data_1BO1
# 
_entry.id   1BO1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BO1         
RCSB  RCSB008419   
WWPDB D_1000008419 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BO1 
_pdbx_database_status.recvd_initial_deposition_date   1998-08-02 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rao, V.D.'        1 
'Misra, S.'        2 
'Boronenkov, I.V.' 3 
'Anderson, R.A.'   4 
'Hurley, J.H.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Structure of type IIbeta phosphatidylinositol phosphate kinase: a protein kinase fold flattened for interfacial phosphorylation.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            94 
_citation.page_first                829 
_citation.page_last                 839 
_citation.year                      1998 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9753329 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)81741-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rao, V.D.'        1 
primary 'Misra, S.'        2 
primary 'Boronenkov, I.V.' 3 
primary 'Anderson, R.A.'   4 
primary 'Hurley, J.H.'     5 
# 
_cell.entry_id           1BO1 
_cell.length_a           109.915 
_cell.length_b           182.403 
_cell.length_c           106.472 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BO1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (PHOSPHATIDYLINOSITOL PHOSPHATE KINASE IIBETA)' 47447.926 2  2.7.1.68 ? ? ? 
2 water   nat water                                                    18.015    19 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PIPK 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVD
NHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEM
HNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLCSY
GTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNP
EQYSKRFNEFMSNILT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVD
NHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEM
HNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLCSY
GTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNP
EQYSKRFNEFMSNILT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   ASN n 
1 5   CYS n 
1 6   THR n 
1 7   SER n 
1 8   THR n 
1 9   THR n 
1 10  ALA n 
1 11  VAL n 
1 12  ALA n 
1 13  VAL n 
1 14  ALA n 
1 15  PRO n 
1 16  LEU n 
1 17  SER n 
1 18  ALA n 
1 19  SER n 
1 20  LYS n 
1 21  THR n 
1 22  LYS n 
1 23  THR n 
1 24  LYS n 
1 25  LYS n 
1 26  LYS n 
1 27  HIS n 
1 28  PHE n 
1 29  VAL n 
1 30  CYS n 
1 31  GLN n 
1 32  LYS n 
1 33  VAL n 
1 34  LYS n 
1 35  LEU n 
1 36  PHE n 
1 37  ARG n 
1 38  ALA n 
1 39  SER n 
1 40  GLU n 
1 41  PRO n 
1 42  ILE n 
1 43  LEU n 
1 44  SER n 
1 45  VAL n 
1 46  LEU n 
1 47  MET n 
1 48  TRP n 
1 49  GLY n 
1 50  VAL n 
1 51  ASN n 
1 52  HIS n 
1 53  THR n 
1 54  ILE n 
1 55  ASN n 
1 56  GLU n 
1 57  LEU n 
1 58  SER n 
1 59  ASN n 
1 60  VAL n 
1 61  PRO n 
1 62  VAL n 
1 63  PRO n 
1 64  VAL n 
1 65  MET n 
1 66  LEU n 
1 67  MET n 
1 68  PRO n 
1 69  ASP n 
1 70  ASP n 
1 71  PHE n 
1 72  LYS n 
1 73  ALA n 
1 74  TYR n 
1 75  SER n 
1 76  LYS n 
1 77  ILE n 
1 78  LYS n 
1 79  VAL n 
1 80  ASP n 
1 81  ASN n 
1 82  HIS n 
1 83  LEU n 
1 84  PHE n 
1 85  ASN n 
1 86  LYS n 
1 87  GLU n 
1 88  ASN n 
1 89  LEU n 
1 90  PRO n 
1 91  SER n 
1 92  ARG n 
1 93  PHE n 
1 94  LYS n 
1 95  PHE n 
1 96  LYS n 
1 97  GLU n 
1 98  TYR n 
1 99  CYS n 
1 100 PRO n 
1 101 MET n 
1 102 VAL n 
1 103 PHE n 
1 104 ARG n 
1 105 ASN n 
1 106 LEU n 
1 107 ARG n 
1 108 GLU n 
1 109 ARG n 
1 110 PHE n 
1 111 GLY n 
1 112 ILE n 
1 113 ASP n 
1 114 ASP n 
1 115 GLN n 
1 116 ASP n 
1 117 TYR n 
1 118 GLN n 
1 119 ASN n 
1 120 SER n 
1 121 VAL n 
1 122 THR n 
1 123 ARG n 
1 124 SER n 
1 125 ALA n 
1 126 PRO n 
1 127 ILE n 
1 128 ASN n 
1 129 SER n 
1 130 ASP n 
1 131 SER n 
1 132 GLN n 
1 133 GLY n 
1 134 ARG n 
1 135 CYS n 
1 136 GLY n 
1 137 THR n 
1 138 ARG n 
1 139 PHE n 
1 140 LEU n 
1 141 THR n 
1 142 THR n 
1 143 TYR n 
1 144 ASP n 
1 145 ARG n 
1 146 ARG n 
1 147 PHE n 
1 148 VAL n 
1 149 ILE n 
1 150 LYS n 
1 151 THR n 
1 152 VAL n 
1 153 SER n 
1 154 SER n 
1 155 GLU n 
1 156 ASP n 
1 157 VAL n 
1 158 ALA n 
1 159 GLU n 
1 160 MET n 
1 161 HIS n 
1 162 ASN n 
1 163 ILE n 
1 164 LEU n 
1 165 LYS n 
1 166 LYS n 
1 167 TYR n 
1 168 HIS n 
1 169 GLN n 
1 170 PHE n 
1 171 ILE n 
1 172 VAL n 
1 173 GLU n 
1 174 CYS n 
1 175 HIS n 
1 176 GLY n 
1 177 ASN n 
1 178 THR n 
1 179 LEU n 
1 180 LEU n 
1 181 PRO n 
1 182 GLN n 
1 183 PHE n 
1 184 LEU n 
1 185 GLY n 
1 186 MET n 
1 187 TYR n 
1 188 ARG n 
1 189 LEU n 
1 190 THR n 
1 191 VAL n 
1 192 ASP n 
1 193 GLY n 
1 194 VAL n 
1 195 GLU n 
1 196 THR n 
1 197 TYR n 
1 198 MET n 
1 199 VAL n 
1 200 VAL n 
1 201 THR n 
1 202 ARG n 
1 203 ASN n 
1 204 VAL n 
1 205 PHE n 
1 206 SER n 
1 207 HIS n 
1 208 ARG n 
1 209 LEU n 
1 210 THR n 
1 211 VAL n 
1 212 HIS n 
1 213 ARG n 
1 214 LYS n 
1 215 TYR n 
1 216 ASP n 
1 217 LEU n 
1 218 LYS n 
1 219 GLY n 
1 220 SER n 
1 221 THR n 
1 222 VAL n 
1 223 ALA n 
1 224 ARG n 
1 225 GLU n 
1 226 ALA n 
1 227 SER n 
1 228 ASP n 
1 229 LYS n 
1 230 GLU n 
1 231 LYS n 
1 232 ALA n 
1 233 LYS n 
1 234 ASP n 
1 235 LEU n 
1 236 PRO n 
1 237 THR n 
1 238 PHE n 
1 239 LYS n 
1 240 ASP n 
1 241 ASN n 
1 242 ASP n 
1 243 PHE n 
1 244 LEU n 
1 245 ASN n 
1 246 GLU n 
1 247 GLY n 
1 248 GLN n 
1 249 LYS n 
1 250 LEU n 
1 251 HIS n 
1 252 VAL n 
1 253 GLY n 
1 254 GLU n 
1 255 GLU n 
1 256 SER n 
1 257 LYS n 
1 258 LYS n 
1 259 ASN n 
1 260 PHE n 
1 261 LEU n 
1 262 GLU n 
1 263 LYS n 
1 264 LEU n 
1 265 LYS n 
1 266 ARG n 
1 267 ASP n 
1 268 VAL n 
1 269 GLU n 
1 270 PHE n 
1 271 LEU n 
1 272 ALA n 
1 273 GLN n 
1 274 LEU n 
1 275 LYS n 
1 276 ILE n 
1 277 MET n 
1 278 ASP n 
1 279 TYR n 
1 280 SER n 
1 281 LEU n 
1 282 LEU n 
1 283 VAL n 
1 284 GLY n 
1 285 ILE n 
1 286 HIS n 
1 287 ASP n 
1 288 VAL n 
1 289 ASP n 
1 290 ARG n 
1 291 ALA n 
1 292 GLU n 
1 293 GLN n 
1 294 GLU n 
1 295 GLU n 
1 296 MET n 
1 297 GLU n 
1 298 VAL n 
1 299 GLU n 
1 300 GLU n 
1 301 ARG n 
1 302 ALA n 
1 303 GLU n 
1 304 ASP n 
1 305 GLU n 
1 306 GLU n 
1 307 CYS n 
1 308 GLU n 
1 309 ASN n 
1 310 ASP n 
1 311 GLY n 
1 312 VAL n 
1 313 GLY n 
1 314 GLY n 
1 315 ASN n 
1 316 LEU n 
1 317 LEU n 
1 318 CYS n 
1 319 SER n 
1 320 TYR n 
1 321 GLY n 
1 322 THR n 
1 323 PRO n 
1 324 PRO n 
1 325 ASP n 
1 326 SER n 
1 327 PRO n 
1 328 GLY n 
1 329 ASN n 
1 330 LEU n 
1 331 LEU n 
1 332 SER n 
1 333 PHE n 
1 334 PRO n 
1 335 ARG n 
1 336 PHE n 
1 337 PHE n 
1 338 GLY n 
1 339 PRO n 
1 340 GLY n 
1 341 GLU n 
1 342 PHE n 
1 343 ASP n 
1 344 PRO n 
1 345 SER n 
1 346 VAL n 
1 347 ASP n 
1 348 VAL n 
1 349 TYR n 
1 350 ALA n 
1 351 MET n 
1 352 LYS n 
1 353 SER n 
1 354 HIS n 
1 355 GLU n 
1 356 SER n 
1 357 SER n 
1 358 PRO n 
1 359 LYS n 
1 360 LYS n 
1 361 GLU n 
1 362 VAL n 
1 363 TYR n 
1 364 PHE n 
1 365 MET n 
1 366 ALA n 
1 367 ILE n 
1 368 ILE n 
1 369 ASP n 
1 370 ILE n 
1 371 LEU n 
1 372 THR n 
1 373 PRO n 
1 374 TYR n 
1 375 ASP n 
1 376 THR n 
1 377 LYS n 
1 378 LYS n 
1 379 LYS n 
1 380 ALA n 
1 381 ALA n 
1 382 HIS n 
1 383 ALA n 
1 384 ALA n 
1 385 LYS n 
1 386 THR n 
1 387 VAL n 
1 388 LYS n 
1 389 HIS n 
1 390 GLY n 
1 391 ALA n 
1 392 GLY n 
1 393 ALA n 
1 394 GLU n 
1 395 ILE n 
1 396 SER n 
1 397 THR n 
1 398 VAL n 
1 399 ASN n 
1 400 PRO n 
1 401 GLU n 
1 402 GLN n 
1 403 TYR n 
1 404 SER n 
1 405 LYS n 
1 406 ARG n 
1 407 PHE n 
1 408 ASN n 
1 409 GLU n 
1 410 PHE n 
1 411 MET n 
1 412 SER n 
1 413 ASN n 
1 414 ILE n 
1 415 LEU n 
1 416 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACTERIAL 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'HUMAN ENZYME CLONED INTO E.COLI.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PI52B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P78356 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BO1 A 1 ? 416 ? P78356 1 ? 416 ? 1 416 
2 1 1BO1 B 1 ? 416 ? P78356 1 ? 416 ? 1 416 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BO1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   54 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    '100MM SODIUM CITRATE PH5.6 200MM MAGNESIUM ACETATE 100MM LITHIUM ACETATE 16% PEG (4000)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1998-02-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BO1 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   21621 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.052 
_reflns.pdbx_netI_over_sigmaI        14.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   98.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.325 
_reflns_shell.meanI_over_sigI_obs    4.5 
_reflns_shell.pdbx_redundancy        10.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BO1 
_refine.ls_number_reflns_obs                     17398 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               100000 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    94.9 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.299 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  95 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               48.05 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5141 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             20 
_refine_hist.number_atoms_total               5161 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.45  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.7  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.339 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        3.12 
_refine_ls_shell.number_reflns_R_work             1990 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               94.9 
_refine_ls_shell.R_factor_R_free                  0.3098 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO  'X-RAY DIFFRACTION' 
3 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.996792 
_struct_ncs_oper.matrix[1][2]   0.067419 
_struct_ncs_oper.matrix[1][3]   -0.043137 
_struct_ncs_oper.matrix[2][1]   -0.029964 
_struct_ncs_oper.matrix[2][2]   -0.814091 
_struct_ncs_oper.matrix[2][3]   -0.579964 
_struct_ncs_oper.matrix[3][1]   -0.074218 
_struct_ncs_oper.matrix[3][2]   -0.576811 
_struct_ncs_oper.matrix[3][3]   0.813499 
_struct_ncs_oper.vector[1]      78.74410 
_struct_ncs_oper.vector[2]      81.53310 
_struct_ncs_oper.vector[3]      28.79180 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1BO1 
_struct.title                     'PHOSPHATIDYLINOSITOL PHOSPHATE KINASE TYPE II BETA' 
_struct.pdbx_descriptor           'PROTEIN (PHOSPHATIDYLINOSITOL PHOSPHATE KINASE IIBETA) (2.7.1.68)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BO1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'LIPID SIGNALING, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 41  ? ASN A 59  ? PRO A 41  ASN A 59  1 ? 19 
HELX_P HELX_P2  2  PRO A 68  ? PHE A 71  ? PRO A 68  PHE A 71  5 ? 4  
HELX_P HELX_P3  3  PRO A 100 ? PHE A 110 ? PRO A 100 PHE A 110 1 ? 11 
HELX_P HELX_P4  4  ASP A 114 ? THR A 122 ? ASP A 114 THR A 122 1 ? 9  
HELX_P HELX_P5  5  SER A 154 ? GLU A 173 ? SER A 154 GLU A 173 1 ? 20 
HELX_P HELX_P6  6  LYS A 229 ? LYS A 231 ? LYS A 229 LYS A 231 5 ? 3  
HELX_P HELX_P7  7  ASP A 240 ? ASN A 245 ? ASP A 240 ASN A 245 1 ? 6  
HELX_P HELX_P8  8  SER A 256 ? LEU A 274 ? SER A 256 LEU A 274 1 ? 19 
HELX_P HELX_P9  9  VAL A 288 ? ARG A 301 ? VAL A 288 ARG A 301 1 ? 14 
HELX_P HELX_P10 10 PRO A 400 ? ILE A 414 ? PRO A 400 ILE A 414 1 ? 15 
HELX_P HELX_P11 11 PRO B 41  ? ASN B 59  ? PRO B 41  ASN B 59  1 ? 19 
HELX_P HELX_P12 12 PRO B 68  ? PHE B 71  ? PRO B 68  PHE B 71  5 ? 4  
HELX_P HELX_P13 13 PRO B 100 ? PHE B 110 ? PRO B 100 PHE B 110 1 ? 11 
HELX_P HELX_P14 14 ASP B 114 ? THR B 122 ? ASP B 114 THR B 122 1 ? 9  
HELX_P HELX_P15 15 SER B 154 ? GLU B 173 ? SER B 154 GLU B 173 1 ? 20 
HELX_P HELX_P16 16 LYS B 229 ? ALA B 232 ? LYS B 229 ALA B 232 5 ? 4  
HELX_P HELX_P17 17 ASP B 240 ? ASN B 245 ? ASP B 240 ASN B 245 1 ? 6  
HELX_P HELX_P18 18 SER B 256 ? GLN B 273 ? SER B 256 GLN B 273 1 ? 18 
HELX_P HELX_P19 19 VAL B 288 ? ALA B 302 ? VAL B 288 ALA B 302 1 ? 15 
HELX_P HELX_P20 20 TYR B 403 ? ILE B 414 ? TYR B 403 ILE B 414 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 6 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 74  ? ASP A 80  ? TYR A 74  ASP A 80  
A 2 ARG A 92  ? TYR A 98  ? ARG A 92  TYR A 98  
A 3 PHE A 183 ? VAL A 191 ? PHE A 183 VAL A 191 
A 4 VAL A 194 ? ARG A 202 ? VAL A 194 ARG A 202 
A 5 PHE A 147 ? LYS A 150 ? PHE A 147 LYS A 150 
A 6 PHE A 139 ? THR A 141 ? PHE A 139 THR A 141 
B 1 ARG A 213 ? LEU A 217 ? ARG A 213 LEU A 217 
B 2 LEU A 281 ? ASP A 287 ? LEU A 281 ASP A 287 
B 3 GLU A 361 ? ILE A 367 ? GLU A 361 ILE A 367 
B 4 SER A 353 ? GLU A 355 ? SER A 353 GLU A 355 
C 1 TYR B 74  ? ASP B 80  ? TYR B 74  ASP B 80  
C 2 ARG B 92  ? TYR B 98  ? ARG B 92  TYR B 98  
C 3 PHE B 183 ? VAL B 191 ? PHE B 183 VAL B 191 
C 4 VAL B 194 ? ARG B 202 ? VAL B 194 ARG B 202 
C 5 PHE B 147 ? LYS B 150 ? PHE B 147 LYS B 150 
C 6 PHE B 139 ? THR B 141 ? PHE B 139 THR B 141 
D 1 LEU B 281 ? ASP B 287 ? LEU B 281 ASP B 287 
D 2 GLU B 361 ? ILE B 367 ? GLU B 361 ILE B 367 
D 3 SER B 353 ? GLU B 355 ? SER B 353 GLU B 355 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 75  ? O SER A 75  N GLU A 97  ? N GLU A 97  
A 2 3 O LYS A 94  ? O LYS A 94  N THR A 190 ? N THR A 190 
A 3 4 O LEU A 184 ? O LEU A 184 N VAL A 200 ? N VAL A 200 
A 4 5 O VAL A 199 ? O VAL A 199 N LYS A 150 ? N LYS A 150 
A 5 6 O ILE A 149 ? O ILE A 149 N LEU A 140 ? N LEU A 140 
B 1 2 O ARG A 213 ? O ARG A 213 N ILE A 285 ? N ILE A 285 
B 2 3 O LEU A 282 ? O LEU A 282 N ALA A 366 ? N ALA A 366 
B 3 4 O TYR A 363 ? O TYR A 363 N HIS A 354 ? N HIS A 354 
C 1 2 O SER B 75  ? O SER B 75  N GLU B 97  ? N GLU B 97  
C 2 3 O LYS B 94  ? O LYS B 94  N THR B 190 ? N THR B 190 
C 3 4 O LEU B 184 ? O LEU B 184 N VAL B 200 ? N VAL B 200 
C 4 5 O VAL B 199 ? O VAL B 199 N LYS B 150 ? N LYS B 150 
C 5 6 O ILE B 149 ? O ILE B 149 N LEU B 140 ? N LEU B 140 
D 1 2 O LEU B 282 ? O LEU B 282 N ALA B 366 ? N ALA B 366 
D 2 3 O TYR B 363 ? O TYR B 363 N HIS B 354 ? N HIS B 354 
# 
_struct_site.id                   ACT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'GLY RICH LOOP (RESIDUES 130-135) - ATP BINDING. FLAT, BASIC SURFACE-MEMBRANE BINDING.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 ACT 6 LYS A 150 ? LYS A 150 . ? 1_555 ? 
