A 1 145 ? 17.297  41.502 23.518 1.00 58.20  ? 145 LYS L N   1 
ATOM 1116 C CA  . LYS A 1 145 ? 18.162  40.542 24.164 1.00 58.20  ? 145 LYS L CA  1 
ATOM 1117 C C   . LYS A 1 145 ? 19.655  40.683 23.789 1.00 58.20  ? 145 LYS L C   1 
ATOM 1118 O O   . LYS A 1 145 ? 20.065  40.474 22.650 1.00 58.20  ? 145 LYS L O   1 
ATOM 1119 C CB  . LYS A 1 145 ? 17.583  39.162 23.849 1.00 64.69  ? 145 LYS L CB  1 
ATOM 1120 C CG  . LYS A 1 145 ? 18.213  37.967 24.535 1.00 64.69  ? 145 LYS L CG  1 
ATOM 1121 C CD  . LYS A 1 145 ? 17.200  36.805 24.612 1.00 64.69  ? 145 LYS L CD  1 
ATOM 1122 C CE  . LYS A 1 145 ? 16.387  36.592 23.309 1.00 64.69  ? 145 LYS L CE  1 
ATOM 1123 N NZ  . LYS A 1 145 ? 17.191  36.178 22.126 1.00 64.69  ? 145 LYS L NZ  1 
ATOM 1124 N N   . VAL A 1 146 ? 20.459  41.050 24.779 1.00 41.96  ? 146 VAL L N   1 
ATOM 1125 C CA  . VAL A 1 146 ? 21.900  41.245 24.634 1.00 41.96  ? 146 VAL L CA  1 
ATOM 1126 C C   . VAL A 1 146 ? 22.696  39.965 24.836 1.00 41.96  ? 146 VAL L C   1 
ATOM 1127 O O   . VAL A 1 146 ? 22.614  39.341 25.887 1.00 41.96  ? 146 VAL L O   1 
ATOM 1128 C CB  . VAL A 1 146 ? 22.404  42.272 25.664 1.00 39.24  ? 146 VAL L CB  1 
ATOM 1129 C CG1 . VAL A 1 146 ? 23.882  42.150 25.850 1.00 39.24  ? 146 VAL L CG1 1 
ATOM 1130 C CG2 . VAL A 1 146 ? 22.065  43.668 25.208 1.00 39.24  ? 146 VAL L CG2 1 
ATOM 1131 N N   . GLN A 1 147 ? 23.507  39.605 23.846 1.00 98.83  ? 147 GLN L N   1 
ATOM 1132 C CA  . GLN A 1 147 ? 24.323  38.391 23.905 1.00 98.83  ? 147 GLN L CA  1 
ATOM 1133 C C   . GLN A 1 147 ? 25.797  38.677 24.147 1.00 98.83  ? 147 GLN L C   1 
ATOM 1134 O O   . GLN A 1 147 ? 26.506  38.998 23.200 1.00 98.83  ? 147 GLN L O   1 
ATOM 1135 C CB  . GLN A 1 147 ? 24.217  37.628 22.588 1.00 81.68  ? 147 GLN L CB  1 
ATOM 1136 C CG  . GLN A 1 147 ? 23.770  36.203 22.720 1.00 81.68  ? 147 GLN L CG  1 
ATOM 1137 C CD  . GLN A 1 147 ? 24.529  35.487 23.791 1.00 81.68  ? 147 GLN L CD  1 
ATOM 1138 O OE1 . GLN A 1 147 ? 24.314  35.730 24.979 1.00 81.68  ? 147 GLN L OE1 1 
ATOM 1139 N NE2 . GLN A 1 147 ? 25.446  34.611 23.389 1.00 81.68  ? 147 GLN L NE2 1 
ATOM 1140 N N   . TRP A 1 148 ? 26.265  38.550 25.390 1.00 47.99  ? 148 TRP L N   1 
ATOM 1141 C CA  . TRP A 1 148 ? 27.683  38.792 25.697 1.00 47.99  ? 148 TRP L CA  1 
ATOM 1142 C C   . TRP A 1 148 ? 28.595  37.683 25.235 1.00 47.99  ? 148 TRP L C   1 
ATOM 1143 O O   . TRP A 1 148 ? 28.258  36.502 25.390 1.00 47.99  ? 148 TRP L O   1 
ATOM 1144 C CB  . TRP A 1 148 ? 27.923  38.978 27.189 1.00 69.91  ? 148 TRP L CB  1 
ATOM 1145 C CG  . TRP A 1 148 ? 27.662  40.344 27.627 1.00 69.91  ? 148 TRP L CG  1 
ATOM 1146 C CD1 . TRP A 1 148 ? 26.477  40.867 28.076 1.00 69.91  ? 148 TRP L CD1 1 
ATOM 1147 C CD2 . TRP A 1 148 ? 28.563  41.428 27.525 1.00 69.91  ? 148 TRP L CD2 1 
ATOM 1148 N NE1 . TRP A 1 148 ? 26.594  42.217 28.254 1.00 69.91  ? 148 TRP L NE1 1 
ATOM 1149 C CE2 . TRP A 1 148 ? 27.870  42.587 27.919 1.00 69.91  ? 148 TRP L CE2 1 
ATOM 1150 C CE3 . TRP A 1 148 ? 29.898  41.540 27.132 1.00 69.91  ? 148 TRP L CE3 1 
ATOM 1151 C CZ2 . TRP A 1 148 ? 28.475  43.842 27.932 1.00 69.91  ? 148 TRP L CZ2 1 
ATOM 1152 C CZ3 . TRP A 1 148 ? 30.501  42.796 27.145 1.00 69.91  ? 148 TRP L CZ3 1 
ATOM 1153 C CH2 . TRP A 1 148 ? 29.791  43.922 27.540 1.00 69.91  ? 148 TRP L CH2 1 
ATOM 1154 N N   . LYS A 1 149 ? 29.744  38.059 24.668 1.00 51.09  ? 149 LYS L N   1 
ATOM 1155 C CA  . LYS A 1 149 ? 30.737  37.085 24.198 1.00 51.09  ? 149 LYS L CA  1 
ATOM 1156 C C   . LYS A 1 149 ? 32.147  37.525 24.560 1.00 51.09  ? 149 LYS L C   1 
ATOM 1157 O O   . LYS A 1 149 ? 32.513  38.688 24.373 1.00 51.09  ? 149 LYS L O   1 
ATOM 1158 C CB  . LYS A 1 149 ? 30.666  36.882 22.683 1.00 18.58  ? 149 LYS L CB  1 
ATOM 1159 C CG  . LYS A 1 149 ? 29.532  36.007 22.180 1.00 18.58  ? 149 LYS L CG  1 
ATOM 1160 C CD  . LYS A 1 149 ? 29.456  36.010 20.627 1.00 18.58  ? 149 LYS L CD  1 
ATOM 1161 C CE  . LYS A 1 149 ? 28.273  35.161 20.146 1.00 18.58  ? 149 LYS L CE  1 
ATOM 1162 N NZ  . LYS A 1 149 ? 27.864  35.259 18.688 1.00 18.58  ? 149 LYS L NZ  1 
ATOM 1163 N N   . VAL A 1 150 ? 32.934  36.597 25.091 1.00 62.56  ? 150 VAL L N   1 
ATOM 1164 C CA  . VAL A 1 150 ? 34.313  36.883 25.451 1.00 62.56  ? 150 VAL L CA  1 
ATOM 1165 C C   . VAL A 1 150 ? 35.140  36.660 24.174 1.00 62.56  ? 150 VAL L C   1 
ATOM 1166 O O   . VAL A 1 150 ? 34.764  37.155 23.104 1.00 62.56  ? 150 VAL L O   1 
ATOM 1167 C CB  . VAL A 1 150 ? 34.760  35.954 26.596 1.00 72.20  ? 150 VAL L CB  1 
ATOM 1168 C CG1 . VAL A 1 150 ? 36.227  36.129 26.899 1.00 72.20  ? 150 VAL L CG1 1 
ATOM 1169 C CG2 . VAL A 1 150 ? 33.942  36.266 27.831 1.00 72.20  ? 150 VAL L CG2 1 
ATOM 1170 N N   . ASP A 1 151 ? 36.257  35.943 24.257 1.00 88.15  ? 151 ASP L N   1 
ATOM 1171 C CA  . ASP A 1 151 ? 37.047  35.711 23.058 1.00 88.15  ? 151 ASP L CA  1 
ATOM 1172 C C   . ASP A 1 151 ? 36.250  34.722 22.227 1.00 88.15  ? 151 ASP L C   1 
ATOM 1173 O O   . ASP A 1 151 ? 36.601  33.544 22.120 1.00 88.15  ? 151 ASP L O   1 
ATOM 1174 C CB  . ASP A 1 151 ? 38.444  35.168 23.405 1.00 66.63  ? 151 ASP L CB  1 
ATOM 1175 C CG  . ASP A 1 151 ? 39.345  36.219 24.101 1.00 66.63  ? 151 ASP L CG  1 
ATOM 1176 O OD1 . ASP A 1 151 ? 39.686  37.247 23.473 1.00 66.63  ? 151 ASP L OD1 1 
ATOM 1177 O OD2 . ASP A 1 151 ? 39.714  36.014 25.279 1.00 66.63  ? 151 ASP L OD2 1 
ATOM 1178 N N   . ASN A 1 152 ? 35.146  35.239 21.679 1.00 88.71  ? 152 ASN L N   1 
ATOM 1179 C CA  . ASN A 1 152 ? 34.189  34.517 20.833 1.00 88.71  ? 152 ASN L CA  1 
ATOM 1180 C C   . ASN A 1 152 ? 33.541  33.397 21.644 1.00 88.71  ? 152 ASN L C   1 
ATOM 1181 O O   . ASN A 1 152 ? 32.891  32.504 21.104 1.00 88.71  ? 152 ASN L O   1 
ATOM 1182 C CB  . ASN A 1 152 ? 34.908  33.980 19.587 1.00 100.00 ? 152 ASN L CB  1 
ATOM 1183 C CG  . ASN A 1 152 ? 33.966  33.738 18.411 1.00 100.00 ? 152 ASN L CG  1 
ATOM 1184 O OD1 . ASN A 1 152 ? 33.194  34.622 18.015 1.00 100.00 ? 152 ASN L OD1 1 
ATOM 1185 N ND2 . ASN A 1 152 ? 34.051  32.544 17.823 1.00 100.00 ? 152 ASN L ND2 1 
ATOM 1186 N N   . ALA A 1 153 ? 33.702  33.493 22.961 1.00 100.00 ? 153 ALA L N   1 
ATOM 1187 C CA  . ALA A 1 153 ? 33.166  32.510 23.892 1.00 100.00 ? 153 ALA L CA  1 
ATOM 1188 C C   . ALA A 1 153 ? 32.148  33.110 24.877 1.00 100.00 ? 153 ALA L C   1 
ATOM 1189 O O   . ALA A 1 153 ? 31.247  33.851 24.483 1.00 100.00 ? 153 ALA L O   1 
ATOM 1190 C CB  . ALA A 1 153 ? 34.327  31.857 24.658 1.00 69.43  ? 153 ALA L CB  1 
ATOM 1191 N N   . LEU A 1 154 ? 32.302  32.762 26.157 1.00 99.84  ? 154 LEU L N   1 
ATOM 1192 C CA  . LEU A 1 154 ? 31.438  33.243 27.240 1.00 99.84  ? 154 LEU L CA  1 
ATOM 1193 C C   . LEU A 1 154 ? 31.562  32.390 28.533 1.00 99.84  ? 154 LEU L C   1 
ATOM 1194 O O   . LEU A 1 154 ? 32.304  31.399 28.578 1.00 99.84  ? 154 LEU L O   1 
ATOM 1195 C CB  . LEU A 1 154 ? 29.966  33.286 26.766 1.00 27.16  ? 154 LEU L CB  1 
ATOM 1196 C CG  . LEU A 1 154 ? 28.982  33.666 27.876 1.00 27.16  ? 154 LEU L CG  1 
ATOM 1197 C CD1 . LEU A 1 154 ? 29.341  35.020 28.433 1.00 27.16  ? 154 LEU L CD1 1 
ATOM 1198 C CD2 . LEU A 1 154 ? 27.596  33.655 27.370 1.00 27.16  ? 154 LEU L CD2 1 
ATOM 1199 N N   . GLN A 1 155 ? 30.844  32.816 29.576 1.00 99.22  ? 155 GLN L N   1 
ATOM 1200 C CA  . GLN A 1 155 ? 30.773  32.154 30.887 1.00 99.22  ? 155 GLN L CA  1 
ATOM 1201 C C   . GLN A 1 155 ? 29.541  32.655 31.661 1.00 99.22  ? 155 GLN L C   1 
ATOM 1202 O O   . GLN A 1 155 ? 29.328  32.295 32.826 1.00 99.22  ? 155 GLN L O   1 
ATOM 1203 C CB  . GLN A 1 155 ? 32.033  32.424 31.706 1.00 95.40  ? 155 GLN L CB  1 
ATOM 1204 C CG  . GLN A 1 155 ? 33.248  31.631 31.268 1.00 95.40  ? 155 GLN L CG  1 
ATOM 1205 C CD  . GLN A 1 155 ? 33.015  30.140 31.376 1.00 95.40  ? 155 GLN L CD  1 
ATOM 1206 O OE1 . GLN A 1 155 ? 32.605  29.636 32.426 1.00 95.40  ? 155 GLN L OE1 1 
ATOM 1207 N NE2 . GLN A 1 155 ? 33.283  29.422 30.290 1.00 95.40  ? 155 GLN L NE2 1 
ATOM 1208 N N   . SER A 1 156 ? 28.747  33.485 30.973 1.00 98.29  ? 156 SER L N   1 
ATOM 1209 C CA  . SER A 1 156 ? 27.509  34.108 31.469 1.00 98.29  ? 156 SER L CA  1 
ATOM 1210 C C   . SER A 1 156 ? 27.552  34.686 32.872 1.00 98.29  ? 156 SER L C   1 
ATOM 1211 O O   . SER A 1 156 ? 28.434  35.476 33.198 1.00 98.29  ? 156 SER L O   1 
ATOM 1212 C CB  . SER A 1 156 ? 26.328  33.130 31.376 1.00 70.96  ? 156 SER L CB  1 
ATOM 1213 O OG  . SER A 1 156 ? 25.137  33.722 31.871 1.00 70.96  ? 156 SER L OG  1 
ATOM 1214 N N   . GLY A 1 157 ? 26.569  34.289 33.677 1.00 100.00 ? 157 GLY L N   1 
ATOM 1215 C CA  . GLY A 1 157 ? 26.445  34.748 35.048 1.00 100.00 ? 157 GLY L CA  1 
ATOM 1216 C C   . GLY A 1 157 ? 27.177  36.033 35.369 1.00 100.00 ? 157 GLY L C   1 
ATOM 1217 O O   . GLY A 1 157 ? 27.698  36.184 36.476 1.00 100.00 ? 157 GLY L O   1 
ATOM 1218 N N   . ASN A 1 158 ? 27.209  36.955 34.408 1.00 73.09  ? 158 ASN L N   1 
ATOM 1219 C CA  . ASN A 1 158 ? 27.900  38.230 34.570 1.00 73.09  ? 158 ASN L CA  1 
ATOM 1220 C C   . ASN A 1 158 ? 27.032  39.366 34.060 1.00 73.09  ? 158 ASN L C   1 
ATOM 1221 O O   . ASN A 1 158 ? 27.109  40.499 34.534 1.00 73.09  ? 158 ASN L O   1 
ATOM 1222 C CB  . ASN A 1 158 ? 29.228  38.201 33.804 1.00 92.41  ? 158 ASN L CB  1 
ATOM 1223 C CG  . ASN A 1 158 ? 30.299  37.372 34.502 1.00 92.41  ? 158 ASN L CG  1 
ATOM 1224 O OD1 . ASN A 1 158 ? 31.275  36.973 33.883 1.00 92.41  ? 158 ASN L OD1 1 
ATOM 1225 N ND2 . ASN A 1 158 ? 30.135  37.141 35.798 1.00 92.41  ? 158 ASN L ND2 1 
ATOM 1226 N N   . SER A 1 159 ? 26.204  39.041 33.081 1.00 46.88  ? 159 SER L N   1 
ATOM 1227 C CA  . SER A 1 159 ? 25.292  39.996 32.484 1.00 46.88  ? 159 SER L CA  1 
ATOM 1228 C C   . SER A 1 159 ? 24.388  40.584 33.571 1.00 46.88  ? 159 SER L C   1 
ATOM 1229 O O   . SER A 1 159 ? 24.503  40.202 34.729 1.00 46.88  ? 159 SER L O   1 
ATOM 1230 C CB  . SER A 1 159 ? 24.447  39.275 31.433 1.00 64.89  ? 159 SER L CB  1 
ATOM 1231 O OG  . SER A 1 159 ? 23.820  38.129 31.990 1.00 64.89  ? 159 SER L OG  1 
ATOM 1232 N N   . GLN A 1 160 ? 23.495  41.508 33.201 1.00 100.00 ? 160 GLN L N   1 
ATOM 1233 C CA  . GLN A 1 160 ? 22.567  42.116 34.162 1.00 100.00 ? 160 GLN L CA  1 
ATOM 1234 C C   . GLN A 1 160 ? 21.763  43.326 33.673 1.00 100.00 ? 160 GLN L C   1 
ATOM 1235 O O   . GLN A 1 160 ? 22.255  44.458 33.715 1.00 100.00 ? 160 GLN L O   1 
ATOM 1236 C CB  . GLN A 1 160 ? 23.306  42.530 35.408 1.00 53.13  ? 160 GLN L CB  1 
ATOM 1237 C CG  . GLN A 1 160 ? 22.363  42.763 36.522 1.00 53.13  ? 160 GLN L CG  1 
ATOM 1238 C CD  . GLN A 1 160 ? 23.057  42.823 37.849 1.00 53.13  ? 160 GLN L CD  1 
ATOM 1239 O OE1 . GLN A 1 160 ? 23.880  43.704 38.094 1.00 53.13  ? 160 GLN L OE1 1 
ATOM 1240 N NE2 . GLN A 1 160 ? 22.741  41.873 38.718 1.00 53.13  ? 160 GLN L NE2 1 
ATOM 1241 N N   . GLU A 1 161 ? 20.517  43.077 33.259 1.00 98.11  ? 161 GLU L N   1 
ATOM 1242 C CA  . GLU A 1 161 ? 19.625  44.111 32.745 1.00 98.11  ? 161 GLU L CA  1 
ATOM 1243 C C   . GLU A 1 161 ? 19.180  45.191 33.716 1.00 98.11  ? 161 GLU L C   1 
ATOM 1244 O O   . GLU A 1 161 ? 19.099  44.993 34.930 1.00 98.11  ? 161 GLU L O   1 
ATOM 1245 C CB  . GLU A 1 161 ? 18.358  43.498 32.134 1.00 84.41  ? 161 GLU L CB  1 
ATOM 1246 C CG  . GLU A 1 161 ? 18.567  42.644 30.893 1.00 84.41  ? 161 GLU L CG  1 
ATOM 1247 C CD  . GLU A 1 161 ? 17.257  42.349 30.132 1.00 84.41  ? 161 GLU L CD  1 
ATOM 1248 O OE1 . GLU A 1 161 ? 16.702  43.269 29.475 1.00 84.41  ? 161 GLU L OE1 1 
ATOM 1249 O OE2 . GLU A 1 161 ? 16.777  41.192 30.194 1.00 84.41  ? 161 GLU L OE2 1 
ATOM 1250 N N   . SER A 1 162 ? 18.883  46.340 33.121 1.00 48.79  ? 162 SER L N   1 
ATOM 1251 C CA  . SER A 1 162 ? 18.384  47.539 33.775 1.00 48.79  ? 162 SER L CA  1 
ATOM 1252 C C   . SER A 1 162 ? 18.059  48.383 32.569 1.00 48.79  ? 162 SER L C   1 
ATOM 1253 O O   . SER A 1 162 ? 18.946  48.711 31.815 1.00 48.79  ? 162 SER L O   1 
ATOM 1254 C CB  . SER A 1 162 ? 19.467  48.231 34.603 1.00 75.91  ? 162 SER L CB  1 
ATOM 1255 O OG  . SER A 1 162 ? 20.525  48.691 33.789 1.00 75.91  ? 162 SER L OG  1 
ATOM 1256 N N   . VAL A 1 163 ? 16.790  48.695 32.354 1.00 44.89  ? 163 VAL L N   1 
ATOM 1257 C CA  . VAL A 1 163 ? 16.392  49.510 31.214 1.00 44.89  ? 163 VAL L CA  1 
ATOM 1258 C C   . VAL A 1 163 ? 15.625  50.719 31.756 1.00 44.89  ? 163 VAL L C   1 
ATOM 1259 O O   . VAL A 1 163 ? 15.099  50.687 32.857 1.00 44.89  ? 163 VAL L O   1 
ATOM 1260 C CB  . VAL A 1 163 ? 15.530  48.665 30.235 1.00 20.08  ? 163 VAL L CB  1 
ATOM 1261 C CG1 . VAL A 1 163 ? 15.820  47.219 30.469 1.00 20.08  ? 163 VAL L CG1 1 
ATOM 1262 C CG2 . VAL A 1 163 ? 14.053  48.952 30.368 1.00 20.08  ? 163 VAL L CG2 1 
ATOM 1263 N N   . THR A 1 164 ? 15.559  51.798 31.004 1.00 49.81  ? 164 THR L N   1 
ATOM 1264 C CA  . THR A 1 164 ? 14.860  52.968 31.507 1.00 49.81  ? 164 THR L CA  1 
ATOM 1265 C C   . THR A 1 164 ? 13.343  53.052 31.263 1.00 49.81  ? 164 THR L C   1 
ATOM 1266 O O   . THR A 1 164 ? 12.734  52.168 30.647 1.00 49.81  ? 164 THR L O   1 
ATOM 1267 C CB  . THR A 1 164 ? 15.508  54.233 30.944 1.00 27.30  ? 164 THR L CB  1 
ATOM 1268 O OG1 . THR A 1 164 ? 15.901  54.001 29.588 1.00 27.30  ? 164 THR L OG1 1 
ATOM 1269 C CG2 . THR A 1 164 ? 16.696  54.650 31.793 1.00 27.30  ? 164 THR L CG2 1 
ATOM 1270 N N   . GLU A 1 165 ? 12.738  54.123 31.782 1.00 39.49  ? 165 GLU L N   1 
ATOM 1271 C CA  . GLU A 1 165 ? 11.321  54.389 31.593 1.00 39.49  ? 165 GLU L CA  1 
ATOM 1272 C C   . GLU A 1 165 ? 11.131  55.018 30.228 1.00 39.49  ? 165 GLU L C   1 
ATOM 1273 O O   . GLU A 1 165 ? 12.018  55.704 29.705 1.00 39.49  ? 165 GLU L O   1 
ATOM 1274 C CB  . GLU A 1 165 ? 10.792  55.325 32.670 1.00 53.64  ? 165 GLU L CB  1 
ATOM 1275 C CG  . GLU A 1 165 ? 10.553  54.611 33.937 1.00 53.64  ? 165 GLU L CG  1 
ATOM 1276 C CD  . GLU A 1 165 ? 9.721   53.402 33.656 1.00 53.64  ? 165 GLU L CD  1 
ATOM 1277 O OE1 . GLU A 1 165 ? 8.597   53.606 33.164 1.00 53.64  ? 165 GLU L OE1 1 
ATOM 1278 O OE2 . GLU A 1 165 ? 10.194  52.265 33.888 1.00 53.64  ? 165 GLU L OE2 1 
ATOM 1279 N N   . GLN A 1 166 ? 9.970   54.790 29.641 1.00 48.79  ? 166 GLN L N   1 
ATOM 1280 C CA  . GLN A 1 166 ? 9.738   55.317 28.327 1.00 48.79  ? 166 GLN L CA  1 
ATOM 1281 C C   . GLN A 1 166 ? 10.013  56.794 28.300 1.00 48.79  ? 166 GLN L C   1 
ATOM 1282 O O   . GLN A 1 166 ? 9.572   57.516 29.165 1.00 48.79  ? 166 GLN L O   1 
ATOM 1283 C CB  . GLN A 1 166 ? 8.317   55.028 27.901 1.00 23.16  ? 166 GLN L CB  1 
ATOM 1284 C CG  . GLN A 1 166 ? 8.184   55.024 26.408 1.00 23.16  ? 166 GLN L CG  1 
ATOM 1285 C CD  . GLN A 1 166 ? 6.987   54.246 25.934 1.00 23.16  ? 166 GLN L CD  1 
ATOM 1286 O OE1 . GLN A 1 166 ? 6.949   53.811 24.792 1.00 23.16  ? 166 GLN L OE1 1 
ATOM 1287 N NE2 . GLN A 1 166 ? 5.998   54.076 26.798 1.00 23.16  ? 166 GLN L NE2 1 
ATOM 1288 N N   . ASP A 1 167 ? 10.779  57.230 27.315 1.00 70.63  ? 167 ASP L N   1 
ATOM 1289 C CA  . ASP A 1 167 ? 11.123  58.641 27.138 1.00 70.63  ? 167 ASP L CA  1 
ATOM 1290 C C   . ASP A 1 167 ? 9.788   59.369 26.861 1.00 70.63  ? 167 ASP L C   1 
ATOM 1291 O O   . ASP A 1 167 ? 8.822   58.752 26.401 1.00 70.63  ? 167 ASP L O   1 
ATOM 1292 C CB  . ASP A 1 167 ? 12.083  58.749 25.929 1.00 100.00 ? 167 ASP L CB  1 
ATOM 1293 C CG  . ASP A 1 167 ? 12.853  60.065 25.868 1.00 100.00 ? 167 ASP L CG  1 
ATOM 1294 O OD1 . ASP A 1 167 ? 13.565  60.396 26.842 1.00 100.00 ? 167 ASP L OD1 1 
ATOM 1295 O OD2 . ASP A 1 167 ? 12.771  60.749 24.826 1.00 100.00 ? 167 ASP L OD2 1 
ATOM 1296 N N   . SER A 1 168 ? 9.714   60.663 27.152 1.00 54.88  ? 168 SER L N   1 
ATOM 1297 C CA  . SER A 1 168 ? 8.477   61.406 26.894 1.00 54.88  ? 168 SER L CA  1 
ATOM 1298 C C   . SER A 1 168 ? 8.661   62.429 25.777 1.00 54.88  ? 168 SER L C   1 
ATOM 1299 O O   . SER A 1 168 ? 7.926   63.408 25.674 1.00 54.88  ? 168 SER L O   1 
ATOM 1300 C CB  . SER A 1 168 ? 8.012   62.090 28.167 1.00 33.24  ? 168 SER L CB  1 
ATOM 1301 O OG  . SER A 1 168 ? 9.147   62.644 28.800 1.00 33.24  ? 168 SER L OG  1 
ATOM 1302 N N   . LYS A 1 169 ? 9.672   62.172 24.960 1.00 40.90  ? 169 LYS L N   1 
ATOM 1303 C CA  . LYS A 1 169 ? 10.027  62.967 23.811 1.00 40.90  ? 169 LYS L CA  1 
ATOM 1304 C C   . LYS A 1 169 ? 9.807   61.963 22.676 1.00 40.90  ? 169 LYS L C   1 
ATOM 1305 O O   . LYS A 1 169 ? 8.961   62.191 21.809 1.00 40.90  ? 169 LYS L O   1 
ATOM 1306 C CB  . LYS A 1 169 ? 11.506  63.337 23.875 1.00 99.27  ? 169 LYS L CB  1 
ATOM 1307 C CG  . LYS A 1 169 ? 11.976  63.964 25.181 1.00 99.27  ? 169 LYS L CG  1 
ATOM 1308 C CD  . LYS A 1 169 ? 11.506  65.402 25.326 1.00 99.27  ? 169 LYS L CD  1 
ATOM 1309 C CE  . LYS A 1 169 ? 12.118  66.084 26.558 1.00 99.27  ? 169 LYS L CE  1 
ATOM 1310 N NZ  . LYS A 1 169 ? 11.738  67.531 26.679 1.00 99.27  ? 169 LYS L NZ  1 
ATOM 1311 N N   . ASP A 1 170 ? 10.564  60.848 22.721 1.00 57.81  ? 170 ASP L N   1 
ATOM 1312 C CA  . ASP A 1 170 ? 10.534  59.736 21.730 1.00 57.81  ? 170 ASP L CA  1 
ATOM 1313 C C   . ASP A 1 170 ? 9.529   58.602 22.007 1.00 57.81  ? 170 ASP L C   1 
ATOM 1314 O O   . ASP A 1 170 ? 8.761   58.213 21.129 1.00 57.81  ? 170 ASP L O   1 
ATOM 1315 C CB  . ASP A 1 170 ? 11.897  59.031 21.623 1.00 94.43  ? 170 ASP L CB  1 
ATOM 1316 C CG  . ASP A 1 170 ? 13.009  59.932 21.159 1.00 94.43  ? 170 ASP L CG  1 
ATOM 1317 O OD1 . ASP A 1 170 ? 13.356  60.855 21.913 1.00 94.43  ? 170 ASP L OD1 1 
ATOM 1318 O OD2 . ASP A 1 170 ? 13.544  59.705 20.049 1.00 94.43  ? 170 ASP L OD2 1 
ATOM 1319 N N   . SER A 1 171 ? 9.614   58.061 23.228 1.00 59.45  ? 171 SER L N   1 
ATOM 1320 C CA  . SER A 1 171 ? 8.807   56.946 23.757 1.00 59.45  ? 171 SER L CA  1 
ATOM 1321 C C   . SER A 1 171 ? 9.573   55.654 23.522 1.00 59.45  ? 171 SER L C   1 
ATOM 1322 O O   . SER A 1 171 ? 8.995   54.599 23.311 1.00 59.45  ? 171 SER L O   1 
ATOM 1323 C CB  . SER A 1 171 ? 7.424   56.876 23.098 1.00 54.43  ? 171 SER L CB  1 
ATOM 1324 O OG  . SER A 1 171 ? 6.616   57.989 23.460 1.00 54.43  ? 171 SER L OG  1 
ATOM 1325 N N   . THR A 1 172 ? 10.894  55.774 23.611 1.00 57.36  ? 172 THR L N   1 
ATOM 1326 C CA  . THR A 1 172 ? 11.869  54.706 23.379 1.00 57.36  ? 172 THR L CA  1 
ATOM 1327 C C   . THR A 1 172 ? 12.624  54.219 24.619 1.00 57.36  ? 172 THR L C   1 
ATOM 1328 O O   . THR A 1 172 ? 13.312  54.996 25.278 1.00 57.36  ? 172 THR L O   1 
ATOM 1329 C CB  . THR A 1 172 ? 12.921  55.212 22.419 1.00 52.93  ? 172 THR L CB  1 
ATOM 1330 O OG1 . THR A 1 172 ? 13.480  56.419 22.963 1.00 52.93  ? 172 THR L OG1 1 
ATOM 1331 C CG2 . THR A 1 172 ? 12.317  55.491 21.054 1.00 52.93  ? 172 THR L CG2 1 
ATOM 1332 N N   . TYR A 1 173 ? 12.539  52.931 24.915 1.00 42.07  ? 173 TYR L N   1 
ATOM 1333 C CA  . TYR A 1 173 ? 13.243  52.424 26.076 1.00 42.07  ? 173 TYR L CA  1 
ATOM 1334 C C   . TYR A 1 173 ? 14.702  52.384 25.703 1.00 42.07  ? 173 TYR L C   1 
ATOM 1335 O O   . TYR A 1 173 ? 15.019  52.463 24.525 1.00 42.07  ? 173 TYR L O   1 
ATOM 1336 C CB  . TYR A 1 173 ? 12.773  51.016 26.438 1.00 36.69  ? 173 TYR L CB  1 
ATOM 1337 C CG  . TYR A 1 173 ? 11.289  50.907 26.442 1.00 36.69  ? 173 TYR L CG  1 
ATOM 1338 C CD1 . TYR A 1 173 ? 10.510  51.670 27.300 1.00 36.69  ? 173 TYR L CD1 1 
ATOM 1339 C CD2 . TYR A 1 173 ? 10.653  50.148 25.490 1.00 36.69  ? 173 TYR L CD2 1 
ATOM 1340 C CE1 . TYR A 1 173 ? 9.114   51.680 27.181 1.00 36.69  ? 173 TYR L CE1 1 
ATOM 1341 C CE2 . TYR A 1 173 ? 9.279   50.150 25.363 1.00 36.69  ? 173 TYR L CE2 1 
ATOM 1342 C CZ  . TYR A 1 173 ? 8.518   50.914 26.197 1.00 36.69  ? 173 TYR L CZ  1 
ATOM 1343 O OH  . TYR A 1 173 ? 7.170   50.903 25.996 1.00 36.69  ? 173 TYR L OH  1 
ATOM 1344 N N   . SER A 1 174 ? 15.561  52.290 26.725 1.00 32.67  ? 174 SER L N   1 
ATOM 1345 C CA  . SER A 1 174 ? 17.019  52.198 26.634 1.00 32.67  ? 174 SER L CA  1 
ATOM 1346 C C   . SER A 1 174 ? 17.469  51.385 27.815 1.00 32.67  ? 174 SER L C   1 
ATOM 1347 O O   . SER A 1 174 ? 17.008  51.605 28.945 1.00 32.67  ? 174 SER L O   1 
ATOM 1348 C CB  . SER A 1 174 ? 17.702  53.550 26.761 1.00 22.36  ? 174 SER L CB  1 
ATOM 1349 O OG  . SER A 1 174 ? 17.324  54.406 25.721 1.00 22.36  ? 174 SER L OG  1 
ATOM 1350 N N   . LEU A 1 175 ? 18.382  50.453 27.564 1.00 73.32  ? 175 LEU L N   1 
ATOM 1351 C CA  . LEU A 1 175 ? 18.904  49.635 28.640 1.00 73.32  ? 175 LEU L CA  1 
ATOM 1352 C C   . LEU A 1 175 ? 20.406  49.443 28.532 1.00 73.32  ? 175 LEU L C   1 
ATOM 1353 O O   . LEU A 1 175 ? 20.952  49.350 27.443 1.00 73.32  ? 175 LEU L O   1 
ATOM 1354 C CB  . LEU A 1 175 ? 18.181  48.277 28.684 1.00 29.61  ? 175 LEU L CB  1 
ATOM 1355 C CG  . LEU A 1 175 ? 18.329  47.185 27.640 1.00 29.61  ? 175 LEU L CG  1 
ATOM 1356 C CD1 . LEU A 1 175 ? 19.673  46.493 27.870 1.00 29.61  ? 175 LEU L CD1 1 
ATOM 1357 C CD2 . LEU A 1 175 ? 17.199  46.170 27.785 1.00 29.61  ? 175 LEU L CD2 1 
ATOM 1358 N N   . SER A 1 176 ? 21.069  49.443 29.681 1.00 15.58  ? 176 SER L N   1 
ATOM 1359 C CA  . SER A 1 176 ? 22.500  49.222 29.738 1.00 15.58  ? 176 SER L CA  1 
ATOM 1360 C C   . SER A 1 176 ? 22.585  47.716 29.913 1.00 15.58  ? 176 SER L C   1 
ATOM 1361 O O   . SER A 1 176 ? 21.555  47.033 29.946 1.00 15.58  ? 176 SER L O   1 
ATOM 1362 C CB  . SER A 1 176 ? 23.161  49.963 30.915 1.00 41.75  ? 176 SER L CB  1 
ATOM 1363 O OG  . SER A 1 176 ? 22.599  49.595 32.158 1.00 41.75  ? 176 SER L OG  1 
ATOM 1364 N N   . SER A 1 177 ? 23.802  47.202 30.017 1.00 35.40  ? 177 SER L N   1 
ATOM 1365 C CA  . SER A 1 177 ? 23.999  45.777 30.128 1.00 35.40  ? 177 SER L CA  1 
ATOM 1366 C C   . SER A 1 177 ? 25.400  45.473 30.629 1.00 35.40  ? 177 SER L C   1 
ATOM 1367 O O   . SER A 1 177 ? 26.194  44.856 29.909 1.00 35.40  ? 177 SER L O   1 
ATOM 1368 C CB  . SER A 1 177 ? 23.821  45.170 28.752 1.00 26.70  ? 177 SER L CB  1 
ATOM 1369 O OG  . SER A 1 177 ? 24.200  43.809 28.781 1.00 26.70  ? 177 SER L OG  1 
ATOM 1370 N N   . THR A 1 178 ? 25.704  45.875 31.862 1.00 33.44  ? 178 THR L N   1 
ATOM 1371 C CA  . THR A 1 178 ? 27.045  45.670 32.415 1.00 33.44  ? 178 THR L CA  1 
ATOM 1372 C C   . THR A 1 178 ? 27.542  44.247 32.556 1.00 33.44  ? 178 THR L C   1 
ATOM 1373 O O   . THR A 1 178 ? 26.917  43.417 33.201 1.00 33.44  ? 178 THR L O   1 
ATOM 1374 C CB  . THR A 1 178 ? 27.204  46.330 33.791 1.00 66.37  ? 178 THR L CB  1 
ATOM 1375 O OG1 . THR A 1 178 ? 27.152  47.752 33.654 1.00 66.37  ? 178 THR L OG1 1 
ATOM 1376 C CG2 . THR A 1 178 ? 28.532  45.953 34.400 1.00 66.37  ? 178 THR L CG2 1 
ATOM 1377 N N   . LEU A 1 179 ? 28.690  43.984 31.950 1.00 76.06  ? 179 LEU L N   1 
ATOM 1378 C CA  . LEU A 1 179 ? 29.324  42.683 32.042 1.00 76.06  ? 179 LEU L CA  1 
ATOM 1379 C C   . LEU A 1 179 ? 30.366  42.947 33.120 1.00 76.06  ? 179 LEU L C   1 
ATOM 1380 O O   . LEU A 1 179 ? 31.290  43.715 32.889 1.00 76.06  ? 179 LEU L O   1 
ATOM 1381 C CB  . LEU A 1 179 ? 30.042  42.326 30.730 1.00 64.14  ? 179 LEU L CB  1 
ATOM 1382 C CG  . LEU A 1 179 ? 30.403  40.849 30.498 1.00 64.14  ? 179 LEU L CG  1 
ATOM 1383 C CD1 . LEU A 1 179 ? 31.513  40.742 29.481 1.00 64.14  ? 179 LEU L CD1 1 
ATOM 1384 C CD2 . LEU A 1 179 ? 30.883  40.222 31.792 1.00 64.14  ? 179 LEU L CD2 1 
ATOM 1385 N N   . THR A 1 180 ? 30.228  42.356 34.299 1.00 82.15  ? 180 THR L N   1 
ATOM 1386 C CA  . THR A 1 180 ? 31.229  42.603 35.335 1.00 82.15  ? 180 THR L CA  1 
ATOM 1387 C C   . THR A 1 180 ? 32.057  41.358 35.601 1.00 82.15  ? 180 THR L C   1 
ATOM 1388 O O   . THR A 1 180 ? 31.849  40.639 36.583 1.00 82.15  ? 180 THR L O   1 
ATOM 1389 C CB  . THR A 1 180 ? 30.595  43.068 36.639 1.00 56.41  ? 180 THR L CB  1 
ATOM 1390 O OG1 . THR A 1 180 ? 29.925  44.314 36.419 1.00 56.41  ? 180 THR L OG1 1 
ATOM 1391 C CG2 . THR A 1 180 ? 31.663  43.255 37.706 1.00 56.41  ? 180 THR L CG2 1 
ATOM 1392 N N   . LEU A 1 181 ? 33.010  41.129 34.706 1.00 63.63  ? 181 LEU L N   1 
ATOM 1393 C CA  . LEU A 1 181 ? 33.885  39.983 34.756 1.00 63.63  ? 181 LEU L CA  1 
ATOM 1394 C C   . LEU A 1 181 ? 35.032  40.147 35.734 1.00 63.63  ? 181 LEU L C   1 
ATOM 1395 O O   . LEU A 1 181 ? 35.899  39.288 35.817 1.00 63.63  ? 181 LEU L O   1 
ATOM 1396 C CB  . LEU A 1 181 ? 34.409  39.700 33.355 1.00 35.18  ? 181 LEU L CB  1 
ATOM 1397 C CG  . LEU A 1 181 ? 35.317  38.493 33.238 1.00 35.18  ? 181 LEU L CG  1 
ATOM 1398 C CD1 . LEU A 1 181 ? 34.643  37.288 33.878 1.00 35.18  ? 181 LEU L CD1 1 
ATOM 1399 C CD2 . LEU A 1 181 ? 35.650  38.244 31.790 1.00 35.18  ? 181 LEU L CD2 1 
ATOM 1400 N N   . SER A 1 182 ? 35.039  41.247 36.479 1.00 78.30  ? 182 SER L N   1 
ATOM 1401 C CA  . SER A 1 182 ? 36.089  41.485 37.472 1.00 78.30  ? 182 SER L CA  1 
ATOM 1402 C C   . SER A 1 182 ? 37.470  41.327 36.876 1.00 78.30  ? 182 SER L C   1 
ATOM 1403 O O   . SER A 1 182 ? 37.612  40.816 35.772 1.00 78.30  ? 182 SER L O   1 
ATOM 1404 C CB  . SER A 1 182 ? 35.943  40.508 38.642 1.00 77.20  ? 182 SER L CB  1 
ATOM 1405 O OG  . SER A 1 182 ? 36.987  40.684 39.580 1.00 77.20  ? 182 SER L OG  1 
ATOM 1406 N N   . LYS A 1 183 ? 38.488  41.742 37.623 1.00 100.00 ? 183 LYS L N   1 
ATOM 1407 C CA  . LYS A 1 183 ? 39.877  41.667 37.161 1.00 100.00 ? 183 LYS L CA  1 
ATOM 1408 C C   . LYS A 1 183 ? 40.483  40.283 36.932 1.00 100.00 ? 183 LYS L C   1 
ATOM 1409 O O   . LYS A 1 183 ? 39.835  39.241 37.145 1.00 100.00 ? 183 LYS L O   1 
ATOM 1410 C CB  . LYS A 1 183 ? 40.783  42.420 38.127 1.00 82.29  ? 183 LYS L CB  1 
ATOM 1411 C CG  . LYS A 1 183 ? 40.756  43.912 37.980 1.00 82.29  ? 183 LYS L CG  1 
ATOM 1412 C CD  . LYS A 1 183 ? 41.678  44.341 36.874 1.00 82.29  ? 183 LYS L CD  1 
ATOM 1413 C CE  . LYS A 1 183 ? 43.101  43.980 37.213 1.00 82.29  ? 183 LYS L CE  1 