2 ACT 6 ASP A 278 ? ASP A 278 . ? 1_555 ? 
3 ACT 6 ASP A 369 ? ASP A 369 . ? 1_555 ? 
4 ACT 6 LYS A 218 ? LYS A 218 . ? 1_555 ? 
5 ACT 6 ARG A 224 ? ARG A 224 . ? 1_555 ? 
6 ACT 6 LYS A 239 ? LYS A 239 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BO1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BO1 
_atom_sites.fract_transf_matrix[1][1]   0.009098 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005482 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009392 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 34  ? 30.599 31.771  50.407 1.00 81.37  ? 34  LYS A N   1 
ATOM   2    C CA  . LYS A 1 34  ? 29.639 32.647  49.662 1.00 82.69  ? 34  LYS A CA  1 
ATOM   3    C C   . LYS A 1 34  ? 30.060 34.109  49.735 1.00 82.03  ? 34  LYS A C   1 
ATOM   4    O O   . LYS A 1 34  ? 29.952 34.746  50.784 1.00 82.83  ? 34  LYS A O   1 
ATOM   5    C CB  . LYS A 1 34  ? 28.224 32.506  50.233 1.00 80.33  ? 34  LYS A CB  1 
ATOM   6    C CG  . LYS A 1 34  ? 27.131 33.072  49.343 1.00 75.79  ? 34  LYS A CG  1 
ATOM   7    C CD  . LYS A 1 34  ? 26.176 31.964  48.927 1.00 83.57  ? 34  LYS A CD  1 
ATOM   8    C CE  . LYS A 1 34  ? 26.925 30.818  48.254 1.00 84.82  ? 34  LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 34  ? 26.185 29.526  48.273 1.00 89.96  ? 34  LYS A NZ  1 
ATOM   10   N N   . LEU A 1 35  ? 30.546 34.643  48.621 1.00 79.37  ? 35  LEU A N   1 
ATOM   11   C CA  . LEU A 1 35  ? 30.964 36.031  48.595 1.00 77.99  ? 35  LEU A CA  1 
ATOM   12   C C   . LEU A 1 35  ? 30.240 36.764  47.482 1.00 80.80  ? 35  LEU A C   1 
ATOM   13   O O   . LEU A 1 35  ? 30.487 36.508  46.306 1.00 85.34  ? 35  LEU A O   1 
ATOM   14   C CB  . LEU A 1 35  ? 32.480 36.129  48.414 1.00 75.57  ? 35  LEU A CB  1 
ATOM   15   C CG  . LEU A 1 35  ? 33.323 35.368  49.448 1.00 78.39  ? 35  LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 35  ? 34.810 35.659  49.263 1.00 78.18  ? 35  LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 35  ? 32.891 35.750  50.855 1.00 83.26  ? 35  LEU A CD2 1 
ATOM   18   N N   . PHE A 1 36  ? 29.283 37.610  47.863 1.00 84.41  ? 36  PHE A N   1 
ATOM   19   C CA  . PHE A 1 36  ? 28.507 38.410  46.909 1.00 84.28  ? 36  PHE A CA  1 
ATOM   20   C C   . PHE A 1 36  ? 29.379 39.583  46.456 1.00 85.94  ? 36  PHE A C   1 
ATOM   21   O O   . PHE A 1 36  ? 30.541 39.701  46.871 1.00 86.56  ? 36  PHE A O   1 
ATOM   22   C CB  . PHE A 1 36  ? 27.249 38.986  47.578 1.00 87.23  ? 36  PHE A CB  1 
ATOM   23   C CG  . PHE A 1 36  ? 26.210 37.965  47.942 1.00 82.44  ? 36  PHE A CG  1 
ATOM   24   C CD1 . PHE A 1 36  ? 25.158 38.313  48.784 1.00 84.67  ? 36  PHE A CD1 1 
ATOM   25   C CD2 . PHE A 1 36  ? 26.259 36.672  47.430 1.00 85.00  ? 36  PHE A CD2 1 
ATOM   26   C CE1 . PHE A 1 36  ? 24.165 37.391  49.110 1.00 89.94  ? 36  PHE A CE1 1 
ATOM   27   C CE2 . PHE A 1 36  ? 25.271 35.739  47.750 1.00 87.50  ? 36  PHE A CE2 1 
ATOM   28   C CZ  . PHE A 1 36  ? 24.221 36.099  48.591 1.00 89.67  ? 36  PHE A CZ  1 
ATOM   29   N N   . ARG A 1 37  ? 28.820 40.469  45.634 1.00 81.41  ? 37  ARG A N   1 
ATOM   30   C CA  . ARG A 1 37  ? 29.593 41.620  45.189 1.00 77.41  ? 37  ARG A CA  1 
ATOM   31   C C   . ARG A 1 37  ? 29.000 42.999  45.521 1.00 75.64  ? 37  ARG A C   1 
ATOM   32   O O   . ARG A 1 37  ? 28.121 43.118  46.377 1.00 77.74  ? 37  ARG A O   1 
ATOM   33   C CB  . ARG A 1 37  ? 29.944 41.485  43.714 1.00 75.69  ? 37  ARG A CB  1 
ATOM   34   C CG  . ARG A 1 37  ? 30.606 40.149  43.357 1.00 78.59  ? 37  ARG A CG  1 
ATOM   35   C CD  . ARG A 1 37  ? 31.921 39.911  44.103 1.00 75.28  ? 37  ARG A CD  1 
ATOM   36   N NE  . ARG A 1 37  ? 32.024 38.536  44.595 1.00 67.53  ? 37  ARG A NE  1 
ATOM   37   C CZ  . ARG A 1 37  ? 33.164 37.919  44.893 1.00 62.88  ? 37  ARG A CZ  1 
ATOM   38   N NH1 . ARG A 1 37  ? 34.324 38.535  44.751 1.00 71.80  ? 37  ARG A NH1 1 
ATOM   39   N NH2 . ARG A 1 37  ? 33.145 36.683  45.356 1.00 63.24  ? 37  ARG A NH2 1 
ATOM   40   N N   . ALA A 1 38  ? 29.490 44.031  44.838 1.00 71.79  ? 38  ALA A N   1 
ATOM   41   C CA  . ALA A 1 38  ? 29.088 45.419  45.083 1.00 71.13  ? 38  ALA A CA  1 
ATOM   42   C C   . ALA A 1 38  ? 28.027 46.052  44.193 1.00 70.59  ? 38  ALA A C   1 
ATOM   43   O O   . ALA A 1 38  ? 27.249 45.366  43.531 1.00 71.56  ? 38  ALA A O   1 
ATOM   44   C CB  . ALA A 1 38  ? 30.329 46.290  45.066 1.00 78.15  ? 38  ALA A CB  1 
ATOM   45   N N   . SER A 1 39  ? 28.007 47.386  44.218 1.00 66.40  ? 39  SER A N   1 
ATOM   46   C CA  . SER A 1 39  ? 27.091 48.197  43.426 1.00 71.14  ? 39  SER A CA  1 
ATOM   47   C C   . SER A 1 39  ? 27.632 48.371  42.009 1.00 69.07  ? 39  SER A C   1 
ATOM   48   O O   . SER A 1 39  ? 27.104 47.793  41.062 1.00 73.29  ? 39  SER A O   1 
ATOM   49   C CB  . SER A 1 39  ? 26.886 49.571  44.084 1.00 77.30  ? 39  SER A CB  1 
ATOM   50   O OG  . SER A 1 39  ? 28.101 50.302  44.206 1.00 81.05  ? 39  SER A OG  1 
ATOM   51   N N   . GLU A 1 40  ? 28.690 49.163  41.869 1.00 63.61  ? 40  GLU A N   1 
ATOM   52   C CA  . GLU A 1 40  ? 29.306 49.396  40.571 1.00 64.25  ? 40  GLU A CA  1 
ATOM   53   C C   . GLU A 1 40  ? 29.878 48.074  40.074 1.00 59.28  ? 40  GLU A C   1 
ATOM   54   O O   . GLU A 1 40  ? 30.500 47.346  40.843 1.00 67.74  ? 40  GLU A O   1 
ATOM   55   C CB  . GLU A 1 40  ? 30.450 50.400  40.702 1.00 72.74  ? 40  GLU A CB  1 
ATOM   56   C CG  . GLU A 1 40  ? 30.056 51.796  41.137 1.00 79.37  ? 40  GLU A CG  1 
ATOM   57   C CD  . GLU A 1 40  ? 31.157 52.806  40.856 1.00 86.48  ? 40  GLU A CD  1 
ATOM   58   O OE1 . GLU A 1 40  ? 31.795 53.288  41.821 1.00 88.40  ? 40  GLU A OE1 1 
ATOM   59   O OE2 . GLU A 1 40  ? 31.391 53.112  39.665 1.00 81.89  ? 40  GLU A OE2 1 
ATOM   60   N N   . PRO A 1 41  ? 29.679 47.739  38.790 1.00 49.61  ? 41  PRO A N   1 
ATOM   61   C CA  . PRO A 1 41  ? 30.214 46.479  38.281 1.00 43.12  ? 41  PRO A CA  1 
ATOM   62   C C   . PRO A 1 41  ? 31.721 46.451  38.407 1.00 37.53  ? 41  PRO A C   1 
ATOM   63   O O   . PRO A 1 41  ? 32.325 45.374  38.502 1.00 43.90  ? 41  PRO A O   1 
ATOM   64   C CB  . PRO A 1 41  ? 29.781 46.495  36.819 1.00 45.37  ? 41  PRO A CB  1 
ATOM   65   C CG  . PRO A 1 41  ? 28.492 47.209  36.879 1.00 49.18  ? 41  PRO A CG  1 
ATOM   66   C CD  . PRO A 1 41  ? 28.842 48.382  37.768 1.00 54.65  ? 41  PRO A CD  1 
ATOM   67   N N   . ILE A 1 42  ? 32.318 47.638  38.452 1.00 25.82  ? 42  ILE A N   1 
ATOM   68   C CA  . ILE A 1 42  ? 33.762 47.746  38.566 1.00 30.00  ? 42  ILE A CA  1 
ATOM   69   C C   . ILE A 1 42  ? 34.239 47.235  39.922 1.00 32.54  ? 42  ILE A C   1 
ATOM   70   O O   . ILE A 1 42  ? 35.258 46.561  40.013 1.00 39.87  ? 42  ILE A O   1 
ATOM   71   C CB  . ILE A 1 42  ? 34.256 49.175  38.360 1.00 32.17  ? 42  ILE A CB  1 
ATOM   72   C CG1 . ILE A 1 42  ? 33.471 49.851  37.234 1.00 40.98  ? 42  ILE A CG1 1 
ATOM   73   C CG2 . ILE A 1 42  ? 35.724 49.152  37.960 1.00 35.82  ? 42  ILE A CG2 1 
ATOM   74   C CD1 . ILE A 1 42  ? 32.400 50.811  37.719 1.00 40.92  ? 42  ILE A CD1 1 
ATOM   75   N N   . LEU A 1 43  ? 33.485 47.529  40.972 1.00 32.07  ? 43  LEU A N   1 
ATOM   76   C CA  . LEU A 1 43  ? 33.829 47.075  42.313 1.00 28.58  ? 43  LEU A CA  1 
ATOM   77   C C   . LEU A 1 43  ? 33.623 45.569  42.493 1.00 32.77  ? 43  LEU A C   1 
ATOM   78   O O   . LEU A 1 43  ? 34.225 44.953  43.380 1.00 34.13  ? 43  LEU A O   1 
ATOM   79   C CB  . LEU A 1 43  ? 33.009 47.826  43.347 1.00 23.19  ? 43  LEU A CB  1 
ATOM   80   C CG  . LEU A 1 43  ? 33.295 49.315  43.378 1.00 24.87  ? 43  LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 43  ? 32.924 49.842  44.751 1.00 27.31  ? 43  LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 43  ? 34.775 49.552  43.099 1.00 30.18  ? 43  LEU A CD2 1 
ATOM   83   N N   . SER A 1 44  ? 32.750 44.986  41.672 1.00 32.03  ? 44  SER A N   1 
ATOM   84   C CA  . SER A 1 44  ? 32.481 43.555  41.728 1.00 26.74  ? 44  SER A CA  1 
ATOM   85   C C   . SER A 1 44  ? 33.575 42.814  41.004 1.00 26.33  ? 44  SER A C   1 
ATOM   86   O O   . SER A 1 44  ? 33.973 41.732  41.438 1.00 32.98  ? 44  SER A O   1 
ATOM   87   C CB  . SER A 1 44  ? 31.138 43.220  41.103 1.00 31.97  ? 44  SER A CB  1 
ATOM   88   O OG  . SER A 1 44  ? 30.095 43.751  41.900 1.00 46.02  ? 44  SER A OG  1 
ATOM   89   N N   . VAL A 1 45  ? 34.057 43.381  39.897 1.00 14.08  ? 45  VAL A N   1 
ATOM   90   C CA  . VAL A 1 45  ? 35.144 42.741  39.163 1.00 12.71  ? 45  VAL A CA  1 
ATOM   91   C C   . VAL A 1 45  ? 36.445 42.845  39.992 1.00 12.86  ? 45  VAL A C   1 
ATOM   92   O O   . VAL A 1 45  ? 37.294 41.968  39.912 1.00 20.67  ? 45  VAL A O   1 
ATOM   93   C CB  . VAL A 1 45  ? 35.304 43.315  37.707 1.00 8.79   ? 45  VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 45  ? 36.523 42.776  37.041 1.00 4.81   ? 45  VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 45  ? 34.129 42.913  36.855 1.00 2.00   ? 45  VAL A CG2 1 
ATOM   96   N N   . LEU A 1 46  ? 36.553 43.860  40.852 1.00 14.62  ? 46  LEU A N   1 
ATOM   97   C CA  . LEU A 1 46  ? 37.741 44.033  41.692 1.00 8.03   ? 46  LEU A CA  1 
ATOM   98   C C   . LEU A 1 46  ? 37.759 42.941  42.733 1.00 9.10   ? 46  LEU A C   1 
ATOM   99   O O   . LEU A 1 46  ? 38.728 42.197  42.842 1.00 19.11  ? 46  LEU A O   1 
ATOM   100  C CB  . LEU A 1 46  ? 37.749 45.402  42.400 1.00 2.07   ? 46  LEU A CB  1 
ATOM   101  C CG  . LEU A 1 46  ? 38.877 45.620  43.424 1.00 3.09   ? 46  LEU A CG  1 
ATOM   102  C CD1 . LEU A 1 46  ? 40.218 45.293  42.795 1.00 6.65   ? 46  LEU A CD1 1 
ATOM   103  C CD2 . LEU A 1 46  ? 38.875 47.042  43.968 1.00 2.00   ? 46  LEU A CD2 1 
ATOM   104  N N   . MET A 1 47  ? 36.678 42.851  43.499 1.00 12.93  ? 47  MET A N   1 
ATOM   105  C CA  . MET A 1 47  ? 36.565 41.854  44.556 1.00 11.58  ? 47  MET A CA  1 
ATOM   106  C C   . MET A 1 47  ? 36.737 40.451  43.970 1.00 12.75  ? 47  MET A C   1 
ATOM   107  O O   . MET A 1 47  ? 37.382 39.585  44.563 1.00 11.76  ? 47  MET A O   1 
ATOM   108  C CB  . MET A 1 47  ? 35.211 41.996  45.232 1.00 8.77   ? 47  MET A CB  1 
ATOM   109  C CG  . MET A 1 47  ? 34.992 43.370  45.812 1.00 9.38   ? 47  MET A CG  1 
ATOM   110  S SD  . MET A 1 47  ? 33.283 43.675  46.210 1.00 19.17  ? 47  MET A SD  1 
ATOM   111  C CE  . MET A 1 47  ? 33.127 42.671  47.667 1.00 12.83  ? 47  MET A CE  1 
ATOM   112  N N   . TRP A 1 48  ? 36.196 40.241  42.777 1.00 7.78   ? 48  TRP A N   1 
ATOM   113  C CA  . TRP A 1 48  ? 36.319 38.943  42.145 1.00 6.39   ? 48  TRP A CA  1 
ATOM   114  C C   . TRP A 1 48  ? 37.770 38.726  41.766 1.00 11.19  ? 48  TRP A C   1 
ATOM   115  O O   . TRP A 1 48  ? 38.271 37.617  41.861 1.00 14.62  ? 48  TRP A O   1 
ATOM   116  C CB  . TRP A 1 48  ? 35.434 38.881  40.912 1.00 9.91   ? 48  TRP A CB  1 
ATOM   117  C CG  . TRP A 1 48  ? 35.523 37.612  40.165 1.00 5.28   ? 48  TRP A CG  1 
ATOM   118  C CD1 . TRP A 1 48  ? 34.608 36.618  40.156 1.00 4.15   ? 48  TRP A CD1 1 
ATOM   119  C CD2 . TRP A 1 48  ? 36.572 37.204  39.278 1.00 8.62   ? 48  TRP A CD2 1 
ATOM   120  N NE1 . TRP A 1 48  ? 35.016 35.606  39.321 1.00 13.55  ? 48  TRP A NE1 1 
ATOM   121  C CE2 . TRP A 1 48  ? 36.223 35.941  38.772 1.00 9.40   ? 48  TRP A CE2 1 
ATOM   122  C CE3 . TRP A 1 48  ? 37.781 37.784  38.872 1.00 12.41  ? 48  TRP A CE3 1 
ATOM   123  C CZ2 . TRP A 1 48  ? 37.037 35.238  37.877 1.00 8.04   ? 48  TRP A CZ2 1 
ATOM   124  C CZ3 . TRP A 1 48  ? 38.602 37.078  37.973 1.00 14.85  ? 48  TRP A CZ3 1 
ATOM   125  C CH2 . TRP A 1 48  ? 38.224 35.822  37.494 1.00 15.44  ? 48  TRP A CH2 1 
ATOM   126  N N   . GLY A 1 49  ? 38.444 39.802  41.362 1.00 14.53  ? 49  GLY A N   1 
ATOM   127  C CA  . GLY A 1 49  ? 39.840 39.734  40.950 1.00 14.49  ? 49  GLY A CA  1 
ATOM   128  C C   . GLY A 1 49  ? 40.858 39.510  42.061 1.00 17.43  ? 49  GLY A C   1 
ATOM   129  O O   . GLY A 1 49  ? 41.740 38.657  41.914 1.00 22.77  ? 49  GLY A O   1 
ATOM   130  N N   . VAL A 1 50  ? 40.781 40.300  43.135 1.00 11.45  ? 50  VAL A N   1 
ATOM   131  C CA  . VAL A 1 50  ? 41.686 40.159  44.275 1.00 7.16   ? 50  VAL A CA  1 
ATOM   132  C C   . VAL A 1 50  ? 41.409 38.823  44.980 1.00 15.24  ? 50  VAL A C   1 
ATOM   133  O O   . VAL A 1 50  ? 42.251 38.307  45.724 1.00 25.34  ? 50  VAL A O   1 
ATOM   134  C CB  . VAL A 1 50  ? 41.501 41.301  45.280 1.00 6.26   ? 50  VAL A CB  1 
ATOM   135  C CG1 . VAL A 1 50  ? 42.283 41.042  46.532 1.00 2.00   ? 50  VAL A CG1 1 
ATOM   136  C CG2 . VAL A 1 50  ? 41.962 42.613  44.671 1.00 13.78  ? 50  VAL A CG2 1 
ATOM   137  N N   . ASN A 1 51  ? 40.218 38.272  44.768 1.00 11.68  ? 51  ASN A N   1 
ATOM   138  C CA  . ASN A 1 51  ? 39.874 36.990  45.365 1.00 5.83   ? 51  ASN A CA  1 
ATOM   139  C C   . ASN A 1 51  ? 40.483 35.889  44.504 1.00 8.81   ? 51  ASN A C   1 
ATOM   140  O O   . ASN A 1 51  ? 41.132 34.980  45.026 1.00 12.29  ? 51  ASN A O   1 
ATOM   141  C CB  . ASN A 1 51  ? 38.364 36.809  45.424 1.00 13.63  ? 51  ASN A CB  1 
ATOM   142  C CG  . ASN A 1 51  ? 37.960 35.544  46.144 1.00 15.52  ? 51  ASN A CG  1 
ATOM   143  O OD1 . ASN A 1 51  ? 37.671 34.527  45.530 1.00 22.97  ? 51  ASN A OD1 1 
ATOM   144  N ND2 . ASN A 1 51  ? 37.928 35.608  47.457 1.00 29.13  ? 51  ASN A ND2 1 
ATOM   145  N N   . HIS A 1 52  ? 40.301 35.996  43.184 1.00 6.18   ? 52  HIS A N   1 
ATOM   146  C CA  . HIS A 1 52  ? 40.821 35.008  42.235 1.00 4.31   ? 52  HIS A CA  1 
ATOM   147  C C   . HIS A 1 52  ? 42.334 34.947  42.242 1.00 13.00  ? 52  HIS A C   1 
ATOM   148  O O   . HIS A 1 52  ? 42.909 33.853  42.325 1.00 14.67  ? 52  HIS A O   1 
ATOM   149  C CB  . HIS A 1 52  ? 40.403 35.341  40.818 1.00 6.56   ? 52  HIS A CB  1 
ATOM   150  C CG  . HIS A 1 52  ? 40.937 34.384  39.800 1.00 5.36   ? 52  HIS A CG  1 
ATOM   151  N ND1 . HIS A 1 52  ? 40.511 33.077  39.714 1.00 8.18   ? 52  HIS A ND1 1 
ATOM   152  C CD2 . HIS A 1 52  ? 41.888 34.532  38.850 1.00 6.93   ? 52  HIS A CD2 1 
ATOM   153  C CE1 . HIS A 1 52  ? 41.176 32.458  38.757 1.00 2.40   ? 52  HIS A CE1 1 
ATOM   154  N NE2 . HIS A 1 52  ? 42.019 33.318  38.216 1.00 9.91   ? 52  HIS A NE2 1 
ATOM   155  N N   . THR A 1 53  ? 42.963 36.118  42.107 1.00 2.87   ? 53  THR A N   1 
ATOM   156  C CA  . THR A 1 53  ? 44.416 36.222  42.083 1.00 9.98   ? 53  THR A CA  1 
ATOM   157  C C   . THR A 1 53  ? 45.090 35.772  43.376 1.00 16.20  ? 53  THR A C   1 
ATOM   158  O O   . THR A 1 53  ? 46.139 35.123  43.326 1.00 24.93  ? 53  THR A O   1 
ATOM   159  C CB  . THR A 1 53  ? 44.882 37.632  41.741 1.00 12.82  ? 53  THR A CB  1 
ATOM   160  O OG1 . THR A 1 53  ? 44.418 38.542  42.741 1.00 29.05  ? 53  THR A OG1 1 
ATOM   161  C CG2 . THR A 1 53  ? 44.327 38.057  40.381 1.00 17.17  ? 53  THR A CG2 1 
ATOM   162  N N   . ILE A 1 54  ? 44.499 36.108  44.525 1.00 16.12  ? 54  ILE A N   1 
ATOM   163  C CA  . ILE A 1 54  ? 45.063 35.709  45.811 1.00 4.42   ? 54  ILE A CA  1 
ATOM   164  C C   . ILE A 1 54  ? 44.910 34.187  46.006 1.00 14.57  ? 54  ILE A C   1 
ATOM   165  O O   . ILE A 1 54  ? 45.847 33.514  46.448 1.00 20.32  ? 54  ILE A O   1 
ATOM   166  C CB  . ILE A 1 54  ? 44.473 36.526  46.964 1.00 2.00   ? 54  ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 54  ? 45.509 37.501  47.482 1.00 2.00   ? 54  ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 54  ? 44.128 35.683  48.107 1.00 7.13   ? 54  ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 54  ? 45.403 38.904  46.895 1.00 2.00   ? 54  ILE A CD1 1 
ATOM   170  N N   . ASN A 1 55  ? 43.756 33.629  45.646 1.00 15.81  ? 55  ASN A N   1 
ATOM   171  C CA  . ASN A 1 55  ? 43.565 32.182  45.773 1.00 16.97  ? 55  ASN A CA  1 
ATOM   172  C C   . ASN A 1 55  ? 44.529 31.522  44.810 1.00 18.74  ? 55  ASN A C   1 
ATOM   173  O O   . ASN A 1 55  ? 45.264 30.614  45.188 1.00 17.00  ? 55  ASN A O   1 
ATOM   174  C CB  . ASN A 1 55  ? 42.131 31.764  45.431 1.00 10.74  ? 55  ASN A CB  1 
ATOM   175  C CG  . ASN A 1 55  ? 41.143 32.135  46.517 1.00 13.40  ? 55  ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 55  ? 39.951 32.303  46.250 1.00 22.11  ? 55  ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 55  ? 41.631 32.274  47.752 1.00 8.82   ? 55  ASN A ND2 1 
ATOM   178  N N   . GLU A 1 56  ? 44.579 32.043  43.586 1.00 18.45  ? 56  GLU A N   1 
ATOM   179  C CA  . GLU A 1 56  ? 45.472 31.507  42.571 1.00 22.20  ? 56  GLU A CA  1 
ATOM   180  C C   . GLU A 1 56  ? 46.908 31.497  43.105 1.00 23.39  ? 56  GLU A C   1 
ATOM   181  O O   . GLU A 1 56  ? 47.659 30.531  42.915 1.00 21.04  ? 56  GLU A O   1 
ATOM   182  C CB  . GLU A 1 56  ? 45.405 32.355  41.314 1.00 26.49  ? 56  GLU A CB  1 
ATOM   183  C CG  . GLU A 1 56  ? 45.696 31.586  40.038 1.00 41.47  ? 56  GLU A CG  1 
ATOM   184  C CD  . GLU A 1 56  ? 44.655 30.519  39.773 1.00 43.69  ? 56  GLU A CD  1 
ATOM   185  O OE1 . GLU A 1 56  ? 43.454 30.839  39.909 1.00 49.58  ? 56  GLU A OE1 1 
ATOM   186  O OE2 . GLU A 1 56  ? 45.033 29.369  39.450 1.00 35.21  ? 56  GLU A OE2 1 
ATOM   187  N N   . LEU A 1 57  ? 47.271 32.553  43.822 1.00 18.19  ? 57  LEU A N   1 
ATOM   188  C CA  . LEU A 1 57  ? 48.608 32.636  44.379 1.00 18.95  ? 57  LEU A CA  1 
ATOM   189  C C   . LEU A 1 57  ? 48.818 31.634  45.512 1.00 25.09  ? 57  LEU A C   1 
ATOM   190  O O   . LEU A 1 57  ? 49.951 31.208  45.743 1.00 41.11  ? 57  LEU A O   1 
ATOM   191  C CB  . LEU A 1 57  ? 48.916 34.056  44.864 1.00 9.25   ? 57  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 57  ? 49.651 35.031  43.945 1.00 4.92   ? 57  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 57  ? 49.687 36.432  44.543 1.00 4.64   ? 57  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 57  ? 51.070 34.547  43.759 1.00 7.88   ? 57  LEU A CD2 1 
ATOM   195  N N   . SER A 1 58  ? 47.744 31.220  46.190 1.00 24.83  ? 58  SER A N   1 
ATOM   196  C CA  . SER A 1 58  ? 47.874 30.275  47.312 1.00 19.49  ? 58  SER A CA  1 
ATOM   197  C C   . SER A 1 58  ? 48.360 28.900  46.890 1.00 17.98  ? 58  SER A C   1 
ATOM   198  O O   . SER A 1 58  ? 48.657 28.065  47.730 1.00 18.61  ? 58  SER A O   1 
ATOM   199  C CB  . SER A 1 58  ? 46.557 30.113  48.051 1.00 18.01  ? 58  SER A CB  1 
ATOM   200  O OG  . SER A 1 58  ? 45.782 29.094  47.442 1.00 26.49  ? 58  SER A OG  1 
ATOM   201  N N   . ASN A 1 59  ? 48.368 28.649  45.588 1.00 19.78  ? 59  ASN A N   1 
ATOM   202  C CA  . ASN A 1 59  ? 48.832 27.374  45.074 1.00 22.94  ? 59  ASN A CA  1 
ATOM   203  C C   . ASN A 1 59  ? 50.235 27.473  44.441 1.00 20.90  ? 59  ASN A C   1 
ATOM   204  O O   . ASN A 1 59  ? 50.896 26.456  44.224 1.00 23.58  ? 59  ASN A O   1 
ATOM   205  C CB  . ASN A 1 59  ? 47.805 26.801  44.094 1.00 27.86  ? 59  ASN A CB  1 
ATOM   206  C CG  . ASN A 1 59  ? 46.475 26.488  44.768 1.00 38.12  ? 59  ASN A CG  1 
ATOM   207  O OD1 . ASN A 1 59  ? 46.441 25.944  45.868 1.00 41.35  ? 59  ASN A OD1 1 
ATOM   208  N ND2 . ASN A 1 59  ? 45.373 26.837  44.110 1.00 45.58  ? 59  ASN A ND2 1 
ATOM   209  N N   . VAL A 1 60  ? 50.681 28.686  44.124 1.00 16.43  ? 60  VAL A N   1 
ATOM   210  C CA  . VAL A 1 60  ? 52.007 28.855  43.551 1.00 11.31  ? 60  VAL A CA  1 
ATOM   211  C C   . VAL A 1 60  ? 52.933 29.175  44.697 1.00 23.99  ? 60  VAL A C   1 
ATOM   212  O O   . VAL A 1 60  ? 52.883 30.261  45.254 1.00 31.55  ? 60  VAL A O   1 
ATOM   213  C CB  . VAL A 1 60  ? 52.085 29.962  42.448 1.00 15.33  ? 60  VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 60  ? 50.889 30.902  42.499 1.00 12.55  ? 60  VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 60  ? 53.415 30.754  42.550 1.00 13.50  ? 60  VAL A CG2 1 
ATOM   216  N N   . PRO A 1 61  ? 53.811 28.230  45.055 1.00 28.32  ? 61  PRO A N   1 
ATOM   217  C CA  . PRO A 1 61  ? 54.787 28.336  46.143 1.00 25.33  ? 61  PRO A CA  1 
ATOM   218  C C   . PRO A 1 61  ? 55.598 29.619  46.236 1.00 23.24  ? 61  PRO A C   1 
ATOM   219  O O   . PRO A 1 61  ? 55.856 30.287  45.233 1.00 24.20  ? 61  PRO A O   1 
ATOM   220  C CB  . PRO A 1 61  ? 55.685 27.117  45.912 1.00 13.68  ? 61  PRO A CB  1 
ATOM   221  C CG  . PRO A 1 61  ? 55.509 26.805  44.477 1.00 19.30  ? 61  PRO A CG  1 
ATOM   222  C CD  . PRO A 1 61  ? 54.034 26.987  44.305 1.00 29.62  ? 61  PRO A CD  1 
ATOM   223  N N   . VAL A 1 62  ? 55.966 29.956  47.470 1.00 25.98  ? 62  VAL A N   1 
ATOM   224  C CA  . VAL A 1 62  ? 56.770 31.138  47.772 1.00 28.80  ? 62  VAL A CA  1 
ATOM   225  C C   . VAL A 1 62  ? 58.227 30.820  47.449 1.00 30.96  ? 62  VAL A C   1 
ATOM   226  O O   . VAL A 1 62  ? 58.844 29.982  48.105 1.00 37.48  ? 62  VAL A O   1 
ATOM   227  C CB  . VAL A 1 62  ? 56.670 31.500  49.258 1.00 24.79  ? 62  VAL A CB  1 
ATOM   228  C CG1 . VAL A 1 62  ? 57.498 32.734  49.546 1.00 21.38  ? 62  VAL A CG1 1 
ATOM   229  C CG2 . VAL A 1 62  ? 55.208 31.709  49.654 1.00 14.36  ? 62  VAL A CG2 1 
ATOM   230  N N   . PRO A 1 63  ? 58.809 31.531  46.473 1.00 29.55  ? 63  PRO A N   1 
ATOM   231  C CA  . PRO A 1 63  ? 60.186 31.350  46.025 1.00 33.57  ? 63  PRO A CA  1 
ATOM   232  C C   . PRO A 1 63  ? 61.194 31.720  47.074 1.00 37.70  ? 63  PRO A C   1 
ATOM   233  O O   . PRO A 1 63  ? 60.891 32.486  47.985 1.00 45.82  ? 63  PRO A O   1 
ATOM   234  C CB  . PRO A 1 63  ? 60.281 32.324  44.862 1.00 31.39  ? 63  PRO A CB  1 
ATOM   235  C CG  . PRO A 1 63  ? 59.500 33.455  45.369 1.00 26.25  ? 63  PRO A CG  1 
ATOM   236  C CD  . PRO A 1 63  ? 58.252 32.760  45.891 1.00 28.94  ? 63  PRO A CD  1 
ATOM   237  N N   . VAL A 1 64  ? 62.397 31.173  46.921 1.00 43.37  ? 64  VAL A N   1 
ATOM   238  C CA  . VAL A 1 64  ? 63.506 31.453  47.818 1.00 40.73  ? 64  VAL A CA  1 
ATOM   239  C C   . VAL A 1 64  ? 63.865 32.897  47.559 1.00 35.81  ? 64  VAL A C   1 
ATOM   240  O O   . VAL A 1 64  ? 64.182 33.647  48.472 1.00 32.77  ? 64  VAL A O   1 
ATOM   241  C CB  . VAL A 1 64  ? 64.719 30.580  47.477 1.00 46.99  ? 64  VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 64  ? 65.892 30.944  48.366 1.00 58.67  ? 64  VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 64  ? 64.363 29.098  47.634 1.00 53.44  ? 64  VAL A CG2 1 
ATOM   244  N N   . MET A 1 65  ? 63.726 33.293  46.301 1.00 40.20  ? 65  MET A N   1 
ATOM   245  C CA  . MET A 1 65  ? 64.037 34.654  45.887 1.00 45.60  ? 65  MET A CA  1 
ATOM   246  C C   . MET A 1 65  ? 63.275 35.038  44.620 1.00 39.61  ? 65  MET A C   1 
ATOM   247  O O   . MET A 1 65  ? 62.740 34.183  43.908 1.00 40.35  ? 65  MET A O   1 
ATOM   248  C CB  . MET A 1 65  ? 65.547 34.808  45.656 1.00 52.58  ? 65  MET A CB  1 
ATOM   249  C CG  . MET A 1 65  ? 66.085 34.050  44.448 1.00 67.35  ? 65  MET A CG  1 
ATOM   250  S SD  . MET A 1 65  ? 67.834 34.387  44.167 1.00 79.08  ? 65  MET A SD  1 
ATOM   251  C CE  . MET A 1 65  ? 67.804 36.160  43.838 1.00 71.86  ? 65  MET A CE  1 
ATOM   252  N N   . LEU A 1 66  ? 63.197 36.332  44.357 1.00 34.35  ? 66  LEU A N   1 
ATOM   253  C CA  . LEU A 1 66  ? 62.497 36.791  43.175 1.00 42.17  ? 66  LEU A CA  1 
ATOM   254  C C   . LEU A 1 66  ? 63.445 36.848  41.984 1.00 49.19  ? 66  LEU A C   1 
ATOM   255  O O   . LEU A 1 66  ? 64.473 37.542  42.027 1.00 57.65  ? 66  LEU A O   1 
ATOM   256  C CB  . LEU A 1 66  ? 61.878 38.175  43.402 1.00 28.54  ? 66  LEU A CB  1 
ATOM   257  C CG  . LEU A 1 66  ? 60.651 38.305  44.294 1.00 28.27  ? 66  LEU A CG  1 
ATOM   258  C CD1 . LEU A 1 66  ? 60.319 39.789  44.450 1.00 32.25  ? 66  LEU A CD1 1 
ATOM   259  C CD2 . LEU A 1 66  ? 59.471 37.560  43.691 1.00 33.00  ? 66  LEU A CD2 1 
ATOM   260  N N   . MET A 1 67  ? 63.122 36.091  40.937 1.00 43.93  ? 67  MET A N   1 
ATOM   261  C CA  . MET A 1 67  ? 63.930 36.113  39.726 1.00 39.94  ? 67  MET A CA  1 
ATOM   262  C C   . MET A 1 67  ? 63.631 37.386  38.979 1.00 35.56  ? 67  MET A C   1 
ATOM   263  O O   . MET A 1 67  ? 62.661 38.069  39.281 1.00 37.06  ? 67  MET A O   1 
ATOM   264  C CB  . MET A 1 67  ? 63.656 34.897  38.852 1.00 45.84  ? 67  MET A CB  1 
ATOM   265  C CG  . MET A 1 67  ? 64.534 33.703  39.212 1.00 58.13  ? 67  MET A CG  1 
ATOM   266  S SD  . MET A 1 67  ? 66.300 34.162  39.267 1.00 76.87  ? 67  MET A SD  1 
ATOM   267  C CE  . MET A 1 67  ? 66.531 34.504  41.036 1.00 66.13  ? 67  MET A CE  1 
ATOM   268  N N   . PRO A 1 68  ? 64.485 37.753  38.025 1.00 35.30  ? 68  PRO A N   1 
ATOM   269  C CA  . PRO A 1 68  ? 64.284 38.980  37.246 1.00 38.55  ? 68  PRO A CA  1 
ATOM   270  C C   . PRO A 1 68  ? 63.009 38.990  36.404 1.00 41.31  ? 68  PRO A C   1 
ATOM   271  O O   . PRO A 1 68  ? 62.415 40.048  36.181 1.00 45.65  ? 68  PRO A O   1 
ATOM   272  C CB  . PRO A 1 68  ? 65.545 39.053  36.400 1.00 38.25  ? 68  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 68  ? 65.927 37.596  36.252 1.00 43.01  ? 68  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 68  ? 65.728 37.077  37.633 1.00 31.70  ? 68  PRO A CD  1 
ATOM   275  N N   . ASP A 1 69  ? 62.583 37.811  35.959 1.00 43.52  ? 69  ASP A N   1 
ATOM   276  C CA  . ASP A 1 69  ? 61.360 37.681  35.158 1.00 49.13  ? 69  ASP A CA  1 
ATOM   277  C C   . ASP A 1 69  ? 60.097 38.104  35.918 1.00 41.53  ? 69  ASP A C   1 
ATOM   278  O O   . ASP A 1 69  ? 59.137 38.611  35.326 1.00 36.32  ? 69  ASP A O   1 
ATOM   279  C CB  . ASP A 1 69  ? 61.180 36.234  34.688 1.00 59.60  ? 69  ASP A CB  1 
ATOM   280  C CG  . ASP A 1 69  ? 61.896 35.944  33.386 1.00 66.75  ? 69  ASP A CG  1 
ATOM   281  O OD1 . ASP A 1 69  ? 62.346 34.790  33.218 1.00 69.73  ? 69  ASP A OD1 1 
ATOM   282  O OD2 . ASP A 1 69  ? 61.986 36.853  32.526 1.00 70.22  ? 69  ASP A OD2 1 
ATOM   283  N N   . ASP A 1 70  ? 60.107 37.869  37.226 1.00 32.74  ? 70  ASP A N   1 
ATOM   284  C CA  . ASP A 1 70  ? 58.990 38.207  38.078 1.00 23.68  ? 70  ASP A CA  1 
ATOM   285  C C   . ASP A 1 70  ? 58.611 39.678  38.019 1.00 26.57  ? 70  ASP A C   1 
ATOM   286  O O   . ASP A 1 70  ? 57.488 40.038  38.370 1.00 36.17  ? 70  ASP A O   1 
ATOM   287  C CB  . ASP A 1 70  ? 59.277 37.787  39.510 1.00 18.07  ? 70  ASP A CB  1 
ATOM   288  C CG  . ASP A 1 70  ? 59.252 36.287  39.690 1.00 21.89  ? 70  ASP A CG  1 
ATOM   289  O OD1 . ASP A 1 70  ? 58.267 35.652  39.262 1.00 34.63  ? 70  ASP A OD1 1 
ATOM   290  O OD2 . ASP A 1 70  ? 60.203 35.736  40.274 1.00 23.55  ? 70  ASP A OD2 1 
ATOM   291  N N   . PHE A 1 71  ? 59.515 40.527  37.547 1.00 20.44  ? 71  PHE A N   1 
ATOM   292  C CA  . PHE A 1 71  ? 59.205 41.958  37.447 1.00 26.96  ? 71  PHE A CA  1 
ATOM   293  C C   . PHE A 1 71  ? 58.675 42.338  36.070 1.00 28.91  ? 71  PHE A C   1 
ATOM   294  O O   . PHE A 1 71  ? 58.409 43.524  35.799 1.00 17.59  ? 71  PHE A O   1 
ATOM   295  C CB  . PHE A 1 71  ? 60.428 42.801  37.804 1.00 22.28  ? 71  PHE A CB  1 
ATOM   296  C CG  . PHE A 1 71  ? 60.913 42.565  39.197 1.00 13.63  ? 71  PHE A CG  1 
ATOM   297  C CD1 . PHE A 1 71  ? 61.599 41.406  39.517 1.00 11.88  ? 71  PHE A CD1 1 
ATOM   298  C CD2 . PHE A 1 71  ? 60.641 43.471  40.196 1.00 11.47  ? 71  PHE A CD2 1 
ATOM   299  C CE1 . PHE A 1 71  ? 62.006 41.148  40.813 1.00 7.41   ? 71  PHE A CE1 1 
ATOM   300  C CE2 . PHE A 1 71  ? 61.042 43.223  41.484 1.00 11.69  ? 71  PHE A CE2 1 