ATOM 1414 N NZ  . LYS A 1 183 ? 44.026  44.527 36.197 1.00 82.29  ? 183 LYS L NZ  1 
ATOM 1415 N N   . ALA A 1 184 ? 41.745  40.305 36.496 1.00 66.21  ? 184 ALA L N   1 
ATOM 1416 C CA  . ALA A 1 184 ? 42.509  39.096 36.231 1.00 66.21  ? 184 ALA L CA  1 
ATOM 1417 C C   . ALA A 1 184 ? 41.941  38.266 35.068 1.00 66.21  ? 184 ALA L C   1 
ATOM 1418 O O   . ALA A 1 184 ? 42.582  37.323 34.590 1.00 66.21  ? 184 ALA L O   1 
ATOM 1419 C CB  . ALA A 1 184 ? 42.605  38.256 37.516 1.00 30.41  ? 184 ALA L CB  1 
ATOM 1420 N N   . ASP A 1 185 ? 40.748  38.618 34.604 1.00 82.01  ? 185 ASP L N   1 
ATOM 1421 C CA  . ASP A 1 185 ? 40.163  37.888 33.498 1.00 82.01  ? 185 ASP L CA  1 
ATOM 1422 C C   . ASP A 1 185 ? 40.015  38.816 32.298 1.00 82.01  ? 185 ASP L C   1 
ATOM 1423 O O   . ASP A 1 185 ? 40.092  38.364 31.155 1.00 82.01  ? 185 ASP L O   1 
ATOM 1424 C CB  . ASP A 1 185 ? 38.819  37.286 33.908 1.00 88.65  ? 185 ASP L CB  1 
ATOM 1425 C CG  . ASP A 1 185 ? 38.327  36.229 32.924 1.00 88.65  ? 185 ASP L CG  1 
ATOM 1426 O OD1 . ASP A 1 185 ? 37.914  36.592 31.800 1.00 88.65  ? 185 ASP L OD1 1 
ATOM 1427 O OD2 . ASP A 1 185 ? 38.373  35.029 33.277 1.00 88.65  ? 185 ASP L OD2 1 
ATOM 1428 N N   . TYR A 1 186 ? 39.810  40.110 32.561 1.00 57.45  ? 186 TYR L N   1 
ATOM 1429 C CA  . TYR A 1 186 ? 39.703  41.119 31.496 1.00 57.45  ? 186 TYR L CA  1 
ATOM 1430 C C   . TYR A 1 186 ? 40.968  41.015 30.695 1.00 57.45  ? 186 TYR L C   1 
ATOM 1431 O O   . TYR A 1 186 ? 41.002  41.314 29.500 1.00 57.45  ? 186 TYR L O   1 
ATOM 1432 C CB  . TYR A 1 186 ? 39.649  42.536 32.055 1.00 51.27  ? 186 TYR L CB  1 
ATOM 1433 C CG  . TYR A 1 186 ? 39.772  43.565 30.965 1.00 51.27  ? 186 TYR L CG  1 
ATOM 1434 C CD1 . TYR A 1 186 ? 38.977  43.475 29.822 1.00 51.27  ? 186 TYR L CD1 1 
ATOM 1435 C CD2 . TYR A 1 186 ? 40.690  44.631 31.053 1.00 51.27  ? 186 TYR L CD2 1 
ATOM 1436 C CE1 . TYR A 1 186 ? 39.084  44.416 28.783 1.00 51.27  ? 186 TYR L CE1 1 
ATOM 1437 C CE2 . TYR A 1 186 ? 40.811  45.591 30.012 1.00 51.27  ? 186 TYR L CE2 1 
ATOM 1438 C CZ  . TYR A 1 186 ? 39.996  45.466 28.884 1.00 51.27  ? 186 TYR L CZ  1 
ATOM 1439 O OH  . TYR A 1 186 ? 40.026  46.378 27.856 1.00 51.27  ? 186 TYR L OH  1 
ATOM 1440 N N   . GLU A 1 187 ? 42.013  40.592 31.399 1.00 100.00 ? 187 GLU L N   1 
ATOM 1441 C CA  . GLU A 1 187 ? 43.341  40.417 30.844 1.00 100.00 ? 187 GLU L CA  1 
ATOM 1442 C C   . GLU A 1 187 ? 43.430  39.059 30.148 1.00 100.00 ? 187 GLU L C   1 
ATOM 1443 O O   . GLU A 1 187 ? 43.698  38.969 28.947 1.00 100.00 ? 187 GLU L O   1 
ATOM 1444 C CB  . GLU A 1 187 ? 44.391  40.486 31.962 1.00 100.00 ? 187 GLU L CB  1 
ATOM 1445 C CG  . GLU A 1 187 ? 44.286  41.687 32.911 1.00 100.00 ? 187 GLU L CG  1 
ATOM 1446 C CD  . GLU A 1 187 ? 43.114  41.598 33.896 1.00 100.00 ? 187 GLU L CD  1 
ATOM 1447 O OE1 . GLU A 1 187 ? 41.941  41.712 33.472 1.00 100.00 ? 187 GLU L OE1 1 
ATOM 1448 O OE2 . GLU A 1 187 ? 43.372  41.412 35.109 1.00 100.00 ? 187 GLU L OE2 1 
ATOM 1449 N N   . LYS A 1 188 ? 43.186  38.007 30.917 1.00 92.94  ? 188 LYS L N   1 
ATOM 1450 C CA  . LYS A 1 188 ? 43.251  36.642 30.418 1.00 92.94  ? 188 LYS L CA  1 
ATOM 1451 C C   . LYS A 1 188 ? 42.511  36.448 29.102 1.00 92.94  ? 188 LYS L C   1 
ATOM 1452 O O   . LYS A 1 188 ? 42.502  35.348 28.555 1.00 92.94  ? 188 LYS L O   1 
ATOM 1453 C CB  . LYS A 1 188 ? 42.686  35.691 31.482 1.00 100.00 ? 188 LYS L CB  1 
ATOM 1454 C CG  . LYS A 1 188 ? 42.962  34.192 31.272 1.00 100.00 ? 188 LYS L CG  1 
ATOM 1455 C CD  . LYS A 1 188 ? 42.650  33.426 32.564 1.00 100.00 ? 188 LYS L CD  1 
ATOM 1456 C CE  . LYS A 1 188 ? 43.241  32.026 32.577 1.00 100.00 ? 188 LYS L CE  1 
ATOM 1457 N NZ  . LYS A 1 188 ? 43.087  31.388 33.921 1.00 100.00 ? 188 LYS L NZ  1 
ATOM 1458 N N   . HIS A 1 189 ? 41.895  37.511 28.592 1.00 67.51  ? 189 HIS L N   1 
ATOM 1459 C CA  . HIS A 1 189 ? 41.139  37.431 27.348 1.00 67.51  ? 189 HIS L CA  1 
ATOM 1460 C C   . HIS A 1 189 ? 41.353  38.685 26.491 1.00 67.51  ? 189 HIS L C   1 
ATOM 1461 O O   . HIS A 1 189 ? 42.127  39.573 26.877 1.00 67.51  ? 189 HIS L O   1 
ATOM 1462 C CB  . HIS A 1 189 ? 39.665  37.232 27.693 1.00 89.71  ? 189 HIS L CB  1 
ATOM 1463 C CG  . HIS A 1 189 ? 39.424  36.086 28.632 1.00 89.71  ? 189 HIS L CG  1 
ATOM 1464 N ND1 . HIS A 1 189 ? 40.016  36.010 29.877 1.00 89.71  ? 189 HIS L ND1 1 
ATOM 1465 C CD2 . HIS A 1 189 ? 38.692  34.954 28.496 1.00 89.71  ? 189 HIS L CD2 1 
ATOM 1466 C CE1 . HIS A 1 189 ? 39.661  34.879 30.464 1.00 89.71  ? 189 HIS L CE1 1 
ATOM 1467 N NE2 . HIS A 1 189 ? 38.857  34.222 29.647 1.00 89.71  ? 189 HIS L NE2 1 
ATOM 1468 N N   . LYS A 1 190 ? 40.678  38.780 25.340 1.00 68.17  ? 190 LYS L N   1 
ATOM 1469 C CA  . LYS A 1 190 ? 40.892  39.956 24.493 1.00 68.17  ? 190 LYS L CA  1 
ATOM 1470 C C   . LYS A 1 190 ? 39.897  40.377 23.401 1.00 68.17  ? 190 LYS L C   1 
ATOM 1471 O O   . LYS A 1 190 ? 40.299  40.983 22.421 1.00 68.17  ? 190 LYS L O   1 
ATOM 1472 C CB  . LYS A 1 190 ? 42.291  39.862 23.877 1.00 63.62  ? 190 LYS L CB  1 
ATOM 1473 C CG  . LYS A 1 190 ? 43.508  40.238 24.815 1.00 63.62  ? 190 LYS L CG  1 
ATOM 1474 C CD  . LYS A 1 190 ? 44.842  40.274 24.065 1.00 63.62  ? 190 LYS L CD  1 
ATOM 1475 C CE  . LYS A 1 190 ? 46.005  40.191 25.060 1.00 63.62  ? 190 LYS L CE  1 
ATOM 1476 N NZ  . LYS A 1 190 ? 47.319  40.232 24.348 1.00 63.62  ? 190 LYS L NZ  1 
ATOM 1477 N N   . VAL A 1 191 ? 38.614  40.088 23.534 1.00 99.18  ? 191 VAL L N   1 
ATOM 1478 C CA  . VAL A 1 191 ? 37.689  40.544 22.498 1.00 99.18  ? 191 VAL L CA  1 
ATOM 1479 C C   . VAL A 1 191 ? 36.257  40.847 22.958 1.00 99.18  ? 191 VAL L C   1 
ATOM 1480 O O   . VAL A 1 191 ? 35.456  41.392 22.195 1.00 99.18  ? 191 VAL L O   1 
ATOM 1481 C CB  . VAL A 1 191 ? 37.660  39.573 21.292 1.00 27.97  ? 191 VAL L CB  1 
ATOM 1482 C CG1 . VAL A 1 191 ? 38.588  40.078 20.203 1.00 27.97  ? 191 VAL L CG1 1 
ATOM 1483 C CG2 . VAL A 1 191 ? 38.066  38.164 21.725 1.00 27.97  ? 191 VAL L CG2 1 
ATOM 1484 N N   . TYR A 1 192 ? 35.957  40.496 24.207 1.00 66.25  ? 192 TYR L N   1 
ATOM 1485 C CA  . TYR A 1 192 ? 34.663  40.731 24.838 1.00 66.25  ? 192 TYR L CA  1 
ATOM 1486 C C   . TYR A 1 192 ? 33.741  41.558 23.978 1.00 66.25  ? 192 TYR L C   1 
ATOM 1487 O O   . TYR A 1 192 ? 33.781  42.772 24.063 1.00 66.25  ? 192 TYR L O   1 
ATOM 1488 C CB  . TYR A 1 192 ? 34.882  41.515 26.103 1.00 67.05  ? 192 TYR L CB  1 
ATOM 1489 C CG  . TYR A 1 192 ? 35.780  40.865 27.090 1.00 67.05  ? 192 TYR L CG  1 
ATOM 1490 C CD1 . TYR A 1 192 ? 35.844  39.489 27.197 1.00 67.05  ? 192 TYR L CD1 1 
ATOM 1491 C CD2 . TYR A 1 192 ? 36.483  41.636 28.004 1.00 67.05  ? 192 TYR L CD2 1 
ATOM 1492 C CE1 . TYR A 1 192 ? 36.578  38.899 28.202 1.00 67.05  ? 192 TYR L CE1 1 
ATOM 1493 C CE2 . TYR A 1 192 ? 37.219  41.061 29.009 1.00 67.05  ? 192 TYR L CE2 1 
ATOM 1494 C CZ  . TYR A 1 192 ? 37.262  39.692 29.114 1.00 67.05  ? 192 TYR L CZ  1 
ATOM 1495 O OH  . TYR A 1 192 ? 37.949  39.127 30.167 1.00 67.05  ? 192 TYR L OH  1 
ATOM 1496 N N   . ALA A 1 193 ? 32.908  40.945 23.157 1.00 44.73  ? 193 ALA L N   1 
ATOM 1497 C CA  . ALA A 1 193 ? 32.017  41.749 22.337 1.00 44.73  ? 193 ALA L CA  1 
ATOM 1498 C C   . ALA A 1 193 ? 30.663  41.944 23.036 1.00 44.73  ? 193 ALA L C   1 
ATOM 1499 O O   . ALA A 1 193 ? 30.547  41.763 24.237 1.00 44.73  ? 193 ALA L O   1 
ATOM 1500 C CB  . ALA A 1 193 ? 31.833  41.091 21.001 1.00 45.79  ? 193 ALA L CB  1 
ATOM 1501 N N   . CYS A 1 194 ? 29.639  42.324 22.287 1.00 47.86  ? 194 CYS L N   1 
ATOM 1502 C CA  . CYS A 1 194 ? 28.321  42.527 22.866 1.00 47.86  ? 194 CYS L CA  1 
ATOM 1503 C C   . CYS A 1 194 ? 27.227  42.550 21.803 1.00 47.86  ? 194 CYS L C   1 
ATOM 1504 O O   . CYS A 1 194 ? 26.579  43.568 21.550 1.00 47.86  ? 194 CYS L O   1 
ATOM 1505 C CB  . CYS A 1 194 ? 28.279  43.818 23.667 1.00 78.53  ? 194 CYS L CB  1 
ATOM 1506 S SG  . CYS A 1 194 ? 26.612  44.144 24.294 1.00 78.53  ? 194 CYS L SG  1 
ATOM 1507 N N   . GLU A 1 195 ? 27.044  41.394 21.185 1.00 64.18  ? 195 GLU L N   1 
ATOM 1508 C CA  . GLU A 1 195 ? 26.043  41.184 20.155 1.00 64.18  ? 195 GLU L CA  1 
ATOM 1509 C C   . GLU A 1 195 ? 24.684  41.599 20.715 1.00 64.18  ? 195 GLU L C   1 
ATOM 1510 O O   . GLU A 1 195 ? 24.513  41.635 21.922 1.00 64.18  ? 195 GLU L O   1 
ATOM 1511 C CB  . GLU A 1 195 ? 26.058  39.703 19.795 1.00 47.03  ? 195 GLU L CB  1 
ATOM 1512 C CG  . GLU A 1 195 ? 25.090  39.267 18.744 1.00 47.03  ? 195 GLU L CG  1 
ATOM 1513 C CD  . GLU A 1 195 ? 24.929  37.766 18.771 1.00 47.03  ? 195 GLU L CD  1 
ATOM 1514 O OE1 . GLU A 1 195 ? 24.868  37.244 19.913 1.00 47.03  ? 195 GLU L OE1 1 
ATOM 1515 O OE2 . GLU A 1 195 ? 24.850  37.124 17.689 1.00 47.03  ? 195 GLU L OE2 1 
ATOM 1516 N N   . VAL A 1 196 ? 23.724  41.911 19.845 1.00 19.48  ? 196 VAL L N   1 
ATOM 1517 C CA  . VAL A 1 196 ? 22.382  42.326 20.275 1.00 19.48  ? 196 VAL L CA  1 
ATOM 1518 C C   . VAL A 1 196 ? 21.172  42.265 19.284 1.00 19.48  ? 196 VAL L C   1 
ATOM 1519 O O   . VAL A 1 196 ? 20.996  43.131 18.443 1.00 19.48  ? 196 VAL L O   1 
ATOM 1520 C CB  . VAL A 1 196 ? 22.486  43.721 20.871 1.00 38.79  ? 196 VAL L CB  1 
ATOM 1521 C CG1 . VAL A 1 196 ? 23.466  44.526 20.068 1.00 38.79  ? 196 VAL L CG1 1 
ATOM 1522 C CG2 . VAL A 1 196 ? 21.128  44.385 20.898 1.00 38.79  ? 196 VAL L CG2 1 
ATOM 1523 N N   . THR A 1 197 ? 20.328  41.247 19.408 1.00 44.22  ? 197 THR L N   1 
ATOM 1524 C CA  . THR A 1 197 ? 19.159  41.121 18.540 1.00 44.22  ? 197 THR L CA  1 
ATOM 1525 C C   . THR A 1 197 ? 17.929  41.846 19.073 1.00 44.22  ? 197 THR L C   1 
ATOM 1526 O O   . THR A 1 197 ? 17.732  41.890 20.280 1.00 44.22  ? 197 THR L O   1 
ATOM 1527 C CB  . THR A 1 197 ? 18.743  39.686 18.390 1.00 43.85  ? 197 THR L CB  1 
ATOM 1528 O OG1 . THR A 1 197 ? 17.359  39.645 17.972 1.00 43.85  ? 197 THR L OG1 1 
ATOM 1529 C CG2 . THR A 1 197 ? 18.962  38.938 19.726 1.00 43.85  ? 197 THR L CG2 1 
ATOM 1530 N N   . HIS A 1 198 ? 17.068  42.353 18.180 1.00 54.57  ? 198 HIS L N   1 
ATOM 1531 C CA  . HIS A 1 198 ? 15.859  43.109 18.587 1.00 54.57  ? 198 HIS L CA  1 
ATOM 1532 C C   . HIS A 1 198 ? 14.704  42.865 17.606 1.00 54.57  ? 198 HIS L C   1 
ATOM 1533 O O   . HIS A 1 198 ? 14.942  42.533 16.459 1.00 54.57  ? 198 HIS L O   1 
ATOM 1534 C CB  . HIS A 1 198 ? 16.195  44.608 18.635 1.00 54.55  ? 198 HIS L CB  1 
ATOM 1535 C CG  . HIS A 1 198 ? 15.145  45.448 19.286 1.00 54.55  ? 198 HIS L CG  1 
ATOM 1536 N ND1 . HIS A 1 198 ? 13.812  45.371 18.950 1.00 54.55  ? 198 HIS L ND1 1 
ATOM 1537 C CD2 . HIS A 1 198 ? 15.238  46.412 20.232 1.00 54.55  ? 198 HIS L CD2 1 
ATOM 1538 C CE1 . HIS A 1 198 ? 13.126  46.248 19.661 1.00 54.55  ? 198 HIS L CE1 1 
ATOM 1539 N NE2 . HIS A 1 198 ? 13.967  46.895 20.447 1.00 54.55  ? 198 HIS L NE2 1 
ATOM 1540 N N   . GLN A 1 199 ? 13.464  43.054 18.053 1.00 58.17  ? 199 GLN L N   1 
ATOM 1541 C CA  . GLN A 1 199 ? 12.265  42.809 17.228 1.00 58.17  ? 199 GLN L CA  1 
ATOM 1542 C C   . GLN A 1 199 ? 12.227  43.504 15.867 1.00 58.17  ? 199 GLN L C   1 
ATOM 1543 O O   . GLN A 1 199 ? 11.863  42.872 14.863 1.00 58.17  ? 199 GLN L O   1 
ATOM 1544 C CB  . GLN A 1 199 ? 10.997  43.192 18.016 1.00 99.50  ? 199 GLN L CB  1 
ATOM 1545 C CG  . GLN A 1 199 ? 9.670   42.452 17.645 1.00 99.50  ? 199 GLN L CG  1 
ATOM 1546 C CD  . GLN A 1 199 ? 9.054   42.806 16.283 1.00 99.50  ? 199 GLN L CD  1 
ATOM 1547 O OE1 . GLN A 1 199 ? 8.849   43.974 15.967 1.00 99.50  ? 199 GLN L OE1 1 
ATOM 1548 N NE2 . GLN A 1 199 ? 8.721   41.784 15.496 1.00 99.50  ? 199 GLN L NE2 1 
ATOM 1549 N N   . GLY A 1 200 ? 12.609  44.786 15.835 1.00 84.53  ? 200 GLY L N   1 
ATOM 1550 C CA  . GLY A 1 200 ? 12.569  45.559 14.600 1.00 84.53  ? 200 GLY L CA  1 
ATOM 1551 C C   . GLY A 1 200 ? 13.789  45.633 13.691 1.00 84.53  ? 200 GLY L C   1 
ATOM 1552 O O   . GLY A 1 200 ? 13.653  45.970 12.518 1.00 84.53  ? 200 GLY L O   1 
ATOM 1553 N N   . LEU A 1 201 ? 14.974  45.318 14.207 1.00 55.71  ? 201 LEU L N   1 
ATOM 1554 C CA  . LEU A 1 201 ? 16.220  45.370 13.420 1.00 55.71  ? 201 LEU L CA  1 
ATOM 1555 C C   . LEU A 1 201 ? 16.740  43.940 13.163 1.00 55.71  ? 201 LEU L C   1 
ATOM 1556 O O   . LEU A 1 201 ? 17.480  43.397 13.989 1.00 55.71  ? 201 LEU L O   1 
ATOM 1557 C CB  . LEU A 1 201 ? 17.252  46.189 14.217 1.00 42.48  ? 201 LEU L CB  1 
ATOM 1558 C CG  . LEU A 1 201 ? 18.641  46.652 13.770 1.00 42.48  ? 201 LEU L CG  1 
ATOM 1559 C CD1 . LEU A 1 201 ? 18.547  47.627 12.609 1.00 42.48  ? 201 LEU L CD1 1 
ATOM 1560 C CD2 . LEU A 1 201 ? 19.326  47.320 14.952 1.00 42.48  ? 201 LEU L CD2 1 
ATOM 1561 N N   . SER A 1 202 ? 16.355  43.352 12.022 1.00 77.37  ? 202 SER L N   1 
ATOM 1562 C CA  . SER A 1 202 ? 16.743  41.979 11.631 1.00 77.37  ? 202 SER L CA  1 
ATOM 1563 C C   . SER A 1 202 ? 18.238  41.688 11.515 1.00 77.37  ? 202 SER L C   1 
ATOM 1564 O O   . SER A 1 202 ? 19.055  42.612 11.401 1.00 77.37  ? 202 SER L O   1 
ATOM 1565 C CB  . SER A 1 202 ? 16.102  41.580 10.305 1.00 41.91  ? 202 SER L CB  1 
ATOM 1566 O OG  . SER A 1 202 ? 16.529  40.283 9.950  1.00 41.91  ? 202 SER L OG  1 
ATOM 1567 N N   . SER A 1 203 ? 18.580  40.394 11.499 1.00 36.72  ? 203 SER L N   1 
ATOM 1568 C CA  . SER A 1 203 ? 19.977  39.967 11.444 1.00 36.72  ? 203 SER L CA  1 
ATOM 1569 C C   . SER A 1 203 ? 20.757  40.789 12.501 1.00 36.72  ? 203 SER L C   1 
ATOM 1570 O O   . SER A 1 203 ? 21.167  41.946 12.274 1.00 36.72  ? 203 SER L O   1 
ATOM 1571 C CB  . SER A 1 203 ? 20.502  40.159 10.023 1.00 100.00 ? 203 SER L CB  1 
ATOM 1572 O OG  . SER A 1 203 ? 19.752  39.340 9.122  1.00 100.00 ? 203 SER L OG  1 
ATOM 1573 N N   . PRO A 1 204 ? 20.986  40.166 13.670 1.00 27.63  ? 204 PRO L N   1 
ATOM 1574 C CA  . PRO A 1 204 ? 21.662  40.672 14.873 1.00 27.63  ? 204 PRO L CA  1 
ATOM 1575 C C   . PRO A 1 204 ? 22.746  41.663 14.570 1.00 27.63  ? 204 PRO L C   1 
ATOM 1576 O O   . PRO A 1 204 ? 23.193  41.725 13.421 1.00 27.63  ? 204 PRO L O   1 
ATOM 1577 C CB  . PRO A 1 204 ? 22.158  39.390 15.528 1.00 76.04  ? 204 PRO L CB  1 
ATOM 1578 C CG  . PRO A 1 204 ? 20.966  38.477 15.308 1.00 76.04  ? 204 PRO L CG  1 
ATOM 1579 C CD  . PRO A 1 204 ? 20.716  38.717 13.815 1.00 76.04  ? 204 PRO L CD  1 
ATOM 1580 N N   . VAL A 1 205 ? 23.151  42.450 15.576 1.00 67.16  ? 205 VAL L N   1 
ATOM 1581 C CA  . VAL A 1 205 ? 24.203  43.476 15.413 1.00 67.16  ? 205 VAL L CA  1 
ATOM 1582 C C   . VAL A 1 205 ? 25.015  43.722 16.665 1.00 67.16  ? 205 VAL L C   1 
ATOM 1583 O O   . VAL A 1 205 ? 24.491  43.666 17.767 1.00 67.16  ? 205 VAL L O   1 
ATOM 1584 C CB  . VAL A 1 205 ? 23.643  44.869 15.024 1.00 52.17  ? 205 VAL L CB  1 
ATOM 1585 C CG1 . VAL A 1 205 ? 22.795  44.768 13.752 1.00 52.17  ? 205 VAL L CG1 1 
ATOM 1586 C CG2 . VAL A 1 205 ? 22.862  45.453 16.182 1.00 52.17  ? 205 VAL L CG2 1 
ATOM 1587 N N   . THR A 1 206 ? 26.293  44.035 16.496 1.00 82.57  ? 206 THR L N   1 
ATOM 1588 C CA  . THR A 1 206 ? 27.128  44.289 17.657 1.00 82.57  ? 206 THR L CA  1 
ATOM 1589 C C   . THR A 1 206 ? 28.241  45.299 17.487 1.00 82.57  ? 206 THR L C   1 
ATOM 1590 O O   . THR A 1 206 ? 28.718  45.579 16.389 1.00 82.57  ? 206 THR L O   1 
ATOM 1591 C CB  . THR A 1 206 ? 27.805  42.997 18.197 1.00 37.36  ? 206 THR L CB  1 
ATOM 1592 O OG1 . THR A 1 206 ? 28.514  43.309 19.404 1.00 37.36  ? 206 THR L OG1 1 
ATOM 1593 C CG2 . THR A 1 206 ? 28.810  42.423 17.173 1.00 37.36  ? 206 THR L CG2 1 
ATOM 1594 N N   . LYS A 1 207 ? 28.626  45.838 18.631 1.00 46.89  ? 207 LYS L N   1 
ATOM 1595 C CA  . LYS A 1 207 ? 29.716  46.768 18.775 1.00 46.89  ? 207 LYS L CA  1 
ATOM 1596 C C   . LYS A 1 207 ? 30.588  45.945 19.723 1.00 46.89  ? 207 LYS L C   1 
ATOM 1597 O O   . LYS A 1 207 ? 30.152  45.539 20.794 1.00 46.89  ? 207 LYS L O   1 
ATOM 1598 C CB  . LYS A 1 207 ? 29.223  48.064 19.419 1.00 73.88  ? 207 LYS L CB  1 
ATOM 1599 C CG  . LYS A 1 207 ? 28.602  49.046 18.444 1.00 73.88  ? 207 LYS L CG  1 
ATOM 1600 C CD  . LYS A 1 207 ? 29.690  49.618 17.535 1.00 73.88  ? 207 LYS L CD  1 
ATOM 1601 C CE  . LYS A 1 207 ? 29.186  50.763 16.656 1.00 73.88  ? 207 LYS L CE  1 
ATOM 1602 N NZ  . LYS A 1 207 ? 28.092  50.340 15.739 1.00 73.88  ? 207 LYS L NZ  1 
ATOM 1603 N N   . SER A 1 208 ? 31.817  45.668 19.315 1.00 82.45  ? 208 SER L N   1 
ATOM 1604 C CA  . SER A 1 208 ? 32.712  44.847 20.121 1.00 82.45  ? 208 SER L CA  1 
ATOM 1605 C C   . SER A 1 208 ? 34.065  45.494 20.343 1.00 82.45  ? 208 SER L C   1 
ATOM 1606 O O   . SER A 1 208 ? 34.173  46.704 20.498 1.00 82.45  ? 208 SER L O   1 
ATOM 1607 C CB  . SER A 1 208 ? 32.899  43.520 19.403 1.00 77.60  ? 208 SER L CB  1 
ATOM 1608 O OG  . SER A 1 208 ? 33.216  43.755 18.037 1.00 77.60  ? 208 SER L OG  1 
ATOM 1609 N N   . PHE A 1 209 ? 35.091  44.656 20.386 1.00 100.00 ? 209 PHE L N   1 
ATOM 1610 C CA  . PHE A 1 209 ? 36.468  45.107 20.524 1.00 100.00 ? 209 PHE L CA  1 
ATOM 1611 C C   . PHE A 1 209 ? 37.408  44.033 21.083 1.00 100.00 ? 209 PHE L C   1 
ATOM 1612 O O   . PHE A 1 209 ? 37.135  43.407 22.111 1.00 100.00 ? 209 PHE L O   1 
ATOM 1613 C CB  . PHE A 1 209 ? 36.554  46.408 21.351 1.00 75.55  ? 209 PHE L CB  1 
ATOM 1614 C CG  . PHE A 1 209 ? 36.317  46.223 22.803 1.00 75.55  ? 209 PHE L CG  1 
ATOM 1615 C CD1 . PHE A 1 209 ? 35.258  45.460 23.260 1.00 75.55  ? 209 PHE L CD1 1 
ATOM 1616 C CD2 . PHE A 1 209 ? 37.154  46.828 23.727 1.00 75.55  ? 209 PHE L CD2 1 
ATOM 1617 C CE1 . PHE A 1 209 ? 35.033  45.298 24.626 1.00 75.55  ? 209 PHE L CE1 1 
ATOM 1618 C CE2 . PHE A 1 209 ? 36.936  46.672 25.094 1.00 75.55  ? 209 PHE L CE2 1 
ATOM 1619 C CZ  . PHE A 1 209 ? 35.870  45.903 25.545 1.00 75.55  ? 209 PHE L CZ  1 
ATOM 1620 N N   . ASN A 1 210 ? 38.507  43.818 20.357 1.00 92.72  ? 210 ASN L N   1 
ATOM 1621 C CA  . ASN A 1 210 ? 39.541  42.861 20.720 1.00 92.72  ? 210 ASN L CA  1 
ATOM 1622 C C   . ASN A 1 210 ? 40.364  43.534 21.794 1.00 92.72  ? 210 ASN L C   1 
ATOM 1623 O O   . ASN A 1 210 ? 41.568  43.328 21.892 1.00 92.72  ? 210 ASN L O   1 
ATOM 1624 C CB  . ASN A 1 210 ? 40.453  42.579 19.527 1.00 97.91  ? 210 ASN L CB  1 
ATOM 1625 C CG  . ASN A 1 210 ? 41.395  43.738 19.226 1.00 97.91  ? 210 ASN L CG  1 
ATOM 1626 O OD1 . ASN A 1 210 ? 40.961  44.861 18.962 1.00 97.91  ? 210 ASN L OD1 1 
ATOM 1627 N ND2 . ASN A 1 210 ? 42.697  43.465 19.273 1.00 97.91  ? 210 ASN L ND2 1 
ATOM 1628 N N   . ARG A 1 211 ? 39.697  44.349 22.594 1.00 55.34  ? 211 ARG L N   1 
ATOM 1629 C CA  . ARG A 1 211 ? 40.351  45.090 23.646 1.00 55.34  ? 211 ARG L CA  1 
ATOM 1630 C C   . ARG A 1 211 ? 41.148  46.167 22.937 1.00 55.34  ? 211 ARG L C   1 
ATOM 1631 O O   . ARG A 1 211 ? 40.581  47.154 22.446 1.00 55.34  ? 211 ARG L O   1 
ATOM 1632 C CB  . ARG A 1 211 ? 41.264  44.170 24.416 1.00 71.82  ? 211 ARG L CB  1 
ATOM 1633 C CG  . ARG A 1 211 ? 41.984  44.832 25.518 1.00 71.82  ? 211 ARG L CG  1 
ATOM 1634 C CD  . ARG A 1 211 ? 42.432  43.761 26.436 1.00 71.82  ? 211 ARG L CD  1 
ATOM 1635 N NE  . ARG A 1 211 ? 43.064  44.274 27.629 1.00 71.82  ? 211 ARG L NE  1 
ATOM 1636 C CZ  . ARG A 1 211 ? 43.388  43.490 28.636 1.00 71.82  ? 211 ARG L CZ  1 
ATOM 1637 N NH1 . ARG A 1 211 ? 43.110  42.199 28.530 1.00 71.82  ? 211 ARG L NH1 1 
ATOM 1638 N NH2 . ARG A 1 211 ? 44.006  43.976 29.710 1.00 71.82  ? 211 ARG L NH2 1 
ATOM 1639 N N   . GLY A 1 212 ? 42.462  45.960 22.864 1.00 100.00 ? 212 GLY L N   1 
ATOM 1640 C CA  . GLY A 1 212 ? 43.336  46.910 22.193 1.00 100.00 ? 212 GLY L CA  1 
ATOM 1641 C C   . GLY A 1 212 ? 44.516  47.378 23.027 1.00 100.00 ? 212 GLY L C   1 
ATOM 1642 O O   . GLY A 1 212 ? 44.985  48.512 22.873 1.00 100.00 ? 212 GLY L O   1 
ATOM 1643 N N   . GLU A 1 213 ? 45.003  46.529 23.921 1.00 87.22  ? 213 GLU L N   1 
ATOM 1644 C CA  . GLU A 1 213 ? 46.128  46.939 24.736 1.00 87.22  ? 213 GLU L CA  1 
ATOM 1645 C C   . GLU A 1 213 ? 46.954  45.755 25.211 1.00 87.22  ? 213 GLU L C   1 
ATOM 1646 O O   . GLU A 1 213 ? 47.122  44.758 24.502 1.00 87.22  ? 213 GLU L O   1 
ATOM 1647 C CB  . GLU A 1 213 ? 45.668  47.720 25.978 1.00 100.00 ? 213 GLU L CB  1 
ATOM 1648 C CG  . GLU A 1 213 ? 44.692  48.881 25.775 1.00 100.00 ? 213 GLU L CG  1 
ATOM 1649 C CD  . GLU A 1 213 ? 43.272  48.419 25.466 1.00 100.00 ? 213 GLU L CD  1 
ATOM 1650 O OE1 . GLU A 1 213 ? 42.805  47.467 26.128 1.00 100.00 ? 213 GLU L OE1 1 
ATOM 1651 O OE2 . GLU A 1 213 ? 42.615  49.024 24.583 1.00 100.00 ? 213 GLU L OE2 1 
ATOM 1652 N N   . CYS A 1 214 ? 47.458  45.906 26.437 1.00 100.00 ? 214 CYS L N   1 
ATOM 1653 C CA  . CYS A 1 214 ? 48.283  44.927 27.136 1.00 100.00 ? 214 CYS L CA  1 
ATOM 1654 C C   . CYS A 1 214 ? 47.589  43.562 27.266 1.00 100.00 ? 214 CYS L C   1 
ATOM 1655 O O   . CYS A 1 214 ? 48.036  42.609 26.596 1.00 100.00 ? 214 CYS L O   1 
ATOM 1656 C CB  . CYS A 1 214 ? 48.620  45.503 28.523 1.00 100.00 ? 214 CYS L CB  1 
ATOM 1657 S SG  . CYS A 1 214 ? 49.521  44.440 29.682 1.00 100.00 ? 214 CYS L SG  1 
ATOM 1658 O OXT . CYS A 1 214 ? 46.598  43.455 28.018 1.00 100.00 ? 214 CYS L OXT 1 
ATOM 1659 N N   . GLN B 2 1   ? 7.929   79.104 42.518 1.00 62.61  ? 1   GLN H N   1 
ATOM 1660 C CA  . GLN B 2 1   ? 6.897   79.705 43.426 1.00 62.61  ? 1   GLN H CA  1 
ATOM 1661 C C   . GLN B 2 1   ? 7.205   79.372 44.891 1.00 62.61  ? 1   GLN H C   1 
ATOM 1662 O O   . GLN B 2 1   ? 7.862   80.138 45.612 1.00 62.61  ? 1   GLN H O   1 
ATOM 1663 C CB  . GLN B 2 1   ? 5.522   79.118 43.088 1.00 100.00 ? 1   GLN H CB  1 
ATOM 1664 C CG  . GLN B 2 1   ? 4.342   79.998 43.419 1.00 100.00 ? 1   GLN H CG  1 
ATOM 1665 C CD  . GLN B 2 1   ? 4.180   81.089 42.389 1.00 100.00 ? 1   GLN H CD  1 
ATOM 1666 O OE1 . GLN B 2 1   ? 5.081   81.904 42.187 1.00 100.00 ? 1   GLN H OE1 1 
ATOM 1667 N NE2 . GLN B 2 1   ? 3.033   81.103 41.714 1.00 100.00 ? 1   GLN H NE2 1 
ATOM 1668 N N   . VAL B 2 2   ? 6.715   78.186 45.269 1.00 53.60  ? 2   VAL H N   1 
ATOM 1669 C CA  . VAL B 2 2   ? 6.801   77.592 46.599 1.00 53.60  ? 2   VAL H CA  1 
ATOM 1670 C C   . VAL B 2 2   ? 7.716   76.363 46.672 1.00 53.60  ? 2   VAL H C   1 
ATOM 1671 O O   . VAL B 2 2   ? 7.882   75.640 45.702 1.00 53.60  ? 2   VAL H O   1 
ATOM 1672 C CB  . VAL B 2 2   ? 5.429   77.119 47.046 1.00 55.12  ? 2   VAL H CB  1 
ATOM 1673 C CG1 . VAL B 2 2   ? 5.443   76.891 48.535 1.00 55.12  ? 2   VAL H CG1 1 
ATOM 1674 C CG2 . VAL B 2 2   ? 4.364   78.104 46.604 1.00 55.12  ? 2   VAL H CG2 1 
ATOM 1675 N N   . GLN B 2 3   ? 8.269   76.103 47.849 1.00 98.35  ? 3   GLN H N   1 
ATOM 1676 C CA  . GLN B 2 3   ? 9.180   74.978 48.013 1.00 98.35  ? 3   GLN H CA  1 
ATOM 1677 C C   . GLN B 2 3   ? 8.849   74.050 49.195 1.00 98.35  ? 3   GLN H C   1 
ATOM 1678 O O   . GLN B 2 3   ? 8.515   74.512 50.289 1.00 98.35  ? 3   GLN H O   1 
ATOM 1679 C CB  . GLN B 2 3   ? 10.629  75.505 48.168 1.00 70.02  ? 3   GLN H CB  1 
ATOM 1680 C CG  . GLN B 2 3   ? 11.242  76.250 46.941 1.00 70.02  ? 3   GLN H CG  1 
ATOM 1681 C CD  . GLN B 2 3   ? 11.786  75.323 45.817 1.00 70.02  ? 3   GLN H CD  1 
ATOM 1682 O OE1 . GLN B 2 3   ? 12.772  74.596 46.013 1.00 70.02  ? 3   GLN H OE1 1 
ATOM 1683 N NE2 . GLN B 2 3   ? 11.146  75.364 44.640 1.00 70.02  ? 3   GLN H NE2 1 
ATOM 1684 N N   . LEU B 2 4   ? 8.928   72.740 48.945 1.00 64.77  ? 4   LEU H N   1 
ATOM 1685 C CA  . LEU B 2 4   ? 8.730   71.711 49.964 1.00 64.77  ? 4   LEU H CA  1 
ATOM 1686 C C   . LEU B 2 4   ? 9.775   70.639 49.723 1.00 64.77  ? 4   LEU H C   1 
ATOM 1687 O O   . LEU B 2 4   ? 9.560   69.748 48.900 1.00 64.77  ? 4   LEU H O   1 
ATOM 1688 C CB  . LEU B 2 4   ? 7.373   71.038 49.879 1.00 53.87  ? 4   LEU H CB  1 
ATOM 1689 C CG  . LEU B 2 4   ? 6.118   71.881 49.891 1.00 53.87  ? 4   LEU H CG  1 
ATOM 1690 C CD1 . LEU B 2 4   ? 5.834   72.317 48.469 1.00 53.87  ? 4   LEU H CD1 1 
ATOM 1691 C CD2 . LEU B 2 4   ? 4.956   71.074 50.414 1.00 53.87  ? 4   LEU H CD2 1 
ATOM 1692 N N   . GLN B 2 5   ? 10.913  70.747 50.410 1.00 27.88  ? 5   GLN H N   1 
ATOM 1693 C CA  . GLN B 2 5   ? 11.974  69.766 50.296 1.00 27.88  ? 5   GLN H CA  1 
ATOM 1694 C C   . GLN B 2 5   ? 11.914  68.966 51.607 1.00 27.88  ? 5   GLN H C   1 
ATOM 1695 O O   . GLN B 2 5   ? 11.722  69.547 52.683 1.00 27.88  ? 5   GLN H O   1 
ATOM 1696 C CB  . GLN B 2 5   ? 13.343  70.433 50.161 1.00 63.98  ? 5   GLN H CB  1 
ATOM 1697 C CG  . GLN B 2 5   ? 13.787  71.134 51.436 1.00 63.98  ? 5   GLN H CG  1 
ATOM 1698 C CD  . GLN B 2 5   ? 15.227  71.630 51.397 1.00 63.98  ? 5   GLN H CD  1 
ATOM 1699 O OE1 . GLN B 2 5   ? 15.608  72.387 50.502 1.00 63.98  ? 5   GLN H OE1 1 
ATOM 1700 N NE2 . GLN B 2 5   ? 16.030  71.216 52.384 1.00 63.98  ? 5   GLN H NE2 1 
ATOM 1701 N N   . GLU B 2 6   ? 12.030  67.635 51.491 1.00 57.50  ? 6   GLU H N   1 
ATOM 1702 C CA  . GLU B 2 6   ? 12.045  66.708 52.625 1.00 57.50  ? 6   GLU H CA  1 
ATOM 1703 C C   . GLU B 2 6   ? 13.470  66.633 53.183 1.00 57.50  ? 6   GLU H C   1 
ATOM 1704 O O   . GLU B 2 6   ? 14.313  67.458 52.884 1.00 57.50  ? 6   GLU H O   1 
ATOM 1705 C CB  . GLU B 2 6   ? 11.634  65.300 52.195 1.00 42.58  ? 6   GLU H CB  1 
ATOM 1706 C CG  . GLU B 2 6   ? 10.163  64.941 52.295 1.00 42.58  ? 6   GLU H CG  1 
ATOM 1707 C CD  . GLU B 2 6   ? 9.273   65.532 51.206 1.00 42.58  ? 6   GLU H CD  1 
ATOM 1708 O OE1 . GLU B 2 6   ? 9.676   65.554 50.027 1.00 42.58  ? 6   GLU H OE1 1 
ATOM 1709 O OE2 . GLU B 2 6   ? 8.132   65.931 51.508 1.00 42.58  ? 6   GLU H OE2 1 
ATOM 1710 N N   . SER B 2 7   ? 13.741  65.621 53.986 1.00 24.49  ? 7   SER H N   1 
ATOM 1711 C CA  . SER B 2 7   ? 15.049  65.444 54.576 1.00 24.49  ? 7   SER H CA  1 
ATOM 1712 C C   . SER B 2 7   ? 14.922  64.306 55.571 1.00 24.49  ? 7   SER H C   1 