ATOM   301  C CZ  . PHE A 1 71  ? 61.727 42.050  41.793 1.00 10.40  ? 71  PHE A CZ  1 
ATOM   302  N N   . LYS A 1 72  ? 58.474 41.304  35.243 1.00 33.28  ? 72  LYS A N   1 
ATOM   303  C CA  . LYS A 1 72  ? 57.986 41.426  33.866 1.00 34.43  ? 72  LYS A CA  1 
ATOM   304  C C   . LYS A 1 72  ? 56.760 40.558  33.621 1.00 33.50  ? 72  LYS A C   1 
ATOM   305  O O   . LYS A 1 72  ? 56.108 40.693  32.585 1.00 37.06  ? 72  LYS A O   1 
ATOM   306  C CB  . LYS A 1 72  ? 59.076 40.979  32.900 1.00 36.84  ? 72  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 72  ? 60.280 41.877  32.867 1.00 45.49  ? 72  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 72  ? 61.386 41.259  32.056 1.00 55.72  ? 72  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 72  ? 62.496 42.262  31.857 1.00 71.53  ? 72  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 72  ? 63.684 41.639  31.221 1.00 83.54  ? 72  LYS A NZ  1 
ATOM   311  N N   . ALA A 1 73  ? 56.479 39.652  34.563 1.00 29.97  ? 73  ALA A N   1 
ATOM   312  C CA  . ALA A 1 73  ? 55.342 38.726  34.478 1.00 19.26  ? 73  ALA A CA  1 
ATOM   313  C C   . ALA A 1 73  ? 54.005 39.365  34.787 1.00 16.82  ? 73  ALA A C   1 
ATOM   314  O O   . ALA A 1 73  ? 53.951 40.511  35.216 1.00 13.52  ? 73  ALA A O   1 
ATOM   315  C CB  . ALA A 1 73  ? 55.558 37.558  35.424 1.00 11.11  ? 73  ALA A CB  1 
ATOM   316  N N   . TYR A 1 74  ? 52.933 38.607  34.552 1.00 13.50  ? 74  TYR A N   1 
ATOM   317  C CA  . TYR A 1 74  ? 51.566 39.037  34.846 1.00 14.73  ? 74  TYR A CA  1 
ATOM   318  C C   . TYR A 1 74  ? 50.598 37.889  34.677 1.00 15.56  ? 74  TYR A C   1 
ATOM   319  O O   . TYR A 1 74  ? 50.968 36.855  34.135 1.00 20.67  ? 74  TYR A O   1 
ATOM   320  C CB  . TYR A 1 74  ? 51.120 40.218  33.980 1.00 17.45  ? 74  TYR A CB  1 
ATOM   321  C CG  . TYR A 1 74  ? 50.975 39.963  32.495 1.00 32.06  ? 74  TYR A CG  1 
ATOM   322  C CD1 . TYR A 1 74  ? 49.762 39.549  31.948 1.00 42.29  ? 74  TYR A CD1 1 
ATOM   323  C CD2 . TYR A 1 74  ? 52.036 40.203  31.623 1.00 41.75  ? 74  TYR A CD2 1 
ATOM   324  C CE1 . TYR A 1 74  ? 49.609 39.385  30.567 1.00 44.49  ? 74  TYR A CE1 1 
ATOM   325  C CE2 . TYR A 1 74  ? 51.897 40.042  30.245 1.00 42.77  ? 74  TYR A CE2 1 
ATOM   326  C CZ  . TYR A 1 74  ? 50.686 39.634  29.726 1.00 48.11  ? 74  TYR A CZ  1 
ATOM   327  O OH  . TYR A 1 74  ? 50.565 39.472  28.364 1.00 56.41  ? 74  TYR A OH  1 
ATOM   328  N N   . SER A 1 75  ? 49.383 38.048  35.203 1.00 15.68  ? 75  SER A N   1 
ATOM   329  C CA  . SER A 1 75  ? 48.330 37.034  35.066 1.00 18.78  ? 75  SER A CA  1 
ATOM   330  C C   . SER A 1 75  ? 47.114 37.716  34.424 1.00 23.55  ? 75  SER A C   1 
ATOM   331  O O   . SER A 1 75  ? 46.752 38.841  34.800 1.00 28.40  ? 75  SER A O   1 
ATOM   332  C CB  . SER A 1 75  ? 47.940 36.463  36.407 1.00 6.14   ? 75  SER A CB  1 
ATOM   333  O OG  . SER A 1 75  ? 47.181 37.410  37.128 1.00 33.83  ? 75  SER A OG  1 
ATOM   334  N N   . LYS A 1 76  ? 46.483 37.044  33.462 1.00 19.38  ? 76  LYS A N   1 
ATOM   335  C CA  . LYS A 1 76  ? 45.358 37.640  32.763 1.00 18.36  ? 76  LYS A CA  1 
ATOM   336  C C   . LYS A 1 76  ? 44.179 36.681  32.693 1.00 22.42  ? 76  LYS A C   1 
ATOM   337  O O   . LYS A 1 76  ? 44.363 35.512  32.357 1.00 33.86  ? 76  LYS A O   1 
ATOM   338  C CB  . LYS A 1 76  ? 45.830 38.054  31.376 1.00 15.45  ? 76  LYS A CB  1 
ATOM   339  C CG  . LYS A 1 76  ? 45.139 39.281  30.849 1.00 25.39  ? 76  LYS A CG  1 
ATOM   340  C CD  . LYS A 1 76  ? 46.078 40.094  29.986 1.00 28.88  ? 76  LYS A CD  1 
ATOM   341  C CE  . LYS A 1 76  ? 46.422 39.388  28.702 1.00 35.03  ? 76  LYS A CE  1 
ATOM   342  N NZ  . LYS A 1 76  ? 47.241 40.274  27.830 1.00 43.55  ? 76  LYS A NZ  1 
ATOM   343  N N   . ILE A 1 77  ? 42.976 37.163  33.021 1.00 16.16  ? 77  ILE A N   1 
ATOM   344  C CA  . ILE A 1 77  ? 41.781 36.313  33.030 1.00 19.65  ? 77  ILE A CA  1 
ATOM   345  C C   . ILE A 1 77  ? 40.615 36.958  32.300 1.00 24.21  ? 77  ILE A C   1 
ATOM   346  O O   . ILE A 1 77  ? 40.240 38.093  32.621 1.00 26.82  ? 77  ILE A O   1 
ATOM   347  C CB  . ILE A 1 77  ? 41.281 36.028  34.477 1.00 24.20  ? 77  ILE A CB  1 
ATOM   348  C CG1 . ILE A 1 77  ? 42.454 35.722  35.413 1.00 40.84  ? 77  ILE A CG1 1 
ATOM   349  C CG2 . ILE A 1 77  ? 40.323 34.830  34.492 1.00 27.33  ? 77  ILE A CG2 1 
ATOM   350  C CD1 . ILE A 1 77  ? 43.061 36.959  36.114 1.00 47.78  ? 77  ILE A CD1 1 
ATOM   351  N N   . LYS A 1 78  ? 40.001 36.213  31.373 1.00 23.52  ? 78  LYS A N   1 
ATOM   352  C CA  . LYS A 1 78  ? 38.852 36.706  30.603 1.00 22.12  ? 78  LYS A CA  1 
ATOM   353  C C   . LYS A 1 78  ? 37.608 35.854  30.859 1.00 23.27  ? 78  LYS A C   1 
ATOM   354  O O   . LYS A 1 78  ? 37.517 34.705  30.411 1.00 30.59  ? 78  LYS A O   1 
ATOM   355  C CB  . LYS A 1 78  ? 39.181 36.711  29.110 1.00 21.92  ? 78  LYS A CB  1 
ATOM   356  C CG  . LYS A 1 78  ? 38.095 37.276  28.230 1.00 16.26  ? 78  LYS A CG  1 
ATOM   357  C CD  . LYS A 1 78  ? 38.421 37.062  26.754 1.00 28.76  ? 78  LYS A CD  1 
ATOM   358  C CE  . LYS A 1 78  ? 37.165 37.037  25.894 1.00 38.76  ? 78  LYS A CE  1 
ATOM   359  N NZ  . LYS A 1 78  ? 36.243 38.172  26.216 1.00 53.80  ? 78  LYS A NZ  1 
ATOM   360  N N   . VAL A 1 79  ? 36.642 36.438  31.555 1.00 15.19  ? 79  VAL A N   1 
ATOM   361  C CA  . VAL A 1 79  ? 35.400 35.751  31.896 1.00 24.07  ? 79  VAL A CA  1 
ATOM   362  C C   . VAL A 1 79  ? 34.232 36.105  30.969 1.00 27.61  ? 79  VAL A C   1 
ATOM   363  O O   . VAL A 1 79  ? 34.019 37.280  30.627 1.00 28.81  ? 79  VAL A O   1 
ATOM   364  C CB  . VAL A 1 79  ? 34.984 36.080  33.354 1.00 22.98  ? 79  VAL A CB  1 
ATOM   365  C CG1 . VAL A 1 79  ? 33.755 35.291  33.749 1.00 15.78  ? 79  VAL A CG1 1 
ATOM   366  C CG2 . VAL A 1 79  ? 36.131 35.791  34.302 1.00 26.81  ? 79  VAL A CG2 1 
ATOM   367  N N   . ASP A 1 80  ? 33.478 35.079  30.571 1.00 29.82  ? 80  ASP A N   1 
ATOM   368  C CA  . ASP A 1 80  ? 32.307 35.241  29.699 1.00 36.68  ? 80  ASP A CA  1 
ATOM   369  C C   . ASP A 1 80  ? 31.276 34.193  30.127 1.00 39.04  ? 80  ASP A C   1 
ATOM   370  O O   . ASP A 1 80  ? 31.288 33.083  29.587 1.00 46.19  ? 80  ASP A O   1 
ATOM   371  C CB  . ASP A 1 80  ? 32.660 34.995  28.213 1.00 38.00  ? 80  ASP A CB  1 
ATOM   372  C CG  . ASP A 1 80  ? 33.880 35.812  27.721 1.00 52.23  ? 80  ASP A CG  1 
ATOM   373  O OD1 . ASP A 1 80  ? 33.892 37.067  27.835 1.00 44.41  ? 80  ASP A OD1 1 
ATOM   374  O OD2 . ASP A 1 80  ? 34.826 35.182  27.185 1.00 50.04  ? 80  ASP A OD2 1 
ATOM   375  N N   . ASN A 1 81  ? 30.454 34.508  31.136 1.00 31.62  ? 81  ASN A N   1 
ATOM   376  C CA  . ASN A 1 81  ? 29.432 33.583  31.635 1.00 24.25  ? 81  ASN A CA  1 
ATOM   377  C C   . ASN A 1 81  ? 28.105 33.855  30.969 1.00 27.28  ? 81  ASN A C   1 
ATOM   378  O O   . ASN A 1 81  ? 27.564 34.956  31.070 1.00 34.12  ? 81  ASN A O   1 
ATOM   379  C CB  . ASN A 1 81  ? 29.186 33.747  33.140 1.00 25.63  ? 81  ASN A CB  1 
ATOM   380  C CG  . ASN A 1 81  ? 30.426 33.587  33.978 1.00 29.16  ? 81  ASN A CG  1 
ATOM   381  O OD1 . ASN A 1 81  ? 30.552 34.246  35.020 1.00 15.64  ? 81  ASN A OD1 1 
ATOM   382  N ND2 . ASN A 1 81  ? 31.336 32.692  33.565 1.00 18.02  ? 81  ASN A ND2 1 
ATOM   383  N N   . HIS A 1 82  ? 27.520 32.825  30.382 1.00 27.77  ? 82  HIS A N   1 
ATOM   384  C CA  . HIS A 1 82  ? 26.236 32.988  29.719 1.00 26.54  ? 82  HIS A CA  1 
ATOM   385  C C   . HIS A 1 82  ? 25.127 32.537  30.631 1.00 18.69  ? 82  HIS A C   1 
ATOM   386  O O   . HIS A 1 82  ? 25.086 31.375  31.016 1.00 19.33  ? 82  HIS A O   1 
ATOM   387  C CB  . HIS A 1 82  ? 26.202 32.166  28.427 1.00 32.65  ? 82  HIS A CB  1 
ATOM   388  C CG  . HIS A 1 82  ? 24.967 32.373  27.603 1.00 31.84  ? 82  HIS A CG  1 
ATOM   389  N ND1 . HIS A 1 82  ? 24.320 31.337  26.964 1.00 27.31  ? 82  HIS A ND1 1 
ATOM   390  C CD2 . HIS A 1 82  ? 24.252 33.490  27.333 1.00 23.80  ? 82  HIS A CD2 1 
ATOM   391  C CE1 . HIS A 1 82  ? 23.256 31.805  26.340 1.00 30.50  ? 82  HIS A CE1 1 
ATOM   392  N NE2 . HIS A 1 82  ? 23.191 33.108  26.549 1.00 27.25  ? 82  HIS A NE2 1 
ATOM   393  N N   . LEU A 1 83  ? 24.242 33.465  30.983 1.00 20.17  ? 83  LEU A N   1 
ATOM   394  C CA  . LEU A 1 83  ? 23.084 33.181  31.845 1.00 21.73  ? 83  LEU A CA  1 
ATOM   395  C C   . LEU A 1 83  ? 23.480 32.533  33.144 1.00 22.11  ? 83  LEU A C   1 
ATOM   396  O O   . LEU A 1 83  ? 22.678 31.847  33.759 1.00 24.84  ? 83  LEU A O   1 
ATOM   397  C CB  . LEU A 1 83  ? 22.103 32.258  31.138 1.00 12.94  ? 83  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 83  ? 21.471 32.824  29.881 1.00 10.20  ? 83  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 83  ? 20.863 31.699  29.060 1.00 10.45  ? 83  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 83  ? 20.445 33.867  30.284 1.00 8.48   ? 83  LEU A CD2 1 
ATOM   401  N N   . PHE A 1 84  ? 24.726 32.746  33.546 1.00 27.06  ? 84  PHE A N   1 
ATOM   402  C CA  . PHE A 1 84  ? 25.249 32.162  34.768 1.00 25.02  ? 84  PHE A CA  1 
ATOM   403  C C   . PHE A 1 84  ? 25.949 33.212  35.601 1.00 28.77  ? 84  PHE A C   1 
ATOM   404  O O   . PHE A 1 84  ? 26.536 34.147  35.067 1.00 32.68  ? 84  PHE A O   1 
ATOM   405  C CB  . PHE A 1 84  ? 26.247 31.056  34.422 1.00 21.60  ? 84  PHE A CB  1 
ATOM   406  C CG  . PHE A 1 84  ? 26.994 30.515  35.603 1.00 13.30  ? 84  PHE A CG  1 
ATOM   407  C CD1 . PHE A 1 84  ? 26.363 29.707  36.525 1.00 20.46  ? 84  PHE A CD1 1 
ATOM   408  C CD2 . PHE A 1 84  ? 28.315 30.850  35.814 1.00 20.62  ? 84  PHE A CD2 1 
ATOM   409  C CE1 . PHE A 1 84  ? 27.028 29.239  37.649 1.00 14.92  ? 84  PHE A CE1 1 
ATOM   410  C CE2 . PHE A 1 84  ? 28.988 30.390  36.935 1.00 25.69  ? 84  PHE A CE2 1 
ATOM   411  C CZ  . PHE A 1 84  ? 28.334 29.579  37.857 1.00 20.65  ? 84  PHE A CZ  1 
ATOM   412  N N   . ASN A 1 85  ? 25.825 33.075  36.916 1.00 31.91  ? 85  ASN A N   1 
ATOM   413  C CA  . ASN A 1 85  ? 26.490 33.951  37.874 1.00 29.35  ? 85  ASN A CA  1 
ATOM   414  C C   . ASN A 1 85  ? 26.437 35.430  37.520 1.00 29.08  ? 85  ASN A C   1 
ATOM   415  O O   . ASN A 1 85  ? 27.488 36.056  37.386 1.00 35.85  ? 85  ASN A O   1 
ATOM   416  C CB  . ASN A 1 85  ? 27.951 33.494  37.989 1.00 30.76  ? 85  ASN A CB  1 
ATOM   417  C CG  . ASN A 1 85  ? 28.588 33.813  39.326 1.00 30.41  ? 85  ASN A CG  1 
ATOM   418  O OD1 . ASN A 1 85  ? 29.649 33.288  39.640 1.00 44.20  ? 85  ASN A OD1 1 
ATOM   419  N ND2 . ASN A 1 85  ? 27.960 34.667  40.113 1.00 32.02  ? 85  ASN A ND2 1 
ATOM   420  N N   . LYS A 1 86  ? 25.242 35.999  37.367 1.00 28.58  ? 86  LYS A N   1 
ATOM   421  C CA  . LYS A 1 86  ? 25.180 37.418  37.038 1.00 36.47  ? 86  LYS A CA  1 
ATOM   422  C C   . LYS A 1 86  ? 24.398 38.341  37.960 1.00 39.94  ? 86  LYS A C   1 
ATOM   423  O O   . LYS A 1 86  ? 24.134 39.495  37.616 1.00 46.04  ? 86  LYS A O   1 
ATOM   424  C CB  . LYS A 1 86  ? 24.827 37.641  35.563 1.00 44.70  ? 86  LYS A CB  1 
ATOM   425  C CG  . LYS A 1 86  ? 23.784 36.719  34.981 1.00 62.46  ? 86  LYS A CG  1 
ATOM   426  C CD  . LYS A 1 86  ? 22.374 37.147  35.349 1.00 77.24  ? 86  LYS A CD  1 
ATOM   427  C CE  . LYS A 1 86  ? 21.330 36.258  34.670 1.00 90.76  ? 86  LYS A CE  1 
ATOM   428  N NZ  . LYS A 1 86  ? 21.476 36.232  33.176 1.00 92.98  ? 86  LYS A NZ  1 
ATOM   429  N N   . GLU A 1 87  ? 24.105 37.864  39.166 1.00 40.25  ? 87  GLU A N   1 
ATOM   430  C CA  . GLU A 1 87  ? 23.378 38.661  40.151 1.00 38.20  ? 87  GLU A CA  1 
ATOM   431  C C   . GLU A 1 87  ? 24.264 39.727  40.775 1.00 40.24  ? 87  GLU A C   1 
ATOM   432  O O   . GLU A 1 87  ? 23.797 40.562  41.547 1.00 38.87  ? 87  GLU A O   1 
ATOM   433  C CB  . GLU A 1 87  ? 22.824 37.774  41.261 1.00 46.27  ? 87  GLU A CB  1 
ATOM   434  C CG  . GLU A 1 87  ? 21.567 37.024  40.888 1.00 60.60  ? 87  GLU A CG  1 
ATOM   435  C CD  . GLU A 1 87  ? 20.436 37.957  40.548 1.00 69.18  ? 87  GLU A CD  1 
ATOM   436  O OE1 . GLU A 1 87  ? 20.049 38.768  41.419 1.00 78.99  ? 87  GLU A OE1 1 
ATOM   437  O OE2 . GLU A 1 87  ? 19.944 37.888  39.405 1.00 76.80  ? 87  GLU A OE2 1 
ATOM   438  N N   . ASN A 1 88  ? 25.556 39.673  40.474 1.00 43.49  ? 88  ASN A N   1 
ATOM   439  C CA  . ASN A 1 88  ? 26.498 40.643  41.014 1.00 45.55  ? 88  ASN A CA  1 
ATOM   440  C C   . ASN A 1 88  ? 27.667 40.956  40.082 1.00 43.31  ? 88  ASN A C   1 
ATOM   441  O O   . ASN A 1 88  ? 28.219 42.056  40.114 1.00 50.68  ? 88  ASN A O   1 
ATOM   442  C CB  . ASN A 1 88  ? 26.999 40.202  42.391 1.00 39.07  ? 88  ASN A CB  1 
ATOM   443  C CG  . ASN A 1 88  ? 26.090 40.672  43.516 1.00 45.74  ? 88  ASN A CG  1 
ATOM   444  O OD1 . ASN A 1 88  ? 25.822 41.869  43.660 1.00 48.85  ? 88  ASN A OD1 1 
ATOM   445  N ND2 . ASN A 1 88  ? 25.609 39.732  44.318 1.00 40.12  ? 88  ASN A ND2 1 
ATOM   446  N N   . LEU A 1 89  ? 28.011 40.011  39.219 1.00 36.25  ? 89  LEU A N   1 
ATOM   447  C CA  . LEU A 1 89  ? 29.113 40.224  38.298 1.00 28.45  ? 89  LEU A CA  1 
ATOM   448  C C   . LEU A 1 89  ? 28.649 40.466  36.867 1.00 29.35  ? 89  LEU A C   1 
ATOM   449  O O   . LEU A 1 89  ? 27.522 40.144  36.503 1.00 38.27  ? 89  LEU A O   1 
ATOM   450  C CB  . LEU A 1 89  ? 30.021 38.992  38.283 1.00 24.66  ? 89  LEU A CB  1 
ATOM   451  C CG  . LEU A 1 89  ? 30.839 38.570  39.494 1.00 14.57  ? 89  LEU A CG  1 
ATOM   452  C CD1 . LEU A 1 89  ? 31.589 37.317  39.135 1.00 18.98  ? 89  LEU A CD1 1 
ATOM   453  C CD2 . LEU A 1 89  ? 31.818 39.653  39.886 1.00 29.54  ? 89  LEU A CD2 1 
ATOM   454  N N   . PRO A 1 90  ? 29.486 41.124  36.062 1.00 18.53  ? 90  PRO A N   1 
ATOM   455  C CA  . PRO A 1 90  ? 29.155 41.381  34.668 1.00 22.95  ? 90  PRO A CA  1 
ATOM   456  C C   . PRO A 1 90  ? 29.281 40.019  33.990 1.00 25.39  ? 90  PRO A C   1 
ATOM   457  O O   . PRO A 1 90  ? 30.064 39.184  34.429 1.00 33.51  ? 90  PRO A O   1 
ATOM   458  C CB  . PRO A 1 90  ? 30.285 42.300  34.224 1.00 27.42  ? 90  PRO A CB  1 
ATOM   459  C CG  . PRO A 1 90  ? 30.603 43.047  35.469 1.00 26.98  ? 90  PRO A CG  1 
ATOM   460  C CD  . PRO A 1 90  ? 30.633 41.940  36.473 1.00 28.97  ? 90  PRO A CD  1 
ATOM   461  N N   . SER A 1 91  ? 28.516 39.773  32.937 1.00 28.11  ? 91  SER A N   1 
ATOM   462  C CA  . SER A 1 91  ? 28.591 38.476  32.273 1.00 24.93  ? 91  SER A CA  1 
ATOM   463  C C   . SER A 1 91  ? 29.931 38.263  31.559 1.00 18.91  ? 91  SER A C   1 
ATOM   464  O O   . SER A 1 91  ? 30.389 37.130  31.377 1.00 11.41  ? 91  SER A O   1 
ATOM   465  C CB  . SER A 1 91  ? 27.395 38.298  31.340 1.00 23.27  ? 91  SER A CB  1 
ATOM   466  O OG  . SER A 1 91  ? 26.187 38.442  32.077 1.00 33.48  ? 91  SER A OG  1 
ATOM   467  N N   . ARG A 1 92  ? 30.576 39.362  31.192 1.00 16.46  ? 92  ARG A N   1 
ATOM   468  C CA  . ARG A 1 92  ? 31.869 39.293  30.531 1.00 21.37  ? 92  ARG A CA  1 
ATOM   469  C C   . ARG A 1 92  ? 32.710 40.388  31.162 1.00 26.57  ? 92  ARG A C   1 
ATOM   470  O O   . ARG A 1 92  ? 32.189 41.471  31.447 1.00 28.75  ? 92  ARG A O   1 
ATOM   471  C CB  . ARG A 1 92  ? 31.735 39.558  29.028 1.00 26.52  ? 92  ARG A CB  1 
ATOM   472  C CG  . ARG A 1 92  ? 30.802 38.615  28.278 1.00 34.45  ? 92  ARG A CG  1 
ATOM   473  C CD  . ARG A 1 92  ? 30.768 38.888  26.772 1.00 42.49  ? 92  ARG A CD  1 
ATOM   474  N NE  . ARG A 1 92  ? 31.989 38.473  26.074 1.00 51.90  ? 92  ARG A NE  1 
ATOM   475  C CZ  . ARG A 1 92  ? 32.188 38.604  24.760 1.00 60.53  ? 92  ARG A CZ  1 
ATOM   476  N NH1 . ARG A 1 92  ? 31.254 39.140  23.989 1.00 66.03  ? 92  ARG A NH1 1 
ATOM   477  N NH2 . ARG A 1 92  ? 33.321 38.186  24.205 1.00 64.01  ? 92  ARG A NH2 1 
ATOM   478  N N   . PHE A 1 93  ? 33.980 40.081  31.440 1.00 23.72  ? 93  PHE A N   1 
ATOM   479  C CA  . PHE A 1 93  ? 34.926 41.036  32.031 1.00 19.11  ? 93  PHE A CA  1 
ATOM   480  C C   . PHE A 1 93  ? 36.335 40.463  32.011 1.00 18.20  ? 93  PHE A C   1 
ATOM   481  O O   . PHE A 1 93  ? 36.516 39.247  31.830 1.00 16.45  ? 93  PHE A O   1 
ATOM   482  C CB  . PHE A 1 93  ? 34.530 41.417  33.475 1.00 25.47  ? 93  PHE A CB  1 
ATOM   483  C CG  . PHE A 1 93  ? 34.479 40.250  34.449 1.00 28.39  ? 93  PHE A CG  1 
ATOM   484  C CD1 . PHE A 1 93  ? 35.630 39.802  35.091 1.00 29.01  ? 93  PHE A CD1 1 
ATOM   485  C CD2 . PHE A 1 93  ? 33.283 39.592  34.704 1.00 29.30  ? 93  PHE A CD2 1 
ATOM   486  C CE1 . PHE A 1 93  ? 35.589 38.709  35.965 1.00 31.82  ? 93  PHE A CE1 1 
ATOM   487  C CE2 . PHE A 1 93  ? 33.231 38.500  35.574 1.00 28.26  ? 93  PHE A CE2 1 
ATOM   488  C CZ  . PHE A 1 93  ? 34.388 38.056  36.203 1.00 34.79  ? 93  PHE A CZ  1 
ATOM   489  N N   . LYS A 1 94  ? 37.339 41.329  32.142 1.00 12.27  ? 94  LYS A N   1 
ATOM   490  C CA  . LYS A 1 94  ? 38.713 40.833  32.181 1.00 15.19  ? 94  LYS A CA  1 
ATOM   491  C C   . LYS A 1 94  ? 39.397 41.354  33.437 1.00 19.78  ? 94  LYS A C   1 
ATOM   492  O O   . LYS A 1 94  ? 39.031 42.425  33.929 1.00 20.06  ? 94  LYS A O   1 
ATOM   493  C CB  . LYS A 1 94  ? 39.509 41.294  30.965 1.00 13.77  ? 94  LYS A CB  1 
ATOM   494  C CG  . LYS A 1 94  ? 38.919 40.969  29.611 1.00 16.89  ? 94  LYS A CG  1 
ATOM   495  C CD  . LYS A 1 94  ? 39.968 41.278  28.551 1.00 29.01  ? 94  LYS A CD  1 
ATOM   496  C CE  . LYS A 1 94  ? 39.370 41.476  27.175 1.00 40.98  ? 94  LYS A CE  1 
ATOM   497  N NZ  . LYS A 1 94  ? 38.653 40.257  26.731 1.00 66.13  ? 94  LYS A NZ  1 
ATOM   498  N N   . PHE A 1 95  ? 40.380 40.605  33.947 1.00 15.34  ? 95  PHE A N   1 
ATOM   499  C CA  . PHE A 1 95  ? 41.144 41.008  35.135 1.00 17.50  ? 95  PHE A CA  1 
ATOM   500  C C   . PHE A 1 95  ? 42.634 40.705  34.920 1.00 22.20  ? 95  PHE A C   1 
ATOM   501  O O   . PHE A 1 95  ? 43.006 39.586  34.526 1.00 26.26  ? 95  PHE A O   1 
ATOM   502  C CB  . PHE A 1 95  ? 40.647 40.283  36.387 1.00 11.32  ? 95  PHE A CB  1 
ATOM   503  C CG  . PHE A 1 95  ? 41.081 40.929  37.662 1.00 2.00   ? 95  PHE A CG  1 
ATOM   504  C CD1 . PHE A 1 95  ? 40.469 42.080  38.102 1.00 2.00   ? 95  PHE A CD1 1 
ATOM   505  C CD2 . PHE A 1 95  ? 42.127 40.414  38.398 1.00 3.73   ? 95  PHE A CD2 1 
ATOM   506  C CE1 . PHE A 1 95  ? 40.899 42.717  39.258 1.00 2.00   ? 95  PHE A CE1 1 
ATOM   507  C CE2 . PHE A 1 95  ? 42.560 41.048  39.556 1.00 2.28   ? 95  PHE A CE2 1 
ATOM   508  C CZ  . PHE A 1 95  ? 41.946 42.198  39.980 1.00 2.00   ? 95  PHE A CZ  1 
ATOM   509  N N   . LYS A 1 96  ? 43.492 41.688  35.191 1.00 22.58  ? 96  LYS A N   1 
ATOM   510  C CA  . LYS A 1 96  ? 44.932 41.499  34.989 1.00 19.68  ? 96  LYS A CA  1 
ATOM   511  C C   . LYS A 1 96  ? 45.735 41.932  36.194 1.00 16.90  ? 96  LYS A C   1 
ATOM   512  O O   . LYS A 1 96  ? 45.559 43.047  36.700 1.00 26.37  ? 96  LYS A O   1 
ATOM   513  C CB  . LYS A 1 96  ? 45.399 42.296  33.774 1.00 21.93  ? 96  LYS A CB  1 
ATOM   514  C CG  . LYS A 1 96  ? 46.791 41.961  33.340 1.00 19.71  ? 96  LYS A CG  1 
ATOM   515  C CD  . LYS A 1 96  ? 47.316 42.976  32.361 1.00 22.57  ? 96  LYS A CD  1 
ATOM   516  C CE  . LYS A 1 96  ? 48.751 42.620  32.023 1.00 26.82  ? 96  LYS A CE  1 
ATOM   517  N NZ  . LYS A 1 96  ? 49.421 43.694  31.251 1.00 45.41  ? 96  LYS A NZ  1 
ATOM   518  N N   . GLU A 1 97  ? 46.630 41.064  36.643 1.00 2.00   ? 97  GLU A N   1 
ATOM   519  C CA  . GLU A 1 97  ? 47.444 41.390  37.794 1.00 6.26   ? 97  GLU A CA  1 
ATOM   520  C C   . GLU A 1 97  ? 48.929 41.520  37.440 1.00 13.44  ? 97  GLU A C   1 
ATOM   521  O O   . GLU A 1 97  ? 49.570 40.554  37.000 1.00 18.49  ? 97  GLU A O   1 
ATOM   522  C CB  . GLU A 1 97  ? 47.259 40.337  38.870 1.00 7.81   ? 97  GLU A CB  1 
ATOM   523  C CG  . GLU A 1 97  ? 48.165 40.578  40.051 1.00 18.99  ? 97  GLU A CG  1 
ATOM   524  C CD  . GLU A 1 97  ? 48.170 39.446  41.029 1.00 24.21  ? 97  GLU A CD  1 
ATOM   525  O OE1 . GLU A 1 97  ? 47.941 38.268  40.605 1.00 12.87  ? 97  GLU A OE1 1 
ATOM   526  O OE2 . GLU A 1 97  ? 48.410 39.765  42.222 1.00 27.15  ? 97  GLU A OE2 1 
ATOM   527  N N   . TYR A 1 98  ? 49.491 42.699  37.673 1.00 5.19   ? 98  TYR A N   1 
ATOM   528  C CA  . TYR A 1 98  ? 50.893 42.923  37.355 1.00 6.99   ? 98  TYR A CA  1 
ATOM   529  C C   . TYR A 1 98  ? 51.899 42.339  38.359 1.00 2.83   ? 98  TYR A C   1 
ATOM   530  O O   . TYR A 1 98  ? 51.849 42.622  39.541 1.00 3.58   ? 98  TYR A O   1 
ATOM   531  C CB  . TYR A 1 98  ? 51.154 44.416  37.180 1.00 5.05   ? 98  TYR A CB  1 
ATOM   532  C CG  . TYR A 1 98  ? 50.305 45.068  36.115 1.00 11.97  ? 98  TYR A CG  1 
ATOM   533  C CD1 . TYR A 1 98  ? 49.312 45.969  36.455 1.00 22.07  ? 98  TYR A CD1 1 
ATOM   534  C CD2 . TYR A 1 98  ? 50.515 44.814  34.772 1.00 6.75   ? 98  TYR A CD2 1 
ATOM   535  C CE1 . TYR A 1 98  ? 48.552 46.610  35.490 1.00 23.61  ? 98  TYR A CE1 1 
ATOM   536  C CE2 . TYR A 1 98  ? 49.757 45.451  33.800 1.00 11.46  ? 98  TYR A CE2 1 
ATOM   537  C CZ  . TYR A 1 98  ? 48.782 46.353  34.173 1.00 13.12  ? 98  TYR A CZ  1 
ATOM   538  O OH  . TYR A 1 98  ? 48.056 47.058  33.252 1.00 19.77  ? 98  TYR A OH  1 
ATOM   539  N N   . CYS A 1 99  ? 52.821 41.527  37.868 1.00 6.47   ? 99  CYS A N   1 
ATOM   540  C CA  . CYS A 1 99  ? 53.869 40.951  38.693 1.00 9.35   ? 99  CYS A CA  1 
ATOM   541  C C   . CYS A 1 99  ? 53.342 40.342  39.991 1.00 14.58  ? 99  CYS A C   1 
ATOM   542  O O   . CYS A 1 99  ? 53.719 40.753  41.090 1.00 20.36  ? 99  CYS A O   1 
ATOM   543  C CB  . CYS A 1 99  ? 54.920 42.011  39.038 1.00 5.64   ? 99  CYS A CB  1 
ATOM   544  S SG  . CYS A 1 99  ? 55.475 43.068  37.695 1.00 30.96  ? 99  CYS A SG  1 
ATOM   545  N N   . PRO A 1 100 ? 52.464 39.356  39.886 1.00 8.37   ? 100 PRO A N   1 
ATOM   546  C CA  . PRO A 1 100 ? 51.891 38.690  41.048 1.00 15.80  ? 100 PRO A CA  1 
ATOM   547  C C   . PRO A 1 100 ? 52.899 38.336  42.152 1.00 18.22  ? 100 PRO A C   1 
ATOM   548  O O   . PRO A 1 100 ? 52.669 38.640  43.324 1.00 23.84  ? 100 PRO A O   1 
ATOM   549  C CB  . PRO A 1 100 ? 51.288 37.428  40.435 1.00 15.22  ? 100 PRO A CB  1 
ATOM   550  C CG  . PRO A 1 100 ? 50.804 37.904  39.156 1.00 23.61  ? 100 PRO A CG  1 
ATOM   551  C CD  . PRO A 1 100 ? 51.931 38.783  38.647 1.00 19.65  ? 100 PRO A CD  1 
ATOM   552  N N   . MET A 1 101 ? 54.024 37.734  41.774 1.00 12.61  ? 101 MET A N   1 
ATOM   553  C CA  . MET A 1 101 ? 55.016 37.302  42.751 1.00 12.02  ? 101 MET A CA  1 
ATOM   554  C C   . MET A 1 101 ? 55.731 38.412  43.506 1.00 16.51  ? 101 MET A C   1 
ATOM   555  O O   . MET A 1 101 ? 55.977 38.269  44.701 1.00 22.45  ? 101 MET A O   1 
ATOM   556  C CB  . MET A 1 101 ? 56.036 36.371  42.111 1.00 4.39   ? 101 MET A CB  1 
ATOM   557  C CG  . MET A 1 101 ? 55.431 35.255  41.287 1.00 8.38   ? 101 MET A CG  1 
ATOM   558  S SD  . MET A 1 101 ? 54.761 33.837  42.204 1.00 24.40  ? 101 MET A SD  1 
ATOM   559  C CE  . MET A 1 101 ? 56.313 33.070  42.793 1.00 13.14  ? 101 MET A CE  1 
ATOM   560  N N   . VAL A 1 102 ? 56.065 39.506  42.831 1.00 12.13  ? 102 VAL A N   1 
ATOM   561  C CA  . VAL A 1 102 ? 56.760 40.611  43.490 1.00 15.89  ? 102 VAL A CA  1 
ATOM   562  C C   . VAL A 1 102 ? 55.899 41.351  44.511 1.00 19.85  ? 102 VAL A C   1 
ATOM   563  O O   . VAL A 1 102 ? 56.397 41.748  45.561 1.00 22.07  ? 102 VAL A O   1 
ATOM   564  C CB  . VAL A 1 102 ? 57.322 41.618  42.487 1.00 12.97  ? 102 VAL A CB  1 
ATOM   565  C CG1 . VAL A 1 102 ? 57.819 42.853  43.196 1.00 9.16   ? 102 VAL A CG1 1 
ATOM   566  C CG2 . VAL A 1 102 ? 58.459 40.984  41.732 1.00 19.16  ? 102 VAL A CG2 1 
ATOM   567  N N   . PHE A 1 103 ? 54.622 41.574  44.204 1.00 22.47  ? 103 PHE A N   1 
ATOM   568  C CA  . PHE A 1 103 ? 53.756 42.265  45.160 1.00 14.37  ? 103 PHE A CA  1 
ATOM   569  C C   . PHE A 1 103 ? 53.417 41.329  46.319 1.00 12.13  ? 103 PHE A C   1 
ATOM   570  O O   . PHE A 1 103 ? 53.420 41.722  47.486 1.00 11.52  ? 103 PHE A O   1 
ATOM   571  C CB  . PHE A 1 103 ? 52.509 42.777  44.475 1.00 4.46   ? 103 PHE A CB  1 
ATOM   572  C CG  . PHE A 1 103 ? 52.751 43.984  43.641 1.00 6.60   ? 103 PHE A CG  1 
ATOM   573  C CD1 . PHE A 1 103 ? 52.777 43.893  42.259 1.00 3.26   ? 103 PHE A CD1 1 
ATOM   574  C CD2 . PHE A 1 103 ? 52.954 45.221  44.237 1.00 2.89   ? 103 PHE A CD2 1 
ATOM   575  C CE1 . PHE A 1 103 ? 53.003 45.024  41.476 1.00 11.11  ? 103 PHE A CE1 1 
ATOM   576  C CE2 . PHE A 1 103 ? 53.180 46.361  43.457 1.00 9.06   ? 103 PHE A CE2 1 
ATOM   577  C CZ  . PHE A 1 103 ? 53.203 46.254  42.070 1.00 3.31   ? 103 PHE A CZ  1 
ATOM   578  N N   . ARG A 1 104 ? 53.194 40.068  45.998 1.00 8.31   ? 104 ARG A N   1 
ATOM   579  C CA  . ARG A 1 104 ? 52.908 39.082  47.016 1.00 5.51   ? 104 ARG A CA  1 
ATOM   580  C C   . ARG A 1 104 ? 54.053 39.068  48.015 1.00 12.50  ? 104 ARG A C   1 
ATOM   581  O O   . ARG A 1 104 ? 53.845 38.830  49.202 1.00 28.81  ? 104 ARG A O   1 
ATOM   582  C CB  . ARG A 1 104 ? 52.786 37.733  46.355 1.00 7.49   ? 104 ARG A CB  1 
ATOM   583  C CG  . ARG A 1 104 ? 52.782 36.572  47.278 1.00 2.00   ? 104 ARG A CG  1 
ATOM   584  C CD  . ARG A 1 104 ? 53.485 35.419  46.586 1.00 4.32   ? 104 ARG A CD  1 
ATOM   585  N NE  . ARG A 1 104 ? 52.857 34.161  46.927 1.00 3.57   ? 104 ARG A NE  1 
ATOM   586  C CZ  . ARG A 1 104 ? 53.356 32.982  46.608 1.00 12.10  ? 104 ARG A CZ  1 
ATOM   587  N NH1 . ARG A 1 104 ? 54.493 32.885  45.926 1.00 11.57  ? 104 ARG A NH1 1 
ATOM   588  N NH2 . ARG A 1 104 ? 52.736 31.900  47.023 1.00 23.45  ? 104 ARG A NH2 1 
ATOM   589  N N   . ASN A 1 105 ? 55.268 39.329  47.538 1.00 20.31  ? 105 ASN A N   1 
ATOM   590  C CA  . ASN A 1 105 ? 56.439 39.357  48.421 1.00 20.21  ? 105 ASN A CA  1 
ATOM   591  C C   . ASN A 1 105 ? 56.442 40.684  49.157 1.00 20.99  ? 105 ASN A C   1 
ATOM   592  O O   . ASN A 1 105 ? 56.741 40.740  50.348 1.00 29.29  ? 105 ASN A O   1 
ATOM   593  C CB  . ASN A 1 105 ? 57.732 39.208  47.622 1.00 19.66  ? 105 ASN A CB  1 
ATOM   594  C CG  . ASN A 1 105 ? 58.958 39.156  48.501 1.00 20.61  ? 105 ASN A CG  1 
ATOM   595  O OD1 . ASN A 1 105 ? 59.727 40.113  48.574 1.00 15.39  ? 105 ASN A OD1 1 
ATOM   596  N ND2 . ASN A 1 105 ? 59.154 38.027  49.166 1.00 30.76  ? 105 ASN A ND2 1 
ATOM   597  N N   . LEU A 1 106 ? 56.099 41.751  48.441 1.00 17.68  ? 106 LEU A N   1 
ATOM   598  C CA  . LEU A 1 106 ? 56.043 43.081  49.032 1.00 19.43  ? 106 LEU A CA  1 
ATOM   599  C C   . LEU A 1 106 ? 55.021 43.069  50.179 1.00 22.38  ? 106 LEU A C   1 
ATOM   600  O O   . LEU A 1 106 ? 55.141 43.828  51.151 1.00 20.73  ? 106 LEU A O   1 
ATOM   601  C CB  . LEU A 1 106 ? 55.660 44.127  47.974 1.00 7.41   ? 106 LEU A CB  1 
ATOM   602  C CG  . LEU A 1 106 ? 56.815 44.462  47.034 1.00 12.78  ? 106 LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 106 ? 56.359 45.328  45.898 1.00 13.19  ? 106 LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 106 ? 57.903 45.153  47.806 1.00 9.81   ? 106 LEU A CD2 1 
ATOM   605  N N   . ARG A 1 107 ? 54.039 42.176  50.075 1.00 17.35  ? 107 ARG A N   1 
ATOM   606  C CA  . ARG A 1 107 ? 53.016 42.065  51.089 1.00 19.64  ? 107 ARG A CA  1 
ATOM   607  C C   . ARG A 1 107 ? 53.611 41.486  52.379 1.00 25.05  ? 107 ARG A C   1 
ATOM   608  O O   . ARG A 1 107 ? 53.577 42.140  53.430 1.00 23.54  ? 107 ARG A O   1 