ATOM 1713 O O   . SER B 2 7   ? 13.817  63.877 55.883 1.00 24.49  ? 7   SER H O   1 
ATOM 1714 C CB  . SER B 2 7   ? 15.477  66.710 55.309 1.00 74.03  ? 7   SER H CB  1 
ATOM 1715 O OG  . SER B 2 7   ? 16.642  66.487 56.087 1.00 74.03  ? 7   SER H OG  1 
ATOM 1716 N N   . GLY B 2 8   ? 16.050  63.802 56.066 1.00 77.97  ? 8   GLY H N   1 
ATOM 1717 C CA  . GLY B 2 8   ? 15.994  62.717 57.034 1.00 77.97  ? 8   GLY H CA  1 
ATOM 1718 C C   . GLY B 2 8   ? 16.944  61.572 56.762 1.00 77.97  ? 8   GLY H C   1 
ATOM 1719 O O   . GLY B 2 8   ? 17.557  61.527 55.698 1.00 77.97  ? 8   GLY H O   1 
ATOM 1720 N N   . PRO B 2 9   ? 17.096  60.642 57.720 1.00 52.50  ? 9   PRO H N   1 
ATOM 1721 C CA  . PRO B 2 9   ? 17.963  59.471 57.636 1.00 52.50  ? 9   PRO H CA  1 
ATOM 1722 C C   . PRO B 2 9   ? 17.481  58.654 56.479 1.00 52.50  ? 9   PRO H C   1 
ATOM 1723 O O   . PRO B 2 9   ? 16.281  58.482 56.323 1.00 52.50  ? 9   PRO H O   1 
ATOM 1724 C CB  . PRO B 2 9   ? 17.733  58.787 58.977 1.00 92.26  ? 9   PRO H CB  1 
ATOM 1725 C CG  . PRO B 2 9   ? 17.430  59.962 59.893 1.00 92.26  ? 9   PRO H CG  1 
ATOM 1726 C CD  . PRO B 2 9   ? 16.412  60.649 59.019 1.00 92.26  ? 9   PRO H CD  1 
ATOM 1727 N N   . GLY B 2 10  ? 18.419  58.154 55.684 1.00 16.98  ? 10  GLY H N   1 
ATOM 1728 C CA  . GLY B 2 10  ? 18.063  57.403 54.496 1.00 16.98  ? 10  GLY H CA  1 
ATOM 1729 C C   . GLY B 2 10  ? 17.852  55.920 54.709 1.00 16.98  ? 10  GLY H C   1 
ATOM 1730 O O   . GLY B 2 10  ? 17.023  55.311 54.004 1.00 16.98  ? 10  GLY H O   1 
ATOM 1731 N N   . LEU B 2 11  ? 18.618  55.342 55.647 1.00 39.28  ? 11  LEU H N   1 
ATOM 1732 C CA  . LEU B 2 11  ? 18.535  53.921 56.009 1.00 39.28  ? 11  LEU H CA  1 
ATOM 1733 C C   . LEU B 2 11  ? 18.257  53.950 57.510 1.00 39.28  ? 11  LEU H C   1 
ATOM 1734 O O   . LEU B 2 11  ? 18.801  54.805 58.204 1.00 39.28  ? 11  LEU H O   1 
ATOM 1735 C CB  . LEU B 2 11  ? 19.883  53.200 55.764 1.00 36.88  ? 11  LEU H CB  1 
ATOM 1736 C CG  . LEU B 2 11  ? 20.051  51.677 56.083 1.00 36.88  ? 11  LEU H CG  1 
ATOM 1737 C CD1 . LEU B 2 11  ? 21.503  51.288 55.893 1.00 36.88  ? 11  LEU H CD1 1 
ATOM 1738 C CD2 . LEU B 2 11  ? 19.669  51.316 57.548 1.00 36.88  ? 11  LEU H CD2 1 
ATOM 1739 N N   . VAL B 2 12  ? 17.421  53.043 58.021 1.00 64.21  ? 12  VAL H N   1 
ATOM 1740 C CA  . VAL B 2 12  ? 17.141  53.003 59.466 1.00 64.21  ? 12  VAL H CA  1 
ATOM 1741 C C   . VAL B 2 12  ? 17.057  51.587 60.044 1.00 64.21  ? 12  VAL H C   1 
ATOM 1742 O O   . VAL B 2 12  ? 16.326  50.740 59.524 1.00 64.21  ? 12  VAL H O   1 
ATOM 1743 C CB  . VAL B 2 12  ? 15.828  53.766 59.845 1.00 38.29  ? 12  VAL H CB  1 
ATOM 1744 C CG1 . VAL B 2 12  ? 16.178  55.057 60.561 1.00 38.29  ? 12  VAL H CG1 1 
ATOM 1745 C CG2 . VAL B 2 12  ? 15.004  54.053 58.617 1.00 38.29  ? 12  VAL H CG2 1 
ATOM 1746 N N   . ARG B 2 13  ? 17.803  51.352 61.130 1.00 44.49  ? 13  ARG H N   1 
ATOM 1747 C CA  . ARG B 2 13  ? 17.840  50.049 61.802 1.00 44.49  ? 13  ARG H CA  1 
ATOM 1748 C C   . ARG B 2 13  ? 16.474  49.640 62.311 1.00 44.49  ? 13  ARG H C   1 
ATOM 1749 O O   . ARG B 2 13  ? 15.789  50.431 62.932 1.00 44.49  ? 13  ARG H O   1 
ATOM 1750 C CB  . ARG B 2 13  ? 18.792  50.065 63.006 1.00 97.91  ? 13  ARG H CB  1 
ATOM 1751 C CG  . ARG B 2 13  ? 20.218  50.414 62.698 1.00 97.91  ? 13  ARG H CG  1 
ATOM 1752 C CD  . ARG B 2 13  ? 21.150  49.725 63.676 1.00 97.91  ? 13  ARG H CD  1 
ATOM 1753 N NE  . ARG B 2 13  ? 20.917  50.082 65.077 1.00 97.91  ? 13  ARG H NE  1 
ATOM 1754 C CZ  . ARG B 2 13  ? 21.148  51.285 65.606 1.00 97.91  ? 13  ARG H CZ  1 
ATOM 1755 N NH1 . ARG B 2 13  ? 21.625  52.273 64.853 1.00 97.91  ? 13  ARG H NH1 1 
ATOM 1756 N NH2 . ARG B 2 13  ? 20.921  51.498 66.898 1.00 97.91  ? 13  ARG H NH2 1 
ATOM 1757 N N   . PRO B 2 14  ? 16.036  48.409 62.043 1.00 29.07  ? 14  PRO H N   1 
ATOM 1758 C CA  . PRO B 2 14  ? 14.720  48.092 62.586 1.00 29.07  ? 14  PRO H CA  1 
ATOM 1759 C C   . PRO B 2 14  ? 14.751  48.448 64.067 1.00 29.07  ? 14  PRO H C   1 
ATOM 1760 O O   . PRO B 2 14  ? 15.814  48.699 64.610 1.00 29.07  ? 14  PRO H O   1 
ATOM 1761 C CB  . PRO B 2 14  ? 14.622  46.601 62.333 1.00 55.03  ? 14  PRO H CB  1 
ATOM 1762 C CG  . PRO B 2 14  ? 15.280  46.497 61.008 1.00 55.03  ? 14  PRO H CG  1 
ATOM 1763 C CD  . PRO B 2 14  ? 16.561  47.259 61.300 1.00 55.03  ? 14  PRO H CD  1 
ATOM 1764 N N   . SER B 2 15  ? 13.593  48.501 64.709 1.00 52.84  ? 15  SER H N   1 
ATOM 1765 C CA  . SER B 2 15  ? 13.519  48.836 66.124 1.00 52.84  ? 15  SER H CA  1 
ATOM 1766 C C   . SER B 2 15  ? 13.789  50.318 66.418 1.00 52.84  ? 15  SER H C   1 
ATOM 1767 O O   . SER B 2 15  ? 13.154  50.885 67.310 1.00 52.84  ? 15  SER H O   1 
ATOM 1768 C CB  . SER B 2 15  ? 14.481  47.957 66.921 1.00 65.31  ? 15  SER H CB  1 
ATOM 1769 O OG  . SER B 2 15  ? 14.371  48.203 68.309 1.00 65.31  ? 15  SER H OG  1 
ATOM 1770 N N   . GLN B 2 16  ? 14.711  50.948 65.684 1.00 49.89  ? 16  GLN H N   1 
ATOM 1771 C CA  . GLN B 2 16  ? 15.013  52.370 65.896 1.00 49.89  ? 16  GLN H CA  1 
ATOM 1772 C C   . GLN B 2 16  ? 13.846  53.190 65.407 1.00 49.89  ? 16  GLN H C   1 
ATOM 1773 O O   . GLN B 2 16  ? 12.825  52.621 65.055 1.00 49.89  ? 16  GLN H O   1 
ATOM 1774 C CB  . GLN B 2 16  ? 16.272  52.786 65.153 1.00 100.00 ? 16  GLN H CB  1 
ATOM 1775 C CG  . GLN B 2 16  ? 17.495  52.005 65.574 1.00 100.00 ? 16  GLN H CG  1 
ATOM 1776 C CD  . GLN B 2 16  ? 17.664  51.980 67.081 1.00 100.00 ? 16  GLN H CD  1 
ATOM 1777 O OE1 . GLN B 2 16  ? 17.639  53.033 67.732 1.00 100.00 ? 16  GLN H OE1 1 
ATOM 1778 N NE2 . GLN B 2 16  ? 17.845  50.777 67.646 1.00 100.00 ? 16  GLN H NE2 1 
ATOM 1779 N N   . THR B 2 17  ? 13.973  54.517 65.361 1.00 47.40  ? 17  THR H N   1 
ATOM 1780 C CA  . THR B 2 17  ? 12.833  55.353 64.927 1.00 47.40  ? 17  THR H CA  1 
ATOM 1781 C C   . THR B 2 17  ? 13.001  56.274 63.722 1.00 47.40  ? 17  THR H C   1 
ATOM 1782 O O   . THR B 2 17  ? 13.974  57.028 63.634 1.00 47.40  ? 17  THR H O   1 
ATOM 1783 C CB  . THR B 2 17  ? 12.369  56.252 66.042 1.00 36.59  ? 17  THR H CB  1 
ATOM 1784 O OG1 . THR B 2 17  ? 12.131  55.487 67.222 1.00 36.59  ? 17  THR H OG1 1 
ATOM 1785 C CG2 . THR B 2 17  ? 11.095  56.917 65.646 1.00 36.59  ? 17  THR H CG2 1 
ATOM 1786 N N   . LEU B 2 18  ? 12.026  56.241 62.816 1.00 24.45  ? 18  LEU H N   1 
ATOM 1787 C CA  . LEU B 2 18  ? 12.062  57.093 61.620 1.00 24.45  ? 18  LEU H CA  1 
ATOM 1788 C C   . LEU B 2 18  ? 11.829  58.570 61.942 1.00 24.45  ? 18  LEU H C   1 
ATOM 1789 O O   . LEU B 2 18  ? 10.938  58.939 62.718 1.00 24.45  ? 18  LEU H O   1 
ATOM 1790 C CB  . LEU B 2 18  ? 11.025  56.673 60.592 1.00 27.05  ? 18  LEU H CB  1 
ATOM 1791 C CG  . LEU B 2 18  ? 11.653  56.661 59.200 1.00 27.05  ? 18  LEU H CG  1 
ATOM 1792 C CD1 . LEU B 2 18  ? 10.562  56.399 58.164 1.00 27.05  ? 18  LEU H CD1 1 
ATOM 1793 C CD2 . LEU B 2 18  ? 12.380  57.941 58.897 1.00 27.05  ? 18  LEU H CD2 1 
ATOM 1794 N N   . SER B 2 19  ? 12.629  59.402 61.289 1.00 38.63  ? 19  SER H N   1 
ATOM 1795 C CA  . SER B 2 19  ? 12.625  60.833 61.481 1.00 38.63  ? 19  SER H CA  1 
ATOM 1796 C C   . SER B 2 19  ? 12.824  61.620 60.176 1.00 38.63  ? 19  SER H C   1 
ATOM 1797 O O   . SER B 2 19  ? 13.848  61.479 59.525 1.00 38.63  ? 19  SER H O   1 
ATOM 1798 C CB  . SER B 2 19  ? 13.744  61.155 62.456 1.00 30.92  ? 19  SER H CB  1 
ATOM 1799 O OG  . SER B 2 19  ? 14.150  62.492 62.294 1.00 30.92  ? 19  SER H OG  1 
ATOM 1800 N N   . LEU B 2 20  ? 11.846  62.447 59.799 1.00 37.58  ? 20  LEU H N   1 
ATOM 1801 C CA  . LEU B 2 20  ? 11.928  63.270 58.581 1.00 37.58  ? 20  LEU H CA  1 
ATOM 1802 C C   . LEU B 2 20  ? 11.442  64.705 58.767 1.00 37.58  ? 20  LEU H C   1 
ATOM 1803 O O   . LEU B 2 20  ? 10.580  64.986 59.587 1.00 37.58  ? 20  LEU H O   1 
ATOM 1804 C CB  . LEU B 2 20  ? 11.130  62.662 57.426 1.00 45.73  ? 20  LEU H CB  1 
ATOM 1805 C CG  . LEU B 2 20  ? 11.643  61.388 56.799 1.00 45.73  ? 20  LEU H CG  1 
ATOM 1806 C CD1 . LEU B 2 20  ? 11.265  60.281 57.674 1.00 45.73  ? 20  LEU H CD1 1 
ATOM 1807 C CD2 . LEU B 2 20  ? 11.026  61.179 55.458 1.00 45.73  ? 20  LEU H CD2 1 
ATOM 1808 N N   . THR B 2 21  ? 11.999  65.607 57.976 1.00 63.62  ? 21  THR H N   1 
ATOM 1809 C CA  . THR B 2 21  ? 11.617  66.995 58.044 1.00 63.62  ? 21  THR H CA  1 
ATOM 1810 C C   . THR B 2 21  ? 11.242  67.571 56.689 1.00 63.62  ? 21  THR H C   1 
ATOM 1811 O O   . THR B 2 21  ? 11.956  67.417 55.703 1.00 63.62  ? 21  THR H O   1 
ATOM 1812 C CB  . THR B 2 21  ? 12.740  67.845 58.680 1.00 35.33  ? 21  THR H CB  1 
ATOM 1813 O OG1 . THR B 2 21  ? 12.756  67.624 60.099 1.00 35.33  ? 21  THR H OG1 1 
ATOM 1814 C CG2 . THR B 2 21  ? 12.527  69.325 58.412 1.00 35.33  ? 21  THR H CG2 1 
ATOM 1815 N N   . CYS B 2 22  ? 10.085  68.220 56.664 1.00 33.22  ? 22  CYS H N   1 
ATOM 1816 C CA  . CYS B 2 22  ? 9.549   68.885 55.482 1.00 33.22  ? 22  CYS H CA  1 
ATOM 1817 C C   . CYS B 2 22  ? 9.981   70.323 55.731 1.00 33.22  ? 22  CYS H C   1 
ATOM 1818 O O   . CYS B 2 22  ? 9.453   70.977 56.603 1.00 33.22  ? 22  CYS H O   1 
ATOM 1819 C CB  . CYS B 2 22  ? 8.019   68.780 55.511 1.00 36.92  ? 22  CYS H CB  1 
ATOM 1820 S SG  . CYS B 2 22  ? 7.026   69.389 54.116 1.00 36.92  ? 22  CYS H SG  1 
ATOM 1821 N N   . THR B 2 23  ? 10.983  70.802 55.029 1.00 26.06  ? 23  THR H N   1 
ATOM 1822 C CA  . THR B 2 23  ? 11.389  72.179 55.239 1.00 26.06  ? 23  THR H CA  1 
ATOM 1823 C C   . THR B 2 23  ? 10.532  72.952 54.259 1.00 26.06  ? 23  THR H C   1 
ATOM 1824 O O   . THR B 2 23  ? 10.604  72.686 53.069 1.00 26.06  ? 23  THR H O   1 
ATOM 1825 C CB  . THR B 2 23  ? 12.905  72.382 54.930 1.00 42.24  ? 23  THR H CB  1 
ATOM 1826 O OG1 . THR B 2 23  ? 13.675  72.096 56.105 1.00 42.24  ? 23  THR H OG1 1 
ATOM 1827 C CG2 . THR B 2 23  ? 13.197  73.799 54.448 1.00 42.24  ? 23  THR H CG2 1 
ATOM 1828 N N   . VAL B 2 24  ? 9.706   73.881 54.739 1.00 71.99  ? 24  VAL H N   1 
ATOM 1829 C CA  . VAL B 2 24  ? 8.834   74.640 53.846 1.00 71.99  ? 24  VAL H CA  1 
ATOM 1830 C C   . VAL B 2 24  ? 9.302   76.068 53.635 1.00 71.99  ? 24  VAL H C   1 
ATOM 1831 O O   . VAL B 2 24  ? 10.074  76.582 54.442 1.00 71.99  ? 24  VAL H O   1 
ATOM 1832 C CB  . VAL B 2 24  ? 7.385   74.667 54.370 1.00 27.96  ? 24  VAL H CB  1 
ATOM 1833 C CG1 . VAL B 2 24  ? 6.590   75.679 53.619 1.00 27.96  ? 24  VAL H CG1 1 
ATOM 1834 C CG2 . VAL B 2 24  ? 6.723   73.364 54.125 1.00 27.96  ? 24  VAL H CG2 1 
ATOM 1835 N N   . SER B 2 25  ? 8.841   76.694 52.545 1.00 50.66  ? 25  SER H N   1 
ATOM 1836 C CA  . SER B 2 25  ? 9.183   78.080 52.211 1.00 50.66  ? 25  SER H CA  1 
ATOM 1837 C C   . SER B 2 25  ? 8.340   78.574 51.038 1.00 50.66  ? 25  SER H C   1 
ATOM 1838 O O   . SER B 2 25  ? 8.492   78.089 49.926 1.00 50.66  ? 25  SER H O   1 
ATOM 1839 C CB  . SER B 2 25  ? 10.660  78.203 51.831 1.00 75.04  ? 25  SER H CB  1 
ATOM 1840 O OG  . SER B 2 25  ? 10.902  77.595 50.576 1.00 75.04  ? 25  SER H OG  1 
ATOM 1841 N N   . GLY B 2 26  ? 7.470   79.551 51.283 1.00 65.23  ? 26  GLY H N   1 
ATOM 1842 C CA  . GLY B 2 26  ? 6.622   80.070 50.224 1.00 65.23  ? 26  GLY H CA  1 
ATOM 1843 C C   . GLY B 2 26  ? 5.165   80.153 50.655 1.00 65.23  ? 26  GLY H C   1 
ATOM 1844 O O   . GLY B 2 26  ? 4.304   80.597 49.892 1.00 65.23  ? 26  GLY H O   1 
ATOM 1845 N N   . PHE B 2 27  ? 4.893   79.716 51.884 1.00 54.23  ? 27  PHE H N   1 
ATOM 1846 C CA  . PHE B 2 27  ? 3.554   79.750 52.455 1.00 54.23  ? 27  PHE H CA  1 
ATOM 1847 C C   . PHE B 2 27  ? 3.656   79.533 53.967 1.00 54.23  ? 27  PHE H C   1 
ATOM 1848 O O   . PHE B 2 27  ? 4.754   79.583 54.511 1.00 54.23  ? 27  PHE H O   1 
ATOM 1849 C CB  . PHE B 2 27  ? 2.662   78.695 51.783 1.00 42.13  ? 27  PHE H CB  1 
ATOM 1850 C CG  . PHE B 2 27  ? 3.009   77.258 52.109 1.00 42.13  ? 27  PHE H CG  1 
ATOM 1851 C CD1 . PHE B 2 27  ? 2.601   76.675 53.290 1.00 42.13  ? 27  PHE H CD1 1 
ATOM 1852 C CD2 . PHE B 2 27  ? 3.707   76.478 51.204 1.00 42.13  ? 27  PHE H CD2 1 
ATOM 1853 C CE1 . PHE B 2 27  ? 2.885   75.346 53.552 1.00 42.13  ? 27  PHE H CE1 1 
ATOM 1854 C CE2 . PHE B 2 27  ? 3.991   75.145 51.466 1.00 42.13  ? 27  PHE H CE2 1 
ATOM 1855 C CZ  . PHE B 2 27  ? 3.583   74.584 52.631 1.00 42.13  ? 27  PHE H CZ  1 
ATOM 1856 N N   . THR B 2 28  ? 2.530   79.324 54.646 1.00 100.00 ? 28  THR H N   1 
ATOM 1857 C CA  . THR B 2 28  ? 2.529   79.106 56.097 1.00 100.00 ? 28  THR H CA  1 
ATOM 1858 C C   . THR B 2 28  ? 1.571   78.045 56.569 1.00 100.00 ? 28  THR H C   1 
ATOM 1859 O O   . THR B 2 28  ? 0.533   77.812 55.953 1.00 100.00 ? 28  THR H O   1 
ATOM 1860 C CB  . THR B 2 28  ? 2.109   80.331 56.891 1.00 66.70  ? 28  THR H CB  1 
ATOM 1861 O OG1 . THR B 2 28  ? 1.229   81.126 56.086 1.00 66.70  ? 28  THR H OG1 1 
ATOM 1862 C CG2 . THR B 2 28  ? 3.321   81.093 57.414 1.00 66.70  ? 28  THR H CG2 1 
ATOM 1863 N N   . PHE B 2 29  ? 1.895   77.423 57.694 1.00 63.34  ? 29  PHE H N   1 
ATOM 1864 C CA  . PHE B 2 29  ? 1.013   76.421 58.219 1.00 63.34  ? 29  PHE H CA  1 
ATOM 1865 C C   . PHE B 2 29  ? -0.233  77.125 58.706 1.00 63.34  ? 29  PHE H C   1 
ATOM 1866 O O   . PHE B 2 29  ? -1.295  76.536 58.705 1.00 63.34  ? 29  PHE H O   1 
ATOM 1867 C CB  . PHE B 2 29  ? 1.699   75.653 59.336 1.00 99.80  ? 29  PHE H CB  1 
ATOM 1868 C CG  . PHE B 2 29  ? 2.974   75.019 58.902 1.00 99.80  ? 29  PHE H CG  1 
ATOM 1869 C CD1 . PHE B 2 29  ? 3.037   74.358 57.673 1.00 99.80  ? 29  PHE H CD1 1 
ATOM 1870 C CD2 . PHE B 2 29  ? 4.114   75.104 59.680 1.00 99.80  ? 29  PHE H CD2 1 
ATOM 1871 C CE1 . PHE B 2 29  ? 4.204   73.804 57.230 1.00 99.80  ? 29  PHE H CE1 1 
ATOM 1872 C CE2 . PHE B 2 29  ? 5.290   74.547 59.238 1.00 99.80  ? 29  PHE H CE2 1 
ATOM 1873 C CZ  . PHE B 2 29  ? 5.328   73.896 58.002 1.00 99.80  ? 29  PHE H CZ  1 
ATOM 1874 N N   . THR B 2 30  ? -0.102  78.393 59.090 1.00 36.46  ? 30  THR H N   1 
ATOM 1875 C CA  . THR B 2 30  ? -1.239  79.194 59.542 1.00 36.46  ? 30  THR H CA  1 
ATOM 1876 C C   . THR B 2 30  ? -2.403  79.327 58.555 1.00 36.46  ? 30  THR H C   1 
ATOM 1877 O O   . THR B 2 30  ? -3.401  79.939 58.876 1.00 36.46  ? 30  THR H O   1 
ATOM 1878 C CB  . THR B 2 30  ? -0.816  80.633 59.998 1.00 58.33  ? 30  THR H CB  1 
ATOM 1879 O OG1 . THR B 2 30  ? -2.003  81.415 60.258 1.00 58.33  ? 30  THR H OG1 1 
ATOM 1880 C CG2 . THR B 2 30  ? 0.058   81.348 58.945 1.00 58.33  ? 30  THR H CG2 1 
ATOM 1881 N N   . ASP B 2 31  ? -2.310  78.749 57.371 1.00 63.61  ? 31  ASP H N   1 
ATOM 1882 C CA  . ASP B 2 31  ? -3.434  78.824 56.456 1.00 63.61  ? 31  ASP H CA  1 
ATOM 1883 C C   . ASP B 2 31  ? -3.370  77.554 55.617 1.00 63.61  ? 31  ASP H C   1 
ATOM 1884 O O   . ASP B 2 31  ? -3.874  77.513 54.511 1.00 63.61  ? 31  ASP H O   1 
ATOM 1885 C CB  . ASP B 2 31  ? -3.329  80.047 55.539 1.00 35.49  ? 31  ASP H CB  1 
ATOM 1886 C CG  . ASP B 2 31  ? -3.063  81.349 56.288 1.00 35.49  ? 31  ASP H CG  1 
ATOM 1887 O OD1 . ASP B 2 31  ? -1.868  81.630 56.472 1.00 35.49  ? 31  ASP H OD1 1 
ATOM 1888 O OD2 . ASP B 2 31  ? -3.998  82.094 56.692 1.00 35.49  ? 31  ASP H OD2 1 
ATOM 1889 N N   . PHE B 2 32  ? -2.773  76.503 56.162 1.00 35.55  ? 32  PHE H N   1 
ATOM 1890 C CA  . PHE B 2 32  ? -2.627  75.265 55.422 1.00 35.55  ? 32  PHE H CA  1 
ATOM 1891 C C   . PHE B 2 32  ? -2.370  73.979 56.183 1.00 35.55  ? 32  PHE H C   1 
ATOM 1892 O O   . PHE B 2 32  ? -1.429  73.894 56.994 1.00 35.55  ? 32  PHE H O   1 
ATOM 1893 C CB  . PHE B 2 32  ? -1.487  75.400 54.462 1.00 38.33  ? 32  PHE H CB  1 
ATOM 1894 C CG  . PHE B 2 32  ? -1.851  76.032 53.211 1.00 38.33  ? 32  PHE H CG  1 
ATOM 1895 C CD1 . PHE B 2 32  ? -2.788  75.450 52.395 1.00 38.33  ? 32  PHE H CD1 1 
ATOM 1896 C CD2 . PHE B 2 32  ? -1.241  77.191 52.824 1.00 38.33  ? 32  PHE H CD2 1 
ATOM 1897 C CE1 . PHE B 2 32  ? -3.116  76.012 51.201 1.00 38.33  ? 32  PHE H CE1 1 
ATOM 1898 C CE2 . PHE B 2 32  ? -1.560  77.762 51.643 1.00 38.33  ? 32  PHE H CE2 1 
ATOM 1899 C CZ  . PHE B 2 32  ? -2.506  77.170 50.817 1.00 38.33  ? 32  PHE H CZ  1 
ATOM 1900 N N   . TYR B 2 33  ? -3.170  72.956 55.885 1.00 43.75  ? 33  TYR H N   1 
ATOM 1901 C CA  . TYR B 2 33  ? -2.955  71.677 56.520 1.00 43.75  ? 33  TYR H CA  1 
ATOM 1902 C C   . TYR B 2 33  ? -1.769  70.983 55.847 1.00 43.75  ? 33  TYR H C   1 
ATOM 1903 O O   . TYR B 2 33  ? -1.706  70.855 54.614 1.00 43.75  ? 33  TYR H O   1 
ATOM 1904 C CB  . TYR B 2 33  ? -4.167  70.754 56.394 1.00 83.63  ? 33  TYR H CB  1 
ATOM 1905 C CG  . TYR B 2 33  ? -5.401  71.162 57.143 1.00 83.63  ? 33  TYR H CG  1 
ATOM 1906 C CD1 . TYR B 2 33  ? -5.323  71.832 58.354 1.00 83.63  ? 33  TYR H CD1 1 
ATOM 1907 C CD2 . TYR B 2 33  ? -6.660  70.820 56.665 1.00 83.63  ? 33  TYR H CD2 1 
ATOM 1908 C CE1 . TYR B 2 33  ? -6.470  72.150 59.063 1.00 83.63  ? 33  TYR H CE1 1 
ATOM 1909 C CE2 . TYR B 2 33  ? -7.808  71.133 57.368 1.00 83.63  ? 33  TYR H CE2 1 
ATOM 1910 C CZ  . TYR B 2 33  ? -7.703  71.796 58.561 1.00 83.63  ? 33  TYR H CZ  1 
ATOM 1911 O OH  . TYR B 2 33  ? -8.842  72.120 59.237 1.00 83.63  ? 33  TYR H OH  1 
ATOM 1912 N N   . MET B 2 34  ? -0.834  70.535 56.667 1.00 76.54  ? 34  MET H N   1 
ATOM 1913 C CA  . MET B 2 34  ? 0.312   69.809 56.171 1.00 76.54  ? 34  MET H CA  1 
ATOM 1914 C C   . MET B 2 34  ? 0.117   68.327 56.483 1.00 76.54  ? 34  MET H C   1 
ATOM 1915 O O   . MET B 2 34  ? 0.085   67.946 57.651 1.00 76.54  ? 34  MET H O   1 
ATOM 1916 C CB  . MET B 2 34  ? 1.608   70.257 56.865 1.00 53.44  ? 34  MET H CB  1 
ATOM 1917 C CG  . MET B 2 34  ? 2.157   71.617 56.515 1.00 53.44  ? 34  MET H CG  1 
ATOM 1918 S SD  . MET B 2 34  ? 2.446   71.854 54.792 1.00 53.44  ? 34  MET H SD  1 
ATOM 1919 C CE  . MET B 2 34  ? 3.522   70.583 54.390 1.00 53.44  ? 34  MET H CE  1 
ATOM 1920 N N   . ASN B 2 35  ? -0.030  67.493 55.460 1.00 15.55  ? 35  ASN H N   1 
ATOM 1921 C CA  . ASN B 2 35  ? -0.131  66.052 55.693 1.00 15.55  ? 35  ASN H CA  1 
ATOM 1922 C C   . ASN B 2 35  ? 1.033   65.396 54.998 1.00 15.55  ? 35  ASN H C   1 
ATOM 1923 O O   . ASN B 2 35  ? 1.679   66.059 54.225 1.00 15.55  ? 35  ASN H O   1 
ATOM 1924 C CB  . ASN B 2 35  ? -1.416  65.493 55.118 1.00 18.39  ? 35  ASN H CB  1 
ATOM 1925 C CG  . ASN B 2 35  ? -1.847  66.216 53.912 1.00 18.39  ? 35  ASN H CG  1 
ATOM 1926 O OD1 . ASN B 2 35  ? -1.086  66.432 52.969 1.00 18.39  ? 35  ASN H OD1 1 
ATOM 1927 N ND2 . ASN B 2 35  ? -3.081  66.603 53.918 1.00 18.39  ? 35  ASN H ND2 1 
ATOM 1928 N N   . TRP B 2 36  ? 1.299   64.118 55.284 1.00 21.09  ? 36  TRP H N   1 
ATOM 1929 C CA  . TRP B 2 36  ? 2.361   63.352 54.606 1.00 21.09  ? 36  TRP H CA  1 
ATOM 1930 C C   . TRP B 2 36  ? 1.808   62.254 53.684 1.00 21.09  ? 36  TRP H C   1 
ATOM 1931 O O   . TRP B 2 36  ? 0.615   62.000 53.640 1.00 21.09  ? 36  TRP H O   1 
ATOM 1932 C CB  . TRP B 2 36  ? 3.290   62.684 55.589 1.00 31.97  ? 36  TRP H CB  1 
ATOM 1933 C CG  . TRP B 2 36  ? 4.158   63.616 56.359 1.00 31.97  ? 36  TRP H CG  1 
ATOM 1934 C CD1 . TRP B 2 36  ? 3.823   64.338 57.485 1.00 31.97  ? 36  TRP H CD1 1 
ATOM 1935 C CD2 . TRP B 2 36  ? 5.549   63.845 56.140 1.00 31.97  ? 36  TRP H CD2 1 
ATOM 1936 N NE1 . TRP B 2 36  ? 4.941   64.988 57.982 1.00 31.97  ? 36  TRP H NE1 1 
ATOM 1937 C CE2 . TRP B 2 36  ? 6.007   64.699 57.172 1.00 31.97  ? 36  TRP H CE2 1 
ATOM 1938 C CE3 . TRP B 2 36  ? 6.452   63.410 55.179 1.00 31.97  ? 36  TRP H CE3 1 
ATOM 1939 C CZ2 . TRP B 2 36  ? 7.317   65.112 57.258 1.00 31.97  ? 36  TRP H CZ2 1 
ATOM 1940 C CZ3 . TRP B 2 36  ? 7.748   63.820 55.267 1.00 31.97  ? 36  TRP H CZ3 1 
ATOM 1941 C CH2 . TRP B 2 36  ? 8.175   64.662 56.297 1.00 31.97  ? 36  TRP H CH2 1 
ATOM 1942 N N   . VAL B 2 37  ? 2.669   61.598 52.931 1.00 41.40  ? 37  VAL H N   1 
ATOM 1943 C CA  . VAL B 2 37  ? 2.205   60.539 52.047 1.00 41.40  ? 37  VAL H CA  1 
ATOM 1944 C C   . VAL B 2 37  ? 3.370   59.601 51.885 1.00 41.40  ? 37  VAL H C   1 
ATOM 1945 O O   . VAL B 2 37  ? 4.500   60.058 51.793 1.00 41.40  ? 37  VAL H O   1 
ATOM 1946 C CB  . VAL B 2 37  ? 1.797   61.080 50.682 1.00 25.90  ? 37  VAL H CB  1 
ATOM 1947 C CG1 . VAL B 2 37  ? 1.464   59.956 49.777 1.00 25.90  ? 37  VAL H CG1 1 
ATOM 1948 C CG2 . VAL B 2 37  ? 0.574   61.944 50.808 1.00 25.90  ? 37  VAL H CG2 1 
ATOM 1949 N N   . ARG B 2 38  ? 3.110   58.296 51.855 1.00 18.02  ? 38  ARG H N   1 
ATOM 1950 C CA  . ARG B 2 38  ? 4.189   57.330 51.741 1.00 18.02  ? 38  ARG H CA  1 
ATOM 1951 C C   . ARG B 2 38  ? 3.879   56.405 50.620 1.00 18.02  ? 38  ARG H C   1 
ATOM 1952 O O   . ARG B 2 38  ? 2.729   56.155 50.368 1.00 18.02  ? 38  ARG H O   1 
ATOM 1953 C CB  . ARG B 2 38  ? 4.334   56.492 53.020 1.00 42.44  ? 38  ARG H CB  1 
ATOM 1954 C CG  . ARG B 2 38  ? 3.134   55.647 53.330 1.00 42.44  ? 38  ARG H CG  1 
ATOM 1955 C CD  . ARG B 2 38  ? 3.433   54.322 54.009 1.00 42.44  ? 38  ARG H CD  1 
ATOM 1956 N NE  . ARG B 2 38  ? 3.982   54.383 55.354 1.00 42.44  ? 38  ARG H NE  1 
ATOM 1957 C CZ  . ARG B 2 38  ? 3.793   53.422 56.263 1.00 42.44  ? 38  ARG H CZ  1 
ATOM 1958 N NH1 . ARG B 2 38  ? 3.072   52.347 55.973 1.00 42.44  ? 38  ARG H NH1 1 
ATOM 1959 N NH2 . ARG B 2 38  ? 4.343   53.515 57.461 1.00 42.44  ? 38  ARG H NH2 1 
ATOM 1960 N N   . GLN B 2 39  ? 4.910   55.888 49.966 1.00 23.92  ? 39  GLN H N   1 
ATOM 1961 C CA  . GLN B 2 39  ? 4.751   54.938 48.864 1.00 23.92  ? 39  GLN H CA  1 
ATOM 1962 C C   . GLN B 2 39  ? 5.884   53.860 48.838 1.00 23.92  ? 39  GLN H C   1 
ATOM 1963 O O   . GLN B 2 39  ? 7.012   54.162 48.442 1.00 23.92  ? 39  GLN H O   1 
ATOM 1964 C CB  . GLN B 2 39  ? 4.740   55.715 47.551 1.00 60.19  ? 39  GLN H CB  1 
ATOM 1965 C CG  . GLN B 2 39  ? 4.859   54.852 46.337 1.00 60.19  ? 39  GLN H CG  1 
ATOM 1966 C CD  . GLN B 2 39  ? 5.020   55.660 45.084 1.00 60.19  ? 39  GLN H CD  1 
ATOM 1967 O OE1 . GLN B 2 39  ? 4.110   56.358 44.669 1.00 60.19  ? 39  GLN H OE1 1 
ATOM 1968 N NE2 . GLN B 2 39  ? 6.197   55.580 44.476 1.00 60.19  ? 39  GLN H NE2 1 
ATOM 1969 N N   . PRO B 2 40  ? 5.629   52.615 49.308 1.00 37.43  ? 40  PRO H N   1 
ATOM 1970 C CA  . PRO B 2 40  ? 6.705   51.612 49.273 1.00 37.43  ? 40  PRO H CA  1 
ATOM 1971 C C   . PRO B 2 40  ? 7.157   51.343 47.846 1.00 37.43  ? 40  PRO H C   1 
ATOM 1972 O O   . PRO B 2 40  ? 6.451   51.710 46.898 1.00 37.43  ? 40  PRO H O   1 
ATOM 1973 C CB  . PRO B 2 40  ? 6.059   50.399 49.919 1.00 38.24  ? 40  PRO H CB  1 
ATOM 1974 C CG  . PRO B 2 40  ? 5.109   51.036 50.886 1.00 38.24  ? 40  PRO H CG  1 
ATOM 1975 C CD  . PRO B 2 40  ? 4.446   52.022 49.938 1.00 38.24  ? 40  PRO H CD  1 
ATOM 1976 N N   . PRO B 2 41  ? 8.314   50.667 47.673 1.00 43.27  ? 41  PRO H N   1 
ATOM 1977 C CA  . PRO B 2 41  ? 8.880   50.347 46.369 1.00 43.27  ? 41  PRO H CA  1 
ATOM 1978 C C   . PRO B 2 41  ? 7.833   49.900 45.366 1.00 43.27  ? 41  PRO H C   1 
ATOM 1979 O O   . PRO B 2 41  ? 7.089   48.954 45.619 1.00 43.27  ? 41  PRO H O   1 
ATOM 1980 C CB  . PRO B 2 41  ? 9.882   49.256 46.712 1.00 78.41  ? 41  PRO H CB  1 
ATOM 1981 C CG  . PRO B 2 41  ? 10.439  49.780 47.954 1.00 78.41  ? 41  PRO H CG  1 
ATOM 1982 C CD  . PRO B 2 41  ? 9.140   50.031 48.709 1.00 78.41  ? 41  PRO H CD  1 
ATOM 1983 N N   . GLY B 2 42  ? 7.777   50.601 44.240 1.00 87.44  ? 42  GLY H N   1 
ATOM 1984 C CA  . GLY B 2 42  ? 6.818   50.272 43.213 1.00 87.44  ? 42  GLY H CA  1 
ATOM 1985 C C   . GLY B 2 42  ? 5.420   49.935 43.721 1.00 87.44  ? 42  GLY H C   1 
ATOM 1986 O O   . GLY B 2 42  ? 4.925   48.819 43.531 1.00 87.44  ? 42  GLY H O   1 
ATOM 1987 N N   . ARG B 2 43  ? 4.766   50.887 44.370 1.00 100.00 ? 43  ARG H N   1 
ATOM 1988 C CA  . ARG B 2 43  ? 3.417   50.636 44.847 1.00 100.00 ? 43  ARG H CA  1 
ATOM 1989 C C   . ARG B 2 43  ? 2.508   51.847 44.759 1.00 100.00 ? 43  ARG H C   1 
ATOM 1990 O O   . ARG B 2 43  ? 2.651   52.676 43.860 1.00 100.00 ? 43  ARG H O   1 
ATOM 1991 C CB  . ARG B 2 43  ? 3.436   50.111 46.276 1.00 86.01  ? 43  ARG H CB  1 
ATOM 1992 C CG  . ARG B 2 43  ? 3.746   48.639 46.385 1.00 86.01  ? 43  ARG H CG  1 
ATOM 1993 C CD  . ARG B 2 43  ? 3.533   48.214 47.814 1.00 86.01  ? 43  ARG H CD  1 
ATOM 1994 N NE  . ARG B 2 43  ? 3.586   46.773 48.008 1.00 86.01  ? 43  ARG H NE  1 
ATOM 1995 C CZ  . ARG B 2 43  ? 3.464   46.191 49.197 1.00 86.01  ? 43  ARG H CZ  1 
ATOM 1996 N NH1 . ARG B 2 43  ? 3.283   46.930 50.292 1.00 86.01  ? 43  ARG H NH1 1 
ATOM 1997 N NH2 . ARG B 2 43  ? 3.516   44.866 49.294 1.00 86.01  ? 43  ARG H NH2 1 
ATOM 1998 N N   . GLY B 2 44  ? 1.560   51.930 45.686 1.00 42.77  ? 44  GLY H N   1 
ATOM 1999 C CA  . GLY B 2 44  ? 0.642   53.043 45.694 1.00 42.77  ? 44  GLY H CA  1 
ATOM 2000 C C   . GLY B 2 44  ? 0.706   53.839 46.975 1.00 42.77  ? 44  GLY H C   1 
ATOM 2001 O O   . GLY B 2 44  ? 0.835   53.307 48.056 1.00 42.77  ? 44  GLY H O   1 
ATOM 2002 N N   . LEU B 2 45  ? 0.623   55.142 46.833 1.00 36.66  ? 45  LEU H N   1 
ATOM 2003 C CA  . LEU B 2 45  ? 0.637   56.071 47.947 1.00 36.66  ? 45  LEU H CA  1 
ATOM 2004 C C   . LEU B 2 45  ? -0.312  55.563 49.062 1.00 36.66  ? 45  LEU H C   1 
ATOM 2005 O O   . LEU B 2 45  ? -1.220  54.786 48.783 1.00 36.66  ? 45  LEU H O   1 
ATOM 2006 C CB  . LEU B 2 45  ? 0.156   57.424 47.405 1.00 15.21  ? 45  LEU H CB  1 
ATOM 2007 C CG  . LEU B 2 45  ? 0.796   57.649 46.055 1.00 15.21  ? 45  LEU H CG  1 
ATOM 2008 C CD1 . LEU B 2 45  ? -0.120  58.349 45.117 1.00 15.21  ? 45  LEU H CD1 1 
ATOM 2009 C CD2 . LEU B 2 45  ? 2.071   58.341 46.280 1.00 15.21  ? 45  LEU H CD2 1 
ATOM 2010 N N   . GLU B 2 46  ? -0.071  55.989 50.306 1.00 40.23  ? 46  GLU H N   1 
ATOM 2011 C CA  . GLU B 2 46  ? -0.891  55.654 51.470 1.00 40.23  ? 46  GLU H CA  1 
ATOM 2012 C C   . GLU B 2 46  ? -0.824  56.869 52.348 1.00 40.23  ? 46  GLU H C   1 
ATOM 2013 O O   . GLU B 2 46  ? 0.247   57.250 52.793 1.00 40.23  ? 46  GLU H O   1 
ATOM 2014 C CB  . GLU B 2 46  ? -0.343  54.507 52.304 1.00 33.93  ? 46  GLU H CB  1 
ATOM 2015 C CG  . GLU B 2 46  ? -1.123  54.446 53.610 1.00 33.93  ? 46  GLU H CG  1 
ATOM 2016 C CD  . GLU B 2 46  ? -0.500  53.595 54.687 1.00 33.93  ? 46  GLU H CD  1 
ATOM 2017 O OE1 . GLU B 2 46  ? 0.701   53.743 54.930 1.00 33.93  ? 46  GLU H OE1 1 
ATOM 2018 O OE2 . GLU B 2 46  ? -1.208  52.803 55.331 1.00 33.93  ? 46  GLU H OE2 1 
ATOM 2019 N N   . TRP B 2 47  ? -1.972  57.459 52.631 1.00 37.17  ? 47  TRP H N   1 
ATOM 2020 C CA  . TRP B 2 47  ? -2.045  58.684 53.433 1.00 37.17  ? 47  TRP H CA  1 
ATOM 2021 C C   . TRP B 2 47  ? -1.682  58.367 54.879 1.00 37.17  ? 47  TRP H C   1 
ATOM 2022 O O   . TRP B 2 47  ? -2.334  57.532 55.458 1.00 37.17  ? 47  TRP H O   1 
ATOM 2023 C CB  . TRP B 2 47  ? -3.482  59.206 53.335 1.00 45.25  ? 47  TRP H CB  1 
ATOM 2024 C CG  . TRP B 2 47  ? -3.766  60.434 54.062 1.00 45.25  ? 47  TRP H CG  1 
ATOM 2025 C CD1 . TRP B 2 47  ? -3.378  61.675 53.716 1.00 45.25  ? 47  TRP H CD1 1 
ATOM 2026 C CD2 . TRP B 2 47  ? -4.519  60.567 55.291 1.00 45.25  ? 47  TRP H CD2 1 
ATOM 2027 N NE1 . TRP B 2 47  ? -3.833  62.590 54.643 1.00 45.25  ? 47  TRP H NE1 1 
ATOM 2028 C CE2 . TRP B 2 47  ? -4.535  61.931 55.619 1.00 45.25  ? 47  TRP H CE2 1 
ATOM 2029 C CE3 . TRP B 2 47  ? -5.178  59.664 56.142 1.00 45.25  ? 47  TRP H CE3 1 
ATOM 2030 C CZ2 . TRP B 2 47  ? -5.182  62.418 56.759 1.00 45.25  ? 47  TRP H CZ2 1 
ATOM 2031 C CZ3 . TRP B 2 47  ? -5.815  60.144 57.267 1.00 45.25  ? 47  TRP H CZ3 1 
ATOM 2032 C CH2 . TRP B 2 47  ? -5.812  61.507 57.567 1.00 45.25  ? 47  TRP H CH2 1 
ATOM 2033 N N   . ILE B 2 48  ? -0.652  58.969 55.472 1.00 56.62  ? 48  ILE H N   1 
ATOM 2034 C CA  . ILE B 2 48  ? -0.391  58.664 56.888 1.00 56.62  ? 48  ILE H CA  1 
ATOM 2035 C C   . ILE B 2 48  ? -1.336  59.474 57.775 1.00 56.62  ? 48  ILE H C   1 
ATOM 2036 O O   . ILE B 2 48  ? -1.872  58.961 58.759 1.00 56.62  ? 48  ILE H O   1 
ATOM 2037 C CB  . ILE B 2 48  ? 1.070   58.971 57.336 1.00 16.76  ? 48  ILE H CB  1 
ATOM 2038 C CG1 . ILE B 2 48  ? 2.028   57.941 56.727 1.00 16.76  ? 48  ILE H CG1 1 
ATOM 2039 C CG2 . ILE B 2 48  ? 1.192   58.913 58.854 1.00 16.76  ? 48  ILE H CG2 1 
ATOM 2040 C CD1 . ILE B 2 48  ? 3.498   58.088 57.142 1.00 16.76  ? 48  ILE H CD1 1 
ATOM 2041 N N   . GLY B 2 49  ? -1.542  60.735 57.400 1.00 85.39  ? 49  GLY H N   1 
ATOM 2042 C CA  . GLY B 2 49  ? -2.397  61.639 58.151 1.00 85.39  ? 49  GLY H CA  1 
ATOM 2043 C C   . GLY B 2 49  ? -1.917  63.064 57.937 1.00 85.39  ? 49  GLY H C   1 
ATOM 2044 O O   . GLY B 2 49  ? -1.056  63.291 57.099 1.00 85.39  ? 49  GLY H O   1 
ATOM 2045 N N   . PHE B 2 50  ? -2.459  64.027 58.673 1.00 36.27  ? 50  PHE H N   1 
ATOM 2046 C CA  . PHE B 2 50  ? -2.038  65.412 58.523 1.00 36.27  ? 50  PHE H CA  1 
ATOM 2047 C C   . PHE B 2 50  ? -2.015  66.122 59.832 1.00 36.27  ? 50  PHE H C   1 
ATOM 2048 O O   . PHE B 2 50  ? -2.121  65.508 60.897 1.00 36.27  ? 50  PHE H O   1 
ATOM 2049 C CB  . PHE B 2 50  ? -2.962  66.217 57.604 1.00 32.07  ? 50  PHE H CB  1 
ATOM 2050 C CG  . PHE B 2 50  ? -4.440  66.242 58.024 1.00 32.07  ? 50  PHE H CG  1 
ATOM 2051 C CD1 . PHE B 2 50  ? -4.828  66.261 59.373 1.00 32.07  ? 50  PHE H CD1 1 
ATOM 2052 C CD2 . PHE B 2 50  ? -5.447  66.337 57.048 1.00 32.07  ? 50  PHE H CD2 1 
ATOM 2053 C CE1 . PHE B 2 50  ? -6.173  66.374 59.740 1.00 32.07  ? 50  PHE H CE1 1 
ATOM 2054 C CE2 . PHE B 2 50  ? -6.778  66.454 57.404 1.00 32.07  ? 50  PHE H CE2 1 
ATOM 2055 C CZ  . PHE B 2 50  ? -7.140  66.472 58.754 1.00 32.07  ? 50  PHE H CZ  1 
ATOM 2056 N N   . ILE B 2 51  ? -1.879  67.441 59.731 1.00 17.77  ? 51  ILE H N   1 
ATOM 2057 C CA  . ILE B 2 51  ? -1.902  68.329 60.889 1.00 17.77  ? 51  ILE H CA  1 
ATOM 2058 C C   . ILE B 2 51  ? -2.647  69.633 60.523 1.00 17.77  ? 51  ILE H C   1 
ATOM 2059 O O   . ILE B 2 51  ? -2.567  70.127 59.397 1.00 17.77  ? 51  ILE H O   1 
ATOM 2060 C CB  . ILE B 2 51  ? -0.497  68.589 61.453 1.00 10.46  ? 51  ILE H CB  1 
ATOM 2061 C CG1 . ILE B 2 51  ? -0.655  69.504 62.641 1.00 10.46  ? 51  ILE H CG1 1 
ATOM 2062 C CG2 . ILE B 2 51  ? 0.444   69.094 60.413 1.00 10.46  ? 51  ILE H CG2 1 
ATOM 2063 C CD1 . ILE B 2 51  ? 0.619   69.894 63.247 1.00 10.46  ? 51  ILE H CD1 1 
ATOM 2064 N N   . ARG B 2 52  ? -3.405  70.186 61.462 1.00 67.40  ? 52  ARG H N   1 
ATOM 2065 C CA  . ARG B 2 52  ? -4.193  71.369 61.131 1.00 67.40  ? 52  ARG H CA  1 
ATOM 2066 C C   . ARG B 2 52  ? -3.606  72.734 61.462 1.00 67.40  ? 52  ARG H C   1 
ATOM 2067 O O   . ARG B 2 52  ? -2.842  72.878 62.408 1.00 67.40  ? 52  ARG H O   1 
ATOM 2068 C CB  . ARG B 2 52  ? -5.593  71.259 61.760 1.00 41.02  ? 52  ARG H CB  1 
ATOM 2069 C CG  . ARG B 2 52  ? -6.352  69.964 61.499 1.00 41.02  ? 52  ARG H CG  1 
ATOM 2070 C CD  . ARG B 2 52  ? -7.797  70.134 61.867 1.00 41.02  ? 52  ARG H CD  1 
ATOM 2071 N NE  . ARG B 2 52  ? -8.504  68.879 62.063 1.00 41.02  ? 52  ARG H NE  1 
ATOM 2072 C CZ  . ARG B 2 52  ? -8.153  67.982 62.975 1.00 41.02  ? 52  ARG H CZ  1 
ATOM 2073 N NH1 . ARG B 2 52  ? -7.112  68.208 63.752 1.00 41.02  ? 52  ARG H NH1 1 
ATOM 2074 N NH2 . ARG B 2 52  ? -8.868  66.882 63.157 1.00 41.02  ? 52  ARG H NH2 1 
ATOM 2075 N N   . ASP B 2 53  ? -4.012  73.734 60.680 1.00 54.31  ? 53  ASP H N   1 
ATOM 2076 C CA  . ASP B 2 53  ? -3.562  75.123 60.827 1.00 54.31  ? 53  ASP H CA  1 
ATOM 2077 C C   . ASP B 2 53  ? -3.510  75.722 62.213 1.00 54.31  ? 53  ASP H C   1 
ATOM 2078 O O   . ASP B 2 53  ? -3.476  75.007 63.219 1.00 54.31  ? 53  ASP H O   1 
ATOM 2079 C CB  . ASP B 2 53  ? -4.402  76.052 59.957 1.00 72.66  ? 53  ASP H CB  1 
ATOM 2080 C CG  . ASP B 2 53  ? -5.839  75.629 59.882 1.00 72.66  ? 53  ASP H CG  1 
ATOM 2081 O OD1 . ASP B 2 53  ? -6.406  75.270 60.934 1.00 72.66  ? 53  ASP H OD1 1 
ATOM 2082 O OD2 . ASP B 2 53  ? -6.400  75.669 58.762 1.00 72.66  ? 53  ASP H OD2 1 
ATOM 2083 N N   . LYS B 2 54  ? -3.493  77.052 62.257 1.00 53.76  ? 54  LYS H N   1 
ATOM 2084 C CA  . LYS B 2 54  ? -3.437  77.747 63.530 1.00 53.76  ? 54  LYS H CA  1 
ATOM 2085 C C   . LYS B 2 54  ? -4.801  77.766 64.225 1.00 53.76  ? 54  LYS H C   1 
ATOM 2086 O O   . LYS B 2 54  ? -4.911  77.574 65.440 1.00 53.76  ? 54  LYS H O   1 
ATOM 2087 C CB  . LYS B 2 54  ? -2.949  79.181 63.338 1.00 84.53  ? 54  LYS H CB  1 
ATOM 2088 C CG  . LYS B 2 54  ? -2.764  79.908 64.661 1.00 84.53  ? 54  LYS H CG  1 
ATOM 2089 C CD  . LYS B 2 54  ? -2.352  81.358 64.494 1.00 84.53  ? 54  LYS H CD  1 
ATOM 2090 C CE  . LYS B 2 54  ? -2.143  82.004 65.863 1.00 84.53  ? 54  LYS H CE  1 
ATOM 2091 N NZ  . LYS B 2 54  ? -1.727  83.441 65.757 1.00 84.53  ? 54  LYS H NZ  1 
ATOM 2092 N N   . ALA B 2 55  ? -5.843  78.010 63.442 1.00 84.22  ? 55  ALA H N   1 
ATOM 2093 C CA  . ALA B 2 55  ? -7.182  78.077 63.988 1.00 84.22  ? 55  ALA H CA  1 
ATOM 2094 C C   . ALA B 2 55  ? -7.478  76.824 64.784 1.00 84.22  ? 55  ALA H C   1 
ATOM 2095 O O   . ALA B 2 55  ? -7.649  76.873 65.994 1.00 84.22  ? 55  ALA H O   1 
ATOM 2096 C CB  . ALA B 2 55  ? -8.190  78.243 62.865 1.00 76.07  ? 55  ALA H CB  1 
ATOM 2097 N N   . LYS B 2 56  ? -7.500  75.698 64.091 1.00 27.37  ? 56  LYS H N   1 
ATOM 2098 C CA  . LYS B 2 56  ? -7.810  74.403 64.686 1.00 27.37  ? 56  LYS H CA  1 
ATOM 2099 C C   . LYS B 2 56  ? -6.766  73.967 65.702 1.00 27.37  ? 56  LYS H C   1 
ATOM 2100 O O   . LYS B 2 56  ? -6.853  72.886 66.291 1.00 27.37  ? 56  LYS H O   1 
ATOM 2101 C CB  . LYS B 2 56  ? -7.906  73.346 63.584 1.00 54.63  ? 56  LYS H CB  1 
ATOM 2102 C CG  . LYS B 2 56  ? -8.773  72.176 63.926 1.00 54.63  ? 56  LYS H CG  1 
ATOM 2103 C CD  . LYS B 2 56  ? -10.235 72.562 63.843 1.00 54.63  ? 56  LYS H CD  1 
ATOM 2104 C CE  . LYS B 2 56  ? -11.135 71.414 64.288 1.00 54.63  ? 56  LYS H CE  1 
ATOM 2105 N NZ  . LYS B 2 56  ? -12.602 71.705 64.216 1.00 54.63  ? 56  LYS H NZ  1 
ATOM 2106 N N   . GLY B 2 57  ? -5.793  74.834 65.931 1.00 100.00 ? 57  GLY H N   1 
ATOM 2107 C CA  . GLY B 2 57  ? -4.724  74.472 66.834 1.00 100.00 ? 57  GLY H CA  1 
ATOM 2108 C C   . GLY B 2 57  ? -3.978  73.539 65.920 1.00 100.00 ? 57  GLY H C   1 
ATOM 2109 O O   . GLY B 2 57  ? -4.553  73.074 64.939 1.00 100.00 ? 57  GLY H O   1 
ATOM 2110 N N   . TYR B 2 58  ? -2.716  73.256 66.178 1.00 45.53  ? 58  TYR H N   1 
ATOM 2111 C CA  . TYR B 2 58  ? -2.062  72.364 65.252 1.00 45.53  ? 58  TYR H CA  1 
ATOM 2112 C C   . TYR B 2 58  ? -2.268  70.958 65.705 1.00 45.53  ? 58  TYR H C   1 
ATOM 2113 O O   . TYR B 2 58  ? -1.367  70.329 66.254 1.00 45.53  ? 58  TYR H O   1 
ATOM 2114 C CB  . TYR B 2 58  ? -0.589  72.696 65.122 1.00 35.78  ? 58  TYR H CB  1 
ATOM 2115 C CG  . TYR B 2 58  ? -0.393  74.113 64.667 1.00 35.78  ? 58  TYR H CG  1 
ATOM 2116 C CD1 . TYR B 2 58  ? -0.550  75.154 65.540 1.00 35.78  ? 58  TYR H CD1 1 
ATOM 2117 C CD2 . TYR B 2 58  ? -0.055  74.398 63.366 1.00 35.78  ? 58  TYR H CD2 1 
ATOM 2118 C CE1 . TYR B 2 58  ? -0.366  76.411 65.145 1.00 35.78  ? 58  TYR H CE1 1 
ATOM 2119 C CE2 . TYR B 2 58  ? 0.128   75.664 62.965 1.00 35.78  ? 58  TYR H CE2 1 
ATOM 2120 C CZ  . TYR B 2 58  ? -0.021  76.665 63.862 1.00 35.78  ? 58  TYR H CZ  1 
ATOM 2121 O OH  . TYR B 2 58  ? 0.265   77.948 63.498 1.00 35.78  ? 58  TYR H OH  1 
ATOM 2122 N N   . THR B 2 59  ? -3.500  70.503 65.480 1.00 45.57  ? 59  THR H N   1 
ATOM 2123 C CA  . THR B 2 59  ? -3.954  69.167 65.824 1.00 45.57  ? 59  THR H CA  1 
ATOM 2124 C C   . THR B 2 59  ? -3.630  68.240 64.682 1.00 45.57  ? 59  THR H C   1 
ATOM 2125 O O   . THR B 2 59  ? -3.486  68.652 63.529 1.00 45.57  ? 59  THR H O   1 
ATOM 2126 C CB  . THR B 2 59  ? -5.445  69.123 66.053 1.00 57.84  ? 59  THR H CB  1 
ATOM 2127 O OG1 . THR B 2 59  ? -6.097  69.682 64.911 1.00 57.84  ? 59  THR H OG1 1 
ATOM 2128 C CG2 . THR B 2 59  ? -5.818  69.904 67.292 1.00 57.84  ? 59  THR H CG2 1 
ATOM 2129 N N   . THR B 2 60  ? -3.564  66.969 65.028 1.00 60.62  ? 60  THR H N   1 
ATOM 2130 C CA  . THR B 2 60  ? -3.193  65.933 64.103 1.00 60.62  ? 60  THR H CA  1 
ATOM 2131 C C   . THR B 2 60  ? -4.209  64.795 64.038 1.00 60.62  ? 60  THR H C   1 
ATOM 2132 O O   . THR B 2 60  ? -4.830  64.459 65.033 1.00 60.62  ? 60  THR H O   1 
ATOM 2133 C CB  . THR B 2 60  ? -1.811  65.448 64.540 1.00 68.43  ? 60  THR H CB  1 
ATOM 2134 O OG1 . THR B 2 60  ? -1.790  65.324 65.969 1.00 68.43  ? 60  THR H OG1 1 
ATOM 2135 C CG2 . THR B 2 60  ? -0.759  66.468 64.163 1.00 68.43  ? 60  THR H CG2 1 
ATOM 2136 N N   . GLU B 2 61  ? -4.381  64.215 62.855 1.00 78.86  ? 61  GLU H N   1 
ATOM 2137 C CA  . GLU B 2 61  ? -5.327  63.114 62.671 1.00 78.86  ? 61  GLU H CA  1 
ATOM 2138 C C   . GLU B 2 61  ? -4.767  62.025 61.749 1.00 78.86  ? 61  GLU H C   1 
ATOM 2139 O O   . GLU B 2 61  ? -4.903  62.107 60.527 1.00 78.86  ? 61  GLU H O   1 
ATOM 2140 C CB  . GLU B 2 61  ? -6.664  63.631 62.109 1.00 58.63  ? 61  GLU H CB  1 
ATOM 2141 C CG  . GLU B 2 61  ? -7.746  62.563 62.005 1.00 58.63  ? 61  GLU H CG  1 
ATOM 2142 C CD  . GLU B 2 61  ? -9.121  63.129 61.695 1.00 58.63  ? 61  GLU H CD  1 
ATOM 2143 O OE1 . GLU B 2 61  ? -9.565  64.013 62.449 1.00 58.63  ? 61  GLU H OE1 1 
ATOM 2144 O OE2 . GLU B 2 61  ? -9.772  62.692 60.721 1.00 58.63  ? 61  GLU H OE2 1 
ATOM 2145 N N   . TYR B 2 62  ? -4.170  60.998 62.357 1.00 33.92  ? 62  TYR H N   1 
ATOM 2146 C CA  . TYR B 2 62  ? -3.567  59.879 61.648 1.00 33.92  ? 62  TYR H CA  1 
ATOM 2147 C C   . TYR B 2 62  ? -4.509  58.861 61.035 1.00 33.92  ? 62  TYR H C   1 
ATOM 2148 O O   . TYR B 2 62  ? -5.600  58.602 61.567 1.00 33.92  ? 62  TYR H O   1 
ATOM 2149 C CB  . TYR B 2 62  ? -2.658  59.154 62.595 1.00 22.07  ? 62  TYR H CB  1 
ATOM 2150 C CG  . TYR B 2 62  ? -1.848  60.124 63.361 1.00 22.07  ? 62  TYR H CG  1 
ATOM 2151 C CD1 . TYR B 2 62  ? -1.405  61.291 62.761 1.00 22.07  ? 62  TYR H CD1 1 
ATOM 2152 C CD2 . TYR B 2 62  ? -1.498  59.894 64.668 1.00 22.07  ? 62  TYR H CD2 1 
ATOM 2153 C CE1 . TYR B 2 62  ? -0.644  62.200 63.443 1.00 22.07  ? 62  TYR H CE1 1 
ATOM 2154 C CE2 . TYR B 2 62  ? -0.738  60.803 65.351 1.00 22.07  ? 62  TYR H CE2 1 
ATOM 2155 C CZ  . TYR B 2 62  ? -0.328  61.948 64.727 1.00 22.07  ? 62  TYR H CZ  1 
ATOM 2156 O OH  . TYR B 2 62  ? 0.346   62.894 65.407 1.00 22.07  ? 62  TYR H OH  1 
ATOM 2157 N N   . ASN B 2 63  ? -4.060  58.283 59.915 1.00 34.85  ? 63  ASN H N   1 
ATOM 2158 C CA  . ASN B 2 63  ? -4.790  57.244 59.203 1.00 34.85  ? 63  ASN H CA  1 
ATOM 2159 C C   . ASN B 2 63  ? -4.840  56.109 60.224 1.00 34.85  ? 63  ASN H C   1 
ATOM 2160 O O   . ASN B 2 63  ? -3.880  55.888 60.963 1.00 34.85  ? 63  ASN H O   1 
ATOM 2161 C CB  . ASN B 2 63  ? -3.993  56.802 58.003 1.00 29.47  ? 63  ASN H CB  1 
ATOM 2162 C CG  . ASN B 2 63  ? -4.721  55.797 57.169 1.00 29.47  ? 63  ASN H CG  1 
ATOM 2163 O OD1 . ASN B 2 63  ? -5.282  54.842 57.681 1.00 29.47  ? 63  ASN H OD1 1 
ATOM 2164 N ND2 . ASN B 2 63  ? -4.692  55.985 55.861 1.00 29.47  ? 63  ASN H ND2 1 
ATOM 2165 N N   . PRO B 2 64  ? -5.951  55.366 60.284 1.00 42.97  ? 64  PRO H N   1 
ATOM 2166 C CA  . PRO B 2 64  ? -6.066  54.275 61.247 1.00 42.97  ? 64  PRO H CA  1 
ATOM 2167 C C   . PRO B 2 64  ? -4.895  53.315 61.238 1.00 42.97  ? 64  PRO H C   1 
ATOM 2168 O O   . PRO B 2 64  ? -4.621  52.678 62.248 1.00 42.97  ? 64  PRO H O   1 
ATOM 2169 C CB  . PRO B 2 64  ? -7.376  53.618 60.836 1.00 100.00 ? 64  PRO H CB  1 
ATOM 2170 C CG  . PRO B 2 64  ? -8.185  54.807 60.369 1.00 100.00 ? 64  PRO H CG  1 
ATOM 2171 C CD  . PRO B 2 64  ? -7.165  55.429 59.456 1.00 100.00 ? 64  PRO H CD  1 
ATOM 2172 N N   . SER B 2 65  ? -4.210  53.229 60.099 1.00 67.03  ? 65  SER H N   1 
ATOM 2173 C CA  . SER B 2 65  ? -3.061  52.335 59.909 1.00 67.03  ? 65  SER H CA  1 
ATOM 2174 C C   . SER B 2 65  ? -1.877  52.508 60.827 1.00 67.03  ? 65  SER H C   1 
ATOM 2175 O O   . SER B 2 65  ? -1.554  51.614 61.604 1.00 67.03  ? 65  SER H O   1 
ATOM 2176 C CB  . SER B 2 65  ? -2.519  52.430 58.482 1.00 64.51  ? 65  SER H CB  1 
ATOM 2177 O OG  . SER B 2 65  ? -1.305  51.695 58.366 1.00 64.51  ? 65  SER H OG  1 
ATOM 2178 N N   . VAL B 2 66  ? -1.196  53.639 60.704 1.00 48.86  ? 66  VAL H N   1 
ATOM 2179 C CA  . VAL B 2 66  ? -0.028  53.875 61.524 1.00 48.86  ? 66  VAL H CA  1 
ATOM 2180 C C   . VAL B 2 66  ? -0.396  54.391 62.907 1.00 48.86  ? 66  VAL H C   1 
ATOM 2181 O O   . VAL B 2 66  ? 0.266   54.047 63.891 1.00 48.86  ? 66  VAL H O   1 
ATOM 2182 C CB  . VAL B 2 66  ? 0.939   54.871 60.849 1.00 24.73  ? 66  VAL H CB  1 
ATOM 2183 C CG1 . VAL B 2 66  ? 1.250   54.433 59.461 1.00 24.73  ? 66  VAL H CG1 1 
ATOM 2184 C CG2 . VAL B 2 66  ? 0.337   56.224 60.788 1.00 24.73  ? 66  VAL H CG2 1 
ATOM 2185 N N   . LYS B 2 67  ? -1.459  55.196 62.985 1.00 63.42  ? 67  LYS H N   1 
ATOM 2186 C CA  . LYS B 2 67  ? -1.895  55.792 64.249 1.00 63.42  ? 67  LYS H CA  1 
ATOM 2187 C C   . LYS B 2 67  ? -1.462  54.917 65.404 1.00 63.42  ? 67  LYS H C   1 
ATOM 2188 O O   . LYS B 2 67  ? -1.814  53.744 65.481 1.00 63.42  ? 67  LYS H O   1 
ATOM 2189 C CB  . LYS B 2 67  ? -3.421  55.985 64.271 1.00 100.00 ? 67  LYS H CB  1 
ATOM 2190 C CG  . LYS B 2 67  ? -3.943  56.718 65.528 1.00 100.00 ? 67  LYS H CG  1 
ATOM 2191 C CD  . LYS B 2 67  ? -5.450  57.076 65.470 1.00 100.00 ? 67  LYS H CD  1 
ATOM 2192 C CE  . LYS B 2 67  ? -6.379  55.857 65.515 1.00 100.00 ? 67  LYS H CE  1 
ATOM 2193 N NZ  . LYS B 2 67  ? -7.818  56.245 65.426 1.00 100.00 ? 67  LYS H NZ  1 
ATOM 2194 N N   . GLY B 2 68  ? -0.678  55.489 66.295 1.00 45.26  ? 68  GLY H N   1 
ATOM 2195 C CA  . GLY B 2 68  ? -0.199  54.720 67.421 1.00 45.26  ? 68  GLY H CA  1 
ATOM 2196 C C   . GLY B 2 68  ? 1.309   54.754 67.407 1.00 45.26  ? 68  GLY H C   1 
ATOM 2197 O O   . GLY B 2 68  ? 1.961   54.510 68.432 1.00 45.26  ? 68  GLY H O   1 
ATOM 2198 N N   . ARG B 2 69  ? 1.845   55.074 66.227 1.00 64.12  ? 69  ARG H N   1 
ATOM 2199 C CA  . ARG B 2 69  ? 3.279   55.174 65.993 1.00 64.12  ? 69  ARG H CA  1 
ATOM 2200 C C   . ARG B 2 69  ? 3.697   56.567 65.538 1.00 64.12  ? 69  ARG H C   1 
ATOM 2201 O O   . ARG B 2 69  ? 4.649   57.141 66.070 1.00 64.12  ? 69  ARG H O   1 
ATOM 2202 C CB  . ARG B 2 69  ? 3.714   54.161 64.942 1.00 35.07  ? 69  ARG H CB  1 
ATOM 2203 C CG  . ARG B 2 69  ? 3.472   52.710 65.319 1.00 35.07  ? 69  ARG H CG  1 
ATOM 2204 C CD  . ARG B 2 69  ? 4.211   51.803 64.364 1.00 35.07  ? 69  ARG H CD  1 
ATOM 2205 N NE  . ARG B 2 69  ? 3.769   51.968 62.988 1.00 35.07  ? 69  ARG H NE  1 
ATOM 2206 C CZ  . ARG B 2 69  ? 4.536   51.705 61.939 1.00 35.07  ? 69  ARG H CZ  1 
ATOM 2207 N NH1 . ARG B 2 69  ? 5.775   51.273 62.106 1.00 35.07  ? 69  ARG H NH1 1 
ATOM 2208 N NH2 . ARG B 2 69  ? 4.068   51.880 60.717 1.00 35.07  ? 69  ARG H NH2 1 
ATOM 2209 N N   . VAL B 2 70  ? 2.988   57.098 64.544 1.00 41.67  ? 70  VAL H N   1 
ATOM 2210 C CA  . VAL B 2 70  ? 3.270   58.429 64.003 1.00 41.67  ? 70  VAL H CA  1 
ATOM 2211 C C   . VAL B 2 70  ? 3.129   59.536 65.024 1.00 41.67  ? 70  VAL H C   1 
ATOM 2212 O O   . VAL B 2 70  ? 2.552   59.343 66.093 1.00 41.67  ? 70  VAL H O   1 
ATOM 2213 C CB  . VAL B 2 70  ? 2.348   58.772 62.848 1.00 56.82  ? 70  VAL H CB  1 
ATOM 2214 C CG1 . VAL B 2 70  ? 2.799   58.076 61.588 1.00 56.82  ? 70  VAL H CG1 1 
ATOM 2215 C CG2 . VAL B 2 70  ? 0.954   58.346 63.198 1.00 56.82  ? 70  VAL H CG2 1 
ATOM 2216 N N   . THR B 2 71  ? 3.646   60.706 64.668 1.00 64.57  ? 71  THR H N   1 
ATOM 2217 C CA  . THR B 2 71  ? 3.618   61.867 65.544 1.00 64.57  ? 71  THR H CA  1 
ATOM 2218 C C   . THR B 2 71  ? 4.076   63.144 64.860 1.00 64.57  ? 71  THR H C   1 
ATOM 2219 O O   . THR B 2 71  ? 5.134   63.689 65.211 1.00 64.57  ? 71  THR H O   1 
ATOM 2220 C CB  . THR B 2 71  ? 4.527   61.667 66.760 1.00 55.11  ? 71  THR H CB  1 
ATOM 2221 O OG1 . THR B 2 71  ? 4.047   60.573 67.544 1.00 55.11  ? 71  THR H OG1 1 
ATOM 2222 C CG2 . THR B 2 71  ? 4.551   62.910 67.613 1.00 55.11  ? 71  THR H CG2 1 
ATOM 2223 N N   . MET B 2 72  ? 3.303   63.629 63.891 1.00 21.42  ? 72  MET H N   1 
ATOM 2224 C CA  . MET B 2 72  ? 3.677   64.871 63.230 1.00 21.42  ? 72  MET H CA  1 
ATOM 2225 C C   . MET B 2 72  ? 3.638   66.101 64.183 1.00 21.42  ? 72  MET H C   1 
ATOM 2226 O O   . MET B 2 72  ? 3.213   66.011 65.335 1.00 21.42  ? 72  MET H O   1 
ATOM 2227 C CB  . MET B 2 72  ? 2.769   65.068 62.044 1.00 28.12  ? 72  MET H CB  1 
ATOM 2228 C CG  . MET B 2 72  ? 1.811   63.928 61.896 1.00 28.12  ? 72  MET H CG  1 
ATOM 2229 S SD  . MET B 2 72  ? 1.161   63.988 60.253 1.00 28.12  ? 72  MET H SD  1 
ATOM 2230 C CE  . MET B 2 72  ? 0.104   62.593 60.242 1.00 28.12  ? 72  MET H CE  1 
ATOM 2231 N N   . LEU B 2 73  ? 4.124   67.241 63.714 1.00 40.48  ? 73  LEU H N   1 
ATOM 2232 C CA  . LEU B 2 73  ? 4.147   68.465 64.526 1.00 40.48  ? 73  LEU H CA  1 
ATOM 2233 C C   . LEU B 2 73  ? 4.892   69.565 63.775 1.00 40.48  ? 73  LEU H C   1 
ATOM 2234 O O   . LEU B 2 73  ? 5.590   69.273 62.815 1.00 40.48  ? 73  LEU H O   1 
ATOM 2235 C CB  . LEU B 2 73  ? 4.813   68.211 65.873 1.00 34.79  ? 73  LEU H CB  1 
ATOM 2236 C CG  . LEU B 2 73  ? 6.270   67.784 65.879 1.00 34.79  ? 73  LEU H CG  1 
ATOM 2237 C CD1 . LEU B 2 73  ? 6.727   67.834 67.318 1.00 34.79  ? 73  LEU H CD1 1 
ATOM 2238 C CD2 . LEU B 2 73  ? 6.457   66.388 65.282 1.00 34.79  ? 73  LEU H CD2 1 
ATOM 2239 N N   . VAL B 2 74  ? 4.777   70.821 64.196 1.00 56.51  ? 74  VAL H N   1 
ATOM 2240 C CA  . VAL B 2 74  ? 5.431   71.877 63.431 1.00 56.51  ? 74  VAL H CA  1 
ATOM 2241 C C   . VAL B 2 74  ? 6.040   73.049 64.183 1.00 56.51  ? 74  VAL H C   1 
ATOM 2242 O O   . VAL B 2 74  ? 5.422   73.594 65.091 1.00 56.51  ? 74  VAL H O   1 
ATOM 2243 C CB  . VAL B 2 74  ? 4.450   72.433 62.462 1.00 26.08  ? 74  VAL H CB  1 
ATOM 2244 C CG1 . VAL B 2 74  ? 4.001   71.384 61.550 1.00 26.08  ? 74  VAL H CG1 1 
ATOM 2245 C CG2 . VAL B 2 74  ? 3.257   72.857 63.193 1.00 26.08  ? 74  VAL H CG2 1 
ATOM 2246 N N   . ASP B 2 75  ? 7.250   73.448 63.780 1.00 34.14  ? 75  ASP H N   1 
ATOM 2247 C CA  . ASP B 2 75  ? 7.951   74.577 64.395 1.00 34.14  ? 75  ASP H CA  1 
ATOM 2248 C C   . ASP B 2 75  ? 7.916   75.763 63.447 1.00 34.14  ? 75  ASP H C   1 
ATOM 2249 O O   . ASP B 2 75  ? 8.845   76.004 62.682 1.00 34.14  ? 75  ASP H O   1 
ATOM 2250 C CB  . ASP B 2 75  ? 9.394   74.213 64.747 1.00 51.92  ? 75  ASP H CB  1 
ATOM 2251 C CG  . ASP B 2 75  ? 10.142  75.372 65.381 1.00 51.92  ? 75  ASP H CG  1 
ATOM 2252 O OD1 . ASP B 2 75  ? 9.513   76.163 66.129 1.00 51.92  ? 75  ASP H OD1 1 
ATOM 2253 O OD2 . ASP B 2 75  ? 11.367  75.476 65.158 1.00 51.92  ? 75  ASP H OD2 1 
ATOM 2254 N N   . THR B 2 76  ? 6.800   76.481 63.517 1.00 42.72  ? 76  THR H N   1 
ATOM 2255 C CA  . THR B 2 76  ? 6.507   77.647 62.712 1.00 42.72  ? 76  THR H CA  1 
ATOM 2256 C C   . THR B 2 76  ? 7.647   78.662 62.686 1.00 42.72  ? 76  THR H C   1 
ATOM 2257 O O   . THR B 2 76  ? 7.694   79.535 61.814 1.00 42.72  ? 76  THR H O   1 
ATOM 2258 C CB  . THR B 2 76  ? 5.240   78.296 63.249 1.00 16.82  ? 76  THR H CB  1 
ATOM 2259 O OG1 . THR B 2 76  ? 5.398   78.501 64.647 1.00 16.82  ? 76  THR H OG1 1 
ATOM 2260 C CG2 . THR B 2 76  ? 4.038   77.403 63.046 1.00 16.82  ? 76  THR H CG2 1 
ATOM 2261 N N   . SER B 2 77  ? 8.571   78.536 63.634 1.00 47.39  ? 77  SER H N   1 
ATOM 2262 C CA  . SER B 2 77  ? 9.721   79.432 63.721 1.00 47.39  ? 77  SER H CA  1 
ATOM 2263 C C   . SER B 2 77  ? 10.839  78.949 62.803 1.00 47.39  ? 77  SER H C   1 
ATOM 2264 O O   . SER B 2 77  ? 11.652  79.749 62.365 1.00 47.39  ? 77  SER H O   1 
ATOM 2265 C CB  . SER B 2 77  ? 10.255  79.512 65.157 1.00 83.74  ? 77  SER H CB  1 
ATOM 2266 O OG  . SER B 2 77  ? 10.903  78.307 65.549 1.00 83.74  ? 77  SER H OG  1 
ATOM 2267 N N   . LYS B 2 78  ? 10.900  77.647 62.522 1.00 24.86  ? 78  LYS H N   1 
ATOM 2268 C CA  . LYS B 2 78  ? 11.928  77.124 61.627 1.00 24.86  ? 78  LYS H CA  1 
ATOM 2269 C C   . LYS B 2 78  ? 11.340  76.620 60.317 1.00 24.86  ? 78  LYS H C   1 
ATOM 2270 O O   . LYS B 2 78  ? 12.031  76.023 59.504 1.00 24.86  ? 78  LYS H O   1 
ATOM 2271 C CB  . LYS B 2 78  ? 12.750  76.025 62.315 1.00 59.69  ? 78  LYS H CB  1 
ATOM 2272 C CG  . LYS B 2 78  ? 13.534  76.579 63.492 1.00 59.69  ? 78  LYS H CG  1 
ATOM 2273 C CD  . LYS B 2 78  ? 14.659  75.702 64.002 1.00 59.69  ? 78  LYS H CD  1 
ATOM 2274 C CE  . LYS B 2 78  ? 15.357  76.447 65.147 1.00 59.69  ? 78  LYS H CE  1 
ATOM 2275 N NZ  . LYS B 2 78  ? 16.435  75.677 65.834 1.00 59.69  ? 78  LYS H NZ  1 
ATOM 2276 N N   . ASN B 2 79  ? 10.059  76.899 60.110 1.00 57.21  ? 79  ASN H N   1 
ATOM 2277 C CA  . ASN B 2 79  ? 9.341   76.488 58.906 1.00 57.21  ? 79  ASN H CA  1 
ATOM 2278 C C   . ASN B 2 79  ? 9.579   75.079 58.394 1.00 57.21  ? 79  ASN H C   1 
ATOM 2279 O O   . ASN B 2 79  ? 9.847   74.863 57.209 1.00 57.21  ? 79  ASN H O   1 
ATOM 2280 C CB  . ASN B 2 79  ? 9.561   77.504 57.789 1.00 68.43  ? 79  ASN H CB  1 
ATOM 2281 C CG  . ASN B 2 79  ? 8.527   78.611 57.815 1.00 68.43  ? 79  ASN H CG  1 
ATOM 2282 O OD1 . ASN B 2 79  ? 7.394   78.438 57.342 1.00 68.43  ? 79  ASN H OD1 1 
ATOM 2283 N ND2 . ASN B 2 79  ? 8.896   79.744 58.402 1.00 68.43  ? 79  ASN H ND2 1 
ATOM 2284 N N   . GLN B 2 80  ? 9.425   74.133 59.318 1.00 43.30  ? 80  GLN H N   1 
ATOM 2285 C CA  . GLN B 2 80  ? 9.574   72.708 59.073 1.00 43.30  ? 80  GLN H CA  1 
ATOM 2286 C C   . GLN B 2 80  ? 8.229   71.971 59.189 1.00 43.30  ? 80  GLN H C   1 
ATOM 2287 O O   . GLN B 2 80  ? 7.189   72.581 59.037 1.00 43.30  ? 80  GLN H O   1 
ATOM 2288 C CB  . GLN B 2 80  ? 10.600  72.146 60.039 1.00 31.13  ? 80  GLN H CB  1 
ATOM 2289 C CG  . GLN B 2 80  ? 11.987  72.408 59.595 1.00 31.13  ? 80  GLN H CG  1 
ATOM 2290 C CD  . GLN B 2 80  ? 12.959  72.337 60.729 1.00 31.13  ? 80  GLN H CD  1 
ATOM 2291 O OE1 . GLN B 2 80  ? 12.835  71.495 61.598 1.00 31.13  ? 80  GLN H OE1 1 
ATOM 2292 N NE2 . GLN B 2 80  ? 13.957  73.204 60.716 1.00 31.13  ? 80  GLN H NE2 1 
ATOM 2293 N N   . PHE B 2 81  ? 8.251   70.674 59.474 1.00 50.15  ? 81  PHE H N   1 
ATOM 2294 C CA  . PHE B 2 81  ? 7.029   69.888 59.533 1.00 50.15  ? 81  PHE H CA  1 
ATOM 2295 C C   . PHE B 2 81  ? 7.391   68.406 59.781 1.00 50.15  ? 81  PHE H C   1 
ATOM 2296 O O   . PHE B 2 81  ? 6.951   67.502 59.080 1.00 50.15  ? 81  PHE H O   1 
ATOM 2297 C CB  . PHE B 2 81  ? 6.282   70.128 58.208 1.00 39.93  ? 81  PHE H CB  1 
ATOM 2298 C CG  . PHE B 2 81  ? 5.169   69.189 57.942 1.00 39.93  ? 81  PHE H CG  1 
ATOM 2299 C CD1 . PHE B 2 81  ? 4.271   68.858 58.917 1.00 39.93  ? 81  PHE H CD1 1 
ATOM 2300 C CD2 . PHE B 2 81  ? 5.032   68.617 56.700 1.00 39.93  ? 81  PHE H CD2 1 
ATOM 2301 C CE1 . PHE B 2 81  ? 3.247   67.958 58.657 1.00 39.93  ? 81  PHE H CE1 1 
ATOM 2302 C CE2 . PHE B 2 81  ? 4.017   67.718 56.431 1.00 39.93  ? 81  PHE H CE2 1 
ATOM 2303 C CZ  . PHE B 2 81  ? 3.124   67.386 57.410 1.00 39.93  ? 81  PHE H CZ  1 
ATOM 2304 N N   . SER B 2 82  ? 8.201   68.191 60.817 1.00 29.31  ? 82  SER H N   1 
ATOM 2305 C CA  . SER B 2 82  ? 8.718   66.889 61.265 1.00 29.31  ? 82  SER H CA  1 
ATOM 2306 C C   . SER B 2 82  ? 7.735   65.723 61.373 1.00 29.31  ? 82  SER H C   1 
ATOM 2307 O O   . SER B 2 82  ? 6.602   65.909 61.801 1.00 29.31  ? 82  SER H O   1 
ATOM 2308 C CB  . SER B 2 82  ? 9.334   67.074 62.641 1.00 70.41  ? 82  SER H CB  1 
ATOM 2309 O OG  . SER B 2 82  ? 9.907   68.361 62.748 1.00 70.41  ? 82  SER H OG  1 