ATOM   609  C CB  . ARG A 1 107 ? 51.848 41.220  50.574 1.00 13.24  ? 107 ARG A CB  1 
ATOM   610  C CG  . ARG A 1 107 ? 50.672 42.037  50.091 1.00 11.60  ? 107 ARG A CG  1 
ATOM   611  C CD  . ARG A 1 107 ? 49.610 41.158  49.421 1.00 2.63   ? 107 ARG A CD  1 
ATOM   612  N NE  . ARG A 1 107 ? 49.852 41.085  47.988 1.00 17.90  ? 107 ARG A NE  1 
ATOM   613  C CZ  . ARG A 1 107 ? 49.630 40.007  47.241 1.00 27.77  ? 107 ARG A CZ  1 
ATOM   614  N NH1 . ARG A 1 107 ? 49.135 38.911  47.801 1.00 20.92  ? 107 ARG A NH1 1 
ATOM   615  N NH2 . ARG A 1 107 ? 49.982 39.993  45.948 1.00 25.17  ? 107 ARG A NH2 1 
ATOM   616  N N   . GLU A 1 108 ? 54.223 40.308  52.298 1.00 24.50  ? 108 GLU A N   1 
ATOM   617  C CA  . GLU A 1 108 ? 54.801 39.707  53.494 1.00 32.67  ? 108 GLU A CA  1 
ATOM   618  C C   . GLU A 1 108 ? 55.912 40.582  54.041 1.00 33.75  ? 108 GLU A C   1 
ATOM   619  O O   . GLU A 1 108 ? 56.184 40.591  55.240 1.00 39.40  ? 108 GLU A O   1 
ATOM   620  C CB  . GLU A 1 108 ? 55.330 38.300  53.221 1.00 44.19  ? 108 GLU A CB  1 
ATOM   621  C CG  . GLU A 1 108 ? 56.790 38.210  52.846 1.00 54.20  ? 108 GLU A CG  1 
ATOM   622  C CD  . GLU A 1 108 ? 57.271 36.774  52.810 1.00 62.72  ? 108 GLU A CD  1 
ATOM   623  O OE1 . GLU A 1 108 ? 57.028 36.096  51.783 1.00 69.93  ? 108 GLU A OE1 1 
ATOM   624  O OE2 . GLU A 1 108 ? 57.877 36.326  53.813 1.00 61.68  ? 108 GLU A OE2 1 
ATOM   625  N N   . ARG A 1 109 ? 56.526 41.347  53.154 1.00 30.55  ? 109 ARG A N   1 
ATOM   626  C CA  . ARG A 1 109 ? 57.607 42.242  53.535 1.00 32.72  ? 109 ARG A CA  1 
ATOM   627  C C   . ARG A 1 109 ? 57.062 43.423  54.344 1.00 32.12  ? 109 ARG A C   1 
ATOM   628  O O   . ARG A 1 109 ? 57.803 44.090  55.068 1.00 34.32  ? 109 ARG A O   1 
ATOM   629  C CB  . ARG A 1 109 ? 58.330 42.725  52.281 1.00 28.10  ? 109 ARG A CB  1 
ATOM   630  C CG  . ARG A 1 109 ? 59.753 43.102  52.512 1.00 33.18  ? 109 ARG A CG  1 
ATOM   631  C CD  . ARG A 1 109 ? 60.592 42.701  51.330 1.00 40.05  ? 109 ARG A CD  1 
ATOM   632  N NE  . ARG A 1 109 ? 60.963 41.286  51.330 1.00 34.19  ? 109 ARG A NE  1 
ATOM   633  C CZ  . ARG A 1 109 ? 62.226 40.856  51.317 1.00 37.95  ? 109 ARG A CZ  1 
ATOM   634  N NH1 . ARG A 1 109 ? 63.231 41.726  51.317 1.00 28.32  ? 109 ARG A NH1 1 
ATOM   635  N NH2 . ARG A 1 109 ? 62.496 39.558  51.250 1.00 40.68  ? 109 ARG A NH2 1 
ATOM   636  N N   . PHE A 1 110 ? 55.764 43.679  54.195 1.00 27.17  ? 110 PHE A N   1 
ATOM   637  C CA  . PHE A 1 110 ? 55.087 44.749  54.912 1.00 18.18  ? 110 PHE A CA  1 
ATOM   638  C C   . PHE A 1 110 ? 54.207 44.088  55.949 1.00 19.49  ? 110 PHE A C   1 
ATOM   639  O O   . PHE A 1 110 ? 53.234 44.672  56.429 1.00 23.59  ? 110 PHE A O   1 
ATOM   640  C CB  . PHE A 1 110 ? 54.228 45.584  53.963 1.00 19.85  ? 110 PHE A CB  1 
ATOM   641  C CG  . PHE A 1 110 ? 55.020 46.371  52.958 1.00 23.19  ? 110 PHE A CG  1 
ATOM   642  C CD1 . PHE A 1 110 ? 54.584 46.481  51.646 1.00 22.17  ? 110 PHE A CD1 1 
ATOM   643  C CD2 . PHE A 1 110 ? 56.177 47.042  53.333 1.00 22.95  ? 110 PHE A CD2 1 
ATOM   644  C CE1 . PHE A 1 110 ? 55.282 47.251  50.724 1.00 26.15  ? 110 PHE A CE1 1 
ATOM   645  C CE2 . PHE A 1 110 ? 56.888 47.819  52.415 1.00 22.25  ? 110 PHE A CE2 1 
ATOM   646  C CZ  . PHE A 1 110 ? 56.440 47.926  51.111 1.00 25.94  ? 110 PHE A CZ  1 
ATOM   647  N N   . GLY A 1 111 ? 54.514 42.830  56.238 1.00 13.91  ? 111 GLY A N   1 
ATOM   648  C CA  . GLY A 1 111 ? 53.768 42.089  57.238 1.00 19.53  ? 111 GLY A CA  1 
ATOM   649  C C   . GLY A 1 111 ? 52.266 42.020  57.057 1.00 19.86  ? 111 GLY A C   1 
ATOM   650  O O   . GLY A 1 111 ? 51.517 42.273  57.988 1.00 39.37  ? 111 GLY A O   1 
ATOM   651  N N   . ILE A 1 112 ? 51.817 41.707  55.856 1.00 20.60  ? 112 ILE A N   1 
ATOM   652  C CA  . ILE A 1 112 ? 50.399 41.577  55.596 1.00 12.38  ? 112 ILE A CA  1 
ATOM   653  C C   . ILE A 1 112 ? 50.147 40.154  55.131 1.00 16.61  ? 112 ILE A C   1 
ATOM   654  O O   . ILE A 1 112 ? 50.883 39.611  54.319 1.00 20.13  ? 112 ILE A O   1 
ATOM   655  C CB  . ILE A 1 112 ? 49.959 42.544  54.533 1.00 6.61   ? 112 ILE A CB  1 
ATOM   656  C CG1 . ILE A 1 112 ? 50.213 43.961  55.026 1.00 9.99   ? 112 ILE A CG1 1 
ATOM   657  C CG2 . ILE A 1 112 ? 48.501 42.329  54.190 1.00 2.00   ? 112 ILE A CG2 1 
ATOM   658  C CD1 . ILE A 1 112 ? 49.715 45.035  54.067 1.00 21.40  ? 112 ILE A CD1 1 
ATOM   659  N N   . ASP A 1 113 ? 49.156 39.516  55.724 1.00 25.49  ? 113 ASP A N   1 
ATOM   660  C CA  . ASP A 1 113 ? 48.827 38.149  55.357 1.00 25.84  ? 113 ASP A CA  1 
ATOM   661  C C   . ASP A 1 113 ? 47.963 38.233  54.119 1.00 25.17  ? 113 ASP A C   1 
ATOM   662  O O   . ASP A 1 113 ? 46.998 39.001  54.074 1.00 26.18  ? 113 ASP A O   1 
ATOM   663  C CB  . ASP A 1 113 ? 48.048 37.466  56.480 1.00 33.04  ? 113 ASP A CB  1 
ATOM   664  C CG  . ASP A 1 113 ? 48.064 35.964  56.364 1.00 44.60  ? 113 ASP A CG  1 
ATOM   665  O OD1 . ASP A 1 113 ? 47.356 35.415  55.492 1.00 45.64  ? 113 ASP A OD1 1 
ATOM   666  O OD2 . ASP A 1 113 ? 48.800 35.332  57.151 1.00 63.00  ? 113 ASP A OD2 1 
ATOM   667  N N   . ASP A 1 114 ? 48.305 37.448  53.111 1.00 18.71  ? 114 ASP A N   1 
ATOM   668  C CA  . ASP A 1 114 ? 47.539 37.455  51.885 1.00 13.44  ? 114 ASP A CA  1 
ATOM   669  C C   . ASP A 1 114 ? 46.050 37.292  52.110 1.00 17.76  ? 114 ASP A C   1 
ATOM   670  O O   . ASP A 1 114 ? 45.250 37.985  51.482 1.00 19.34  ? 114 ASP A O   1 
ATOM   671  C CB  . ASP A 1 114 ? 48.029 36.364  50.963 1.00 14.90  ? 114 ASP A CB  1 
ATOM   672  C CG  . ASP A 1 114 ? 48.947 36.883  49.901 1.00 21.12  ? 114 ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 114 ? 49.681 37.871  50.156 1.00 19.02  ? 114 ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 114 ? 48.924 36.301  48.798 1.00 29.62  ? 114 ASP A OD2 1 
ATOM   675  N N   . GLN A 1 115 ? 45.674 36.408  53.033 1.00 18.71  ? 115 GLN A N   1 
ATOM   676  C CA  . GLN A 1 115 ? 44.260 36.180  53.282 1.00 26.17  ? 115 GLN A CA  1 
ATOM   677  C C   . GLN A 1 115 ? 43.625 37.343  53.995 1.00 25.22  ? 115 GLN A C   1 
ATOM   678  O O   . GLN A 1 115 ? 42.426 37.568  53.848 1.00 31.34  ? 115 GLN A O   1 
ATOM   679  C CB  . GLN A 1 115 ? 44.009 34.893  54.044 1.00 30.67  ? 115 GLN A CB  1 
ATOM   680  C CG  . GLN A 1 115 ? 42.564 34.462  53.986 1.00 38.44  ? 115 GLN A CG  1 
ATOM   681  C CD  . GLN A 1 115 ? 42.337 33.140  54.669 1.00 51.49  ? 115 GLN A CD  1 
ATOM   682  O OE1 . GLN A 1 115 ? 43.150 32.220  54.550 1.00 58.63  ? 115 GLN A OE1 1 
ATOM   683  N NE2 . GLN A 1 115 ? 41.231 33.032  55.397 1.00 61.16  ? 115 GLN A NE2 1 
ATOM   684  N N   . ASP A 1 116 ? 44.413 38.071  54.780 1.00 19.38  ? 116 ASP A N   1 
ATOM   685  C CA  . ASP A 1 116 ? 43.885 39.240  55.463 1.00 21.40  ? 116 ASP A CA  1 
ATOM   686  C C   . ASP A 1 116 ? 43.651 40.291  54.390 1.00 26.65  ? 116 ASP A C   1 
ATOM   687  O O   . ASP A 1 116 ? 42.647 41.020  54.405 1.00 31.30  ? 116 ASP A O   1 
ATOM   688  C CB  . ASP A 1 116 ? 44.879 39.770  56.484 1.00 18.33  ? 116 ASP A CB  1 
ATOM   689  C CG  . ASP A 1 116 ? 44.968 38.903  57.698 1.00 32.77  ? 116 ASP A CG  1 
ATOM   690  O OD1 . ASP A 1 116 ? 45.879 39.154  58.510 1.00 35.66  ? 116 ASP A OD1 1 
ATOM   691  O OD2 . ASP A 1 116 ? 44.129 37.980  57.848 1.00 40.85  ? 116 ASP A OD2 1 
ATOM   692  N N   . TYR A 1 117 ? 44.574 40.328  53.432 1.00 22.92  ? 117 TYR A N   1 
ATOM   693  C CA  . TYR A 1 117 ? 44.515 41.274  52.325 1.00 18.40  ? 117 TYR A CA  1 
ATOM   694  C C   . TYR A 1 117 ? 43.282 40.975  51.478 1.00 15.50  ? 117 TYR A C   1 
ATOM   695  O O   . TYR A 1 117 ? 42.496 41.868  51.136 1.00 13.41  ? 117 TYR A O   1 
ATOM   696  C CB  . TYR A 1 117 ? 45.777 41.132  51.469 1.00 11.77  ? 117 TYR A CB  1 
ATOM   697  C CG  . TYR A 1 117 ? 45.775 41.996  50.236 1.00 12.11  ? 117 TYR A CG  1 
ATOM   698  C CD1 . TYR A 1 117 ? 45.743 41.430  48.967 1.00 6.34   ? 117 TYR A CD1 1 
ATOM   699  C CD2 . TYR A 1 117 ? 45.774 43.379  50.341 1.00 19.06  ? 117 TYR A CD2 1 
ATOM   700  C CE1 . TYR A 1 117 ? 45.704 42.218  47.840 1.00 10.54  ? 117 TYR A CE1 1 
ATOM   701  C CE2 . TYR A 1 117 ? 45.736 44.182  49.220 1.00 17.45  ? 117 TYR A CE2 1 
ATOM   702  C CZ  . TYR A 1 117 ? 45.696 43.596  47.973 1.00 21.09  ? 117 TYR A CZ  1 
ATOM   703  O OH  . TYR A 1 117 ? 45.611 44.401  46.858 1.00 34.12  ? 117 TYR A OH  1 
ATOM   704  N N   . GLN A 1 118 ? 43.097 39.691  51.206 1.00 7.01   ? 118 GLN A N   1 
ATOM   705  C CA  . GLN A 1 118 ? 41.998 39.206  50.395 1.00 7.03   ? 118 GLN A CA  1 
ATOM   706  C C   . GLN A 1 118 ? 40.639 39.525  50.986 1.00 14.33  ? 118 GLN A C   1 
ATOM   707  O O   . GLN A 1 118 ? 39.765 40.034  50.284 1.00 20.12  ? 118 GLN A O   1 
ATOM   708  C CB  . GLN A 1 118 ? 42.145 37.689  50.186 1.00 2.00   ? 118 GLN A CB  1 
ATOM   709  C CG  . GLN A 1 118 ? 40.973 37.056  49.503 1.00 2.00   ? 118 GLN A CG  1 
ATOM   710  C CD  . GLN A 1 118 ? 41.220 35.611  49.235 1.00 5.90   ? 118 GLN A CD  1 
ATOM   711  O OE1 . GLN A 1 118 ? 41.757 34.913  50.080 1.00 26.87  ? 118 GLN A OE1 1 
ATOM   712  N NE2 . GLN A 1 118 ? 40.865 35.145  48.040 1.00 22.09  ? 118 GLN A NE2 1 
ATOM   713  N N   . ASN A 1 119 ? 40.480 39.246  52.282 1.00 21.53  ? 119 ASN A N   1 
ATOM   714  C CA  . ASN A 1 119 ? 39.216 39.466  52.986 1.00 18.70  ? 119 ASN A CA  1 
ATOM   715  C C   . ASN A 1 119 ? 38.869 40.936  53.098 1.00 18.54  ? 119 ASN A C   1 
ATOM   716  O O   . ASN A 1 119 ? 37.704 41.304  53.009 1.00 22.44  ? 119 ASN A O   1 
ATOM   717  C CB  . ASN A 1 119 ? 39.239 38.809  54.369 1.00 18.13  ? 119 ASN A CB  1 
ATOM   718  C CG  . ASN A 1 119 ? 39.326 37.288  54.292 1.00 29.59  ? 119 ASN A CG  1 
ATOM   719  O OD1 . ASN A 1 119 ? 38.662 36.655  53.468 1.00 39.37  ? 119 ASN A OD1 1 
ATOM   720  N ND2 . ASN A 1 119 ? 40.151 36.697  55.148 1.00 32.93  ? 119 ASN A ND2 1 
ATOM   721  N N   . SER A 1 120 ? 39.872 41.785  53.277 1.00 11.48  ? 120 SER A N   1 
ATOM   722  C CA  . SER A 1 120 ? 39.604 43.211  53.381 1.00 15.99  ? 120 SER A CA  1 
ATOM   723  C C   . SER A 1 120 ? 38.949 43.703  52.085 1.00 22.08  ? 120 SER A C   1 
ATOM   724  O O   . SER A 1 120 ? 38.103 44.608  52.097 1.00 26.28  ? 120 SER A O   1 
ATOM   725  C CB  . SER A 1 120 ? 40.902 43.989  53.617 1.00 20.32  ? 120 SER A CB  1 
ATOM   726  O OG  . SER A 1 120 ? 41.537 43.591  54.817 1.00 17.53  ? 120 SER A OG  1 
ATOM   727  N N   . VAL A 1 121 ? 39.315 43.072  50.972 1.00 17.90  ? 121 VAL A N   1 
ATOM   728  C CA  . VAL A 1 121 ? 38.795 43.466  49.674 1.00 11.92  ? 121 VAL A CA  1 
ATOM   729  C C   . VAL A 1 121 ? 37.548 42.692  49.235 1.00 18.16  ? 121 VAL A C   1 
ATOM   730  O O   . VAL A 1 121 ? 36.718 43.240  48.509 1.00 24.99  ? 121 VAL A O   1 
ATOM   731  C CB  . VAL A 1 121 ? 39.910 43.365  48.587 1.00 6.19   ? 121 VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 121 ? 39.415 43.832  47.236 1.00 2.00   ? 121 VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 121 ? 41.111 44.191  48.996 1.00 5.89   ? 121 VAL A CG2 1 
ATOM   734  N N   . THR A 1 122 ? 37.370 41.453  49.695 1.00 12.22  ? 122 THR A N   1 
ATOM   735  C CA  . THR A 1 122 ? 36.213 40.684  49.247 1.00 12.85  ? 122 THR A CA  1 
ATOM   736  C C   . THR A 1 122 ? 35.075 40.520  50.232 1.00 18.06  ? 122 THR A C   1 
ATOM   737  O O   . THR A 1 122 ? 33.948 40.247  49.831 1.00 26.08  ? 122 THR A O   1 
ATOM   738  C CB  . THR A 1 122 ? 36.609 39.288  48.756 1.00 4.28   ? 122 THR A CB  1 
ATOM   739  O OG1 . THR A 1 122 ? 37.226 38.566  49.820 1.00 27.49  ? 122 THR A OG1 1 
ATOM   740  C CG2 . THR A 1 122 ? 37.587 39.377  47.628 1.00 13.75  ? 122 THR A CG2 1 
ATOM   741  N N   . ARG A 1 123 ? 35.349 40.706  51.513 1.00 23.59  ? 123 ARG A N   1 
ATOM   742  C CA  . ARG A 1 123 ? 34.314 40.519  52.528 1.00 31.47  ? 123 ARG A CA  1 
ATOM   743  C C   . ARG A 1 123 ? 33.121 41.443  52.323 1.00 27.93  ? 123 ARG A C   1 
ATOM   744  O O   . ARG A 1 123 ? 31.984 40.989  52.262 1.00 34.35  ? 123 ARG A O   1 
ATOM   745  C CB  . ARG A 1 123 ? 34.905 40.661  53.939 1.00 43.79  ? 123 ARG A CB  1 
ATOM   746  C CG  . ARG A 1 123 ? 34.059 40.047  55.044 1.00 54.44  ? 123 ARG A CG  1 
ATOM   747  C CD  . ARG A 1 123 ? 34.820 39.985  56.366 1.00 64.20  ? 123 ARG A CD  1 
ATOM   748  N NE  . ARG A 1 123 ? 33.981 39.520  57.474 1.00 75.04  ? 123 ARG A NE  1 
ATOM   749  C CZ  . ARG A 1 123 ? 33.521 40.294  58.457 1.00 72.66  ? 123 ARG A CZ  1 
ATOM   750  N NH1 . ARG A 1 123 ? 33.812 41.590  58.484 1.00 77.94  ? 123 ARG A NH1 1 
ATOM   751  N NH2 . ARG A 1 123 ? 32.770 39.770  59.422 1.00 69.73  ? 123 ARG A NH2 1 
ATOM   752  N N   . SER A 1 124 ? 33.386 42.728  52.150 1.00 22.44  ? 124 SER A N   1 
ATOM   753  C CA  . SER A 1 124 ? 32.330 43.708  51.945 1.00 21.58  ? 124 SER A CA  1 
ATOM   754  C C   . SER A 1 124 ? 32.852 44.713  50.948 1.00 20.38  ? 124 SER A C   1 
ATOM   755  O O   . SER A 1 124 ? 33.998 45.144  51.048 1.00 32.87  ? 124 SER A O   1 
ATOM   756  C CB  . SER A 1 124 ? 32.011 44.413  53.266 1.00 34.97  ? 124 SER A CB  1 
ATOM   757  O OG  . SER A 1 124 ? 31.210 45.563  53.065 1.00 49.95  ? 124 SER A OG  1 
ATOM   758  N N   . ALA A 1 125 ? 32.014 45.106  50.001 1.00 18.06  ? 125 ALA A N   1 
ATOM   759  C CA  . ALA A 1 125 ? 32.405 46.063  48.962 1.00 20.59  ? 125 ALA A CA  1 
ATOM   760  C C   . ALA A 1 125 ? 33.112 47.306  49.515 1.00 22.03  ? 125 ALA A C   1 
ATOM   761  O O   . ALA A 1 125 ? 32.655 47.912  50.491 1.00 28.47  ? 125 ALA A O   1 
ATOM   762  C CB  . ALA A 1 125 ? 31.195 46.466  48.175 1.00 21.12  ? 125 ALA A CB  1 