ATOM 2310 N N   . LEU B 2 83  ? 8.185   64.518 61.005 1.00 42.96  ? 83  LEU H N   1 
ATOM 2311 C CA  . LEU B 2 83  ? 7.394   63.268 61.120 1.00 42.96  ? 83  LEU H CA  1 
ATOM 2312 C C   . LEU B 2 83  ? 8.253   62.261 61.852 1.00 42.96  ? 83  LEU H C   1 
ATOM 2313 O O   . LEU B 2 83  ? 9.428   62.134 61.539 1.00 42.96  ? 83  LEU H O   1 
ATOM 2314 C CB  . LEU B 2 83  ? 7.058   62.674 59.768 1.00 53.18  ? 83  LEU H CB  1 
ATOM 2315 C CG  . LEU B 2 83  ? 6.747   61.187 59.886 1.00 53.18  ? 83  LEU H CG  1 
ATOM 2316 C CD1 . LEU B 2 83  ? 5.605   60.967 60.805 1.00 53.18  ? 83  LEU H CD1 1 
ATOM 2317 C CD2 . LEU B 2 83  ? 6.441   60.636 58.522 1.00 53.18  ? 83  LEU H CD2 1 
ATOM 2318 N N   . ARG B 2 84  ? 7.690   61.546 62.821 1.00 25.56  ? 84  ARG H N   1 
ATOM 2319 C CA  . ARG B 2 84  ? 8.475   60.566 63.580 1.00 25.56  ? 84  ARG H CA  1 
ATOM 2320 C C   . ARG B 2 84  ? 7.685   59.290 63.712 1.00 25.56  ? 84  ARG H C   1 
ATOM 2321 O O   . ARG B 2 84  ? 6.568   59.316 64.223 1.00 25.56  ? 84  ARG H O   1 
ATOM 2322 C CB  . ARG B 2 84  ? 8.833   61.115 64.970 1.00 60.08  ? 84  ARG H CB  1 
ATOM 2323 C CG  . ARG B 2 84  ? 9.633   62.419 64.896 1.00 60.08  ? 84  ARG H CG  1 
ATOM 2324 C CD  . ARG B 2 84  ? 9.890   63.133 66.243 1.00 60.08  ? 84  ARG H CD  1 
ATOM 2325 N NE  . ARG B 2 84  ? 11.209  62.882 66.840 1.00 60.08  ? 84  ARG H NE  1 
ATOM 2326 C CZ  . ARG B 2 84  ? 11.544  61.802 67.551 1.00 60.08  ? 84  ARG H CZ  1 
ATOM 2327 N NH1 . ARG B 2 84  ? 10.652  60.827 67.779 1.00 60.08  ? 84  ARG H NH1 1 
ATOM 2328 N NH2 . ARG B 2 84  ? 12.785  61.695 68.025 1.00 60.08  ? 84  ARG H NH2 1 
ATOM 2329 N N   . LEU B 2 85  ? 8.246   58.182 63.213 1.00 39.11  ? 85  LEU H N   1 
ATOM 2330 C CA  . LEU B 2 85  ? 7.599   56.856 63.287 1.00 39.11  ? 85  LEU H CA  1 
ATOM 2331 C C   . LEU B 2 85  ? 8.328   55.949 64.263 1.00 39.11  ? 85  LEU H C   1 
ATOM 2332 O O   . LEU B 2 85  ? 9.531   55.789 64.170 1.00 39.11  ? 85  LEU H O   1 
ATOM 2333 C CB  . LEU B 2 85  ? 7.574   56.179 61.910 1.00 47.46  ? 85  LEU H CB  1 
ATOM 2334 C CG  . LEU B 2 85  ? 6.308   56.375 61.075 1.00 47.46  ? 85  LEU H CG  1 
ATOM 2335 C CD1 . LEU B 2 85  ? 6.463   55.741 59.719 1.00 47.46  ? 85  LEU H CD1 1 
ATOM 2336 C CD2 . LEU B 2 85  ? 5.143   55.746 61.793 1.00 47.46  ? 85  LEU H CD2 1 
ATOM 2337 N N   . SER B 2 86  ? 7.646   55.360 65.221 1.00 36.34  ? 86  SER H N   1 
ATOM 2338 C CA  . SER B 2 86  ? 8.402   54.492 66.093 1.00 36.34  ? 86  SER H CA  1 
ATOM 2339 C C   . SER B 2 86  ? 8.177   53.063 65.623 1.00 36.34  ? 86  SER H C   1 
ATOM 2340 O O   . SER B 2 86  ? 7.108   52.761 65.073 1.00 36.34  ? 86  SER H O   1 
ATOM 2341 C CB  . SER B 2 86  ? 7.981   54.685 67.553 1.00 46.19  ? 86  SER H CB  1 
ATOM 2342 O OG  . SER B 2 86  ? 6.574   54.663 67.720 1.00 46.19  ? 86  SER H OG  1 
ATOM 2343 N N   . SER B 2 87  ? 9.192   52.206 65.804 1.00 79.14  ? 87  SER H N   1 
ATOM 2344 C CA  . SER B 2 87  ? 9.150   50.781 65.419 1.00 79.14  ? 87  SER H CA  1 
ATOM 2345 C C   . SER B 2 87  ? 9.205   50.497 63.913 1.00 79.14  ? 87  SER H C   1 
ATOM 2346 O O   . SER B 2 87  ? 8.522   49.600 63.426 1.00 79.14  ? 87  SER H O   1 
ATOM 2347 C CB  . SER B 2 87  ? 7.900   50.085 66.004 1.00 89.40  ? 87  SER H CB  1 
ATOM 2348 O OG  . SER B 2 87  ? 7.889   50.076 67.430 1.00 89.40  ? 87  SER H OG  1 
ATOM 2349 N N   . VAL B 2 88  ? 10.021  51.248 63.180 1.00 71.43  ? 88  VAL H N   1 
ATOM 2350 C CA  . VAL B 2 88  ? 10.145  51.052 61.736 1.00 71.43  ? 88  VAL H CA  1 
ATOM 2351 C C   . VAL B 2 88  ? 10.578  49.639 61.395 1.00 71.43  ? 88  VAL H C   1 
ATOM 2352 O O   . VAL B 2 88  ? 11.558  49.123 61.934 1.00 71.43  ? 88  VAL H O   1 
ATOM 2353 C CB  . VAL B 2 88  ? 11.176  52.025 61.084 1.00 70.42  ? 88  VAL H CB  1 
ATOM 2354 C CG1 . VAL B 2 88  ? 10.632  53.426 61.039 1.00 70.42  ? 88  VAL H CG1 1 
ATOM 2355 C CG2 . VAL B 2 88  ? 12.467  52.012 61.861 1.00 70.42  ? 88  VAL H CG2 1 
ATOM 2356 N N   . THR B 2 89  ? 9.840   49.017 60.489 1.00 67.70  ? 89  THR H N   1 
ATOM 2357 C CA  . THR B 2 89  ? 10.151  47.666 60.042 1.00 67.70  ? 89  THR H CA  1 
ATOM 2358 C C   . THR B 2 89  ? 10.211  47.639 58.534 1.00 67.70  ? 89  THR H C   1 
ATOM 2359 O O   . THR B 2 89  ? 9.806   48.586 57.869 1.00 67.70  ? 89  THR H O   1 
ATOM 2360 C CB  . THR B 2 89  ? 9.105   46.712 60.500 1.00 45.55  ? 89  THR H CB  1 
ATOM 2361 O OG1 . THR B 2 89  ? 7.849   47.036 59.884 1.00 45.55  ? 89  THR H OG1 1 
ATOM 2362 C CG2 . THR B 2 89  ? 8.982   46.826 62.000 1.00 45.55  ? 89  THR H CG2 1 
ATOM 2363 N N   . ALA B 2 90  ? 10.697  46.555 57.975 1.00 45.69  ? 90  ALA H N   1 
ATOM 2364 C CA  . ALA B 2 90  ? 10.812  46.530 56.537 1.00 45.69  ? 90  ALA H CA  1 
ATOM 2365 C C   . ALA B 2 90  ? 9.540   46.963 55.772 1.00 45.69  ? 90  ALA H C   1 
ATOM 2366 O O   . ALA B 2 90  ? 9.599   47.243 54.575 1.00 45.69  ? 90  ALA H O   1 
ATOM 2367 C CB  . ALA B 2 90  ? 11.268  45.161 56.092 1.00 48.21  ? 90  ALA H CB  1 
ATOM 2368 N N   . ALA B 2 91  ? 8.397   47.037 56.449 1.00 67.40  ? 91  ALA H N   1 
ATOM 2369 C CA  . ALA B 2 91  ? 7.152   47.417 55.777 1.00 67.40  ? 91  ALA H CA  1 
ATOM 2370 C C   . ALA B 2 91  ? 7.040   48.911 55.540 1.00 67.40  ? 91  ALA H C   1 
ATOM 2371 O O   . ALA B 2 91  ? 6.604   49.352 54.481 1.00 67.40  ? 91  ALA H O   1 
ATOM 2372 C CB  . ALA B 2 91  ? 5.959   46.939 56.583 1.00 74.88  ? 91  ALA H CB  1 
ATOM 2373 N N   . ASP B 2 92  ? 7.413   49.687 56.546 1.00 47.84  ? 92  ASP H N   1 
ATOM 2374 C CA  . ASP B 2 92  ? 7.378   51.128 56.444 1.00 47.84  ? 92  ASP H CA  1 
ATOM 2375 C C   . ASP B 2 92  ? 8.545   51.599 55.588 1.00 47.84  ? 92  ASP H C   1 
ATOM 2376 O O   . ASP B 2 92  ? 9.386   52.361 56.068 1.00 47.84  ? 92  ASP H O   1 
ATOM 2377 C CB  . ASP B 2 92  ? 7.522   51.764 57.823 1.00 49.12  ? 92  ASP H CB  1 
ATOM 2378 C CG  . ASP B 2 92  ? 6.394   51.413 58.763 1.00 49.12  ? 92  ASP H CG  1 
ATOM 2379 O OD1 . ASP B 2 92  ? 5.225   51.611 58.375 1.00 49.12  ? 92  ASP H OD1 1 
ATOM 2380 O OD2 . ASP B 2 92  ? 6.687   50.969 59.897 1.00 49.12  ? 92  ASP H OD2 1 
ATOM 2381 N N   . THR B 2 93  ? 8.630   51.119 54.350 1.00 25.04  ? 93  THR H N   1 
ATOM 2382 C CA  . THR B 2 93  ? 9.699   51.536 53.435 1.00 25.04  ? 93  THR H CA  1 
ATOM 2383 C C   . THR B 2 93  ? 8.959   52.093 52.274 1.00 25.04  ? 93  THR H C   1 
ATOM 2384 O O   . THR B 2 93  ? 7.950   51.532 51.838 1.00 25.04  ? 93  THR H O   1 
ATOM 2385 C CB  . THR B 2 93  ? 10.609  50.390 52.886 1.00 10.62  ? 93  THR H CB  1 
ATOM 2386 O OG1 . THR B 2 93  ? 11.425  49.861 53.932 1.00 10.62  ? 93  THR H OG1 1 
ATOM 2387 C CG2 . THR B 2 93  ? 11.544  50.929 51.861 1.00 10.62  ? 93  THR H CG2 1 
ATOM 2388 N N   . ALA B 2 94  ? 9.460   53.201 51.761 1.00 30.48  ? 94  ALA H N   1 
ATOM 2389 C CA  . ALA B 2 94  ? 8.802   53.832 50.648 1.00 30.48  ? 94  ALA H CA  1 
ATOM 2390 C C   . ALA B 2 94  ? 9.564   55.113 50.404 1.00 30.48  ? 94  ALA H C   1 
ATOM 2391 O O   . ALA B 2 94  ? 10.774  55.223 50.701 1.00 30.48  ? 94  ALA H O   1 
ATOM 2392 C CB  . ALA B 2 94  ? 7.396   54.142 51.046 1.00 57.54  ? 94  ALA H CB  1 
ATOM 2393 N N   . VAL B 2 95  ? 8.850   56.072 49.832 1.00 39.71  ? 95  VAL H N   1 
ATOM 2394 C CA  . VAL B 2 95  ? 9.380   57.396 49.608 1.00 39.71  ? 95  VAL H CA  1 
ATOM 2395 C C   . VAL B 2 95  ? 8.358   58.104 50.461 1.00 39.71  ? 95  VAL H C   1 
ATOM 2396 O O   . VAL B 2 95  ? 7.173   57.885 50.292 1.00 39.71  ? 95  VAL H O   1 
ATOM 2397 C CB  . VAL B 2 95  ? 9.286   57.841 48.122 1.00 66.96  ? 95  VAL H CB  1 
ATOM 2398 C CG1 . VAL B 2 95  ? 10.032  56.862 47.255 1.00 66.96  ? 95  VAL H CG1 1 
ATOM 2399 C CG2 . VAL B 2 95  ? 7.862   57.929 47.669 1.00 66.96  ? 95  VAL H CG2 1 
ATOM 2400 N N   . TYR B 2 96  ? 8.809   58.863 51.445 1.00 38.64  ? 96  TYR H N   1 
ATOM 2401 C CA  . TYR B 2 96  ? 7.893   59.590 52.295 1.00 38.64  ? 96  TYR H CA  1 
ATOM 2402 C C   . TYR B 2 96  ? 7.750   60.986 51.708 1.00 38.64  ? 96  TYR H C   1 
ATOM 2403 O O   . TYR B 2 96  ? 8.746   61.685 51.549 1.00 38.64  ? 96  TYR H O   1 
ATOM 2404 C CB  . TYR B 2 96  ? 8.413   59.631 53.728 1.00 31.96  ? 96  TYR H CB  1 
ATOM 2405 C CG  . TYR B 2 96  ? 7.995   58.432 54.528 1.00 31.96  ? 96  TYR H CG  1 
ATOM 2406 C CD1 . TYR B 2 96  ? 6.660   58.074 54.611 1.00 31.96  ? 96  TYR H CD1 1 
ATOM 2407 C CD2 . TYR B 2 96  ? 8.909   57.672 55.226 1.00 31.96  ? 96  TYR H CD2 1 
ATOM 2408 C CE1 . TYR B 2 96  ? 6.237   56.976 55.376 1.00 31.96  ? 96  TYR H CE1 1 
ATOM 2409 C CE2 . TYR B 2 96  ? 8.502   56.578 55.991 1.00 31.96  ? 96  TYR H CE2 1 
ATOM 2410 C CZ  . TYR B 2 96  ? 7.163   56.234 56.059 1.00 31.96  ? 96  TYR H CZ  1 
ATOM 2411 O OH  . TYR B 2 96  ? 6.742   55.143 56.781 1.00 31.96  ? 96  TYR H OH  1 
ATOM 2412 N N   . TYR B 2 97  ? 6.513   61.355 51.356 1.00 75.40  ? 97  TYR H N   1 
ATOM 2413 C CA  . TYR B 2 97  ? 6.156   62.652 50.757 1.00 75.40  ? 97  TYR H CA  1 
ATOM 2414 C C   . TYR B 2 97  ? 5.450   63.625 51.712 1.00 75.40  ? 97  TYR H C   1 
ATOM 2415 O O   . TYR B 2 97  ? 4.631   63.208 52.535 1.00 75.40  ? 97  TYR H O   1 
ATOM 2416 C CB  . TYR B 2 97  ? 5.171   62.462 49.599 1.00 20.27  ? 97  TYR H CB  1 
ATOM 2417 C CG  . TYR B 2 97  ? 5.668   61.792 48.361 1.00 20.27  ? 97  TYR H CG  1 
ATOM 2418 C CD1 . TYR B 2 97  ? 6.815   62.225 47.719 1.00 20.27  ? 97  TYR H CD1 1 
ATOM 2419 C CD2 . TYR B 2 97  ? 4.961   60.753 47.808 1.00 20.27  ? 97  TYR H CD2 1 
ATOM 2420 C CE1 . TYR B 2 97  ? 7.249   61.628 46.561 1.00 20.27  ? 97  TYR H CE1 1 
ATOM 2421 C CE2 . TYR B 2 97  ? 5.370   60.149 46.662 1.00 20.27  ? 97  TYR H CE2 1 
ATOM 2422 C CZ  . TYR B 2 97  ? 6.526   60.575 46.032 1.00 20.27  ? 97  TYR H CZ  1 
ATOM 2423 O OH  . TYR B 2 97  ? 6.993   59.877 44.918 1.00 20.27  ? 97  TYR H OH  1 
ATOM 2424 N N   . CYS B 2 98  ? 5.737   64.919 51.609 1.00 20.33  ? 98  CYS H N   1 
ATOM 2425 C CA  . CYS B 2 98  ? 4.985   65.825 52.437 1.00 20.33  ? 98  CYS H CA  1 
ATOM 2426 C C   . CYS B 2 98  ? 4.209   66.734 51.513 1.00 20.33  ? 98  CYS H C   1 
ATOM 2427 O O   . CYS B 2 98  ? 4.755   67.668 50.989 1.00 20.33  ? 98  CYS H O   1 
ATOM 2428 C CB  . CYS B 2 98  ? 5.849   66.654 53.411 1.00 39.08  ? 98  CYS H CB  1 
ATOM 2429 S SG  . CYS B 2 98  ? 6.994   67.896 52.745 1.00 39.08  ? 98  CYS H SG  1 
ATOM 2430 N N   . ALA B 2 99  ? 2.930   66.432 51.299 1.00 65.41  ? 99  ALA H N   1 
ATOM 2431 C CA  . ALA B 2 99  ? 2.065   67.229 50.438 1.00 65.41  ? 99  ALA H CA  1 
ATOM 2432 C C   . ALA B 2 99  ? 1.468   68.292 51.314 1.00 65.41  ? 99  ALA H C   1 
ATOM 2433 O O   . ALA B 2 99  ? 1.322   68.066 52.504 1.00 65.41  ? 99  ALA H O   1 
ATOM 2434 C CB  . ALA B 2 99  ? 0.982   66.378 49.880 1.00 50.55  ? 99  ALA H CB  1 
ATOM 2435 N N   . ARG B 2 100 ? 1.113   69.439 50.734 1.00 14.32  ? 100 ARG H N   1 
ATOM 2436 C CA  . ARG B 2 100 ? 0.537   70.555 51.501 1.00 14.32  ? 100 ARG H CA  1 
ATOM 2437 C C   . ARG B 2 100 ? -0.916  70.731 51.151 1.00 14.32  ? 100 ARG H C   1 
ATOM 2438 O O   . ARG B 2 100 ? -1.234  71.378 50.182 1.00 14.32  ? 100 ARG H O   1 
ATOM 2439 C CB  . ARG B 2 100 ? 1.282   71.839 51.199 1.00 49.96  ? 100 ARG H CB  1 
ATOM 2440 C CG  . ARG B 2 100 ? 0.806   73.017 51.997 1.00 49.96  ? 100 ARG H CG  1 
ATOM 2441 C CD  . ARG B 2 100 ? 0.217   74.039 51.081 1.00 49.96  ? 100 ARG H CD  1 
ATOM 2442 N NE  . ARG B 2 100 ? 1.167   74.410 50.049 1.00 49.96  ? 100 ARG H NE  1 
ATOM 2443 C CZ  . ARG B 2 100 ? 0.799   74.848 48.855 1.00 49.96  ? 100 ARG H CZ  1 
ATOM 2444 N NH1 . ARG B 2 100 ? -0.489  74.955 48.566 1.00 49.96  ? 100 ARG H NH1 1 
ATOM 2445 N NH2 . ARG B 2 100 ? 1.707   75.165 47.951 1.00 49.96  ? 100 ARG H NH2 1 
ATOM 2446 N N   . GLU B 2 101 ? -1.817  70.145 51.926 1.00 82.54  ? 101 GLU H N   1 
ATOM 2447 C CA  . GLU B 2 101 ? -3.228  70.254 51.596 1.00 82.54  ? 101 GLU H CA  1 
ATOM 2448 C C   . GLU B 2 101 ? -3.561  71.704 51.425 1.00 82.54  ? 101 GLU H C   1 
ATOM 2449 O O   . GLU B 2 101 ? -3.310  72.493 52.331 1.00 82.54  ? 101 GLU H O   1 
ATOM 2450 C CB  . GLU B 2 101 ? -4.081  69.656 52.699 1.00 65.63  ? 101 GLU H CB  1 
ATOM 2451 C CG  . GLU B 2 101 ? -5.550  69.714 52.414 1.00 65.63  ? 101 GLU H CG  1 
ATOM 2452 C CD  . GLU B 2 101 ? -6.293  68.788 53.304 1.00 65.63  ? 101 GLU H CD  1 
ATOM 2453 O OE1 . GLU B 2 101 ? -5.996  68.783 54.507 1.00 65.63  ? 101 GLU H OE1 1 
ATOM 2454 O OE2 . GLU B 2 101 ? -7.170  68.064 52.817 1.00 65.63  ? 101 GLU H OE2 1 
ATOM 2455 N N   . GLY B 2 102 ? -4.127  72.060 50.274 1.00 16.76  ? 102 GLY H N   1 
ATOM 2456 C CA  . GLY B 2 102 ? -4.452  73.460 50.048 1.00 16.76  ? 102 GLY H CA  1 
ATOM 2457 C C   . GLY B 2 102 ? -5.790  74.162 50.313 1.00 16.76  ? 102 GLY H C   1 
ATOM 2458 O O   . GLY B 2 102 ? -6.336  74.219 51.408 1.00 16.76  ? 102 GLY H O   1 
ATOM 2459 N N   . HIS B 2 103 ? -6.287  74.762 49.250 1.00 69.85  ? 103 HIS H N   1 
ATOM 2460 C CA  . HIS B 2 103 ? -7.524  75.501 49.274 1.00 69.85  ? 103 HIS H CA  1 
ATOM 2461 C C   . HIS B 2 103 ? -8.279  75.003 48.048 1.00 69.85  ? 103 HIS H C   1 
ATOM 2462 O O   . HIS B 2 103 ? -7.888  75.268 46.912 1.00 69.85  ? 103 HIS H O   1 
ATOM 2463 C CB  . HIS B 2 103 ? -7.174  76.977 49.190 1.00 38.06  ? 103 HIS H CB  1 
ATOM 2464 C CG  . HIS B 2 103 ? -6.413  77.470 50.381 1.00 38.06  ? 103 HIS H CG  1 
ATOM 2465 N ND1 . HIS B 2 103 ? -5.593  78.576 50.340 1.00 38.06  ? 103 HIS H ND1 1 
ATOM 2466 C CD2 . HIS B 2 103 ? -6.414  77.054 51.670 1.00 38.06  ? 103 HIS H CD2 1 
ATOM 2467 C CE1 . HIS B 2 103 ? -5.123  78.821 51.549 1.00 38.06  ? 103 HIS H CE1 1 
ATOM 2468 N NE2 . HIS B 2 103 ? -5.608  77.914 52.375 1.00 38.06  ? 103 HIS H NE2 1 
ATOM 2469 N N   . THR B 2 104 ? -9.344  74.248 48.308 1.00 99.87  ? 104 THR H N   1 
ATOM 2470 C CA  . THR B 2 104 ? -10.180 73.618 47.292 1.00 99.87  ? 104 THR H CA  1 
ATOM 2471 C C   . THR B 2 104 ? -9.321  72.613 46.549 1.00 99.87  ? 104 THR H C   1 
ATOM 2472 O O   . THR B 2 104 ? -9.641  71.424 46.522 1.00 99.87  ? 104 THR H O   1 
ATOM 2473 C CB  . THR B 2 104 ? -10.780 74.629 46.293 1.00 39.16  ? 104 THR H CB  1 
ATOM 2474 O OG1 . THR B 2 104 ? -11.832 73.980 45.560 1.00 39.16  ? 104 THR H OG1 1 
ATOM 2475 C CG2 . THR B 2 104 ? -9.730  75.162 45.313 1.00 39.16  ? 104 THR H CG2 1 
ATOM 2476 N N   . ALA B 2 105 ? -8.217  73.097 45.979 1.00 84.21  ? 105 ALA H N   1 
ATOM 2477 C CA  . ALA B 2 105 ? -7.261  72.277 45.242 1.00 84.21  ? 105 ALA H CA  1 
ATOM 2478 C C   . ALA B 2 105 ? -7.006  71.012 46.026 1.00 84.21  ? 105 ALA H C   1 
ATOM 2479 O O   . ALA B 2 105 ? -6.692  69.969 45.476 1.00 84.21  ? 105 ALA H O   1 
ATOM 2480 C CB  . ALA B 2 105 ? -5.983  73.028 45.085 1.00 21.09  ? 105 ALA H CB  1 
ATOM 2481 N N   . ALA B 2 106 ? -7.144  71.135 47.334 1.00 38.18  ? 106 ALA H N   1 
ATOM 2482 C CA  . ALA B 2 106 ? -6.944  70.046 48.259 1.00 38.18  ? 106 ALA H CA  1 
ATOM 2483 C C   . ALA B 2 106 ? -7.661  68.838 47.747 1.00 38.18  ? 106 ALA H C   1 
ATOM 2484 O O   . ALA B 2 106 ? -8.578  68.964 46.963 1.00 38.18  ? 106 ALA H O   1 
ATOM 2485 C CB  . ALA B 2 106 ? -7.486  70.427 49.639 1.00 85.91  ? 106 ALA H CB  1 
ATOM 2486 N N   . PRO B 2 107 ? -7.264  67.646 48.219 1.00 18.57  ? 107 PRO H N   1 
ATOM 2487 C CA  . PRO B 2 107 ? -6.176  67.539 49.172 1.00 18.57  ? 107 PRO H CA  1 
ATOM 2488 C C   . PRO B 2 107 ? -4.931  67.367 48.337 1.00 18.57  ? 107 PRO H C   1 
ATOM 2489 O O   . PRO B 2 107 ? -5.023  66.811 47.254 1.00 18.57  ? 107 PRO H O   1 
ATOM 2490 C CB  . PRO B 2 107 ? -6.571  66.283 49.930 1.00 10.00  ? 107 PRO H CB  1 
ATOM 2491 C CG  . PRO B 2 107 ? -6.948  65.424 48.836 1.00 10.00  ? 107 PRO H CG  1 
ATOM 2492 C CD  . PRO B 2 107 ? -7.852  66.312 48.014 1.00 10.00  ? 107 PRO H CD  1 
ATOM 2493 N N   . PHE B 2 108 ? -3.788  67.870 48.790 1.00 51.33  ? 108 PHE H N   1 
ATOM 2494 C CA  . PHE B 2 108 ? -2.544  67.673 48.053 1.00 51.33  ? 108 PHE H CA  1 
ATOM 2495 C C   . PHE B 2 108 ? -2.368  68.441 46.730 1.00 51.33  ? 108 PHE H C   1 
ATOM 2496 O O   . PHE B 2 108 ? -2.715  67.934 45.668 1.00 51.33  ? 108 PHE H O   1 
ATOM 2497 C CB  . PHE B 2 108 ? -2.353  66.177 47.756 1.00 23.29  ? 108 PHE H CB  1 
ATOM 2498 C CG  . PHE B 2 108 ? -2.725  65.255 48.903 1.00 23.29  ? 108 PHE H CG  1 
ATOM 2499 C CD1 . PHE B 2 108 ? -2.214  65.447 50.183 1.00 23.29  ? 108 PHE H CD1 1 
ATOM 2500 C CD2 . PHE B 2 108 ? -3.598  64.195 48.694 1.00 23.29  ? 108 PHE H CD2 1 
ATOM 2501 C CE1 . PHE B 2 108 ? -2.578  64.604 51.218 1.00 23.29  ? 108 PHE H CE1 1 
ATOM 2502 C CE2 . PHE B 2 108 ? -3.957  63.361 49.724 1.00 23.29  ? 108 PHE H CE2 1 
ATOM 2503 C CZ  . PHE B 2 108 ? -3.448  63.567 50.985 1.00 23.29  ? 108 PHE H CZ  1 
ATOM 2504 N N   . ASP B 2 109 ? -1.813  69.654 46.784 1.00 59.23  ? 109 ASP H N   1 
ATOM 2505 C CA  . ASP B 2 109 ? -1.576  70.450 45.565 1.00 59.23  ? 109 ASP H CA  1 
ATOM 2506 C C   . ASP B 2 109 ? -0.088  70.708 45.364 1.00 59.23  ? 109 ASP H C   1 
ATOM 2507 O O   . ASP B 2 109 ? 0.373   70.910 44.233 1.00 59.23  ? 109 ASP H O   1 
ATOM 2508 C CB  . ASP B 2 109 ? -2.355  71.793 45.572 1.00 61.33  ? 109 ASP H CB  1 
ATOM 2509 C CG  . ASP B 2 109 ? -1.984  72.721 46.729 1.00 61.33  ? 109 ASP H CG  1 
ATOM 2510 O OD1 . ASP B 2 109 ? -0.816  73.105 46.855 1.00 61.33  ? 109 ASP H OD1 1 
ATOM 2511 O OD2 . ASP B 2 109 ? -2.881  73.089 47.505 1.00 61.33  ? 109 ASP H OD2 1 
ATOM 2512 N N   . TYR B 2 110 ? 0.653   70.696 46.467 1.00 88.25  ? 110 TYR H N   1 
ATOM 2513 C CA  . TYR B 2 110 ? 2.087   70.902 46.426 1.00 88.25  ? 110 TYR H CA  1 
ATOM 2514 C C   . TYR B 2 110 ? 2.781   69.814 47.217 1.00 88.25  ? 110 TYR H C   1 
ATOM 2515 O O   . TYR B 2 110 ? 2.683   69.778 48.441 1.00 88.25  ? 110 TYR H O   1 
ATOM 2516 C CB  . TYR B 2 110 ? 2.454   72.293 46.965 1.00 58.25  ? 110 TYR H CB  1 
ATOM 2517 C CG  . TYR B 2 110 ? 2.385   73.392 45.911 1.00 58.25  ? 110 TYR H CG  1 
ATOM 2518 C CD1 . TYR B 2 110 ? 1.272   73.509 45.067 1.00 58.25  ? 110 TYR H CD1 1 
ATOM 2519 C CD2 . TYR B 2 110 ? 3.436   74.301 45.740 1.00 58.25  ? 110 TYR H CD2 1 
ATOM 2520 C CE1 . TYR B 2 110 ? 1.202   74.482 44.083 1.00 58.25  ? 110 TYR H CE1 1 
ATOM 2521 C CE2 . TYR B 2 110 ? 3.374   75.286 44.755 1.00 58.25  ? 110 TYR H CE2 1 
ATOM 2522 C CZ  . TYR B 2 110 ? 2.251   75.361 43.929 1.00 58.25  ? 110 TYR H CZ  1 
ATOM 2523 O OH  . TYR B 2 110 ? 2.183   76.273 42.910 1.00 58.25  ? 110 TYR H OH  1 
ATOM 2524 N N   . TRP B 2 111 ? 3.461   68.917 46.493 1.00 45.60  ? 111 TRP H N   1 
ATOM 2525 C CA  . TRP B 2 111 ? 4.198   67.802 47.084 1.00 45.60  ? 111 TRP H CA  1 
ATOM 2526 C C   . TRP B 2 111 ? 5.673   68.125 47.188 1.00 45.60  ? 111 TRP H C   1 
ATOM 2527 O O   . TRP B 2 111 ? 6.180   68.982 46.482 1.00 45.60  ? 111 TRP H O   1 
ATOM 2528 C CB  . TRP B 2 111 ? 4.047   66.543 46.242 1.00 46.51  ? 111 TRP H CB  1 
ATOM 2529 C CG  . TRP B 2 111 ? 2.670   65.982 46.182 1.00 46.51  ? 111 TRP H CG  1 
ATOM 2530 C CD1 . TRP B 2 111 ? 1.578   66.518 45.560 1.00 46.51  ? 111 TRP H CD1 1 
ATOM 2531 C CD2 . TRP B 2 111 ? 2.247   64.727 46.714 1.00 46.51  ? 111 TRP H CD2 1 
ATOM 2532 N NE1 . TRP B 2 111 ? 0.502   65.666 45.664 1.00 46.51  ? 111 TRP H NE1 1 
ATOM 2533 C CE2 . TRP B 2 111 ? 0.890   64.559 46.367 1.00 46.51  ? 111 TRP H CE2 1 
ATOM 2534 C CE3 . TRP B 2 111 ? 2.887   63.722 47.448 1.00 46.51  ? 111 TRP H CE3 1 
ATOM 2535 C CZ2 . TRP B 2 111 ? 0.164   63.425 46.732 1.00 46.51  ? 111 TRP H CZ2 1 
ATOM 2536 C CZ3 . TRP B 2 111 ? 2.158   62.595 47.811 1.00 46.51  ? 111 TRP H CZ3 1 
ATOM 2537 C CH2 . TRP B 2 111 ? 0.812   62.456 47.453 1.00 46.51  ? 111 TRP H CH2 1 
ATOM 2538 N N   . GLY B 2 112 ? 6.367   67.436 48.074 1.00 39.17  ? 112 GLY H N   1 
ATOM 2539 C CA  . GLY B 2 112 ? 7.783   67.684 48.206 1.00 39.17  ? 112 GLY H CA  1 
ATOM 2540 C C   . GLY B 2 112 ? 8.436   66.970 47.050 1.00 39.17  ? 112 GLY H C   1 
ATOM 2541 O O   . GLY B 2 112 ? 7.803   66.779 46.013 1.00 39.17  ? 112 GLY H O   1 
ATOM 2542 N N   . GLN B 2 113 ? 9.695   66.579 47.202 1.00 37.44  ? 113 GLN H N   1 
ATOM 2543 C CA  . GLN B 2 113 ? 10.378  65.861 46.138 1.00 37.44  ? 113 GLN H CA  1 
ATOM 2544 C C   . GLN B 2 113 ? 10.180  64.447 46.588 1.00 37.44  ? 113 GLN H C   1 
ATOM 2545 O O   . GLN B 2 113 ? 9.139   63.846 46.368 1.00 37.44  ? 113 GLN H O   1 
ATOM 2546 C CB  . GLN B 2 113 ? 11.875  66.150 46.137 1.00 100.00 ? 113 GLN H CB  1 
ATOM 2547 C CG  . GLN B 2 113 ? 12.282  67.615 46.120 1.00 100.00 ? 113 GLN H CG  1 
ATOM 2548 C CD  . GLN B 2 113 ? 13.805  67.775 46.096 1.00 100.00 ? 113 GLN H CD  1 
ATOM 2549 O OE1 . GLN B 2 113 ? 14.516  67.280 46.995 1.00 100.00 ? 113 GLN H OE1 1 
ATOM 2550 N NE2 . GLN B 2 113 ? 14.315  68.460 45.060 1.00 100.00 ? 113 GLN H NE2 1 
ATOM 2551 N N   . GLY B 2 114 ? 11.198  63.931 47.257 1.00 71.97  ? 114 GLY H N   1 
ATOM 2552 C CA  . GLY B 2 114 ? 11.128  62.585 47.765 1.00 71.97  ? 114 GLY H CA  1 
ATOM 2553 C C   . GLY B 2 114 ? 12.307  62.306 48.659 1.00 71.97  ? 114 GLY H C   1 
ATOM 2554 O O   . GLY B 2 114 ? 13.365  62.896 48.492 1.00 71.97  ? 114 GLY H O   1 
ATOM 2555 N N   . SER B 2 115 ? 12.116  61.404 49.609 1.00 18.88  ? 115 SER H N   1 
ATOM 2556 C CA  . SER B 2 115 ? 13.169  61.024 50.517 1.00 18.88  ? 115 SER H CA  1 
ATOM 2557 C C   . SER B 2 115 ? 13.004  59.505 50.794 1.00 18.88  ? 115 SER H C   1 
ATOM 2558 O O   . SER B 2 115 ? 12.123  59.112 51.541 1.00 18.88  ? 115 SER H O   1 
ATOM 2559 C CB  . SER B 2 115 ? 13.007  61.849 51.796 1.00 48.96  ? 115 SER H CB  1 
ATOM 2560 O OG  . SER B 2 115 ? 14.076  61.636 52.703 1.00 48.96  ? 115 SER H OG  1 
ATOM 2561 N N   . LEU B 2 116 ? 13.828  58.641 50.210 1.00 84.56  ? 116 LEU H N   1 
ATOM 2562 C CA  . LEU B 2 116 ? 13.666  57.199 50.455 1.00 84.56  ? 116 LEU H CA  1 
ATOM 2563 C C   . LEU B 2 116 ? 14.213  56.823 51.836 1.00 84.56  ? 116 LEU H C   1 
ATOM 2564 O O   . LEU B 2 116 ? 15.371  57.102 52.160 1.00 84.56  ? 116 LEU H O   1 
ATOM 2565 C CB  . LEU B 2 116 ? 14.405  56.400 49.375 1.00 10.00  ? 116 LEU H CB  1 
ATOM 2566 C CG  . LEU B 2 116 ? 14.108  54.976 48.847 1.00 10.00  ? 116 LEU H CG  1 
ATOM 2567 C CD1 . LEU B 2 116 ? 12.788  54.843 47.999 1.00 10.00  ? 116 LEU H CD1 1 
ATOM 2568 C CD2 . LEU B 2 116 ? 15.295  54.624 47.958 1.00 10.00  ? 116 LEU H CD2 1 
ATOM 2569 N N   . VAL B 2 117 ? 13.370  56.193 52.647 1.00 46.99  ? 117 VAL H N   1 
ATOM 2570 C CA  . VAL B 2 117 ? 13.750  55.750 53.995 1.00 46.99  ? 117 VAL H CA  1 
ATOM 2571 C C   . VAL B 2 117 ? 13.788  54.226 54.002 1.00 46.99  ? 117 VAL H C   1 
ATOM 2572 O O   . VAL B 2 117 ? 12.755  53.590 54.167 1.00 46.99  ? 117 VAL H O   1 
ATOM 2573 C CB  . VAL B 2 117 ? 12.706  56.167 55.027 1.00 20.25  ? 117 VAL H CB  1 
ATOM 2574 C CG1 . VAL B 2 117 ? 13.241  56.023 56.391 1.00 20.25  ? 117 VAL H CG1 1 
ATOM 2575 C CG2 . VAL B 2 117 ? 12.305  57.566 54.793 1.00 20.25  ? 117 VAL H CG2 1 
ATOM 2576 N N   . THR B 2 118 ? 14.962  53.635 53.818 1.00 62.07  ? 118 THR H N   1 
ATOM 2577 C CA  . THR B 2 118 ? 15.063  52.180 53.800 1.00 62.07  ? 118 THR H CA  1 
ATOM 2578 C C   . THR B 2 118 ? 15.266  51.624 55.203 1.00 62.07  ? 118 THR H C   1 
ATOM 2579 O O   . THR B 2 118 ? 16.045  52.173 55.995 1.00 62.07  ? 118 THR H O   1 
ATOM 2580 C CB  . THR B 2 118 ? 16.238  51.705 52.904 1.00 38.24  ? 118 THR H CB  1 
ATOM 2581 O OG1 . THR B 2 118 ? 16.039  52.172 51.566 1.00 38.24  ? 118 THR H OG1 1 
ATOM 2582 C CG2 . THR B 2 118 ? 16.331  50.176 52.871 1.00 38.24  ? 118 THR H CG2 1 
ATOM 2583 N N   . VAL B 2 119 ? 14.550  50.544 55.514 1.00 45.98  ? 119 VAL H N   1 
ATOM 2584 C CA  . VAL B 2 119 ? 14.671  49.888 56.813 1.00 45.98  ? 119 VAL H CA  1 
ATOM 2585 C C   . VAL B 2 119 ? 15.470  48.626 56.538 1.00 45.98  ? 119 VAL H C   1 
ATOM 2586 O O   . VAL B 2 119 ? 15.033  47.744 55.800 1.00 45.98  ? 119 VAL H O   1 
ATOM 2587 C CB  . VAL B 2 119 ? 13.311  49.500 57.376 1.00 89.02  ? 119 VAL H CB  1 
ATOM 2588 C CG1 . VAL B 2 119 ? 13.483  48.870 58.742 1.00 89.02  ? 119 VAL H CG1 1 
ATOM 2589 C CG2 . VAL B 2 119 ? 12.422  50.719 57.444 1.00 89.02  ? 119 VAL H CG2 1 
ATOM 2590 N N   . SER B 2 120 ? 16.659  48.553 57.114 1.00 26.91  ? 120 SER H N   1 
ATOM 2591 C CA  . SER B 2 120 ? 17.528  47.415 56.911 1.00 26.91  ? 120 SER H CA  1 
ATOM 2592 C C   . SER B 2 120 ? 18.458  47.326 58.084 1.00 26.91  ? 120 SER H C   1 
ATOM 2593 O O   . SER B 2 120 ? 18.946  48.338 58.554 1.00 26.91  ? 120 SER H O   1 
ATOM 2594 C CB  . SER B 2 120 ? 18.348  47.609 55.641 1.00 72.31  ? 120 SER H CB  1 
ATOM 2595 O OG  . SER B 2 120 ? 19.097  48.812 55.697 1.00 72.31  ? 120 SER H OG  1 
ATOM 2596 N N   . SER B 2 121 ? 18.701  46.115 58.558 1.00 41.35  ? 121 SER H N   1 
ATOM 2597 C CA  . SER B 2 121 ? 19.612  45.909 59.669 1.00 41.35  ? 121 SER H CA  1 
ATOM 2598 C C   . SER B 2 121 ? 21.021  46.015 59.088 1.00 41.35  ? 121 SER H C   1 
ATOM 2599 O O   . SER B 2 121 ? 21.975  45.522 59.671 1.00 41.35  ? 121 SER H O   1 
ATOM 2600 C CB  . SER B 2 121 ? 19.414  44.511 60.233 1.00 65.91  ? 121 SER H CB  1 
ATOM 2601 O OG  . SER B 2 121 ? 18.042  44.197 60.296 1.00 65.91  ? 121 SER H OG  1 
ATOM 2602 N N   . ALA B 2 122 ? 21.135  46.629 57.918 1.00 49.02  ? 122 ALA H N   1 
ATOM 2603 C CA  . ALA B 2 122 ? 22.420  46.768 57.260 1.00 49.02  ? 122 ALA H CA  1 
ATOM 2604 C C   . ALA B 2 122 ? 23.083  48.064 57.672 1.00 49.02  ? 122 ALA H C   1 
ATOM 2605 O O   . ALA B 2 122 ? 22.876  48.534 58.793 1.00 49.02  ? 122 ALA H O   1 
ATOM 2606 C CB  . ALA B 2 122 ? 22.247  46.723 55.748 1.00 27.24  ? 122 ALA H CB  1 
ATOM 2607 N N   . SER B 2 123 ? 23.880  48.627 56.759 1.00 38.23  ? 123 SER H N   1 
ATOM 2608 C CA  . SER B 2 123 ? 24.608  49.879 56.982 1.00 38.23  ? 123 SER H CA  1 