ATOM   763  N N   . PRO A 1 126 ? 34.236 47.698  48.897 1.00 17.20  ? 126 PRO A N   1 
ATOM   764  C CA  . PRO A 1 126 ? 35.032 48.859  49.300 1.00 18.85  ? 126 PRO A CA  1 
ATOM   765  C C   . PRO A 1 126 ? 34.321 50.195  49.107 1.00 23.80  ? 126 PRO A C   1 
ATOM   766  O O   . PRO A 1 126 ? 33.915 50.539  47.998 1.00 36.41  ? 126 PRO A O   1 
ATOM   767  C CB  . PRO A 1 126 ? 36.270 48.731  48.420 1.00 21.42  ? 126 PRO A CB  1 
ATOM   768  C CG  . PRO A 1 126 ? 35.751 48.086  47.188 1.00 20.74  ? 126 PRO A CG  1 
ATOM   769  C CD  . PRO A 1 126 ? 34.842 47.025  47.739 1.00 19.27  ? 126 PRO A CD  1 
ATOM   770  N N   . ILE A 1 127 ? 34.184 50.946  50.193 1.00 18.11  ? 127 ILE A N   1 
ATOM   771  C CA  . ILE A 1 127 ? 33.506 52.243  50.173 1.00 24.75  ? 127 ILE A CA  1 
ATOM   772  C C   . ILE A 1 127 ? 34.381 53.358  49.618 1.00 31.32  ? 127 ILE A C   1 
ATOM   773  O O   . ILE A 1 127 ? 35.598 53.251  49.639 1.00 29.07  ? 127 ILE A O   1 
ATOM   774  C CB  . ILE A 1 127 ? 33.059 52.632  51.577 1.00 19.97  ? 127 ILE A CB  1 
ATOM   775  C CG1 . ILE A 1 127 ? 34.274 52.728  52.500 1.00 19.95  ? 127 ILE A CG1 1 
ATOM   776  C CG2 . ILE A 1 127 ? 32.068 51.619  52.087 1.00 24.40  ? 127 ILE A CG2 1 
ATOM   777  C CD1 . ILE A 1 127 ? 33.944 52.883  53.958 1.00 27.55  ? 127 ILE A CD1 1 
ATOM   778  N N   . ASN A 1 128 ? 33.754 54.416  49.107 1.00 43.73  ? 128 ASN A N   1 
ATOM   779  C CA  . ASN A 1 128 ? 34.479 55.553  48.546 1.00 55.07  ? 128 ASN A CA  1 
ATOM   780  C C   . ASN A 1 128 ? 35.039 56.406  49.668 1.00 66.70  ? 128 ASN A C   1 
ATOM   781  O O   . ASN A 1 128 ? 34.540 56.358  50.795 1.00 71.06  ? 128 ASN A O   1 
ATOM   782  C CB  . ASN A 1 128 ? 33.579 56.391  47.632 1.00 60.54  ? 128 ASN A CB  1 
ATOM   783  C CG  . ASN A 1 128 ? 33.257 55.685  46.320 1.00 66.46  ? 128 ASN A CG  1 
ATOM   784  O OD1 . ASN A 1 128 ? 32.452 54.759  46.283 1.00 79.46  ? 128 ASN A OD1 1 
ATOM   785  N ND2 . ASN A 1 128 ? 33.891 56.120  45.240 1.00 74.17  ? 128 ASN A ND2 1 
ATOM   786  N N   . SER A 1 129 ? 36.085 57.174  49.362 1.00 77.06  ? 129 SER A N   1 
ATOM   787  C CA  . SER A 1 129 ? 36.730 58.015  50.365 1.00 84.08  ? 129 SER A CA  1 
ATOM   788  C C   . SER A 1 129 ? 36.586 59.523  50.134 1.00 86.13  ? 129 SER A C   1 
ATOM   789  O O   . SER A 1 129 ? 35.528 60.086  50.392 1.00 91.25  ? 129 SER A O   1 
ATOM   790  C CB  . SER A 1 129 ? 38.203 57.624  50.515 1.00 86.22  ? 129 SER A CB  1 
ATOM   791  O OG  . SER A 1 129 ? 38.699 58.003  51.787 1.00 91.75  ? 129 SER A OG  1 
ATOM   792  N N   . ASP A 1 130 ? 37.681 60.203  49.805 1.00 88.65  ? 130 ASP A N   1 
ATOM   793  C CA  . ASP A 1 130 ? 37.649 61.653  49.577 1.00 91.14  ? 130 ASP A CA  1 
ATOM   794  C C   . ASP A 1 130 ? 38.641 61.882  48.452 1.00 90.60  ? 130 ASP A C   1 
ATOM   795  O O   . ASP A 1 130 ? 39.697 62.496  48.647 1.00 89.92  ? 130 ASP A O   1 
ATOM   796  C CB  . ASP A 1 130 ? 38.088 62.405  50.848 1.00 91.88  ? 130 ASP A CB  1 
ATOM   797  C CG  . ASP A 1 130 ? 37.607 63.864  50.887 1.00 91.87  ? 130 ASP A CG  1 
ATOM   798  O OD1 . ASP A 1 130 ? 36.378 64.097  50.970 1.00 90.24  ? 130 ASP A OD1 1 
ATOM   799  O OD2 . ASP A 1 130 ? 38.464 64.778  50.881 1.00 88.93  ? 130 ASP A OD2 1 
ATOM   800  N N   . SER A 1 131 ? 38.297 61.329  47.286 1.00 90.27  ? 131 SER A N   1 
ATOM   801  C CA  . SER A 1 131 ? 39.132 61.400  46.088 1.00 90.35  ? 131 SER A CA  1 
ATOM   802  C C   . SER A 1 131 ? 39.642 62.782  45.673 1.00 88.35  ? 131 SER A C   1 
ATOM   803  O O   . SER A 1 131 ? 38.885 63.743  45.522 1.00 84.04  ? 131 SER A O   1 
ATOM   804  C CB  . SER A 1 131 ? 38.462 60.673  44.909 1.00 92.55  ? 131 SER A CB  1 
ATOM   805  O OG  . SER A 1 131 ? 37.151 61.148  44.653 1.00 94.05  ? 131 SER A OG  1 
ATOM   806  N N   . GLN A 1 132 ? 40.959 62.858  45.526 1.00 87.87  ? 132 GLN A N   1 
ATOM   807  C CA  . GLN A 1 132 ? 41.642 64.080  45.135 1.00 89.54  ? 132 GLN A CA  1 
ATOM   808  C C   . GLN A 1 132 ? 42.168 63.878  43.709 1.00 91.27  ? 132 GLN A C   1 
ATOM   809  O O   . GLN A 1 132 ? 43.201 64.490  43.362 1.00 92.82  ? 132 GLN A O   1 
ATOM   810  C CB  . GLN A 1 132 ? 42.812 64.348  46.094 1.00 89.42  ? 132 GLN A CB  1 
ATOM   811  C CG  . GLN A 1 132 ? 42.481 64.185  47.583 1.00 90.02  ? 132 GLN A CG  1 
ATOM   812  C CD  . GLN A 1 132 ? 41.810 65.403  48.189 1.00 87.75  ? 132 GLN A CD  1 
ATOM   813  O OE1 . GLN A 1 132 ? 42.262 66.535  48.000 1.00 87.81  ? 132 GLN A OE1 1 
ATOM   814  N NE2 . GLN A 1 132 ? 40.746 65.175  48.952 1.00 82.43  ? 132 GLN A NE2 1 
ATOM   815  N N   . THR A 1 137 ? 42.134 59.899  39.986 1.00 88.03  ? 137 THR A N   1 
ATOM   816  C CA  . THR A 1 137 ? 40.658 60.043  39.831 1.00 88.47  ? 137 THR A CA  1 
ATOM   817  C C   . THR A 1 137 ? 39.899 59.579  41.090 1.00 87.66  ? 137 THR A C   1 
ATOM   818  O O   . THR A 1 137 ? 39.468 60.410  41.895 1.00 90.95  ? 137 THR A O   1 
ATOM   819  C CB  . THR A 1 137 ? 40.130 59.320  38.540 1.00 87.04  ? 137 THR A CB  1 
ATOM   820  O OG1 . THR A 1 137 ? 40.262 57.899  38.666 1.00 80.43  ? 137 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 137 ? 40.919 59.771  37.317 1.00 85.25  ? 137 THR A CG2 1 
ATOM   822  N N   . ARG A 1 138 ? 39.750 58.269  41.281 1.00 85.84  ? 138 ARG A N   1 
ATOM   823  C CA  . ARG A 1 138 ? 39.039 57.779  42.456 1.00 80.38  ? 138 ARG A CA  1 
ATOM   824  C C   . ARG A 1 138 ? 39.928 57.312  43.589 1.00 72.54  ? 138 ARG A C   1 
ATOM   825  O O   . ARG A 1 138 ? 41.067 56.890  43.378 1.00 70.25  ? 138 ARG A O   1 
ATOM   826  C CB  . ARG A 1 138 ? 38.057 56.657  42.100 1.00 86.49  ? 138 ARG A CB  1 
ATOM   827  C CG  . ARG A 1 138 ? 36.676 57.132  41.674 1.00 90.12  ? 138 ARG A CG  1 
ATOM   828  C CD  . ARG A 1 138 ? 35.662 55.991  41.749 1.00 89.95  ? 138 ARG A CD  1 
ATOM   829  N NE  . ARG A 1 138 ? 34.412 56.326  41.069 1.00 89.45  ? 138 ARG A NE  1 
ATOM   830  C CZ  . ARG A 1 138 ? 33.704 55.468  40.335 1.00 91.13  ? 138 ARG A CZ  1 
ATOM   831  N NH1 . ARG A 1 138 ? 34.118 54.212  40.192 1.00 89.84  ? 138 ARG A NH1 1 
ATOM   832  N NH2 . ARG A 1 138 ? 32.612 55.880  39.693 1.00 94.49  ? 138 ARG A NH2 1 
ATOM   833  N N   . PHE A 1 139 ? 39.369 57.397  44.793 1.00 67.31  ? 139 PHE A N   1 
ATOM   834  C CA  . PHE A 1 139 ? 40.027 56.966  46.012 1.00 63.55  ? 139 PHE A CA  1 
ATOM   835  C C   . PHE A 1 139 ? 39.058 56.154  46.869 1.00 62.56  ? 139 PHE A C   1 
ATOM   836  O O   . PHE A 1 139 ? 38.069 56.679  47.388 1.00 67.97  ? 139 PHE A O   1 
ATOM   837  C CB  . PHE A 1 139 ? 40.559 58.156  46.797 1.00 59.94  ? 139 PHE A CB  1 
ATOM   838  C CG  . PHE A 1 139 ? 42.041 58.321  46.696 1.00 67.62  ? 139 PHE A CG  1 
ATOM   839  C CD1 . PHE A 1 139 ? 42.888 57.687  47.602 1.00 70.58  ? 139 PHE A CD1 1 
ATOM   840  C CD2 . PHE A 1 139 ? 42.599 59.109  45.696 1.00 67.66  ? 139 PHE A CD2 1 
ATOM   841  C CE1 . PHE A 1 139 ? 44.275 57.838  47.512 1.00 68.37  ? 139 PHE A CE1 1 
ATOM   842  C CE2 . PHE A 1 139 ? 43.982 59.265  45.600 1.00 70.56  ? 139 PHE A CE2 1 
ATOM   843  C CZ  . PHE A 1 139 ? 44.820 58.627  46.512 1.00 63.85  ? 139 PHE A CZ  1 
ATOM   844  N N   . LEU A 1 140 ? 39.332 54.855  46.956 1.00 53.40  ? 140 LEU A N   1 
ATOM   845  C CA  . LEU A 1 140 ? 38.535 53.919  47.730 1.00 36.84  ? 140 LEU A CA  1 
ATOM   846  C C   . LEU A 1 140 ? 39.317 53.440  48.946 1.00 39.93  ? 140 LEU A C   1 
ATOM   847  O O   . LEU A 1 140 ? 40.504 53.730  49.107 1.00 48.83  ? 140 LEU A O   1 
ATOM   848  C CB  . LEU A 1 140 ? 38.180 52.699  46.880 1.00 24.45  ? 140 LEU A CB  1 
ATOM   849  C CG  . LEU A 1 140 ? 37.103 52.825  45.815 1.00 9.80   ? 140 LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 140 ? 36.884 51.473  45.199 1.00 2.00   ? 140 LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 140 ? 35.812 53.294  46.443 1.00 19.32  ? 140 LEU A CD2 1 
ATOM   852  N N   . THR A 1 141 ? 38.632 52.699  49.799 1.00 31.27  ? 141 THR A N   1 
ATOM   853  C CA  . THR A 1 141 ? 39.234 52.140  50.986 1.00 27.47  ? 141 THR A CA  1 
ATOM   854  C C   . THR A 1 141 ? 38.403 50.929  51.343 1.00 24.78  ? 141 THR A C   1 
ATOM   855  O O   . THR A 1 141 ? 37.179 50.940  51.203 1.00 27.25  ? 141 THR A O   1 
ATOM   856  C CB  . THR A 1 141 ? 39.265 53.138  52.143 1.00 28.75  ? 141 THR A CB  1 
ATOM   857  O OG1 . THR A 1 141 ? 40.335 52.781  53.020 1.00 47.19  ? 141 THR A OG1 1 
ATOM   858  C CG2 . THR A 1 141 ? 37.962 53.117  52.933 1.00 33.35  ? 141 THR A CG2 1 
ATOM   859  N N   . THR A 1 142 ? 39.074 49.850  51.714 1.00 22.37  ? 142 THR A N   1 
ATOM   860  C CA  . THR A 1 142 ? 38.387 48.625  52.054 1.00 23.61  ? 142 THR A CA  1 
ATOM   861  C C   . THR A 1 142 ? 37.377 48.944  53.152 1.00 29.69  ? 142 THR A C   1 
ATOM   862  O O   . THR A 1 142 ? 37.459 50.007  53.781 1.00 28.64  ? 142 THR A O   1 
ATOM   863  C CB  . THR A 1 142 ? 39.395 47.539  52.477 1.00 23.64  ? 142 THR A CB  1 
ATOM   864  O OG1 . THR A 1 142 ? 40.370 48.102  53.361 1.00 17.53  ? 142 THR A OG1 1 
ATOM   865  C CG2 . THR A 1 142 ? 40.115 47.006  51.261 1.00 21.19  ? 142 THR A CG2 1 
ATOM   866  N N   . TYR A 1 143 ? 36.384 48.071  53.326 1.00 30.65  ? 143 TYR A N   1 
ATOM   867  C CA  . TYR A 1 143 ? 35.350 48.289  54.338 1.00 22.89  ? 143 TYR A CA  1 
ATOM   868  C C   . TYR A 1 143 ? 36.010 48.533  55.683 1.00 18.41  ? 143 TYR A C   1 
ATOM   869  O O   . TYR A 1 143 ? 35.575 49.391  56.447 1.00 17.42  ? 143 TYR A O   1 
ATOM   870  C CB  . TYR A 1 143 ? 34.360 47.105  54.397 1.00 18.49  ? 143 TYR A CB  1 
ATOM   871  C CG  . TYR A 1 143 ? 34.866 45.857  55.088 1.00 20.46  ? 143 TYR A CG  1 
ATOM   872  C CD1 . TYR A 1 143 ? 34.711 45.693  56.458 1.00 26.77  ? 143 TYR A CD1 1 
ATOM   873  C CD2 . TYR A 1 143 ? 35.478 44.835  54.378 1.00 24.61  ? 143 TYR A CD2 1 
ATOM   874  C CE1 . TYR A 1 143 ? 35.147 44.547  57.110 1.00 22.28  ? 143 TYR A CE1 1 
ATOM   875  C CE2 . TYR A 1 143 ? 35.924 43.676  55.025 1.00 25.74  ? 143 TYR A CE2 1 
ATOM   876  C CZ  . TYR A 1 143 ? 35.750 43.547  56.395 1.00 24.50  ? 143 TYR A CZ  1 
ATOM   877  O OH  . TYR A 1 143 ? 36.185 42.425  57.059 1.00 21.17  ? 143 TYR A OH  1 
ATOM   878  N N   . ASP A 1 144 ? 37.119 47.840  55.920 1.00 15.49  ? 144 ASP A N   1 
ATOM   879  C CA  . ASP A 1 144 ? 37.850 47.976  57.167 1.00 16.55  ? 144 ASP A CA  1 
ATOM   880  C C   . ASP A 1 144 ? 38.844 49.138  57.241 1.00 21.01  ? 144 ASP A C   1 
ATOM   881  O O   . ASP A 1 144 ? 39.669 49.171  58.143 1.00 27.21  ? 144 ASP A O   1 
ATOM   882  C CB  . ASP A 1 144 ? 38.551 46.664  57.520 1.00 17.04  ? 144 ASP A CB  1 
ATOM   883  C CG  . ASP A 1 144 ? 39.498 46.190  56.434 1.00 23.50  ? 144 ASP A CG  1 
ATOM   884  O OD1 . ASP A 1 144 ? 40.261 47.000  55.883 1.00 32.34  ? 144 ASP A OD1 1 
ATOM   885  O OD2 . ASP A 1 144 ? 39.486 44.989  56.128 1.00 29.97  ? 144 ASP A OD2 1 
ATOM   886  N N   . ARG A 1 145 ? 38.795 50.062  56.282 1.00 21.06  ? 145 ARG A N   1 
ATOM   887  C CA  . ARG A 1 145 ? 39.679 51.242  56.261 1.00 18.57  ? 145 ARG A CA  1 
ATOM   888  C C   . ARG A 1 145 ? 41.203 50.973  56.234 1.00 18.93  ? 145 ARG A C   1 
ATOM   889  O O   . ARG A 1 145 ? 42.028 51.911  56.178 1.00 7.28   ? 145 ARG A O   1 
ATOM   890  C CB  . ARG A 1 145 ? 39.384 52.137  57.466 1.00 24.24  ? 145 ARG A CB  1 
ATOM   891  C CG  . ARG A 1 145 ? 38.088 52.938  57.471 1.00 43.28  ? 145 ARG A CG  1 
ATOM   892  C CD  . ARG A 1 145 ? 38.031 53.695  58.804 1.00 57.04  ? 145 ARG A CD  1 
ATOM   893  N NE  . ARG A 1 145 ? 36.975 54.699  58.903 1.00 74.56  ? 145 ARG A NE  1 
ATOM   894  C CZ  . ARG A 1 145 ? 36.948 55.656  59.830 1.00 75.83  ? 145 ARG A CZ  1 
ATOM   895  N NH1 . ARG A 1 145 ? 37.918 55.733  60.733 1.00 78.34  ? 145 ARG A NH1 1 
ATOM   896  N NH2 . ARG A 1 145 ? 35.963 56.549  59.853 1.00 82.25  ? 145 ARG A NH2 1 
ATOM   897  N N   . ARG A 1 146 ? 41.580 49.703  56.232 1.00 12.85  ? 146 ARG A N   1 
ATOM   898  C CA  . ARG A 1 146 ? 42.978 49.352  56.262 1.00 19.59  ? 146 ARG A CA  1 
ATOM   899  C C   . ARG A 1 146 ? 43.759 49.529  54.973 1.00 24.56  ? 146 ARG A C   1 
ATOM   900  O O   . ARG A 1 146 ? 44.939 49.894  55.012 1.00 33.86  ? 146 ARG A O   1 
ATOM   901  C CB  . ARG A 1 146 ? 43.139 47.942  56.811 1.00 21.35  ? 146 ARG A CB  1 
ATOM   902  C CG  . ARG A 1 146 ? 44.194 47.863  57.884 1.00 36.83  ? 146 ARG A CG  1 
ATOM   903  C CD  . ARG A 1 146 ? 44.164 46.534  58.595 1.00 40.77  ? 146 ARG A CD  1 
ATOM   904  N NE  . ARG A 1 146 ? 42.888 46.287  59.251 1.00 40.49  ? 146 ARG A NE  1 
ATOM   905  C CZ  . ARG A 1 146 ? 42.706 45.370  60.201 1.00 48.73  ? 146 ARG A CZ  1 
ATOM   906  N NH1 . ARG A 1 146 ? 43.718 44.611  60.614 1.00 36.23  ? 146 ARG A NH1 1 
ATOM   907  N NH2 . ARG A 1 146 ? 41.501 45.199  60.732 1.00 51.11  ? 146 ARG A NH2 1 
ATOM   908  N N   . PHE A 1 147 ? 43.123 49.254  53.836 1.00 23.78  ? 147 PHE A N   1 
ATOM   909  C CA  . PHE A 1 147 ? 43.791 49.395  52.538 1.00 18.89  ? 147 PHE A CA  1 
ATOM   910  C C   . PHE A 1 147 ? 43.032 50.389  51.686 1.00 16.60  ? 147 PHE A C   1 
ATOM   911  O O   . PHE A 1 147 ? 41.831 50.540  51.829 1.00 14.50  ? 147 PHE A O   1 
ATOM   912  C CB  . PHE A 1 147 ? 43.907 48.045  51.831 1.00 13.10  ? 147 PHE A CB  1 
ATOM   913  C CG  . PHE A 1 147 ? 44.569 46.972  52.677 1.00 13.19  ? 147 PHE A CG  1 
ATOM   914  C CD1 . PHE A 1 147 ? 43.900 45.798  52.986 1.00 13.94  ? 147 PHE A CD1 1 
ATOM   915  C CD2 . PHE A 1 147 ? 45.830 47.166  53.206 1.00 5.01   ? 147 PHE A CD2 1 
ATOM   916  C CE1 . PHE A 1 147 ? 44.474 44.842  53.812 1.00 12.30  ? 147 PHE A CE1 1 