ATOM 2609 C C   . SER B 2 123 ? 24.912  50.610 55.667 1.00 38.23  ? 123 SER H C   1 
ATOM 2610 O O   . SER B 2 123 ? 24.619  50.105 54.587 1.00 38.23  ? 123 SER H O   1 
ATOM 2611 C CB  . SER B 2 123 ? 25.908  49.592 57.719 1.00 27.09  ? 123 SER H CB  1 
ATOM 2612 O OG  . SER B 2 123 ? 26.714  48.745 56.938 1.00 27.09  ? 123 SER H OG  1 
ATOM 2613 N N   . THR B 2 124 ? 25.508  51.793 55.767 1.00 28.97  ? 124 THR H N   1 
ATOM 2614 C CA  . THR B 2 124 ? 25.836  52.610 54.596 1.00 28.97  ? 124 THR H CA  1 
ATOM 2615 C C   . THR B 2 124 ? 26.903  52.031 53.657 1.00 28.97  ? 124 THR H C   1 
ATOM 2616 O O   . THR B 2 124 ? 27.266  50.871 53.771 1.00 28.97  ? 124 THR H O   1 
ATOM 2617 C CB  . THR B 2 124 ? 26.311  54.000 55.018 1.00 80.67  ? 124 THR H CB  1 
ATOM 2618 O OG1 . THR B 2 124 ? 27.420  53.861 55.917 1.00 80.67  ? 124 THR H OG1 1 
ATOM 2619 C CG2 . THR B 2 124 ? 25.186  54.768 55.682 1.00 80.67  ? 124 THR H CG2 1 
ATOM 2620 N N   . LYS B 2 125 ? 27.400  52.865 52.734 1.00 30.27  ? 125 LYS H N   1 
ATOM 2621 C CA  . LYS B 2 125 ? 28.417  52.465 51.749 1.00 30.27  ? 125 LYS H CA  1 
ATOM 2622 C C   . LYS B 2 125 ? 28.703  53.536 50.662 1.00 30.27  ? 125 LYS H C   1 
ATOM 2623 O O   . LYS B 2 125 ? 27.880  53.810 49.797 1.00 30.27  ? 125 LYS H O   1 
ATOM 2624 C CB  . LYS B 2 125 ? 27.988  51.149 51.082 1.00 90.65  ? 125 LYS H CB  1 
ATOM 2625 C CG  . LYS B 2 125 ? 28.949  50.636 50.031 1.00 90.65  ? 125 LYS H CG  1 
ATOM 2626 C CD  . LYS B 2 125 ? 30.360  50.425 50.584 1.00 90.65  ? 125 LYS H CD  1 
ATOM 2627 C CE  . LYS B 2 125 ? 31.322  50.054 49.463 1.00 90.65  ? 125 LYS H CE  1 
ATOM 2628 N NZ  . LYS B 2 125 ? 32.690  49.878 49.974 1.00 90.65  ? 125 LYS H NZ  1 
ATOM 2629 N N   . GLY B 2 126 ? 29.889  54.123 50.697 1.00 72.75  ? 126 GLY H N   1 
ATOM 2630 C CA  . GLY B 2 126 ? 30.209  55.137 49.715 1.00 72.75  ? 126 GLY H CA  1 
ATOM 2631 C C   . GLY B 2 126 ? 30.319  54.610 48.298 1.00 72.75  ? 126 GLY H C   1 
ATOM 2632 O O   . GLY B 2 126 ? 31.107  53.693 48.052 1.00 72.75  ? 126 GLY H O   1 
ATOM 2633 N N   . PRO B 2 127 ? 29.550  55.175 47.338 1.00 41.67  ? 127 PRO H N   1 
ATOM 2634 C CA  . PRO B 2 127 ? 29.551  54.774 45.928 1.00 41.67  ? 127 PRO H CA  1 
ATOM 2635 C C   . PRO B 2 127 ? 30.861  55.098 45.214 1.00 41.67  ? 127 PRO H C   1 
ATOM 2636 O O   . PRO B 2 127 ? 31.612  56.007 45.599 1.00 41.67  ? 127 PRO H O   1 
ATOM 2637 C CB  . PRO B 2 127 ? 28.403  55.574 45.353 1.00 20.70  ? 127 PRO H CB  1 
ATOM 2638 C CG  . PRO B 2 127 ? 28.527  56.860 46.145 1.00 20.70  ? 127 PRO H CG  1 
ATOM 2639 C CD  . PRO B 2 127 ? 28.588  56.270 47.532 1.00 20.70  ? 127 PRO H CD  1 
ATOM 2640 N N   . SER B 2 128 ? 31.125  54.346 44.158 1.00 68.77  ? 128 SER H N   1 
ATOM 2641 C CA  . SER B 2 128 ? 32.320  54.561 43.384 1.00 68.77  ? 128 SER H CA  1 
ATOM 2642 C C   . SER B 2 128 ? 31.936  54.855 41.977 1.00 68.77  ? 128 SER H C   1 
ATOM 2643 O O   . SER B 2 128 ? 31.254  54.056 41.348 1.00 68.77  ? 128 SER H O   1 
ATOM 2644 C CB  . SER B 2 128 ? 33.194  53.335 43.405 1.00 47.59  ? 128 SER H CB  1 
ATOM 2645 O OG  . SER B 2 128 ? 33.621  53.119 44.722 1.00 47.59  ? 128 SER H OG  1 
ATOM 2646 N N   . VAL B 2 129 ? 32.385  56.010 41.499 1.00 56.99  ? 129 VAL H N   1 
ATOM 2647 C CA  . VAL B 2 129 ? 32.115  56.453 40.146 1.00 56.99  ? 129 VAL H CA  1 
ATOM 2648 C C   . VAL B 2 129 ? 33.374  56.194 39.275 1.00 56.99  ? 129 VAL H C   1 
ATOM 2649 O O   . VAL B 2 129 ? 34.472  56.646 39.594 1.00 56.99  ? 129 VAL H O   1 
ATOM 2650 C CB  . VAL B 2 129 ? 31.751  57.954 40.139 1.00 98.66  ? 129 VAL H CB  1 
ATOM 2651 C CG1 . VAL B 2 129 ? 30.712  58.215 39.074 1.00 98.66  ? 129 VAL H CG1 1 
ATOM 2652 C CG2 . VAL B 2 129 ? 31.252  58.385 41.508 1.00 98.66  ? 129 VAL H CG2 1 
ATOM 2653 N N   . PHE B 2 130 ? 33.204  55.438 38.196 1.00 28.91  ? 130 PHE H N   1 
ATOM 2654 C CA  . PHE B 2 130 ? 34.284  55.103 37.301 1.00 28.91  ? 130 PHE H CA  1 
ATOM 2655 C C   . PHE B 2 130 ? 34.029  55.797 35.954 1.00 28.91  ? 130 PHE H C   1 
ATOM 2656 O O   . PHE B 2 130 ? 33.097  55.465 35.232 1.00 28.91  ? 130 PHE H O   1 
ATOM 2657 C CB  . PHE B 2 130 ? 34.361  53.584 37.192 1.00 46.38  ? 130 PHE H CB  1 
ATOM 2658 C CG  . PHE B 2 130 ? 34.838  52.933 38.449 1.00 46.38  ? 130 PHE H CG  1 
ATOM 2659 C CD1 . PHE B 2 130 ? 36.134  53.119 38.886 1.00 46.38  ? 130 PHE H CD1 1 
ATOM 2660 C CD2 . PHE B 2 130 ? 33.974  52.214 39.252 1.00 46.38  ? 130 PHE H CD2 1 
ATOM 2661 C CE1 . PHE B 2 130 ? 36.578  52.607 40.115 1.00 46.38  ? 130 PHE H CE1 1 
ATOM 2662 C CE2 . PHE B 2 130 ? 34.399  51.686 40.499 1.00 46.38  ? 130 PHE H CE2 1 
ATOM 2663 C CZ  . PHE B 2 130 ? 35.709  51.889 40.929 1.00 46.38  ? 130 PHE H CZ  1 
ATOM 2664 N N   . PRO B 2 131 ? 34.904  56.736 35.568 1.00 35.55  ? 131 PRO H N   1 
ATOM 2665 C CA  . PRO B 2 131 ? 34.754  57.483 34.328 1.00 35.55  ? 131 PRO H CA  1 
ATOM 2666 C C   . PRO B 2 131 ? 34.614  56.612 33.129 1.00 35.55  ? 131 PRO H C   1 
ATOM 2667 O O   . PRO B 2 131 ? 35.605  56.147 32.623 1.00 35.55  ? 131 PRO H O   1 
ATOM 2668 C CB  . PRO B 2 131 ? 36.034  58.290 34.281 1.00 59.20  ? 131 PRO H CB  1 
ATOM 2669 C CG  . PRO B 2 131 ? 37.016  57.348 34.955 1.00 59.20  ? 131 PRO H CG  1 
ATOM 2670 C CD  . PRO B 2 131 ? 36.197  57.074 36.179 1.00 59.20  ? 131 PRO H CD  1 
ATOM 2671 N N   . LEU B 2 132 ? 33.411  56.382 32.643 1.00 28.84  ? 132 LEU H N   1 
ATOM 2672 C CA  . LEU B 2 132 ? 33.312  55.549 31.452 1.00 28.84  ? 132 LEU H CA  1 
ATOM 2673 C C   . LEU B 2 132 ? 33.553  56.290 30.096 1.00 28.84  ? 132 LEU H C   1 
ATOM 2674 O O   . LEU B 2 132 ? 32.676  57.007 29.563 1.00 28.84  ? 132 LEU H O   1 
ATOM 2675 C CB  . LEU B 2 132 ? 31.965  54.825 31.442 1.00 97.04  ? 132 LEU H CB  1 
ATOM 2676 C CG  . LEU B 2 132 ? 31.769  53.904 32.653 1.00 97.04  ? 132 LEU H CG  1 
ATOM 2677 C CD1 . LEU B 2 132 ? 30.394  53.274 32.566 1.00 97.04  ? 132 LEU H CD1 1 
ATOM 2678 C CD2 . LEU B 2 132 ? 32.871  52.836 32.699 1.00 97.04  ? 132 LEU H CD2 1 
ATOM 2679 N N   . ALA B 2 133 ? 34.744  56.096 29.527 1.00 45.11  ? 133 ALA H N   1 
ATOM 2680 C CA  . ALA B 2 133 ? 35.105  56.749 28.270 1.00 45.11  ? 133 ALA H CA  1 
ATOM 2681 C C   . ALA B 2 133 ? 34.430  56.100 27.072 1.00 45.11  ? 133 ALA H C   1 
ATOM 2682 O O   . ALA B 2 133 ? 34.351  54.876 26.987 1.00 45.11  ? 133 ALA H O   1 
ATOM 2683 C CB  . ALA B 2 133 ? 36.579  56.715 28.100 1.00 66.22  ? 133 ALA H CB  1 
ATOM 2684 N N   . PRO B 2 134 ? 33.996  56.930 26.098 1.00 56.14  ? 134 PRO H N   1 
ATOM 2685 C CA  . PRO B 2 134 ? 33.297  56.629 24.828 1.00 56.14  ? 134 PRO H CA  1 
ATOM 2686 C C   . PRO B 2 134 ? 33.940  55.544 23.964 1.00 56.14  ? 134 PRO H C   1 
ATOM 2687 O O   . PRO B 2 134 ? 34.530  55.951 22.930 1.00 56.14  ? 134 PRO H O   1 
ATOM 2688 C CB  . PRO B 2 134 ? 33.276  57.986 24.105 1.00 28.06  ? 134 PRO H CB  1 
ATOM 2689 C CG  . PRO B 2 134 ? 34.506  58.620 24.643 1.00 28.06  ? 134 PRO H CG  1 
ATOM 2690 C CD  . PRO B 2 134 ? 34.316  58.362 26.127 1.00 28.06  ? 134 PRO H CD  1 
ATOM 2691 N N   . ALA B 2 144 ? 28.182  59.762 19.158 1.00 25.78  ? 144 ALA H N   1 
ATOM 2692 C CA  . ALA B 2 144 ? 29.072  59.250 20.282 1.00 25.78  ? 144 ALA H CA  1 
ATOM 2693 C C   . ALA B 2 144 ? 28.495  59.397 21.712 1.00 25.78  ? 144 ALA H C   1 
ATOM 2694 O O   . ALA B 2 144 ? 27.768  60.346 22.003 1.00 25.78  ? 144 ALA H O   1 
ATOM 2695 C CB  . ALA B 2 144 ? 30.438  59.907 20.209 1.00 59.57  ? 144 ALA H CB  1 
ATOM 2696 N N   . ALA B 2 145 ? 28.854  58.461 22.596 1.00 60.64  ? 145 ALA H N   1 
ATOM 2697 C CA  . ALA B 2 145 ? 28.336  58.419 23.969 1.00 60.64  ? 145 ALA H CA  1 
ATOM 2698 C C   . ALA B 2 145 ? 29.321  58.520 25.136 1.00 60.64  ? 145 ALA H C   1 
ATOM 2699 O O   . ALA B 2 145 ? 30.494  58.197 25.007 1.00 60.64  ? 145 ALA H O   1 
ATOM 2700 C CB  . ALA B 2 145 ? 27.521  57.168 24.129 1.00 38.10  ? 145 ALA H CB  1 
ATOM 2701 N N   . LEU B 2 146 ? 28.804  58.960 26.281 1.00 64.80  ? 146 LEU H N   1 
ATOM 2702 C CA  . LEU B 2 146 ? 29.569  59.120 27.524 1.00 64.80  ? 146 LEU H CA  1 
ATOM 2703 C C   . LEU B 2 146 ? 28.732  58.559 28.660 1.00 64.80  ? 146 LEU H C   1 
ATOM 2704 O O   . LEU B 2 146 ? 27.521  58.422 28.518 1.00 64.80  ? 146 LEU H O   1 
ATOM 2705 C CB  . LEU B 2 146 ? 29.785  60.588 27.862 1.00 80.54  ? 146 LEU H CB  1 
ATOM 2706 C CG  . LEU B 2 146 ? 30.727  61.525 27.139 1.00 80.54  ? 146 LEU H CG  1 
ATOM 2707 C CD1 . LEU B 2 146 ? 30.449  62.934 27.617 1.00 80.54  ? 146 LEU H CD1 1 
ATOM 2708 C CD2 . LEU B 2 146 ? 32.160  61.128 27.426 1.00 80.54  ? 146 LEU H CD2 1 
ATOM 2709 N N   . GLY B 2 147 ? 29.357  58.266 29.795 1.00 22.50  ? 147 GLY H N   1 
ATOM 2710 C CA  . GLY B 2 147 ? 28.594  57.771 30.917 1.00 22.50  ? 147 GLY H CA  1 
ATOM 2711 C C   . GLY B 2 147 ? 29.432  57.798 32.171 1.00 22.50  ? 147 GLY H C   1 
ATOM 2712 O O   . GLY B 2 147 ? 30.515  58.381 32.206 1.00 22.50  ? 147 GLY H O   1 
ATOM 2713 N N   . CYS B 2 148 ? 28.932  57.198 33.236 1.00 55.39  ? 148 CYS H N   1 
ATOM 2714 C CA  . CYS B 2 148 ? 29.708  57.116 34.461 1.00 55.39  ? 148 CYS H CA  1 
ATOM 2715 C C   . CYS B 2 148 ? 29.209  55.866 35.168 1.00 55.39  ? 148 CYS H C   1 
ATOM 2716 O O   . CYS B 2 148 ? 28.029  55.540 35.051 1.00 55.39  ? 148 CYS H O   1 
ATOM 2717 C CB  . CYS B 2 148 ? 29.504  58.345 35.358 1.00 51.23  ? 148 CYS H CB  1 
ATOM 2718 S SG  . CYS B 2 148 ? 30.194  59.963 34.841 1.00 51.23  ? 148 CYS H SG  1 
ATOM 2719 N N   . LEU B 2 149 ? 30.103  55.141 35.846 1.00 59.42  ? 149 LEU H N   1 
ATOM 2720 C CA  . LEU B 2 149 ? 29.694  53.964 36.591 1.00 59.42  ? 149 LEU H CA  1 
ATOM 2721 C C   . LEU B 2 149 ? 29.756  54.357 38.049 1.00 59.42  ? 149 LEU H C   1 
ATOM 2722 O O   . LEU B 2 149 ? 30.831  54.612 38.549 1.00 59.42  ? 149 LEU H O   1 
ATOM 2723 C CB  . LEU B 2 149 ? 30.627  52.780 36.380 1.00 40.47  ? 149 LEU H CB  1 
ATOM 2724 C CG  . LEU B 2 149 ? 30.117  51.500 37.076 1.00 40.47  ? 149 LEU H CG  1 
ATOM 2725 C CD1 . LEU B 2 149 ? 28.830  51.069 36.407 1.00 40.47  ? 149 LEU H CD1 1 
ATOM 2726 C CD2 . LEU B 2 149 ? 31.100  50.351 36.985 1.00 40.47  ? 149 LEU H CD2 1 
ATOM 2727 N N   . VAL B 2 150 ? 28.598  54.440 38.706 1.00 31.03  ? 150 VAL H N   1 
ATOM 2728 C CA  . VAL B 2 150 ? 28.485  54.776 40.125 1.00 31.03  ? 150 VAL H CA  1 
ATOM 2729 C C   . VAL B 2 150 ? 28.261  53.389 40.694 1.00 31.03  ? 150 VAL H C   1 
ATOM 2730 O O   . VAL B 2 150 ? 27.136  52.911 40.763 1.00 31.03  ? 150 VAL H O   1 
ATOM 2731 C CB  . VAL B 2 150 ? 27.270  55.738 40.386 1.00 11.57  ? 150 VAL H CB  1 
ATOM 2732 C CG1 . VAL B 2 150 ? 27.114  56.061 41.906 1.00 11.57  ? 150 VAL H CG1 1 
ATOM 2733 C CG2 . VAL B 2 150 ? 27.464  57.016 39.579 1.00 11.57  ? 150 VAL H CG2 1 
ATOM 2734 N N   . LYS B 2 151 ? 29.381  52.777 41.086 1.00 30.21  ? 151 LYS H N   1 
ATOM 2735 C CA  . LYS B 2 151 ? 29.465  51.405 41.558 1.00 30.21  ? 151 LYS H CA  1 
ATOM 2736 C C   . LYS B 2 151 ? 29.635  51.130 43.033 1.00 30.21  ? 151 LYS H C   1 
ATOM 2737 O O   . LYS B 2 151 ? 30.412  51.800 43.699 1.00 30.21  ? 151 LYS H O   1 
ATOM 2738 C CB  . LYS B 2 151 ? 30.614  50.716 40.818 1.00 68.00  ? 151 LYS H CB  1 
ATOM 2739 C CG  . LYS B 2 151 ? 30.557  49.203 40.831 1.00 68.00  ? 151 LYS H CG  1 
ATOM 2740 C CD  . LYS B 2 151 ? 31.631  48.581 39.942 1.00 68.00  ? 151 LYS H CD  1 
ATOM 2741 C CE  . LYS B 2 151 ? 31.152  47.248 39.333 1.00 68.00  ? 151 LYS H CE  1 
ATOM 2742 N NZ  . LYS B 2 151 ? 30.642  46.267 40.341 1.00 68.00  ? 151 LYS H NZ  1 
ATOM 2743 N N   . ASP B 2 152 ? 28.899  50.107 43.497 1.00 38.84  ? 152 ASP H N   1 
ATOM 2744 C CA  . ASP B 2 152 ? 28.895  49.568 44.868 1.00 38.84  ? 152 ASP H CA  1 
ATOM 2745 C C   . ASP B 2 152 ? 28.593  50.497 45.991 1.00 38.84  ? 152 ASP H C   1 
ATOM 2746 O O   . ASP B 2 152 ? 29.530  51.055 46.538 1.00 38.84  ? 152 ASP H O   1 
ATOM 2747 C CB  . ASP B 2 152 ? 30.245  48.913 45.211 1.00 58.08  ? 152 ASP H CB  1 
ATOM 2748 C CG  . ASP B 2 152 ? 30.471  47.585 44.493 1.00 58.08  ? 152 ASP H CG  1 
ATOM 2749 O OD1 . ASP B 2 152 ? 29.751  46.598 44.827 1.00 58.08  ? 152 ASP H OD1 1 
ATOM 2750 O OD2 . ASP B 2 152 ? 31.369  47.546 43.603 1.00 58.08  ? 152 ASP H OD2 1 
ATOM 2751 N N   . TYR B 2 153 ? 27.316  50.647 46.356 1.00 36.26  ? 153 TYR H N   1 
ATOM 2752 C CA  . TYR B 2 153 ? 26.915  51.514 47.483 1.00 36.26  ? 153 TYR H CA  1 
ATOM 2753 C C   . TYR B 2 153 ? 25.606  51.091 48.151 1.00 36.26  ? 153 TYR H C   1 
ATOM 2754 O O   . TYR B 2 153 ? 24.873  50.247 47.653 1.00 36.26  ? 153 TYR H O   1 
ATOM 2755 C CB  . TYR B 2 153 ? 26.778  52.986 47.043 1.00 16.25  ? 153 TYR H CB  1 
ATOM 2756 C CG  . TYR B 2 153 ? 25.716  53.215 46.013 1.00 16.25  ? 153 TYR H CG  1 
ATOM 2757 C CD1 . TYR B 2 153 ? 24.444  52.771 46.218 1.00 16.25  ? 153 TYR H CD1 1 
ATOM 2758 C CD2 . TYR B 2 153 ? 25.991  53.849 44.830 1.00 16.25  ? 153 TYR H CD2 1 
ATOM 2759 C CE1 . TYR B 2 153 ? 23.467  52.933 45.283 1.00 16.25  ? 153 TYR H CE1 1 
ATOM 2760 C CE2 . TYR B 2 153 ? 25.016  54.021 43.881 1.00 16.25  ? 153 TYR H CE2 1 
ATOM 2761 C CZ  . TYR B 2 153 ? 23.750  53.551 44.118 1.00 16.25  ? 153 TYR H CZ  1 
ATOM 2762 O OH  . TYR B 2 153 ? 22.760  53.644 43.176 1.00 16.25  ? 153 TYR H OH  1 
ATOM 2763 N N   . PHE B 2 154 ? 25.290  51.712 49.274 1.00 21.39  ? 154 PHE H N   1 
ATOM 2764 C CA  . PHE B 2 154 ? 24.050  51.377 49.955 1.00 21.39  ? 154 PHE H CA  1 
ATOM 2765 C C   . PHE B 2 154 ? 23.900  52.256 51.217 1.00 21.39  ? 154 PHE H C   1 
ATOM 2766 O O   . PHE B 2 154 ? 24.877  52.493 51.913 1.00 21.39  ? 154 PHE H O   1 
ATOM 2767 C CB  . PHE B 2 154 ? 24.088  49.869 50.253 1.00 32.94  ? 154 PHE H CB  1 
ATOM 2768 C CG  . PHE B 2 154 ? 22.815  49.304 50.777 1.00 32.94  ? 154 PHE H CG  1 
ATOM 2769 C CD1 . PHE B 2 154 ? 22.463  49.461 52.106 1.00 32.94  ? 154 PHE H CD1 1 
ATOM 2770 C CD2 . PHE B 2 154 ? 21.978  48.592 49.942 1.00 32.94  ? 154 PHE H CD2 1 
ATOM 2771 C CE1 . PHE B 2 154 ? 21.294  48.911 52.598 1.00 32.94  ? 154 PHE H CE1 1 
ATOM 2772 C CE2 . PHE B 2 154 ? 20.799  48.033 50.423 1.00 32.94  ? 154 PHE H CE2 1 
ATOM 2773 C CZ  . PHE B 2 154 ? 20.455  48.192 51.756 1.00 32.94  ? 154 PHE H CZ  1 
ATOM 2774 N N   . PRO B 2 155 ? 22.671  52.722 51.542 1.00 54.09  ? 155 PRO H N   1 
ATOM 2775 C CA  . PRO B 2 155 ? 21.350  52.542 50.930 1.00 54.09  ? 155 PRO H CA  1 
ATOM 2776 C C   . PRO B 2 155 ? 21.110  53.507 49.798 1.00 54.09  ? 155 PRO H C   1 
ATOM 2777 O O   . PRO B 2 155 ? 21.931  54.401 49.600 1.00 54.09  ? 155 PRO H O   1 
ATOM 2778 C CB  . PRO B 2 155 ? 20.422  52.830 52.088 1.00 100.00 ? 155 PRO H CB  1 
ATOM 2779 C CG  . PRO B 2 155 ? 21.077  54.036 52.635 1.00 100.00 ? 155 PRO H CG  1 
ATOM 2780 C CD  . PRO B 2 155 ? 22.518  53.540 52.757 1.00 100.00 ? 155 PRO H CD  1 
ATOM 2781 N N   . GLU B 2 156 ? 19.989  53.311 49.078 1.00 33.13  ? 156 GLU H N   1 
ATOM 2782 C CA  . GLU B 2 156 ? 19.541  54.164 47.954 1.00 33.13  ? 156 GLU H CA  1 
ATOM 2783 C C   . GLU B 2 156 ? 18.851  55.460 48.428 1.00 33.13  ? 156 GLU H C   1 
ATOM 2784 O O   . GLU B 2 156 ? 18.532  55.610 49.600 1.00 33.13  ? 156 GLU H O   1 
ATOM 2785 C CB  . GLU B 2 156 ? 18.549  53.412 47.063 1.00 72.35  ? 156 GLU H CB  1 
ATOM 2786 C CG  . GLU B 2 156 ? 19.125  52.747 45.824 1.00 72.35  ? 156 GLU H CG  1 
ATOM 2787 C CD  . GLU B 2 156 ? 18.233  52.973 44.598 1.00 72.35  ? 156 GLU H CD  1 
ATOM 2788 O OE1 . GLU B 2 156 ? 17.006  52.795 44.719 1.00 72.35  ? 156 GLU H OE1 1 
ATOM 2789 O OE2 . GLU B 2 156 ? 18.748  53.321 43.510 1.00 72.35  ? 156 GLU H OE2 1 
ATOM 2790 N N   . PRO B 2 157 ? 18.573  56.397 47.515 1.00 21.25  ? 157 PRO H N   1 
ATOM 2791 C CA  . PRO B 2 157 ? 18.799  56.437 46.079 1.00 21.25  ? 157 PRO H CA  1 
ATOM 2792 C C   . PRO B 2 157 ? 20.003  57.273 45.877 1.00 21.25  ? 157 PRO H C   1 
ATOM 2793 O O   . PRO B 2 157 ? 20.309  58.080 46.744 1.00 21.25  ? 157 PRO H O   1 
ATOM 2794 C CB  . PRO B 2 157 ? 17.570  57.184 45.544 1.00 36.54  ? 157 PRO H CB  1 
ATOM 2795 C CG  . PRO B 2 157 ? 16.863  57.704 46.795 1.00 36.54  ? 157 PRO H CG  1 
ATOM 2796 C CD  . PRO B 2 157 ? 17.912  57.644 47.879 1.00 36.54  ? 157 PRO H CD  1 
ATOM 2797 N N   . VAL B 2 158 ? 20.678  57.089 44.748 1.00 41.74  ? 158 VAL H N   1 
ATOM 2798 C CA  . VAL B 2 158 ? 21.841  57.891 44.423 1.00 41.74  ? 158 VAL H CA  1 
ATOM 2799 C C   . VAL B 2 158 ? 21.412  58.795 43.240 1.00 41.74  ? 158 VAL H C   1 
ATOM 2800 O O   . VAL B 2 158 ? 20.759  58.310 42.296 1.00 41.74  ? 158 VAL H O   1 
ATOM 2801 C CB  . VAL B 2 158 ? 23.024  56.999 44.041 1.00 15.33  ? 158 VAL H CB  1 
ATOM 2802 C CG1 . VAL B 2 158 ? 22.780  56.331 42.710 1.00 15.33  ? 158 VAL H CG1 1 
ATOM 2803 C CG2 . VAL B 2 158 ? 24.285  57.849 43.992 1.00 15.33  ? 158 VAL H CG2 1 
ATOM 2804 N N   . THR B 2 159 ? 21.749  60.093 43.285 1.00 31.22  ? 159 THR H N   1 
ATOM 2805 C CA  . THR B 2 159 ? 21.332  61.030 42.224 1.00 31.22  ? 159 THR H CA  1 
ATOM 2806 C C   . THR B 2 159 ? 22.487  61.620 41.465 1.00 31.22  ? 159 THR H C   1 
ATOM 2807 O O   . THR B 2 159 ? 23.329  62.235 42.102 1.00 31.22  ? 159 THR H O   1 
ATOM 2808 C CB  . THR B 2 159 ? 20.615  62.227 42.820 1.00 42.15  ? 159 THR H CB  1 
ATOM 2809 O OG1 . THR B 2 159 ? 21.510  62.913 43.696 1.00 42.15  ? 159 THR H OG1 1 
ATOM 2810 C CG2 . THR B 2 159 ? 19.411  61.793 43.603 1.00 42.15  ? 159 THR H CG2 1 
ATOM 2811 N N   . VAL B 2 160 ? 22.521  61.501 40.133 1.00 47.00  ? 160 VAL H N   1 
ATOM 2812 C CA  . VAL B 2 160 ? 23.640  62.074 39.348 1.00 47.00  ? 160 VAL H CA  1 
ATOM 2813 C C   . VAL B 2 160 ? 23.196  63.065 38.264 1.00 47.00  ? 160 VAL H C   1 
ATOM 2814 O O   . VAL B 2 160 ? 22.223  62.828 37.560 1.00 47.00  ? 160 VAL H O   1 
ATOM 2815 C CB  . VAL B 2 160 ? 24.487  60.971 38.641 1.00 27.54  ? 160 VAL H CB  1 
ATOM 2816 C CG1 . VAL B 2 160 ? 23.913  60.644 37.239 1.00 27.54  ? 160 VAL H CG1 1 
ATOM 2817 C CG2 . VAL B 2 160 ? 25.928  61.401 38.551 1.00 27.54  ? 160 VAL H CG2 1 
ATOM 2818 N N   . SER B 2 161 ? 23.919  64.172 38.133 1.00 82.63  ? 161 SER H N   1 
ATOM 2819 C CA  . SER B 2 161 ? 23.605  65.191 37.131 1.00 82.63  ? 161 SER H CA  1 
ATOM 2820 C C   . SER B 2 161 ? 24.889  65.815 36.593 1.00 82.63  ? 161 SER H C   1 
ATOM 2821 O O   . SER B 2 161 ? 25.743  66.283 37.343 1.00 82.63  ? 161 SER H O   1 
ATOM 2822 C CB  . SER B 2 161 ? 22.722  66.283 37.726 1.00 43.46  ? 161 SER H CB  1 
ATOM 2823 O OG  . SER B 2 161 ? 23.382  66.881 38.824 1.00 43.46  ? 161 SER H OG  1 
ATOM 2824 N N   . TRP B 2 162 ? 24.994  65.835 35.272 1.00 99.93  ? 162 TRP H N   1 
ATOM 2825 C CA  . TRP B 2 162 ? 26.158  66.353 34.567 1.00 99.93  ? 162 TRP H CA  1 
ATOM 2826 C C   . TRP B 2 162 ? 26.276  67.851 34.446 1.00 99.93  ? 162 TRP H C   1 
ATOM 2827 O O   . TRP B 2 162 ? 25.307  68.562 34.194 1.00 99.93  ? 162 TRP H O   1 
ATOM 2828 C CB  . TRP B 2 162 ? 26.185  65.799 33.156 1.00 61.43  ? 162 TRP H CB  1 
ATOM 2829 C CG  . TRP B 2 162 ? 26.057  64.352 33.121 1.00 61.43  ? 162 TRP H CG  1 
ATOM 2830 C CD1 . TRP B 2 162 ? 25.056  63.602 33.658 1.00 61.43  ? 162 TRP H CD1 1 
ATOM 2831 C CD2 . TRP B 2 162 ? 26.965  63.455 32.522 1.00 61.43  ? 162 TRP H CD2 1 
ATOM 2832 N NE1 . TRP B 2 162 ? 25.293  62.285 33.430 1.00 61.43  ? 162 TRP H NE1 1 
ATOM 2833 C CE2 . TRP B 2 162 ? 26.466  62.164 32.731 1.00 61.43  ? 162 TRP H CE2 1 
ATOM 2834 C CE3 . TRP B 2 162 ? 28.162  63.612 31.825 1.00 61.43  ? 162 TRP H CE3 1 
ATOM 2835 C CZ2 . TRP B 2 162 ? 27.123  61.032 32.269 1.00 61.43  ? 162 TRP H CZ2 1 
ATOM 2836 C CZ3 . TRP B 2 162 ? 28.812  62.492 31.365 1.00 61.43  ? 162 TRP H CZ3 1 
ATOM 2837 C CH2 . TRP B 2 162 ? 28.293  61.217 31.589 1.00 61.43  ? 162 TRP H CH2 1 
ATOM 2838 N N   . ASN B 2 163 ? 27.501  68.316 34.583 1.00 46.62  ? 163 ASN H N   1 
ATOM 2839 C CA  . ASN B 2 163 ? 27.780  69.721 34.438 1.00 46.62  ? 163 ASN H CA  1 
ATOM 2840 C C   . ASN B 2 163 ? 26.825  70.573 35.272 1.00 46.62  ? 163 ASN H C   1 
ATOM 2841 O O   . ASN B 2 163 ? 26.394  71.658 34.844 1.00 46.62  ? 163 ASN H O   1 
ATOM 2842 C CB  . ASN B 2 163 ? 27.685  70.106 32.958 1.00 59.97  ? 163 ASN H CB  1 
ATOM 2843 C CG  . ASN B 2 163 ? 28.655  69.329 32.084 1.00 59.97  ? 163 ASN H CG  1 
ATOM 2844 O OD1 . ASN B 2 163 ? 29.800  69.072 32.486 1.00 59.97  ? 163 ASN H OD1 1 
ATOM 2845 N ND2 . ASN B 2 163 ? 28.216  68.985 30.863 1.00 59.97  ? 163 ASN H ND2 1 
ATOM 2846 N N   . SER B 2 164 ? 26.514  70.060 36.458 1.00 67.41  ? 164 SER H N   1 
ATOM 2847 C CA  . SER B 2 164 ? 25.637  70.730 37.400 1.00 67.41  ? 164 SER H CA  1 
ATOM 2848 C C   . SER B 2 164 ? 24.565  71.575 36.724 1.00 67.41  ? 164 SER H C   1 
ATOM 2849 O O   . SER B 2 164 ? 24.189  72.658 37.211 1.00 67.41  ? 164 SER H O   1 
ATOM 2850 C CB  . SER B 2 164 ? 26.462  71.599 38.337 1.00 41.14  ? 164 SER H CB  1 
ATOM 2851 O OG  . SER B 2 164 ? 25.616  72.296 39.229 1.00 41.14  ? 164 SER H OG  1 
ATOM 2852 N N   . GLY B 2 165 ? 24.080  71.071 35.593 1.00 42.90  ? 165 GLY H N   1 
ATOM 2853 C CA  . GLY B 2 165 ? 23.049  71.765 34.858 1.00 42.90  ? 165 GLY H CA  1 
ATOM 2854 C C   . GLY B 2 165 ? 23.176  71.495 33.382 1.00 42.90  ? 165 GLY H C   1 
ATOM 2855 O O   . GLY B 2 165 ? 22.855  70.407 32.917 1.00 42.90  ? 165 GLY H O   1 
ATOM 2856 N N   . ALA B 2 166 ? 23.653  72.508 32.665 1.00 64.08  ? 166 ALA H N   1 
ATOM 2857 C CA  . ALA B 2 166 ? 23.831  72.497 31.214 1.00 64.08  ? 166 ALA H CA  1 
ATOM 2858 C C   . ALA B 2 166 ? 23.296  71.297 30.460 1.00 64.08  ? 166 ALA H C   1 
ATOM 2859 O O   . ALA B 2 166 ? 22.326  71.408 29.709 1.00 64.08  ? 166 ALA H O   1 
ATOM 2860 C CB  . ALA B 2 166 ? 25.302  72.689 30.861 1.00 43.89  ? 166 ALA H CB  1 
ATOM 2861 N N   . LEU B 2 167 ? 23.937  70.148 30.664 1.00 53.87  ? 167 LEU H N   1 
ATOM 2862 C CA  . LEU B 2 167 ? 23.557  68.940 29.950 1.00 53.87  ? 167 LEU H CA  1 
ATOM 2863 C C   . LEU B 2 167 ? 22.309  68.217 30.398 1.00 53.87  ? 167 LEU H C   1 
ATOM 2864 O O   . LEU B 2 167 ? 22.221  67.654 31.489 1.00 53.87  ? 167 LEU H O   1 
ATOM 2865 C CB  . LEU B 2 167 ? 24.734  67.953 29.871 1.00 37.34  ? 167 LEU H CB  1 
ATOM 2866 C CG  . LEU B 2 167 ? 24.423  66.701 29.022 1.00 37.34  ? 167 LEU H CG  1 
ATOM 2867 C CD1 . LEU B 2 167 ? 23.776  67.048 27.672 1.00 37.34  ? 167 LEU H CD1 1 
ATOM 2868 C CD2 . LEU B 2 167 ? 25.722  65.923 28.813 1.00 37.34  ? 167 LEU H CD2 1 
ATOM 2869 N N   . THR B 2 168 ? 21.341  68.273 29.498 1.00 62.11  ? 168 THR H N   1 
ATOM 2870 C CA  . THR B 2 168 ? 20.061  67.628 29.643 1.00 62.11  ? 168 THR H CA  1 
ATOM 2871 C C   . THR B 2 168 ? 19.850  67.059 28.230 1.00 62.11  ? 168 THR H C   1 
ATOM 2872 O O   . THR B 2 168 ? 20.829  66.875 27.499 1.00 62.11  ? 168 THR H O   1 
ATOM 2873 C CB  . THR B 2 168 ? 18.980  68.660 30.102 1.00 51.00  ? 168 THR H CB  1 
ATOM 2874 O OG1 . THR B 2 168 ? 19.337  69.155 31.408 1.00 51.00  ? 168 THR H OG1 1 
ATOM 2875 C CG2 . THR B 2 168 ? 17.576  68.007 30.192 1.00 51.00  ? 168 THR H CG2 1 
ATOM 2876 N N   . SER B 2 169 ? 18.614  66.772 27.843 1.00 80.40  ? 169 SER H N   1 
ATOM 2877 C CA  . SER B 2 169 ? 18.339  66.196 26.526 1.00 80.40  ? 169 SER H CA  1 
ATOM 2878 C C   . SER B 2 169 ? 19.545  65.456 25.940 1.00 80.40  ? 169 SER H C   1 
ATOM 2879 O O   . SER B 2 169 ? 20.351  66.023 25.196 1.00 80.40  ? 169 SER H O   1 
ATOM 2880 C CB  . SER B 2 169 ? 17.843  67.277 25.554 1.00 85.40  ? 169 SER H CB  1 
ATOM 2881 O OG  . SER B 2 169 ? 16.556  67.753 25.932 1.00 85.40  ? 169 SER H OG  1 
ATOM 2882 N N   . GLY B 2 170 ? 19.650  64.179 26.297 1.00 76.42  ? 170 GLY H N   1 
ATOM 2883 C CA  . GLY B 2 170 ? 20.743  63.344 25.837 1.00 76.42  ? 170 GLY H CA  1 
ATOM 2884 C C   . GLY B 2 170 ? 21.201  62.408 26.949 1.00 76.42  ? 170 GLY H C   1 
ATOM 2885 O O   . GLY B 2 170 ? 21.932  61.438 26.719 1.00 76.42  ? 170 GLY H O   1 
ATOM 2886 N N   . VAL B 2 171 ? 20.764  62.713 28.166 1.00 67.37  ? 171 VAL H N   1 
ATOM 2887 C CA  . VAL B 2 171 ? 21.105  61.929 29.344 1.00 67.37  ? 171 VAL H CA  1 
ATOM 2888 C C   . VAL B 2 171 ? 20.150  60.776 29.494 1.00 67.37  ? 171 VAL H C   1 
ATOM 2889 O O   . VAL B 2 171 ? 18.981  60.890 29.144 1.00 67.37  ? 171 VAL H O   1 
ATOM 2890 C CB  . VAL B 2 171 ? 21.024  62.782 30.630 1.00 83.15  ? 171 VAL H CB  1 
ATOM 2891 C CG1 . VAL B 2 171 ? 20.877  61.891 31.835 1.00 83.15  ? 171 VAL H CG1 1 
ATOM 2892 C CG2 . VAL B 2 171 ? 22.280  63.627 30.785 1.00 83.15  ? 171 VAL H CG2 1 
ATOM 2893 N N   . HIS B 2 172 ? 20.676  59.666 30.003 1.00 47.56  ? 172 HIS H N   1 
ATOM 2894 C CA  . HIS B 2 172 ? 19.919  58.451 30.278 1.00 47.56  ? 172 HIS H CA  1 
ATOM 2895 C C   . HIS B 2 172 ? 20.448  57.910 31.593 1.00 47.56  ? 172 HIS H C   1 
ATOM 2896 O O   . HIS B 2 172 ? 21.255  57.019 31.557 1.00 47.56  ? 172 HIS H O   1 
ATOM 2897 C CB  . HIS B 2 172 ? 20.152  57.382 29.206 1.00 59.78  ? 172 HIS H CB  1 
ATOM 2898 C CG  . HIS B 2 172 ? 19.417  57.619 27.922 1.00 59.78  ? 172 HIS H CG  1 
ATOM 2899 N ND1 . HIS B 2 172 ? 18.044  57.547 27.827 1.00 59.78  ? 172 HIS H ND1 1 
ATOM 2900 C CD2 . HIS B 2 172 ? 19.863  57.931 26.681 1.00 59.78  ? 172 HIS H CD2 1 
ATOM 2901 C CE1 . HIS B 2 172 ? 17.677  57.807 26.582 1.00 59.78  ? 172 HIS H CE1 1 
ATOM 2902 N NE2 . HIS B 2 172 ? 18.762  58.043 25.867 1.00 59.78  ? 172 HIS H NE2 1 
ATOM 2903 N N   . THR B 2 173 ? 20.055  58.452 32.746 1.00 46.92  ? 173 THR H N   1 
ATOM 2904 C CA  . THR B 2 173 ? 20.533  57.898 34.015 1.00 46.92  ? 173 THR H CA  1 
ATOM 2905 C C   . THR B 2 173 ? 19.621  56.720 34.336 1.00 46.92  ? 173 THR H C   1 
ATOM 2906 O O   . THR B 2 173 ? 18.422  56.887 34.588 1.00 46.92  ? 173 THR H O   1 
ATOM 2907 C CB  . THR B 2 173 ? 20.516  58.937 35.220 1.00 47.33  ? 173 THR H CB  1 
ATOM 2908 O OG1 . THR B 2 173 ? 21.723  59.705 35.227 1.00 47.33  ? 173 THR H OG1 1 
ATOM 2909 C CG2 . THR B 2 173 ? 20.447  58.237 36.566 1.00 47.33  ? 173 THR H CG2 1 
ATOM 2910 N N   . PHE B 2 174 ? 20.204  55.527 34.302 1.00 23.29  ? 174 PHE H N   1 
ATOM 2911 C CA  . PHE B 2 174 ? 19.505  54.280 34.579 1.00 23.29  ? 174 PHE H CA  1 
ATOM 2912 C C   . PHE B 2 174 ? 19.020  54.076 36.041 1.00 23.29  ? 174 PHE H C   1 
ATOM 2913 O O   . PHE B 2 174 ? 19.368  54.830 36.942 1.00 23.29  ? 174 PHE H O   1 
ATOM 2914 C CB  . PHE B 2 174 ? 20.422  53.139 34.180 1.00 30.11  ? 174 PHE H CB  1 
ATOM 2915 C CG  . PHE B 2 174 ? 20.558  52.975 32.734 1.00 30.11  ? 174 PHE H CG  1 
ATOM 2916 C CD1 . PHE B 2 174 ? 19.542  52.433 32.009 1.00 30.11  ? 174 PHE H CD1 1 
ATOM 2917 C CD2 . PHE B 2 174 ? 21.685  53.408 32.090 1.00 30.11  ? 174 PHE H CD2 1 
ATOM 2918 C CE1 . PHE B 2 174 ? 19.630  52.321 30.654 1.00 30.11  ? 174 PHE H CE1 1 
ATOM 2919 C CE2 . PHE B 2 174 ? 21.791  53.306 30.726 1.00 30.11  ? 174 PHE H CE2 1 
ATOM 2920 C CZ  . PHE B 2 174 ? 20.751  52.757 30.003 1.00 30.11  ? 174 PHE H CZ  1 
ATOM 2921 N N   . PRO B 2 175 ? 18.228  53.028 36.284 1.00 47.45  ? 175 PRO H N   1 
ATOM 2922 C CA  . PRO B 2 175 ? 17.707  52.733 37.608 1.00 47.45  ? 175 PRO H CA  1 
ATOM 2923 C C   . PRO B 2 175 ? 18.780  52.346 38.612 1.00 47.45  ? 175 PRO H C   1 
ATOM 2924 O O   . PRO B 2 175 ? 19.502  53.188 39.135 1.00 47.45  ? 175 PRO H O   1 
ATOM 2925 C CB  . PRO B 2 175 ? 16.754  51.577 37.329 1.00 55.89  ? 175 PRO H CB  1 
ATOM 2926 C CG  . PRO B 2 175 ? 16.354  51.829 35.920 1.00 55.89  ? 175 PRO H CG  1 
ATOM 2927 C CD  . PRO B 2 175 ? 17.716  52.027 35.350 1.00 55.89  ? 175 PRO H CD  1 
ATOM 2928 N N   . ALA B 2 176 ? 18.848  51.049 38.889 1.00 28.02  ? 176 ALA H N   1 
ATOM 2929 C CA  . ALA B 2 176 ? 19.811  50.467 39.826 1.00 28.02  ? 176 ALA H CA  1 
ATOM 2930 C C   . ALA B 2 176 ? 19.600  48.952 39.820 1.00 28.02  ? 176 ALA H C   1 
ATOM 2931 O O   . ALA B 2 176 ? 18.583  48.447 39.351 1.00 28.02  ? 176 ALA H O   1 
ATOM 2932 C CB  . ALA B 2 176 ? 19.599  51.040 41.229 1.00 53.32  ? 176 ALA H CB  1 
ATOM 2933 N N   . VAL B 2 177 ? 20.593  48.230 40.298 1.00 62.71  ? 177 VAL H N   1 
ATOM 2934 C CA  . VAL B 2 177 ? 20.490  46.792 40.364 1.00 62.71  ? 177 VAL H CA  1 
ATOM 2935 C C   . VAL B 2 177 ? 21.212  46.492 41.649 1.00 62.71  ? 177 VAL H C   1 
ATOM 2936 O O   . VAL B 2 177 ? 22.102  47.256 42.070 1.00 62.71  ? 177 VAL H O   1 
ATOM 2937 C CB  . VAL B 2 177 ? 21.204  46.101 39.193 1.00 21.14  ? 177 VAL H CB  1 
ATOM 2938 C CG1 . VAL B 2 177 ? 20.884  46.822 37.893 1.00 21.14  ? 177 VAL H CG1 1 
ATOM 2939 C CG2 . VAL B 2 177 ? 22.673  46.065 39.421 1.00 21.14  ? 177 VAL H CG2 1 
ATOM 2940 N N   . LEU B 2 178 ? 20.809  45.409 42.301 1.00 64.98  ? 178 LEU H N   1 
ATOM 2941 C CA  . LEU B 2 178 ? 21.446  45.034 43.550 1.00 64.98  ? 178 LEU H CA  1 
ATOM 2942 C C   . LEU B 2 178 ? 22.375  43.884 43.192 1.00 64.98  ? 178 LEU H C   1 
ATOM 2943 O O   . LEU B 2 178 ? 21.956  42.824 42.732 1.00 64.98  ? 178 LEU H O   1 
ATOM 2944 C CB  . LEU B 2 178 ? 20.402  44.632 44.598 1.00 17.67  ? 178 LEU H CB  1 
ATOM 2945 C CG  . LEU B 2 178 ? 20.876  44.562 46.036 1.00 17.67  ? 178 LEU H CG  1 
ATOM 2946 C CD1 . LEU B 2 178 ? 21.156  45.902 46.573 1.00 17.67  ? 178 LEU H CD1 1 
ATOM 2947 C CD2 . LEU B 2 178 ? 19.817  43.937 46.853 1.00 17.67  ? 178 LEU H CD2 1 
ATOM 2948 N N   . GLN B 2 179 ? 23.657  44.157 43.352 1.00 90.13  ? 179 GLN H N   1 
ATOM 2949 C CA  . GLN B 2 179 ? 24.706  43.214 43.057 1.00 90.13  ? 179 GLN H CA  1 
ATOM 2950 C C   . GLN B 2 179 ? 24.731  42.133 44.130 1.00 90.13  ? 179 GLN H C   1 
ATOM 2951 O O   . GLN B 2 179 ? 24.313  42.361 45.257 1.00 90.13  ? 179 GLN H O   1 
ATOM 2952 C CB  . GLN B 2 179 ? 26.043  43.956 43.025 1.00 42.47  ? 179 GLN H CB  1 
ATOM 2953 C CG  . GLN B 2 179 ? 26.190  45.012 41.932 1.00 42.47  ? 179 GLN H CG  1 
ATOM 2954 C CD  . GLN B 2 179 ? 27.502  45.789 42.059 1.00 42.47  ? 179 GLN H CD  1 
ATOM 2955 O OE1 . GLN B 2 179 ? 27.895  46.536 41.156 1.00 42.47  ? 179 GLN H OE1 1 
ATOM 2956 N NE2 . GLN B 2 179 ? 28.179  45.618 43.192 1.00 42.47  ? 179 GLN H NE2 1 
ATOM 2957 N N   . SER B 2 180 ? 25.217  40.951 43.770 1.00 68.37  ? 180 SER H N   1 
ATOM 2958 C CA  . SER B 2 180 ? 25.314  39.851 44.714 1.00 68.37  ? 180 SER H CA  1 
ATOM 2959 C C   . SER B 2 180 ? 26.035  40.391 45.937 1.00 68.37  ? 180 SER H C   1 
ATOM 2960 O O   . SER B 2 180 ? 25.778  39.955 47.058 1.00 68.37  ? 180 SER H O   1 
ATOM 2961 C CB  . SER B 2 180 ? 26.152  38.716 44.130 1.00 47.80  ? 180 SER H CB  1 
ATOM 2962 O OG  . SER B 2 180 ? 25.801  38.465 42.789 1.00 47.80  ? 180 SER H OG  1 
ATOM 2963 N N   . SER B 2 181 ? 26.944  41.344 45.713 1.00 28.98  ? 181 SER H N   1 
ATOM 2964 C CA  . SER B 2 181 ? 27.709  41.910 46.812 1.00 28.98  ? 181 SER H CA  1 
ATOM 2965 C C   . SER B 2 181 ? 26.676  42.381 47.787 1.00 28.98  ? 181 SER H C   1 
ATOM 2966 O O   . SER B 2 181 ? 26.953  42.572 48.981 1.00 28.98  ? 181 SER H O   1 
ATOM 2967 C CB  . SER B 2 181 ? 28.700  43.052 46.356 1.00 27.07  ? 181 SER H CB  1 
ATOM 2968 O OG  . SER B 2 181 ? 28.387  43.793 45.175 1.00 27.07  ? 181 SER H OG  1 
ATOM 2969 N N   . GLY B 2 182 ? 25.460  42.492 47.249 1.00 26.18  ? 182 GLY H N   1 
ATOM 2970 C CA  . GLY B 2 182 ? 24.315  42.932 48.016 1.00 26.18  ? 182 GLY H CA  1 
ATOM 2971 C C   . GLY B 2 182 ? 24.331  44.426 47.955 1.00 26.18  ? 182 GLY H C   1 
ATOM 2972 O O   . GLY B 2 182 ? 23.770  45.103 48.803 1.00 26.18  ? 182 GLY H O   1 
ATOM 2973 N N   . LEU B 2 183 ? 25.009  44.919 46.923 1.00 78.37  ? 183 LEU H N   1 
ATOM 2974 C CA  . LEU B 2 183 ? 25.152  46.341 46.678 1.00 78.37  ? 183 LEU H CA  1 
ATOM 2975 C C   . LEU B 2 183 ? 24.563  46.835 45.374 1.00 78.37  ? 183 LEU H C   1 
ATOM 2976 O O   . LEU B 2 183 ? 24.514  46.150 44.355 1.00 78.37  ? 183 LEU H O   1 
ATOM 2977 C CB  . LEU B 2 183 ? 26.608  46.745 46.722 1.00 34.79  ? 183 LEU H CB  1 
ATOM 2978 C CG  . LEU B 2 183 ? 27.255  46.346 48.024 1.00 34.79  ? 183 LEU H CG  1 
ATOM 2979 C CD1 . LEU B 2 183 ? 28.574  47.061 48.131 1.00 34.79  ? 183 LEU H CD1 1 
ATOM 2980 C CD2 . LEU B 2 183 ? 26.354  46.704 49.191 1.00 34.79  ? 183 LEU H CD2 1 
ATOM 2981 N N   . TYR B 2 184 ? 24.129  48.074 45.441 1.00 66.83  ? 184 TYR H N   1 
ATOM 2982 C CA  . TYR B 2 184 ? 23.524  48.738 44.335 1.00 66.83  ? 184 TYR H CA  1 
ATOM 2983 C C   . TYR B 2 184 ? 24.545  49.239 43.343 1.00 66.83  ? 184 TYR H C   1 
ATOM 2984 O O   . TYR B 2 184 ? 25.704  49.512 43.691 1.00 66.83  ? 184 TYR H O   1 
ATOM 2985 C CB  . TYR B 2 184 ? 22.667  49.863 44.888 1.00 40.18  ? 184 TYR H CB  1 
ATOM 2986 C CG  . TYR B 2 184 ? 21.320  49.350 45.254 1.00 40.18  ? 184 TYR H CG  1 
ATOM 2987 C CD1 . TYR B 2 184 ? 20.589  48.666 44.312 1.00 40.18  ? 184 TYR H CD1 1 
ATOM 2988 C CD2 . TYR B 2 184 ? 20.782  49.526 46.506 1.00 40.18  ? 184 TYR H CD2 1 
ATOM 2989 C CE1 . TYR B 2 184 ? 19.375  48.170 44.583 1.00 40.18  ? 184 TYR H CE1 1 
ATOM 2990 C CE2 . TYR B 2 184 ? 19.540  49.021 46.796 1.00 40.18  ? 184 TYR H CE2 1 
ATOM 2991 C CZ  . TYR B 2 184 ? 18.839  48.336 45.812 1.00 40.18  ? 184 TYR H CZ  1 
ATOM 2992 O OH  . TYR B 2 184 ? 17.591  47.775 46.004 1.00 40.18  ? 184 TYR H OH  1 
ATOM 2993 N N   . SER B 2 185 ? 24.126  49.348 42.091 1.00 36.83  ? 185 SER H N   1 
ATOM 2994 C CA  . SER B 2 185 ? 25.052  49.821 41.099 1.00 36.83  ? 185 SER H CA  1 
ATOM 2995 C C   . SER B 2 185 ? 24.357  50.209 39.805 1.00 36.83  ? 185 SER H C   1 
ATOM 2996 O O   . SER B 2 185 ? 23.998  49.348 39.008 1.00 36.83  ? 185 SER H O   1 
ATOM 2997 C CB  . SER B 2 185 ? 26.110  48.741 40.846 1.00 58.88  ? 185 SER H CB  1 
ATOM 2998 O OG  . SER B 2 185 ? 27.147  49.183 39.995 1.00 58.88  ? 185 SER H OG  1 
ATOM 2999 N N   . LEU B 2 186 ? 24.181  51.517 39.610 1.00 57.53  ? 186 LEU H N   1 
ATOM 3000 C CA  . LEU B 2 186 ? 23.580  52.081 38.402 1.00 57.53  ? 186 LEU H CA  1 
ATOM 3001 C C   . LEU B 2 186 ? 24.705  52.702 37.560 1.00 57.53  ? 186 LEU H C   1 
ATOM 3002 O O   . LEU B 2 186 ? 25.851  52.761 37.995 1.00 57.53  ? 186 LEU H O   1 
ATOM 3003 C CB  . LEU B 2 186 ? 22.571  53.184 38.775 1.00 57.13  ? 186 LEU H CB  1 
ATOM 3004 C CG  . LEU B 2 186 ? 23.009  54.448 39.545 1.00 57.13  ? 186 LEU H CG  1 
ATOM 3005 C CD1 . LEU B 2 186 ? 24.062  55.225 38.787 1.00 57.13  ? 186 LEU H CD1 1 
ATOM 3006 C CD2 . LEU B 2 186 ? 21.814  55.335 39.752 1.00 57.13  ? 186 LEU H CD2 1 
ATOM 3007 N N   . SER B 2 187 ? 24.380  53.165 36.360 1.00 31.76  ? 187 SER H N   1 
ATOM 3008 C CA  . SER B 2 187 ? 25.375  53.826 35.537 1.00 31.76  ? 187 SER H CA  1 
ATOM 3009 C C   . SER B 2 187 ? 24.731  54.809 34.542 1.00 31.76  ? 187 SER H C   1 
ATOM 3010 O O   . SER B 2 187 ? 24.132  54.416 33.550 1.00 31.76  ? 187 SER H O   1 
ATOM 3011 C CB  . SER B 2 187 ? 26.252  52.793 34.837 1.00 19.86  ? 187 SER H CB  1 
ATOM 3012 O OG  . SER B 2 187 ? 25.553  52.073 33.842 1.00 19.86  ? 187 SER H OG  1 
ATOM 3013 N N   . SER B 2 188 ? 24.853  56.098 34.862 1.00 33.46  ? 188 SER H N   1 
ATOM 3014 C CA  . SER B 2 188 ? 24.335  57.234 34.082 1.00 33.46  ? 188 SER H CA  1 
ATOM 3015 C C   . SER B 2 188 ? 25.157  57.488 32.810 1.00 33.46  ? 188 SER H C   1 
ATOM 3016 O O   . SER B 2 188 ? 26.380  57.622 32.859 1.00 33.46  ? 188 SER H O   1 
ATOM 3017 C CB  . SER B 2 188 ? 24.340  58.481 34.967 1.00 60.26  ? 188 SER H CB  1 
ATOM 3018 O OG  . SER B 2 188 ? 23.930  59.625 34.263 1.00 60.26  ? 188 SER H OG  1 
ATOM 3019 N N   . VAL B 2 189 ? 24.453  57.582 31.688 1.00 23.08  ? 189 VAL H N   1 
ATOM 3020 C CA  . VAL B 2 189 ? 25.012  57.746 30.350 1.00 23.08  ? 189 VAL H CA  1 
ATOM 3021 C C   . VAL B 2 189 ? 24.308  58.843 29.543 1.00 23.08  ? 189 VAL H C   1 
ATOM 3022 O O   . VAL B 2 189 ? 23.075  58.923 29.548 1.00 23.08  ? 189 VAL H O   1 
ATOM 3023 C CB  . VAL B 2 189 ? 24.850  56.423 29.625 1.00 38.52  ? 189 VAL H CB  1 
ATOM 3024 C CG1 . VAL B 2 189 ? 24.990  56.591 28.138 1.00 38.52  ? 189 VAL H CG1 1 
ATOM 3025 C CG2 . VAL B 2 189 ? 25.858  55.464 30.169 1.00 38.52  ? 189 VAL H CG2 1 
ATOM 3026 N N   . VAL B 2 190 ? 25.070  59.663 28.818 1.00 51.40  ? 190 VAL H N   1 
ATOM 3027 C CA  . VAL B 2 190 ? 24.475  60.745 28.032 1.00 51.40  ? 190 VAL H CA  1 
ATOM 3028 C C   . VAL B 2 190 ? 25.088  61.050 26.659 1.00 51.40  ? 190 VAL H C   1 
ATOM 3029 O O   . VAL B 2 190 ? 25.888  61.964 26.541 1.00 51.40  ? 190 VAL H O   1 
ATOM 3030 C CB  . VAL B 2 190 ? 24.483  62.041 28.851 1.00 78.47  ? 190 VAL H CB  1 
ATOM 3031 C CG1 . VAL B 2 190 ? 25.875  62.293 29.400 1.00 78.47  ? 190 VAL H CG1 1 
ATOM 3032 C CG2 . VAL B 2 190 ? 24.048  63.208 27.981 1.00 78.47  ? 190 VAL H CG2 1 
ATOM 3033 N N   . THR B 2 191 ? 24.688  60.318 25.621 1.00 33.73  ? 191 THR H N   1 
ATOM 3034 C CA  . THR B 2 191 ? 25.210  60.544 24.264 1.00 33.73  ? 191 THR H CA  1 
ATOM 3035 C C   . THR B 2 191 ? 25.364  62.026 23.890 1.00 33.73  ? 191 THR H C   1 
ATOM 3036 O O   . THR B 2 191 ? 24.464  62.834 24.114 1.00 33.73  ? 191 THR H O   1 
ATOM 3037 C CB  . THR B 2 191 ? 24.309  59.886 23.188 1.00 41.33  ? 191 THR H CB  1 
ATOM 3038 O OG1 . THR B 2 191 ? 22.939  60.207 23.448 1.00 41.33  ? 191 THR H OG1 1 
ATOM 3039 C CG2 . THR B 2 191 ? 24.486  58.375 23.157 1.00 41.33  ? 191 THR H CG2 1 
ATOM 3040 N N   . VAL B 2 192 ? 26.515  62.378 23.314 1.00 72.54  ? 192 VAL H N   1 
ATOM 3041 C CA  . VAL B 2 192 ? 26.800  63.758 22.907 1.00 72.54  ? 192 VAL H CA  1 
ATOM 3042 C C   . VAL B 2 192 ? 27.091  63.834 21.427 1.00 72.54  ? 192 VAL H C   1 
ATOM 3043 O O   . VAL B 2 192 ? 27.380  62.824 20.808 1.00 72.54  ? 192 VAL H O   1 
ATOM 3044 C CB  . VAL B 2 192 ? 27.992  64.326 23.662 1.00 73.11  ? 192 VAL H CB  1 
ATOM 3045 C CG1 . VAL B 2 192 ? 27.605  64.577 25.112 1.00 73.11  ? 192 VAL H CG1 1 
ATOM 3046 C CG2 . VAL B 2 192 ? 29.161  63.360 23.570 1.00 73.11  ? 192 VAL H CG2 1 
ATOM 3047 N N   . PRO B 2 193 ? 27.029  65.041 20.841 1.00 43.12  ? 193 PRO H N   1 
ATOM 3048 C CA  . PRO B 2 193 ? 27.275  65.272 19.416 1.00 43.12  ? 193 PRO H CA  1 
ATOM 3049 C C   . PRO B 2 193 ? 28.633  64.776 18.961 1.00 43.12  ? 193 PRO H C   1 
ATOM 3050 O O   . PRO B 2 193 ? 29.658  64.987 19.645 1.00 43.12  ? 193 PRO H O   1 
ATOM 3051 C CB  . PRO B 2 193 ? 27.128  66.782 19.299 1.00 80.78  ? 193 PRO H CB  1 
ATOM 3052 C CG  . PRO B 2 193 ? 26.094  67.078 20.356 1.00 80.78  ? 193 PRO H CG  1 
ATOM 3053 C CD  . PRO B 2 193 ? 26.732  66.326 21.491 1.00 80.78  ? 193 PRO H CD  1 
ATOM 3054 N N   . SER B 2 194 ? 28.624  64.104 17.807 1.00 82.81  ? 194 SER H N   1 
ATOM 3055 C CA  . SER B 2 194 ? 29.821  63.527 17.190 1.00 82.81  ? 194 SER H CA  1 
ATOM 3056 C C   . SER B 2 194 ? 31.060  64.371 17.475 1.00 82.81  ? 194 SER H C   1 
ATOM 3057 O O   . SER B 2 194 ? 31.901  63.966 18.272 1.00 82.81  ? 194 SER H O   1 
ATOM 3058 C CB  . SER B 2 194 ? 29.599  63.396 15.687 1.00 43.48  ? 194 SER H CB  1 
ATOM 3059 O OG  . SER B 2 194 ? 28.396  62.690 15.416 1.00 43.48  ? 194 SER H OG  1 
ATOM 3060 N N   . SER B 2 195 ? 31.169  65.535 16.824 1.00 82.55  ? 195 SER H N   1 
ATOM 3061 C CA  . SER B 2 195 ? 32.291  66.457 17.048 1.00 82.55  ? 195 SER H CA  1 
ATOM 3062 C C   . SER B 2 195 ? 31.837  67.578 17.975 1.00 82.55  ? 195 SER H C   1 
ATOM 3063 O O   . SER B 2 195 ? 30.984  68.390 17.615 1.00 82.55  ? 195 SER H O   1 
ATOM 3064 C CB  . SER B 2 195 ? 32.799  67.082 15.734 1.00 67.42  ? 195 SER H CB  1 
ATOM 3065 O OG  . SER B 2 195 ? 33.605  66.209 14.951 1.00 67.42  ? 195 SER H OG  1 
ATOM 3066 N N   . SER B 2 196 ? 32.425  67.604 19.164 1.00 83.53  ? 196 SER H N   1 
ATOM 3067 C CA  . SER B 2 196 ? 32.126  68.590 20.204 1.00 83.53  ? 196 SER H CA  1 
ATOM 3068 C C   . SER B 2 196 ? 32.662  68.023 21.524 1.00 83.53  ? 196 SER H C   1 
ATOM 3069 O O   . SER B 2 196 ? 32.019  68.103 22.581 1.00 83.53  ? 196 SER H O   1 
ATOM 3070 C CB  . SER B 2 196 ? 30.614  68.841 20.300 1.00 100.00 ? 196 SER H CB  1 
ATOM 3071 O OG  . SER B 2 196 ? 29.899  67.637 20.512 1.00 100.00 ? 196 SER H OG  1 
ATOM 3072 N N   . LEU B 2 197 ? 33.862  67.454 21.425 1.00 100.00 ? 197 LEU H N   1 
ATOM 3073 C CA  . LEU B 2 197 ? 34.559  66.815 22.531 1.00 100.00 ? 197 LEU H CA  1 
ATOM 3074 C C   . LEU B 2 197 ? 36.036  67.224 22.452 1.00 100.00 ? 197 LEU H C   1 
ATOM 3075 O O   . LEU B 2 197 ? 36.923  66.370 22.541 1.00 100.00 ? 197 LEU H O   1 
ATOM 3076 C CB  . LEU B 2 197 ? 34.416  65.299 22.363 1.00 99.52  ? 197 LEU H CB  1 
ATOM 3077 C CG  . LEU B 2 197 ? 34.877  64.303 23.421 1.00 99.52  ? 197 LEU H CG  1 
ATOM 3078 C CD1 . LEU B 2 197 ? 34.123  64.581 24.700 1.00 99.52  ? 197 LEU H CD1 1 
ATOM 3079 C CD2 . LEU B 2 197 ? 34.608  62.873 22.954 1.00 99.52  ? 197 LEU H CD2 1 
ATOM 3080 N N   . GLY B 2 198 ? 36.284  68.528 22.282 1.00 89.12  ? 198 GLY H N   1 
ATOM 3081 C CA  . GLY B 2 198 ? 37.641  69.051 22.166 1.00 89.12  ? 198 GLY H CA  1 
ATOM 3082 C C   . GLY B 2 198 ? 38.505  68.792 23.384 1.00 89.12  ? 198 GLY H C   1 
ATOM 3083 O O   . GLY B 2 198 ? 38.779  67.635 23.734 1.00 89.12  ? 198 GLY H O   1 
ATOM 3084 N N   . THR B 2 199 ? 38.975  69.864 24.015 1.00 75.02  ? 199 THR H N   1 
ATOM 3085 C CA  . THR B 2 199 ? 39.776  69.733 25.242 1.00 75.02  ? 199 THR H CA  1 
ATOM 3086 C C   . THR B 2 199 ? 38.787  70.233 26.295 1.00 75.02  ? 199 THR H C   1 
ATOM 3087 O O   . THR B 2 199 ? 39.159  70.877 27.286 1.00 75.02  ? 199 THR H O   1 
ATOM 3088 C CB  . THR B 2 199 ? 41.041  70.649 25.228 1.00 100.00 ? 199 THR H CB  1 
ATOM 3089 O OG1 . THR B 2 199 ? 41.793  70.437 24.022 1.00 100.00 ? 199 THR H OG1 1 
ATOM 3090 C CG2 . THR B 2 199 ? 41.931  70.364 26.449 1.00 100.00 ? 199 THR H CG2 1 
ATOM 3091 N N   . GLN B 2 200 ? 37.515  69.906 26.020 1.00 100.00 ? 200 GLN H N   1 
ATOM 3092 C CA  . GLN B 2 200 ? 36.343  70.295 26.812 1.00 100.00 ? 200 GLN H CA  1 
ATOM 3093 C C   . GLN B 2 200 ? 36.019  69.519 28.070 1.00 100.00 ? 200 GLN H C   1 
ATOM 3094 O O   . GLN B 2 200 ? 36.506  68.413 28.326 1.00 100.00 ? 200 GLN H O   1 
ATOM 3095 C CB  . GLN B 2 200 ? 35.065  70.323 25.933 1.00 100.00 ? 200 GLN H CB  1 
ATOM 3096 C CG  . GLN B 2 200 ? 33.843  70.978 26.627 1.00 100.00 ? 200 GLN H CG  1 
ATOM 3097 C CD  . GLN B 2 200 ? 32.665  71.263 25.694 1.00 100.00 ? 200 GLN H CD  1 
ATOM 3098 O OE1 . GLN B 2 200 ? 32.847  71.617 24.520 1.00 100.00 ? 200 GLN H OE1 1 
ATOM 3099 N NE2 . GLN B 2 200 ? 31.452  71.158 26.231 1.00 100.00 ? 200 GLN H NE2 1 
ATOM 3100 N N   . THR B 2 201 ? 35.141  70.148 28.830 1.00 50.40  ? 201 THR H N   1 
ATOM 3101 C CA  . THR B 2 201 ? 34.660  69.665 30.092 1.00 50.40  ? 201 THR H CA  1 
ATOM 3102 C C   . THR B 2 201 ? 33.426  68.799 29.916 1.00 50.40  ? 201 THR H C   1 
ATOM 3103 O O   . THR B 2 201 ? 32.797  68.805 28.858 1.00 50.40  ? 201 THR H O   1 
ATOM 3104 C CB  . THR B 2 201 ? 34.244  70.837 30.936 1.00 61.02  ? 201 THR H CB  1 
ATOM 3105 O OG1 . THR B 2 201 ? 33.933  70.396 32.260 1.00 61.02  ? 201 THR H OG1 1 
ATOM 3106 C CG2 . THR B 2 201 ? 33.015  71.497 30.302 1.00 61.02  ? 201 THR H CG2 1 
ATOM 3107 N N   . TYR B 2 202 ? 33.120  68.079 30.999 1.00 72.86  ? 202 TYR H N   1 
ATOM 3108 C CA  . TYR B 2 202 ? 31.966  67.196 31.224 1.00 72.86  ? 202 TYR H CA  1 
ATOM 3109 C C   . TYR B 2 202 ? 32.194  66.675 32.613 1.00 72.86  ? 202 TYR H C   1 
ATOM 3110 O O   . TYR B 2 202 ? 32.805  65.637 32.785 1.00 72.86  ? 202 TYR H O   1 
ATOM 3111 C CB  . TYR B 2 202 ? 31.880  65.974 30.302 1.00 36.55  ? 202 TYR H CB  1 
ATOM 3112 C CG  . TYR B 2 202 ? 31.267  66.244 28.957 1.00 36.55  ? 202 TYR H CG  1 
ATOM 3113 C CD1 . TYR B 2 202 ? 30.128  67.046 28.826 1.00 36.55  ? 202 TYR H CD1 1 
ATOM 3114 C CD2 . TYR B 2 202 ? 31.841  65.720 27.808 1.00 36.55  ? 202 TYR H CD2 1 
ATOM 3115 C CE1 . TYR B 2 202 ? 29.607  67.316 27.582 1.00 36.55  ? 202 TYR H CE1 1 
ATOM 3116 C CE2 . TYR B 2 202 ? 31.320  65.990 26.575 1.00 36.55  ? 202 TYR H CE2 1 
ATOM 3117 C CZ  . TYR B 2 202 ? 30.223  66.784 26.469 1.00 36.55  ? 202 TYR H CZ  1 
ATOM 3118 O OH  . TYR B 2 202 ? 29.809  67.099 25.223 1.00 36.55  ? 202 TYR H OH  1 
ATOM 3119 N N   . ILE B 2 203 ? 31.733  67.395 33.616 1.00 74.69  ? 203 ILE H N   1 
ATOM 3120 C CA  . ILE B 2 203 ? 31.927  66.911 34.955 1.00 74.69  ? 203 ILE H CA  1 
ATOM 3121 C C   . ILE B 2 203 ? 30.867  65.850 35.187 1.00 74.69  ? 203 ILE H C   1 
ATOM 3122 O O   . ILE B 2 203 ? 29.915  65.755 34.423 1.00 74.69  ? 203 ILE H O   1 
ATOM 3123 C CB  . ILE B 2 203 ? 31.771  68.035 35.921 1.00 81.00  ? 203 ILE H CB  1 
ATOM 3124 C CG1 . ILE B 2 203 ? 32.457  69.256 35.331 1.00 81.00  ? 203 ILE H CG1 1 
ATOM 3125 C CG2 . ILE B 2 203 ? 32.461  67.698 37.226 1.00 81.00  ? 203 ILE H CG2 1 
ATOM 3126 C CD1 . ILE B 2 203 ? 33.912  68.991 34.984 1.00 81.00  ? 203 ILE H CD1 1 
ATOM 3127 N N   . CYS B 2 204 ? 31.037  65.034 36.219 1.00 79.60  ? 204 CYS H N   1 
ATOM 3128 C CA  . CYS B 2 204 ? 30.085  63.972 36.532 1.00 79.60  ? 204 CYS H CA  1 
ATOM 3129 C C   . CYS B 2 204 ? 29.731  64.193 38.001 1.00 79.60  ? 204 CYS H C   1 
ATOM 3130 O O   . CYS B 2 204 ? 30.569  64.012 38.868 1.00 79.60  ? 204 CYS H O   1 
ATOM 3131 C CB  . CYS B 2 204 ? 30.764  62.618 36.275 1.00 49.85  ? 204 CYS H CB  1 
ATOM 3132 S SG  . CYS B 2 204 ? 29.750  61.129 36.451 1.00 49.85  ? 204 CYS H SG  1 
ATOM 3133 N N   . ASN B 2 205 ? 28.493  64.608 38.266 1.00 54.98  ? 205 ASN H N   1 
ATOM 3134 C CA  . ASN B 2 205 ? 28.040  64.927 39.627 1.00 54.98  ? 205 ASN H CA  1 
ATOM 3135 C C   . ASN B 2 205 ? 27.226  63.858 40.353 1.00 54.98  ? 205 ASN H C   1 
ATOM 3136 O O   . ASN B 2 205 ? 26.029  64.043 40.587 1.00 54.98  ? 205 ASN H O   1 
ATOM 3137 C CB  . ASN B 2 205 ? 27.216  66.213 39.597 1.00 52.64  ? 205 ASN H CB  1 
ATOM 3138 C CG  . ASN B 2 205 ? 27.958  67.368 38.950 1.00 52.64  ? 205 ASN H CG  1 
ATOM 3139 O OD1 . ASN B 2 205 ? 28.921  67.910 39.515 1.00 52.64  ? 205 ASN H OD1 1 
ATOM 3140 N ND2 . ASN B 2 205 ? 27.520  67.751 37.745 1.00 52.64  ? 205 ASN H ND2 1 
ATOM 3141 N N   . VAL B 2 206 ? 27.869  62.756 40.727 1.00 24.26  ? 206 VAL H N   1 
ATOM 3142 C CA  . VAL B 2 206 ? 27.172  61.702 41.420 1.00 24.26  ? 206 VAL H CA  1 
ATOM 3143 C C   . VAL B 2 206 ? 26.942  62.164 42.828 1.00 24.26  ? 206 VAL H C   1 
ATOM 3144 O O   . VAL B 2 206 ? 27.885  62.388 43.554 1.00 24.26  ? 206 VAL H O   1 
ATOM 3145 C CB  . VAL B 2 206 ? 27.988  60.456 41.470 1.00 42.77  ? 206 VAL H CB  1 
ATOM 3146 C CG1 . VAL B 2 206 ? 27.240  59.415 42.244 1.00 42.77  ? 206 VAL H CG1 1 
ATOM 3147 C CG2 . VAL B 2 206 ? 28.280  59.989 40.085 1.00 42.77  ? 206 VAL H CG2 1 
ATOM 3148 N N   . ASN B 2 207 ? 25.692  62.335 43.226 1.00 71.84  ? 207 ASN H N   1 
ATOM 3149 C CA  . ASN B 2 207 ? 25.410  62.783 44.584 1.00 71.84  ? 207 ASN H CA  1 
ATOM 3150 C C   . ASN B 2 207 ? 24.862  61.541 45.285 1.00 71.84  ? 207 ASN H C   1 
ATOM 3151 O O   . ASN B 2 207 ? 24.296  60.659 44.630 1.00 71.84  ? 207 ASN H O   1 
ATOM 3152 C CB  . ASN B 2 207 ? 24.354  63.908 44.570 1.00 45.02  ? 207 ASN H CB  1 
ATOM 3153 C CG  . ASN B 2 207 ? 24.539  64.922 45.711 1.00 45.02  ? 207 ASN H CG  1 
ATOM 3154 O OD1 . ASN B 2 207 ? 25.154  64.612 46.727 1.00 45.02  ? 207 ASN H OD1 1 
ATOM 3155 N ND2 . ASN B 2 207 ? 23.980  66.127 45.546 1.00 45.02  ? 207 ASN H ND2 1 
ATOM 3156 N N   . HIS B 2 208 ? 25.047  61.459 46.600 1.00 84.34  ? 208 HIS H N   1 
ATOM 3157 C CA  . HIS B 2 208 ? 24.559  60.322 47.373 1.00 84.34  ? 208 HIS H CA  1 
ATOM 3158 C C   . HIS B 2 208 ? 24.516  60.728 48.835 1.00 84.34  ? 208 HIS H C   1 
ATOM 3159 O O   . HIS B 2 208 ? 25.547  60.777 49.505 1.00 84.34  ? 208 HIS H O   1 
ATOM 3160 C CB  . HIS B 2 208 ? 25.459  59.094 47.143 1.00 69.76  ? 208 HIS H CB  1 
ATOM 3161 C CG  . HIS B 2 208 ? 25.005  57.855 47.858 1.00 69.76  ? 208 HIS H CG  1 
ATOM 3162 N ND1 . HIS B 2 208 ? 25.411  57.539 49.136 1.00 69.76  ? 208 HIS H ND1 1 
ATOM 3163 C CD2 . HIS B 2 208 ? 24.171  56.858 47.477 1.00 69.76  ? 208 HIS H CD2 1 
ATOM 3164 C CE1 . HIS B 2 208 ? 24.851  56.401 49.510 1.00 69.76  ? 208 HIS H CE1 1 
ATOM 3165 N NE2 . HIS B 2 208 ? 24.092  55.968 48.521 1.00 69.76  ? 208 HIS H NE2 1 
ATOM 3166 N N   . LYS B 2 209 ? 23.303  61.026 49.307 1.00 66.39  ? 209 LYS H N   1 
ATOM 3167 C CA  . LYS B 2 209 ? 23.041  61.467 50.683 1.00 66.39  ? 209 LYS H CA  1 
ATOM 3168 C C   . LYS B 2 209 ? 23.197  60.423 51.786 1.00 66.39  ? 209 LYS H C   1 
ATOM 3169 O O   . LYS B 2 209 ? 23.898  60.665 52.770 1.00 66.39  ? 209 LYS H O   1 
ATOM 3170 C CB  . LYS B 2 209 ? 21.629  62.047 50.800 1.00 58.43  ? 209 LYS H CB  1 
ATOM 3171 C CG  . LYS B 2 209 ? 21.322  63.097 49.782 1.00 58.43  ? 209 LYS H CG  1 
ATOM 3172 C CD  . LYS B 2 209 ? 19.922  63.649 49.960 1.00 58.43  ? 209 LYS H CD  1 
ATOM 3173 C CE  . LYS B 2 209 ? 19.597  64.682 48.882 1.00 58.43  ? 209 LYS H CE  1 
ATOM 3174 N NZ  . LYS B 2 209 ? 18.260  65.284 49.080 1.00 58.43  ? 209 LYS H NZ  1 
ATOM 3175 N N   . PRO B 2 210 ? 22.547  59.250 51.644 1.00 35.54  ? 210 PRO H N   1 
ATOM 3176 C CA  . PRO B 2 210 ? 22.663  58.231 52.684 1.00 35.54  ? 210 PRO H CA  1 
ATOM 3177 C C   . PRO B 2 210 ? 24.046  58.130 53.339 1.00 35.54  ? 210 PRO H C   1 
ATOM 3178 O O   . PRO B 2 210 ? 24.145  58.022 54.564 1.00 35.54  ? 210 PRO H O   1 
ATOM 3179 C CB  . PRO B 2 210 ? 22.219  56.951 51.952 1.00 86.15  ? 210 PRO H CB  1 
ATOM 3180 C CG  . PRO B 2 210 ? 22.232  57.340 50.470 1.00 86.15  ? 210 PRO H CG  1 
ATOM 3181 C CD  . PRO B 2 210 ? 21.727  58.731 50.541 1.00 86.15  ? 210 PRO H CD  1 
ATOM 3182 N N   . SER B 2 211 ? 25.100  58.213 52.530 1.00 51.97  ? 211 SER H N   1 
ATOM 3183 C CA  . SER B 2 211 ? 26.481  58.108 53.018 1.00 51.97  ? 211 SER H CA  1 
ATOM 3184 C C   . SER B 2 211 ? 27.034  59.396 53.596 1.00 51.97  ? 211 SER H C   1 
ATOM 3185 O O   . SER B 2 211 ? 27.646  59.409 54.671 1.00 51.97  ? 211 SER H O   1 
ATOM 3186 C CB  . SER B 2 211 ? 27.406  57.753 51.873 1.00 69.38  ? 211 SER H CB  1 
ATOM 3187 O OG  . SER B 2 211 ? 27.498  58.878 51.009 1.00 69.38  ? 211 SER H OG  1 
ATOM 3188 N N   . ASN B 2 212 ? 26.832  60.454 52.813 1.00 70.21  ? 212 ASN H N   1 
ATOM 3189 C CA  . ASN B 2 212 ? 27.297  61.815 53.062 1.00 70.21  ? 212 ASN H CA  1 
ATOM 3190 C C   . ASN B 2 212 ? 28.484  61.958 52.123 1.00 70.21  ? 212 ASN H C   1 
ATOM 3191 O O   . ASN B 2 212 ? 29.460  62.636 52.463 1.00 70.21  ? 212 ASN H O   1 
ATOM 3192 C CB  . ASN B 2 212 ? 27.769  62.026 54.505 1.00 100.00 ? 212 ASN H CB  1 
ATOM 3193 C CG  . ASN B 2 212 ? 26.639  61.954 55.506 1.00 100.00 ? 212 ASN H CG  1 
ATOM 3194 O OD1 . ASN B 2 212 ? 25.660  62.688 55.398 1.00 100.00 ? 212 ASN H OD1 1 
ATOM 3195 N ND2 . ASN B 2 212 ? 26.771  61.075 56.494 1.00 100.00 ? 212 ASN H ND2 1 
ATOM 3196 N N   . THR B 2 213 ? 28.384  61.318 50.944 1.00 98.96  ? 213 THR H N   1 
ATOM 3197 C CA  . THR B 2 213 ? 29.454  61.315 49.928 1.00 98.96  ? 213 THR H CA  1 
ATOM 3198 C C   . THR B 2 213 ? 29.228  62.098 48.626 1.00 98.96  ? 213 THR H C   1 
ATOM 3199 O O   . THR B 2 213 ? 28.163  62.029 48.013 1.00 98.96  ? 213 THR H O   1 
ATOM 3200 C CB  . THR B 2 213 ? 29.838  59.868 49.539 1.00 75.72  ? 213 THR H CB  1 
ATOM 3201 O OG1 . THR B 2 213 ? 30.395  59.196 50.680 1.00 75.72  ? 213 THR H OG1 1 
ATOM 3202 C CG2 . THR B 2 213 ? 30.849  59.866 48.402 1.00 75.72  ? 213 THR H CG2 1 
ATOM 3203 N N   . LYS B 2 214 ? 30.268  62.826 48.212 1.00 100.00 ? 214 LYS H N   1 
ATOM 3204 C CA  . LYS B 2 214 ? 30.255  63.643 46.998 1.00 100.00 ? 214 LYS H CA  1 
ATOM 3205 C C   . LYS B 2 214 ? 31.407  63.309 46.055 1.00 100.00 ? 214 LYS H C   1 
ATOM 3206 O O   . LYS B 2 214 ? 32.572  63.255 46.465 1.00 100.00 ? 214 LYS H O   1 
ATOM 3207 C CB  . LYS B 2 214 ? 30.421  65.122 47.327 1.00 70.91  ? 214 LYS H CB  1 
ATOM 3208 C CG  . LYS B 2 214 ? 29.358  65.775 48.138 1.00 70.91  ? 214 LYS H CG  1 
ATOM 3209 C CD  . LYS B 2 214 ? 29.582  67.273 48.106 1.00 70.91  ? 214 LYS H CD  1 
ATOM 3210 C CE  . LYS B 2 214 ? 28.363  68.007 48.608 1.00 70.91  ? 214 LYS H CE  1 
ATOM 3211 N NZ  . LYS B 2 214 ? 27.132  67.713 47.786 1.00 70.91  ? 214 LYS H NZ  1 
ATOM 3212 N N   . VAL B 2 215 ? 31.082  63.126 44.784 1.00 53.49  ? 215 VAL H N   1 
ATOM 3213 C CA  . VAL B 2 215 ? 32.090  62.859 43.757 1.00 53.49  ? 215 VAL H CA  1 
ATOM 3214 C C   . VAL B 2 215 ? 31.713  63.481 42.422 1.00 53.49  ? 215 VAL H C   1 
ATOM 3215 O O   . VAL B 2 215 ? 30.586  63.346 41.944 1.00 53.49  ? 215 VAL H O   1 
ATOM 3216 C CB  . VAL B 2 215 ? 32.320  61.365 43.542 1.00 10.00  ? 215 VAL H CB  1 
ATOM 3217 C CG1 . VAL B 2 215 ? 33.003  61.135 42.216 1.00 10.00  ? 215 VAL H CG1 1 
ATOM 3218 C CG2 . VAL B 2 215 ? 33.182  60.839 44.639 1.00 10.00  ? 215 VAL H CG2 1 
ATOM 3219 N N   . ASP B 2 216 ? 32.654  64.184 41.821 1.00 57.50  ? 216 ASP H N   1 
ATOM 3220 C CA  . ASP B 2 216 ? 32.369  64.788 40.548 1.00 57.50  ? 216 ASP H CA  1 
ATOM 3221 C C   . ASP B 2 216 ? 33.368  64.321 39.521 1.00 57.50  ? 216 ASP H C   1 
ATOM 3222 O O   . ASP B 2 216 ? 34.201  65.085 39.082 1.00 57.50  ? 216 ASP H O   1 
ATOM 3223 C CB  . ASP B 2 216 ? 32.383  66.299 40.686 1.00 61.06  ? 216 ASP H CB  1 
ATOM 3224 C CG  . ASP B 2 216 ? 31.280  66.789 41.584 1.00 61.06  ? 216 ASP H CG  1 
ATOM 3225 O OD1 . ASP B 2 216 ? 30.111  66.403 41.374 1.00 61.06  ? 216 ASP H OD1 1 
ATOM 3226 O OD2 . ASP B 2 216 ? 31.569  67.566 42.504 1.00 61.06  ? 216 ASP H OD2 1 
ATOM 3227 N N   . LYS B 2 217 ? 33.280  63.064 39.117 1.00 31.49  ? 217 LYS H N   1 
ATOM 3228 C CA  . LYS B 2 217 ? 34.236  62.546 38.163 1.00 31.49  ? 217 LYS H CA  1 
ATOM 3229 C C   . LYS B 2 217 ? 34.165  63.250 36.793 1.00 31.49  ? 217 LYS H C   1 
ATOM 3230 O O   . LYS B 2 217 ? 33.107  63.665 36.349 1.00 31.49  ? 217 LYS H O   1 
ATOM 3231 C CB  . LYS B 2 217 ? 34.045  61.027 38.011 1.00 87.14  ? 217 LYS H CB  1 
ATOM 3232 C CG  . LYS B 2 217 ? 35.304  60.291 37.592 1.00 87.14  ? 217 LYS H CG  1 
ATOM 3233 C CD  . LYS B 2 217 ? 36.436  60.589 38.589 1.00 87.14  ? 217 LYS H CD  1 
ATOM 3234 C CE  . LYS B 2 217 ? 37.769  59.912 38.206 1.00 87.14  ? 217 LYS H CE  1 
ATOM 3235 N NZ  . LYS B 2 217 ? 38.942  60.225 39.117 1.00 87.14  ? 217 LYS H NZ  1 
ATOM 3236 N N   . LYS B 2 218 ? 35.319  63.380 36.143 1.00 39.60  ? 218 LYS H N   1 
ATOM 3237 C CA  . LYS B 2 218 ? 35.452  64.002 34.836 1.00 39.60  ? 218 LYS H CA  1 
ATOM 3238 C C   . LYS B 2 218 ? 35.456  62.881 33.796 1.00 39.60  ? 218 LYS H C   1 
ATOM 3239 O O   . LYS B 2 218 ? 36.442  62.188 33.670 1.00 39.60  ? 218 LYS H O   1 
ATOM 3240 C CB  . LYS B 2 218 ? 36.797  64.730 34.778 1.00 71.19  ? 218 LYS H CB  1 
ATOM 3241 C CG  . LYS B 2 218 ? 37.094  65.482 33.502 1.00 71.19  ? 218 LYS H CG  1 
ATOM 3242 C CD  . LYS B 2 218 ? 36.498  66.881 33.539 1.00 71.19  ? 218 LYS H CD  1 
ATOM 3243 C CE  . LYS B 2 218 ? 36.562  67.589 32.164 1.00 71.19  ? 218 LYS H CE  1 
ATOM 3244 N NZ  . LYS B 2 218 ? 36.214  69.041 32.241 1.00 71.19  ? 218 LYS H NZ  1 
ATOM 3245 N N   . VAL B 2 219 ? 34.380  62.671 33.056 1.00 24.36  ? 219 VAL H N   1 
ATOM 3246 C CA  . VAL B 2 219 ? 34.421  61.614 32.055 1.00 24.36  ? 219 VAL H CA  1 
ATOM 3247 C C   . VAL B 2 219 ? 35.180  62.107 30.838 1.00 24.36  ? 219 VAL H C   1 
ATOM 3248 O O   . VAL B 2 219 ? 36.405  61.851 30.775 1.00 24.36  ? 219 VAL H O   1 
ATOM 3249 C CB  . VAL B 2 219 ? 33.023  61.205 31.578 1.00 55.39  ? 219 VAL H CB  1 
ATOM 3250 C CG1 . VAL B 2 219 ? 32.272  62.428 31.111 1.00 55.39  ? 219 VAL H CG1 1 
ATOM 3251 C CG2 . VAL B 2 219 ? 33.126  60.208 30.428 1.00 55.39  ? 219 VAL H CG2 1 
ATOM 3252 O OXT . VAL B 2 219 ? 34.553  62.767 29.969 1.00 24.36  ? 219 VAL H OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   GLN 3   3   3   GLN GLN L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   SER 9   9   9   SER SER L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  SER 12  12  12  SER SER L . n 
A 1 13  ALA 13  13  13  ALA ALA L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  VAL 15  15  15  VAL VAL L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  ASP 17  17  17  ASP ASP L . n 
A 1 18  ARG 18  18  18  ARG ARG L . n 
A 1 19  VAL 19  19  19  VAL VAL L . n 
A 1 20  THR 20  20  20  THR THR L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  THR 22  22  22  THR THR L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  LYS 24  24  24  LYS LYS L . n 
A 1 25  ALA 25  25  25  ALA ALA L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  ASN 28  28  28  ASN ASN L . n 
A 1 29  ILE 29  29  29  ILE ILE L . n 
A 1 30  ASP 30  30  30  ASP ASP L . n 
A 1 31  LYS 31  31  31  LYS LYS L . n 
A 1 32  TYR 32  32  32  TYR TYR L . n 
A 1 33  LEU 33  33  33  LEU LEU L . n 
A 1 34  ASN 34  34  34  ASN ASN L . n 
A 1 35  TRP 35  35  35  TRP TRP L . n 
A 1 36  TYR 36  36  36  TYR TYR L . n 
A 1 37  GLN 37  37  37  GLN GLN L . n 
A 1 38  GLN 38  38  38  GLN GLN L . n 
A 1 39  LYS 39  39  39  LYS LYS L . n 
A 1 40  PRO 40  40  40  PRO PRO L . n 
A 1 41  GLY 41  41  41  GLY GLY L . n 
A 1 42  LYS 42  42  42  LYS LYS L . n 
A 1 43  ALA 43  43  43  ALA ALA L . n 
A 1 44  PRO 44  44  44  PRO PRO L . n 
A 1 45  LYS 45  45  45  LYS LYS L . n 
A 1 46  LEU 46  46  46  LEU LEU L . n 
A 1 47  LEU 47  47  47  LEU LEU L . n 
A 1 48  ILE 48  48  48  ILE ILE L . n 
A 1 49  TYR 49  49  49  TYR TYR L . n 
A 1 50  ASN 50  50  50  ASN ASN L . n 
A 1 51  THR 51  51  51  THR THR L . n 
A 1 52  ASN 52  52  52  ASN ASN L . n 
A 1 53  ASN 53  53  53  ASN ASN L . n 
A 1 54  LEU 54  54  54  LEU LEU L . n 
A 1 55  GLN 55  55  55  GLN GLN L . n 
A 1 56  THR 56  56  56  THR THR L . n 
A 1 57  GLY 57  57  57  GLY GLY L . n 
A 1 58  VAL 58  58  58  VAL VAL L . n 
A 1 59  PRO 59  59  59  PRO PRO L . n 
A 1 60  SER 60  60  60  SER SER L . n 
A 1 61  ARG 61  61  61  ARG ARG L . n 
A 1 62  PHE 62  62  62  PHE PHE L . n 
A 1 63  SER 63  63  63  SER SER L . n 
A 1 64  GLY 64  64  64  GLY GLY L . n 
A 1 65  SER 65  65  65  SER SER L . n 
A 1 66  GLY 66  66  66  GLY GLY L . n 
A 1 67  SER 67  67  67  SER SER L . n 
A 1 68  GLY 68  68  68  GLY GLY L . n 
A 1 69  THR 69  69  69  THR THR L . n 
A 1 70  ASP 70  70  70  ASP ASP L . n 
A 1 71  PHE 71  71  71  PHE PHE L . n 
A 1 72  THR 72  72  72  THR THR L . n 
A 1 73  PHE 73  73  73  PHE PHE L . n 
A 1 74  THR 74  74  74  THR THR L . n 
A 1 75  ILE 75  75  75  ILE ILE L . n 
A 1 76  SER 76  76  76  SER SER L . n 
A 1 77  SER 77  77  77  SER SER L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  GLN 79  79  79  GLN GLN L . n 
A 1 80  PRO 80  80  80  PRO PRO L . n 
A 1 81  GLU 81  81  81  GLU GLU L . n 
A 1 82  ASP 82  82  82  ASP ASP L . n 
A 1 83  ILE 83  83  83  ILE ILE L . n 
A 1 84  ALA 84  84  84  ALA ALA L . n 
A 1 85  THR 85  85  85  THR THR L . n 
A 1 86  TYR 86  86  86  TYR TYR L . n 
A 1 87  TYR 87  87  87  TYR TYR L . n 
A 1 88  CYS 88  88  88  CYS CYS L . n 
A 1 89  LEU 89  89  89  LEU LEU L . n 
A 1 90  GLN 90  90  90  GLN GLN L . n 
A 1 91  HIS 91  91  91  HIS HIS L . n 
A 1 92  ILE 92  92  92  ILE ILE L . n 
A 1 93  SER 93  93  93  SER SER L . n 
A 1 94  ARG 94  94  94  ARG ARG L . n 
A 1 95  PRO 95  95  95  PRO PRO L . n 
A 1 96  ARG 96  96  96  ARG ARG L . n 
A 1 97  THR 97  97  97  THR THR L . n 
A 1 98  PHE 98  98  98  PHE PHE L . n 
A 1 99  GLY 99  99  99  GLY GLY L . n 
A 1 100 GLN 100 100 100 GLN GLN L . n 
A 1 101 GLY 101 101 101 GLY GLY L . n 
A 1 102 THR 102 102 102 THR THR L . n 
A 1 103 LYS 103 103 103 LYS LYS L . n 
A 1 104 VAL 104 104 104 VAL VAL L . n 
A 1 105 GLU 105 105 105 GLU GLU L . n 
A 1 106 ILE 106 106 106 ILE ILE L . n 
A 1 107 LYS 107 107 107 LYS LYS L . n 
A 1 108 ARG 108 108 108 ARG ARG L . n 
A 1 109 THR 109 109 109 THR THR L . n 
A 1 110 VAL 110 110 110 VAL VAL L . n 
A 1 111 ALA 111 111 111 ALA ALA L . n 
A 1 112 ALA 112 112 112 ALA ALA L . n 
A 1 113 PRO 113 113 113 PRO PRO L . n 
A 1 114 SER 114 114 114 SER SER L . n 
A 1 115 VAL 115 115 115 VAL VAL L . n 
A 1 116 PHE 116 116 116 PHE PHE L . n 
A 1 117 ILE 117 117 117 ILE ILE L . n 
A 1 118 PHE 118 118 118 PHE PHE L . n 
A 1 119 PRO 119 119 119 PRO PRO L . n 
A 1 120 PRO 120 120 120 PRO PRO L . n 
A 1 121 SER 121 121 121 SER SER L . n 
A 1 122 ASP 122 122 122 ASP ASP L . n 
A 1 123 GLU 123 123 123 GLU GLU L . n 
A 1 124 GLN 124 124 124 GLN GLN L . n 
A 1 125 LEU 125 125 125 LEU LEU L . n 
A 1 126 LYS 126 126 126 LYS LYS L . n 
A 1 127 SER 127 127 127 SER SER L . n 
A 1 128 GLY 128 128 128 GLY GLY L . n 
A 1 129 THR 129 129 129 THR THR L . n 
A 1 130 ALA 130 130 130 ALA ALA L . n 
A 1 131 SER 131 131 131 SER SER L . n 
A 1 132 VAL 132 132 132 VAL VAL L . n 
A 1 133 VAL 133 133 133 VAL VAL L . n 
A 1 134 CYS 134 134 134 CYS CYS L . n 
A 1 135 LEU 135 135 135 LEU LEU L . n 
A 1 136 LEU 136 136 136 LEU LEU L . n 
A 1 137 ASN 137 137 137 ASN ASN L . n 
A 1 138 ASN 138 138 138 ASN ASN L . n 
A 1 139 PHE 139 139 139 PHE PHE L . n 
A 1 140 TYR 140 140 140 TYR TYR L . n 
A 1 141 PRO 141 141 141 PRO PRO L . n 
A 1 142 ARG 142 142 142 ARG ARG L . n 
A 1 143 GLU 143 143 143 GLU GLU L . n 
A 1 144 ALA 144 144 144 ALA ALA L . n 
A 1 145 LYS 145 145 145 LYS LYS L . n 
A 1 146 VAL 146 146 146 VAL VAL L . n 
A 1 147 GLN 147 147 147 GLN GLN L . n 
A 1 148 TRP 148 148 148 TRP TRP L . n 
A 1 149 LYS 149 149 149 LYS LYS L . n 
A 1 150 VAL 150 150 150 VAL VAL L . n 
A 1 151 ASP 151 151 151 ASP ASP L . n 
A 1 152 ASN 152 152 152 ASN ASN L . n 
A 1 153 ALA 153 153 153 ALA ALA L . n 
A 1 154 LEU 154 154 154 LEU LEU L . n 
A 1 155 GLN 155 155 155 GLN GLN L . n 
A 1 156 SER 156 156 156 SER SER L . n 
A 1 157 GLY 157 157 157 GLY GLY L . n 
A 1 158 ASN 158 158 158 ASN ASN L . n 
A 1 159 SER 159 159 159 SER SER L . n 
A 1 160 GLN 160 160 160 GLN GLN L . n 
A 1 161 GLU 161 161 161 GLU GLU L . n 
A 1 162 SER 162 162 162 SER SER L . n 
A 1 163 VAL 163 163 163 VAL VAL L . n 
A 1 164 THR 164 164 164 THR THR L . n 
A 1 165 GLU 165 165 165 GLU GLU L . n 
A 1 166 GLN 166 166 166 GLN GLN L . n 
A 1 167 ASP 167 167 167 ASP ASP L . n 
A 1 168 SER 168 168 168 SER SER L . n 
A 1 169 LYS 169 169 169 LYS LYS L . n 
A 1 170 ASP 170 170 170 ASP ASP L . n 
A 1 171 SER 171 171 171 SER SER L . n 
A 1 172 THR 172 172 172 THR THR L . n 
A 1 173 TYR 173 173 173 TYR TYR L . n 
A 1 174 SER 174 174 174 SER SER L . n 
A 1 175 LEU 175 175 175 LEU LEU L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 SER 177 177 177 SER SER L . n 
A 1 178 THR 178 178 178 THR THR L . n 
A 1 179 LEU 179 179 179 LEU LEU L . n 
A 1 180 THR 180 180 180 THR THR L . n 
A 1 181 LEU 181 181 181 LEU LEU L . n 
A 1 182 SER 182 182 182 SER SER L . n 
A 1 183 LYS 183 183 183 LYS LYS L . n 
A 1 184 ALA 184 184 184 ALA ALA L . n 
A 1 185 ASP 185 185 185 ASP ASP L . n 
A 1 186 TYR 186 186 186 TYR TYR L . n 
A 1 187 GLU 187 187 187 GLU GLU L . n 
A 1 188 LYS 188 188 188 LYS LYS L . n 
A 1 189 HIS 189 189 189 HIS HIS L . n 
A 1 190 LYS 190 190 190 LYS LYS L . n 
A 1 191 VAL 191 191 191 VAL VAL L . n 
A 1 192 TYR 192 192 192 TYR TYR L . n 
A 1 193 ALA 193 193 193 ALA ALA L . n 
A 1 194 CYS 194 194 194 CYS CYS L . n 
A 1 195 GLU 195 195 195 GLU GLU L . n 
A 1 196 VAL 196 196 196 VAL VAL L . n 
A 1 197 THR 197 197 197 THR THR L . n 
A 1 198 HIS 198 198 198 HIS HIS L . n 
A 1 199 GLN 199 199 199 GLN GLN L . n 
A 1 200 GLY 200 200 200 GLY GLY L . n 
A 1 201 LEU 201 201 201 LEU LEU L . n 
A 1 202 SER 202 202 202 SER SER L . n 
A 1 203 SER 203 203 203 SER SER L . n 
A 1 204 PRO 204 204 204 PRO PRO L . n 
A 1 205 VAL 205 205 205 VAL VAL L . n 
A 1 206 THR 206 206 206 THR THR L . n 
A 1 207 LYS 207 207 207 LYS LYS L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PHE 209 209 209 PHE PHE L . n 
A 1 210 ASN 210 210 210 ASN ASN L . n 
A 1 211 ARG 211 211 211 ARG ARG L . n 
A 1 212 GLY 212 212 212 GLY GLY L . n 
A 1 213 GLU 213 213 213 GLU GLU L . n 
A 1 214 CYS 214 214 214 CYS CYS L . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   PRO 9   9   9   PRO PRO H . n 
B 2 10  GLY 10  10  10  GLY GLY H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  ARG 13  13  13  ARG ARG H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  SER 15  15  15  SER SER H . n 
B 2 16  GLN 16  16  16  GLN GLN H . n 
B 2 17  THR 17  17  17  THR THR H . n 
B 2 18  LEU 18  18  18  LEU LEU H . n 
B 2 19  SER 19  19  19  SER SER H . n 
B 2 20  LEU 20  20  20  LEU LEU H . n 
B 2 21  THR 21  21  21  THR THR H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  THR 23  23  23  THR THR H . n 
B 2 24  VAL 24  24  24  VAL VAL H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  PHE 27  27  27  PHE PHE H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  ASP 31  31  31  ASP ASP H . n 
B 2 32  PHE 32  32  32  PHE PHE H . n 
B 2 33  TYR 33  33  33  TYR TYR H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  ASN 35  35  35  ASN ASN H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  ARG 38  38  38  ARG ARG H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  PRO 40  40  40  PRO PRO H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  ARG 43  43  43  ARG ARG H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  ILE 48  48  48  ILE ILE H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  PHE 50  50  50  PHE PHE H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  ARG 52  52  52  ARG ARG H . n 
B 2 53  ASP 53  53  53  ASP ASP H . n 
B 2 54  LYS 54  54  54  LYS LYS H . n 
B 2 55  ALA 55  55  55  ALA ALA H . n 
B 2 56  LYS 56  56  56  LYS LYS H . n 
B 2 57  GLY 57  57  57  GLY GLY H . n 
B 2 58  TYR 58  58  58  TYR TYR H . n 
B 2 59  THR 59  59  59  THR THR H . n 
B 2 60  THR 60  60  60  THR THR H . n 
B 2 61  GLU 61  61  61  GLU GLU H . n 
B 2 62  TYR 62  62  62  TYR TYR H . n 
B 2 63  ASN 63  63  63  ASN ASN H . n 
B 2 64  PRO 64  64  64  PRO PRO H . n 
B 2 65  SER 65  65  65  SER SER H . n 
B 2 66  VAL 66  66  66  VAL VAL H . n 
B 2 67  LYS 67  67  67  LYS LYS H . n 
B 2 68  GLY 68  68  68  GLY GLY H . n 
B 2 69  ARG 69  69  69  ARG ARG H . n 
B 2 70  VAL 70  70  70  VAL VAL H . n 
B 2 71  THR 71  71  71  THR THR H . n 
B 2 72  MET 72  72  72  MET MET H . n 
B 2 73  LEU 73  73  73  LEU LEU H . n 
B 2 74  VAL 74  74  74  VAL VAL H . n 
B 2 75  ASP 75  75  75  ASP ASP H . n 
B 2 76  THR 76  76  76  THR THR H . n 
B 2 77  SER 77  77  77  SER SER H . n 
B 2 78  LYS 78  78  78  LYS LYS H . n 
B 2 79  ASN 79  79  79  ASN ASN H . n 
B 2 80  GLN 80  80  80  GLN GLN H . n 
B 2 81  PHE 81  81  81  PHE PHE H . n 
B 2 82  SER 82  82  82  SER SER H . n 
B 2 83  LEU 83  83  83  LEU LEU H . n 
B 2 84  ARG 84  84  84  ARG ARG H . n 
B 2 85  LEU 85  85  85  LEU LEU H . n 
B 2 86  SER 86  86  86  SER SER H . n 
B 2 87  SER 87  87  87  SER SER H . n 
B 2 88  VAL 88  88  88  VAL VAL H . n 
B 2 89  THR 89  89  89  THR THR H . n 
B 2 90  ALA 90  90  90  ALA ALA H . n 
B 2 91  ALA 91  91  91  ALA ALA H . n 
B 2 92  ASP 92  92  92  ASP ASP H . n 
B 2 93  THR 93  93  93  THR THR H . n 
B 2 94  ALA 94  94  94  ALA ALA H . n 
B 2 95  VAL 95  95  95  VAL VAL H . n 
B 2 96  TYR 96  96  96  TYR TYR H . n 
B 2 97  TYR 97  97  97  TYR TYR H . n 
B 2 98  CYS 98  98  98  CYS CYS H . n 
B 2 99  ALA 99  99  99  ALA ALA H . n 
B 2 100 ARG 100 100 100 ARG ARG H . n 
B 2 101 GLU 101 101 101 GLU GLU H . n 
B 2 102 GLY 102 102 102 GLY GLY H . n 
B 2 103 HIS 103 103 103 HIS HIS H . n 
B 2 104 THR 104 104 104 THR THR H . n 
B 2 105 ALA 105 105 105 ALA ALA H . n 
B 2 106 ALA 106 106 106 ALA ALA H . n 
B 2 107 PRO 107 107 107 PRO PRO H . n 
B 2 108 PHE 108 108 108 PHE PHE H . n 
B 2 109 ASP 109 109 109 ASP ASP H . n 
B 2 110 TYR 110 110 110 TYR TYR H . n 
B 2 111 TRP 111 111 111 TRP TRP H . n 
B 2 112 GLY 112 112 112 GLY GLY H . n 
B 2 113 GLN 113 113 113 GLN GLN H . n 
B 2 114 GLY 114 114 114 GLY GLY H . n 
B 2 115 SER 115 115 115 SER SER H . n 
B 2 116 LEU 116 116 116 LEU LEU H . n 
B 2 117 VAL 117 117 117 VAL VAL H . n 
B 2 118 THR 118 118 118 THR THR H . n 
B 2 119 VAL 119 119 119 VAL VAL H . n 
B 2 120 SER 120 120 120 SER SER H . n 
B 2 121 SER 121 121 121 SER SER H . n 
B 2 122 ALA 122 122 122 ALA ALA H . n 
B 2 123 SER 123 123 123 SER SER H . n 
B 2 124 THR 124 124 124 THR THR H . n 
B 2 125 LYS 125 125 125 LYS LYS H . n 
B 2 126 GLY 126 126 126 GLY GLY H . n 
B 2 127 PRO 127 127 127 PRO PRO H . n 
B 2 128 SER 128 128 128 SER SER H . n 
B 2 129 VAL 129 129 129 VAL VAL H . n 
B 2 130 PHE 130 130 130 PHE PHE H . n 
B 2 131 PRO 131 131 131 PRO PRO H . n 
B 2 132 LEU 132 132 132 LEU LEU H . n 
B 2 133 ALA 133 133 133 ALA ALA H . n 
B 2 134 PRO 134 134 134 PRO PRO H . n 
B 2 135 SER 135 135 ?   ?   ?   H . n 
B 2 136 SER 136 136 ?   ?   ?   H . n 
B 2 137 LYS 137 137 ?   ?   ?   H . n 
B 2 138 SER 138 138 ?   ?   ?   H . n 
B 2 139 THR 139 139 ?   ?   ?   H . n 
B 2 140 SER 140 140 ?   ?   ?   H . n 
B 2 141 GLY 141 141 ?   ?   ?   H . n 
B 2 142 GLY 142 142 ?   ?   ?   H . n 
B 2 143 THR 143 143 ?   ?   ?   H . n 
B 2 144 ALA 144 144 144 ALA ALA H . n 
B 2 145 ALA 145 145 145 ALA ALA H . n 
B 2 146 LEU 146 146 146 LEU LEU H . n 
B 2 147 GLY 147 147 147 GLY GLY H . n 
B 2 148 CYS 148 148 148 CYS CYS H . n 
B 2 149 LEU 149 149 149 LEU LEU H . n 
B 2 150 VAL 150 150 150 VAL VAL H . n 
B 2 151 LYS 151 151 151 LYS LYS H . n 
B 2 152 ASP 152 152 152 ASP ASP H . n 
B 2 153 TYR 153 153 153 TYR TYR H . n 
B 2 154 PHE 154 154 154 PHE PHE H . n 
B 2 155 PRO 155 155 155 PRO PRO H . n 
B 2 156 GLU 156 156 156 GLU GLU H . n 
B 2 157 PRO 157 157 157 PRO PRO H . n 
B 2 158 VAL 158 158 158 VAL VAL H . n 
B 2 159 THR 159 159 159 THR THR H . n 
B 2 160 VAL 160 160 160 VAL VAL H . n 
B 2 161 SER 161 161 161 SER SER H . n 
B 2 162 TRP 162 162 162 TRP TRP H . n 
B 2 163 ASN 163 163 163 ASN ASN H . n 
B 2 164 SER 164 164 164 SER SER H . n 
B 2 165 GLY 165 165 165 GLY GLY H . n 
B 2 166 ALA 166 166 166 ALA ALA H . n 
B 2 167 LEU 167 167 167 LEU LEU H . n 
B 2 168 THR 168 168 168 THR THR H . n 
B 2 169 SER 169 169 169 SER SER H . n 
B 2 170 GLY 170 170 170 GLY GLY H . n 
B 2 171 VAL 171 171 171 VAL VAL H . n 
B 2 172 HIS 172 172 172 HIS HIS H . n 
B 2 173 THR 173 173 173 THR THR H . n 
B 2 174 PHE 174 174 174 PHE PHE H . n 
B 2 175 PRO 175 175 175 PRO PRO H . n 
B 2 176 ALA 176 176 176 ALA ALA H . n 
B 2 177 VAL 177 177 177 VAL VAL H . n 
B 2 178 LEU 178 178 178 LEU LEU H . n 
B 2 179 GLN 179 179 179 GLN GLN H . n 
B 2 180 SER 180 180 180 SER SER H . n 
B 2 181 SER 181 181 181 SER SER H . n 
B 2 182 GLY 182 182 182 GLY GLY H . n 
B 2 183 LEU 183 183 183 LEU LEU H . n 
B 2 184 TYR 184 184 184 TYR TYR H . n 
B 2 185 SER 185 185 185 SER SER H . n 
B 2 186 LEU 186 186 186 LEU LEU H . n 
B 2 187 SER 187 187 187 SER SER H . n 
B 2 188 SER 188 188 188 SER SER H . n 
B 2 189 VAL 189 189 189 VAL VAL H . n 
B 2 190 VAL 190 190 190 VAL VAL H . n 
B 2 191 THR 191 191 191 THR THR H . n 
B 2 192 VAL 192 192 192 VAL VAL H . n 
B 2 193 PRO 193 193 193 PRO PRO H . n 
B 2 194 SER 194 194 194 SER SER H . n 
B 2 195 SER 195 195 195 SER SER H . n 
B 2 196 SER 196 196 196 SER SER H . n 
B 2 197 LEU 197 197 197 LEU LEU H . n 
B 2 198 GLY 198 198 198 GLY GLY H . n 
B 2 199 THR 199 199 199 THR THR H . n 
B 2 200 GLN 200 200 200 GLN GLN H . n 
B 2 201 THR 201 201 201 THR THR H . n 
B 2 202 TYR 202 202 202 TYR TYR H . n 
B 2 203 ILE 203 203 203 ILE ILE H . n 
B 2 204 CYS 204 204 204 CYS CYS H . n 
B 2 205 ASN 205 205 205 ASN ASN H . n 
B 2 206 VAL 206 206 206 VAL VAL H . n 
B 2 207 ASN 207 207 207 ASN ASN H . n 
B 2 208 HIS 208 208 208 HIS HIS H . n 
B 2 209 LYS 209 209 209 LYS LYS H . n 
B 2 210 PRO 210 210 210 PRO PRO H . n 
B 2 211 SER 211 211 211 SER SER H . n 
B 2 212 ASN 212 212 212 ASN ASN H . n 
B 2 213 THR 213 213 213 THR THR H . n 
B 2 214 LYS 214 214 214 LYS LYS H . n 
B 2 215 VAL 215 215 215 VAL VAL H . n 
B 2 216 ASP 216 216 216 ASP ASP H . n 
B 2 217 LYS 217 217 217 LYS LYS H . n 
B 2 218 LYS 218 218 218 LYS LYS H . n 
B 2 219 VAL 219 219 219 VAL VAL H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3240  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  19220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-27 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM   'data reduction' .            ? 1 
ROTAVATA 'data reduction' .            ? 2 
CNS      refinement       .            ? 3 
CCP4     'data scaling'   '(ROTAVATA)' ? 4 
CNS      phasing          .            ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   H 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    52 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OG1 
_pdbx_validate_close_contact.auth_asym_id_2   H 
_pdbx_validate_close_contact.auth_comp_id_2   THR 
_pdbx_validate_close_contact.auth_seq_id_2    59 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA L CYS 23  ? ? CB L CYS 23  ? ? SG L CYS 23  ? ? 121.65 114.20 7.45   1.10 N 
2 1 C  L GLN 79  ? ? N  L PRO 80  ? ? CA L PRO 80  ? ? 129.27 119.30 9.97   1.50 Y 
3 1 N  L THR 85  ? ? CA L THR 85  ? ? C  L THR 85  ? ? 93.82  111.00 -17.18 2.70 N 
4 1 CA L CYS 88  ? ? CB L CYS 88  ? ? SG L CYS 88  ? ? 121.86 114.20 7.66   1.10 N 
5 1 C  L ALA 112 ? ? N  L PRO 113 ? ? CA L PRO 113 ? ? 133.75 119.30 14.45  1.50 Y 
6 1 CA L LEU 125 ? ? CB L LEU 125 ? ? CG L LEU 125 ? ? 130.97 115.30 15.67  2.30 N 
7 1 C  L SER 203 ? ? N  L PRO 204 ? ? CA L PRO 204 ? ? 129.09 119.30 9.79   1.50 Y 
8 1 C  H ALA 133 ? ? N  H PRO 134 ? ? CA H PRO 134 ? ? 130.17 119.30 10.87  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN L 3   ? ? -20.13  126.15  
2  1 SER L 7   ? ? -171.17 138.01  
3  1 GLN L 27  ? ? -100.19 -158.66 
4  1 ASP L 30  ? ? 75.51   -126.91 
5  1 GLN L 38  ? ? -115.71 79.93   
6  1 LYS L 39  ? ? -44.41  153.76  
7  1 PRO L 40  ? ? -50.09  109.61  
8  1 LYS L 42  ? ? -91.06  -155.23 
9  1 ASN L 50  ? ? 60.24   61.82   
10 1 THR L 51  ? ? 71.74   -50.33  
11 1 ASN L 52  ? ? -144.36 22.54   
12 1 PRO L 59  ? ? -50.48  -175.89 
13 1 SER L 63  ? ? -176.25 149.85  
14 1 SER L 67  ? ? 152.68  153.15  
15 1 THR L 69  ? ? -151.53 -49.43  
16 1 SER L 76  ? ? -18.51  -66.60  
17 1 PRO L 80  ? ? -46.06  -4.81   
18 1 ALA L 84  ? ? -123.53 -155.68 
19 1 SER L 93  ? ? -90.86  -143.89 
20 1 ARG L 94  ? ? -172.30 149.48  
21 1 VAL L 104 ? ? -151.87 75.76   
22 1 ARG L 108 ? ? -132.73 -150.72 
23 1 VAL L 110 ? ? -38.82  127.05  
24 1 ALA L 112 ? ? -15.64  124.06  
25 1 PRO L 113 ? ? -46.52  157.76  
26 1 PHE L 116 ? ? -148.11 43.92   
27 1 ILE L 117 ? ? -31.17  107.37  
28 1 ASP L 122 ? ? -5.60   -52.22  
29 1 LYS L 126 ? ? -165.33 10.49   
30 1 ASN L 138 ? ? 62.42   89.93   
31 1 TYR L 140 ? ? 179.89  135.69  
32 1 PRO L 141 ? ? -61.37  -162.81 
33 1 GLU L 143 ? ? -63.04  88.12   
34 1 VAL L 150 ? ? -86.04  -132.86 
35 1 ALA L 153 ? ? -118.64 -134.07 
36 1 LEU L 154 ? ? 163.34  177.06  
37 1 GLN L 155 ? ? -162.09 4.85    
38 1 SER L 156 ? ? 44.05   -128.90 
39 1 SER L 159 ? ? -57.41  178.77  
40 1 GLN L 160 ? ? 169.78  97.98   
41 1 SER L 162 ? ? -171.97 115.01  
42 1 SER L 171 ? ? 93.63   34.05   
43 1 SER L 177 ? ? -163.68 64.84   
44 1 THR L 180 ? ? -110.85 78.85   
45 1 SER L 182 ? ? 51.47   168.82  
46 1 ALA L 184 ? ? 65.23   -10.33  
47 1 LYS L 188 ? ? -47.58  -1.00   
48 1 LYS L 190 ? ? -161.09 28.72   
49 1 VAL L 191 ? ? -149.94 -8.63   
50 1 TYR L 192 ? ? -6.53   92.08   
51 1 CYS L 194 ? ? -163.00 66.52   
52 1 VAL L 196 ? ? -161.28 101.78  
53 1 SER L 203 ? ? 47.21   99.06   
54 1 PRO L 204 ? ? -31.57  161.55  
55 1 SER L 208 ? ? -128.68 -145.11 
56 1 PHE L 209 ? ? 157.74  127.82  
57 1 ASN L 210 ? ? -78.42  32.93   
58 1 ARG L 211 ? ? 72.32   -104.21 
59 1 GLU L 213 ? ? -153.74 -144.55 
60 1 SER H 7   ? ? 172.35  168.31  
61 1 SER H 15  ? ? 72.73   -36.65  
62 1 SER H 25  ? ? -171.26 114.00  
63 1 PHE H 27  ? ? -165.16 -169.83 
64 1 THR H 30  ? ? -57.09  -1.26   
65 1 ASP H 31  ? ? -150.19 25.86   
66 1 ARG H 43  ? ? -143.87 -148.95 
67 1 LEU H 45  ? ? -45.54  156.21  
68 1 ASP H 53  ? ? -44.74  -160.58 
69 1 LYS H 56  ? ? -65.15  2.92    
70 1 LYS H 67  ? ? -26.53  120.98  
71 1 THR H 71  ? ? -171.43 67.14   
72 1 LEU H 73  ? ? 174.10  165.47  
73 1 THR H 76  ? ? -48.69  -16.78  
74 1 GLN H 80  ? ? -111.89 -156.04 
75 1 PHE H 81  ? ? 175.85  51.74   
76 1 SER H 87  ? ? 72.05   39.48   
77 1 ALA H 90  ? ? -49.23  -14.13  
78 1 ALA H 94  ? ? 175.26  -153.77 
79 1 THR H 104 ? ? 63.93   -57.04  
80 1 ALA H 106 ? ? -46.66  159.58  
81 1 PHE H 108 ? ? 71.44   89.64   
82 1 GLN H 113 ? ? -96.35  -96.88  
83 1 ALA H 122 ? ? -90.96  -149.54 
84 1 THR H 124 ? ? -66.48  -167.56 
85 1 LYS H 125 ? ? 172.21  111.34  
86 1 PRO H 131 ? ? -54.28  99.09   
87 1 ASP H 152 ? ? 56.41   89.47   
88 1 PHE H 154 ? ? -178.84 141.48  
89 1 SER H 164 ? ? 31.44   36.02   
90 1 ALA H 166 ? ? 6.77    -68.99  
91 1 THR H 168 ? ? -137.74 -158.48 
92 1 SER H 169 ? ? 23.76   87.11   
93 1 PRO H 175 ? ? -66.02  -103.98 
94 1 SER H 185 ? ? -166.24 102.07  
95 1 SER H 194 ? ? -32.83  -73.25  
96 1 SER H 196 ? ? 162.51  42.50   
97 1 TYR H 202 ? ? 179.55  87.10   
98 1 HIS H 208 ? ? -161.75 102.40  
99 1 ASN H 212 ? ? 103.47  34.78   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H SER 135 ? B SER 135 
2 1 Y 1 H SER 136 ? B SER 136 
3 1 Y 1 H LYS 137 ? B LYS 137 
4 1 Y 1 H SER 138 ? B SER 138 
5 1 Y 1 H THR 139 ? B THR 139 
6 1 Y 1 H SER 140 ? B SER 140 
7 1 Y 1 H GLY 141 ? B GLY 141 
8 1 Y 1 H GLY 142 ? B GLY 142 
9 1 Y 1 H THR 143 ? B THR 143 
#