ATOM   917  C CE2 . PHE A 1 147 ? 46.411 46.218  54.030 1.00 7.22   ? 147 PHE A CE2 1 
ATOM   918  C CZ  . PHE A 1 147 ? 45.738 45.058  54.338 1.00 10.81  ? 147 PHE A CZ  1 
ATOM   919  N N   . VAL A 1 148 ? 43.762 51.133  50.872 1.00 16.27  ? 148 VAL A N   1 
ATOM   920  C CA  . VAL A 1 148 ? 43.181 52.140  50.004 1.00 10.49  ? 148 VAL A CA  1 
ATOM   921  C C   . VAL A 1 148 ? 43.397 51.739  48.560 1.00 18.41  ? 148 VAL A C   1 
ATOM   922  O O   . VAL A 1 148 ? 44.496 51.305  48.187 1.00 28.37  ? 148 VAL A O   1 
ATOM   923  C CB  . VAL A 1 148 ? 43.842 53.498  50.252 1.00 4.13   ? 148 VAL A CB  1 
ATOM   924  C CG1 . VAL A 1 148 ? 43.706 54.411  49.038 1.00 5.88   ? 148 VAL A CG1 1 
ATOM   925  C CG2 . VAL A 1 148 ? 43.187 54.139  51.411 1.00 2.89   ? 148 VAL A CG2 1 
ATOM   926  N N   . ILE A 1 149 ? 42.357 51.895  47.744 1.00 19.10  ? 149 ILE A N   1 
ATOM   927  C CA  . ILE A 1 149 ? 42.447 51.540  46.333 1.00 16.75  ? 149 ILE A CA  1 
ATOM   928  C C   . ILE A 1 149 ? 42.359 52.786  45.464 1.00 17.79  ? 149 ILE A C   1 
ATOM   929  O O   . ILE A 1 149 ? 41.320 53.418  45.421 1.00 19.43  ? 149 ILE A O   1 
ATOM   930  C CB  . ILE A 1 149 ? 41.339 50.561  45.944 1.00 16.68  ? 149 ILE A CB  1 
ATOM   931  C CG1 . ILE A 1 149 ? 41.284 49.417  46.963 1.00 26.91  ? 149 ILE A CG1 1 
ATOM   932  C CG2 . ILE A 1 149 ? 41.625 49.991  44.562 1.00 13.60  ? 149 ILE A CG2 1 
ATOM   933  C CD1 . ILE A 1 149 ? 40.007 48.588  46.934 1.00 37.68  ? 149 ILE A CD1 1 
ATOM   934  N N   . LYS A 1 150 ? 43.446 53.136  44.771 1.00 24.07  ? 150 LYS A N   1 
ATOM   935  C CA  . LYS A 1 150 ? 43.459 54.321  43.904 1.00 29.37  ? 150 LYS A CA  1 
ATOM   936  C C   . LYS A 1 150 ? 43.381 53.932  42.439 1.00 29.29  ? 150 LYS A C   1 
ATOM   937  O O   . LYS A 1 150 ? 43.949 52.915  42.043 1.00 26.54  ? 150 LYS A O   1 
ATOM   938  C CB  . LYS A 1 150 ? 44.763 55.125  44.031 1.00 38.61  ? 150 LYS A CB  1 
ATOM   939  C CG  . LYS A 1 150 ? 45.405 55.278  45.388 1.00 49.35  ? 150 LYS A CG  1 
ATOM   940  C CD  . LYS A 1 150 ? 46.641 56.162  45.215 1.00 56.75  ? 150 LYS A CD  1 
ATOM   941  C CE  . LYS A 1 150 ? 47.485 56.262  46.474 1.00 62.58  ? 150 LYS A CE  1 
ATOM   942  N NZ  . LYS A 1 150 ? 48.559 57.300  46.349 1.00 62.50  ? 150 LYS A NZ  1 
ATOM   943  N N   . THR A 1 151 ? 42.757 54.772  41.615 1.00 27.74  ? 151 THR A N   1 
ATOM   944  C CA  . THR A 1 151 ? 42.704 54.482  40.185 1.00 32.25  ? 151 THR A CA  1 
ATOM   945  C C   . THR A 1 151 ? 43.824 55.274  39.515 1.00 34.04  ? 151 THR A C   1 
ATOM   946  O O   . THR A 1 151 ? 43.734 56.491  39.378 1.00 40.28  ? 151 THR A O   1 
ATOM   947  C CB  . THR A 1 151 ? 41.379 54.896  39.539 1.00 26.68  ? 151 THR A CB  1 
ATOM   948  O OG1 . THR A 1 151 ? 40.287 54.523  40.380 1.00 45.39  ? 151 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 151 ? 41.217 54.182  38.235 1.00 26.00  ? 151 THR A CG2 1 
ATOM   950  N N   . VAL A 1 152 ? 44.904 54.597  39.149 1.00 35.78  ? 152 VAL A N   1 
ATOM   951  C CA  . VAL A 1 152 ? 46.023 55.266  38.498 1.00 34.80  ? 152 VAL A CA  1 
ATOM   952  C C   . VAL A 1 152 ? 45.773 55.374  36.990 1.00 41.98  ? 152 VAL A C   1 
ATOM   953  O O   . VAL A 1 152 ? 44.681 55.064  36.506 1.00 44.62  ? 152 VAL A O   1 
ATOM   954  C CB  . VAL A 1 152 ? 47.365 54.523  38.771 1.00 33.74  ? 152 VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 152 ? 47.677 54.527  40.248 1.00 23.78  ? 152 VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 152 ? 47.308 53.092  38.255 1.00 25.06  ? 152 VAL A CG2 1 
ATOM   957  N N   . SER A 1 153 ? 46.783 55.831  36.256 1.00 47.24  ? 153 SER A N   1 
ATOM   958  C CA  . SER A 1 153 ? 46.696 55.978  34.805 1.00 45.06  ? 153 SER A CA  1 
ATOM   959  C C   . SER A 1 153 ? 47.637 54.979  34.151 1.00 44.78  ? 153 SER A C   1 
ATOM   960  O O   . SER A 1 153 ? 48.499 54.395  34.814 1.00 44.04  ? 153 SER A O   1 
ATOM   961  C CB  . SER A 1 153 ? 47.118 57.385  34.394 1.00 47.97  ? 153 SER A CB  1 
ATOM   962  O OG  . SER A 1 153 ? 48.504 57.584  34.644 1.00 62.41  ? 153 SER A OG  1 
ATOM   963  N N   . SER A 1 154 ? 47.495 54.811  32.841 1.00 45.82  ? 154 SER A N   1 
ATOM   964  C CA  . SER A 1 154 ? 48.356 53.893  32.097 1.00 49.67  ? 154 SER A CA  1 
ATOM   965  C C   . SER A 1 154 ? 49.827 54.289  32.250 1.00 47.38  ? 154 SER A C   1 
ATOM   966  O O   . SER A 1 154 ? 50.719 53.439  32.226 1.00 41.61  ? 154 SER A O   1 
ATOM   967  C CB  . SER A 1 154 ? 47.979 53.897  30.619 1.00 53.53  ? 154 SER A CB  1 
ATOM   968  O OG  . SER A 1 154 ? 48.760 52.953  29.914 1.00 58.09  ? 154 SER A OG  1 
ATOM   969  N N   . GLU A 1 155 ? 50.059 55.590  32.410 1.00 46.52  ? 155 GLU A N   1 
ATOM   970  C CA  . GLU A 1 155 ? 51.403 56.130  32.589 1.00 48.01  ? 155 GLU A CA  1 
ATOM   971  C C   . GLU A 1 155 ? 51.958 55.578  33.899 1.00 47.07  ? 155 GLU A C   1 
ATOM   972  O O   . GLU A 1 155 ? 53.008 54.929  33.921 1.00 45.68  ? 155 GLU A O   1 
ATOM   973  C CB  . GLU A 1 155 ? 51.363 57.659  32.673 1.00 53.55  ? 155 GLU A CB  1 
ATOM   974  C CG  . GLU A 1 155 ? 50.463 58.340  31.649 1.00 72.88  ? 155 GLU A CG  1 
ATOM   975  C CD  . GLU A 1 155 ? 50.982 58.225  30.230 1.00 82.24  ? 155 GLU A CD  1 
ATOM   976  O OE1 . GLU A 1 155 ? 50.729 57.187  29.582 1.00 91.58  ? 155 GLU A OE1 1 
ATOM   977  O OE2 . GLU A 1 155 ? 51.635 59.181  29.758 1.00 88.47  ? 155 GLU A OE2 1 
ATOM   978  N N   . ASP A 1 156 ? 51.218 55.802  34.982 1.00 41.25  ? 156 ASP A N   1 
ATOM   979  C CA  . ASP A 1 156 ? 51.616 55.348  36.311 1.00 32.44  ? 156 ASP A CA  1 
ATOM   980  C C   . ASP A 1 156 ? 51.935 53.850  36.370 1.00 29.65  ? 156 ASP A C   1 
ATOM   981  O O   . ASP A 1 156 ? 52.972 53.448  36.910 1.00 29.00  ? 156 ASP A O   1 
ATOM   982  C CB  . ASP A 1 156 ? 50.529 55.706  37.322 1.00 37.98  ? 156 ASP A CB  1 
ATOM   983  C CG  . ASP A 1 156 ? 50.174 57.186  37.294 1.00 44.33  ? 156 ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 156 ? 51.090 58.022  37.138 1.00 52.89  ? 156 ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 156 ? 48.980 57.522  37.427 1.00 50.32  ? 156 ASP A OD2 1 
ATOM   986  N N   . VAL A 1 157 ? 51.066 53.031  35.782 1.00 21.19  ? 157 VAL A N   1 
ATOM   987  C CA  . VAL A 1 157 ? 51.262 51.589  35.773 1.00 11.99  ? 157 VAL A CA  1 
ATOM   988  C C   . VAL A 1 157 ? 52.607 51.263  35.168 1.00 23.79  ? 157 VAL A C   1 
ATOM   989  O O   . VAL A 1 157 ? 53.230 50.265  35.522 1.00 27.32  ? 157 VAL A O   1 
ATOM   990  C CB  . VAL A 1 157 ? 50.151 50.897  34.980 1.00 7.37   ? 157 VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 157 ? 50.449 49.413  34.807 1.00 5.34   ? 157 VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 157 ? 48.817 51.081  35.697 1.00 2.00   ? 157 VAL A CG2 1 
ATOM   993  N N   . ALA A 1 158 ? 53.061 52.131  34.265 1.00 38.18  ? 158 ALA A N   1 
ATOM   994  C CA  . ALA A 1 158 ? 54.352 51.960  33.601 1.00 41.54  ? 158 ALA A CA  1 
ATOM   995  C C   . ALA A 1 158 ? 55.469 52.429  34.522 1.00 43.68  ? 158 ALA A C   1 
ATOM   996  O O   . ALA A 1 158 ? 56.569 51.856  34.523 1.00 40.75  ? 158 ALA A O   1 
ATOM   997  C CB  . ALA A 1 158 ? 54.380 52.730  32.303 1.00 41.32  ? 158 ALA A CB  1 
ATOM   998  N N   . GLU A 1 159 ? 55.191 53.490  35.279 1.00 43.02  ? 159 GLU A N   1 
ATOM   999  C CA  . GLU A 1 159 ? 56.160 54.028  36.234 1.00 50.42  ? 159 GLU A CA  1 
ATOM   1000 C C   . GLU A 1 159 ? 56.421 52.967  37.288 1.00 51.10  ? 159 GLU A C   1 
ATOM   1001 O O   . GLU A 1 159 ? 57.568 52.750  37.705 1.00 59.74  ? 159 GLU A O   1 
ATOM   1002 C CB  . GLU A 1 159 ? 55.624 55.284  36.911 1.00 40.70  ? 159 GLU A CB  1 
ATOM   1003 C CG  . GLU A 1 159 ? 55.847 56.542  36.123 1.00 55.80  ? 159 GLU A CG  1 
ATOM   1004 C CD  . GLU A 1 159 ? 54.904 57.651  36.534 1.00 61.18  ? 159 GLU A CD  1 
ATOM   1005 O OE1 . GLU A 1 159 ? 54.628 57.785  37.748 1.00 57.81  ? 159 GLU A OE1 1 
ATOM   1006 O OE2 . GLU A 1 159 ? 54.429 58.382  35.635 1.00 63.77  ? 159 GLU A OE2 1 
ATOM   1007 N N   . MET A 1 160 ? 55.346 52.301  37.706 1.00 44.09  ? 160 MET A N   1 
ATOM   1008 C CA  . MET A 1 160 ? 55.450 51.248  38.701 1.00 40.52  ? 160 MET A CA  1 
ATOM   1009 C C   . MET A 1 160 ? 56.424 50.167  38.237 1.00 35.96  ? 160 MET A C   1 
ATOM   1010 O O   . MET A 1 160 ? 57.208 49.647  39.029 1.00 26.25  ? 160 MET A O   1 
ATOM   1011 C CB  . MET A 1 160 ? 54.082 50.629  38.968 1.00 38.54  ? 160 MET A CB  1 
ATOM   1012 C CG  . MET A 1 160 ? 53.488 50.992  40.319 1.00 44.49  ? 160 MET A CG  1 
ATOM   1013 S SD  . MET A 1 160 ? 54.459 50.421  41.727 1.00 31.75  ? 160 MET A SD  1 
ATOM   1014 C CE  . MET A 1 160 ? 54.763 48.810  41.280 1.00 29.98  ? 160 MET A CE  1 
ATOM   1015 N N   . HIS A 1 161 ? 56.396 49.856  36.945 1.00 30.81  ? 161 HIS A N   1 
ATOM   1016 C CA  . HIS A 1 161 ? 57.281 48.839  36.418 1.00 36.74  ? 161 HIS A CA  1 
ATOM   1017 C C   . HIS A 1 161 ? 58.741 49.256  36.379 1.00 37.92  ? 161 HIS A C   1 
ATOM   1018 O O   . HIS A 1 161 ? 59.645 48.460  36.687 1.00 25.65  ? 161 HIS A O   1 
ATOM   1019 C CB  . HIS A 1 161 ? 56.790 48.369  35.062 1.00 36.69  ? 161 HIS A CB  1 
ATOM   1020 C CG  . HIS A 1 161 ? 55.737 47.318  35.162 1.00 41.73  ? 161 HIS A CG  1 
ATOM   1021 N ND1 . HIS A 1 161 ? 54.393 47.608  35.105 1.00 37.23  ? 161 HIS A ND1 1 
ATOM   1022 C CD2 . HIS A 1 161 ? 55.830 45.986  35.394 1.00 40.58  ? 161 HIS A CD2 1 
ATOM   1023 C CE1 . HIS A 1 161 ? 53.700 46.500  35.305 1.00 54.63  ? 161 HIS A CE1 1 
ATOM   1024 N NE2 . HIS A 1 161 ? 54.549 45.502  35.483 1.00 49.90  ? 161 HIS A NE2 1 
ATOM   1025 N N   . ASN A 1 162 ? 58.975 50.514  36.032 1.00 41.93  ? 162 ASN A N   1 
ATOM   1026 C CA  . ASN A 1 162 ? 60.334 51.015  35.993 1.00 47.43  ? 162 ASN A CA  1 
ATOM   1027 C C   . ASN A 1 162 ? 60.942 51.023  37.385 1.00 47.72  ? 162 ASN A C   1 
ATOM   1028 O O   . ASN A 1 162 ? 62.066 50.553  37.566 1.00 61.64  ? 162 ASN A O   1 
ATOM   1029 C CB  . ASN A 1 162 ? 60.382 52.415  35.397 1.00 55.61  ? 162 ASN A CB  1 
ATOM   1030 C CG  . ASN A 1 162 ? 60.716 52.398  33.935 1.00 66.01  ? 162 ASN A CG  1 
ATOM   1031 O OD1 . ASN A 1 162 ? 59.834 52.530  33.084 1.00 76.10  ? 162 ASN A OD1 1 
ATOM   1032 N ND2 . ASN A 1 162 ? 61.995 52.208  33.623 1.00 72.09  ? 162 ASN A ND2 1 
ATOM   1033 N N   . ILE A 1 163 ? 60.184 51.496  38.376 1.00 38.86  ? 163 ILE A N   1 
ATOM   1034 C CA  . ILE A 1 163 ? 60.693 51.563  39.744 1.00 30.22  ? 163 ILE A CA  1 
ATOM   1035 C C   . ILE A 1 163 ? 60.582 50.261  40.558 1.00 31.99  ? 163 ILE A C   1 
ATOM   1036 O O   . ILE A 1 163 ? 61.458 49.961  41.360 1.00 27.39  ? 163 ILE A O   1 
ATOM   1037 C CB  . ILE A 1 163 ? 60.052 52.724  40.528 1.00 21.09  ? 163 ILE A CB  1 
ATOM   1038 C CG1 . ILE A 1 163 ? 58.610 52.398  40.894 1.00 27.29  ? 163 ILE A CG1 1 
ATOM   1039 C CG2 . ILE A 1 163 ? 60.006 53.968  39.671 1.00 18.77  ? 163 ILE A CG2 1 
ATOM   1040 C CD1 . ILE A 1 163 ? 57.978 53.458  41.766 1.00 26.14  ? 163 ILE A CD1 1 
ATOM   1041 N N   . LEU A 1 164 ? 59.586 49.434  40.246 1.00 28.49  ? 164 LEU A N   1 
ATOM   1042 C CA  . LEU A 1 164 ? 59.328 48.197  40.985 1.00 29.11  ? 164 LEU A CA  1 
ATOM   1043 C C   . LEU A 1 164 ? 60.498 47.344  41.458 1.00 27.58  ? 164 LEU A C   1 
ATOM   1044 O O   . LEU A 1 164 ? 60.438 46.818  42.562 1.00 31.82  ? 164 LEU A O   1 
ATOM   1045 C CB  . LEU A 1 164 ? 58.309 47.319  40.247 1.00 25.53  ? 164 LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 164 ? 57.701 46.186  41.090 1.00 25.92  ? 164 LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 164 ? 57.148 46.779  42.368 1.00 18.47  ? 164 LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 164 ? 56.613 45.430  40.320 1.00 18.75  ? 164 LEU A CD2 1 
ATOM   1049 N N   . LYS A 1 165 ? 61.539 47.190  40.636 1.00 39.21  ? 165 LYS A N   1 
ATOM   1050 C CA  . LYS A 1 165 ? 62.699 46.372  41.020 1.00 34.88  ? 165 LYS A CA  1 
ATOM   1051 C C   . LYS A 1 165 ? 63.588 47.104  41.992 1.00 33.07  ? 165 LYS A C   1 
ATOM   1052 O O   . LYS A 1 165 ? 64.154 46.489  42.914 1.00 16.18  ? 165 LYS A O   1 
ATOM   1053 C CB  . LYS A 1 165 ? 63.530 45.936  39.818 1.00 33.46  ? 165 LYS A CB  1 
ATOM   1054 C CG  . LYS A 1 165 ? 64.740 45.112  40.221 1.00 32.82  ? 165 LYS A CG  1 
ATOM   1055 C CD  . LYS A 1 165 ? 64.363 44.091  41.288 1.00 40.23  ? 165 LYS A CD  1 
ATOM   1056 C CE  . LYS A 1 165 ? 65.391 44.051  42.414 1.00 44.27  ? 165 LYS A CE  1 
ATOM   1057 N NZ  . LYS A 1 165 ? 64.773 43.676  43.718 1.00 47.62  ? 165 LYS A NZ  1 
ATOM   1058 N N   . LYS A 1 166 ? 63.745 48.405  41.760 1.00 32.41  ? 166 LYS A N   1 
ATOM   1059 C CA  . LYS A 1 166 ? 64.543 49.213  42.664 1.00 41.42  ? 166 LYS A CA  1 
ATOM   1060 C C   . LYS A 1 166 ? 63.780 49.374  43.994 1.00 39.29  ? 166 LYS A C   1 
ATOM   1061 O O   . LYS A 1 166 ? 64.296 49.061  45.072 1.00 40.17  ? 166 LYS A O   1 
ATOM   1062 C CB  . LYS A 1 166 ? 64.861 50.564  42.027 1.00 49.94  ? 166 LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 166 ? 65.878 50.480  40.892 1.00 66.16  ? 166 LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 166 ? 66.210 51.867  40.352 1.00 76.54  ? 166 LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 166 ? 67.340 51.842  39.328 1.00 81.24  ? 166 LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 166 ? 67.625 53.203  38.777 1.00 81.87  ? 166 LYS A NZ  1 
ATOM   1067 N N   . TYR A 1 167 ? 62.528 49.807  43.896 1.00 39.68  ? 167 TYR A N   1 
ATOM   1068 C CA  . TYR A 1 167 ? 61.649 49.996  45.049 1.00 31.17  ? 167 TYR A CA  1 
ATOM   1069 C C   . TYR A 1 167 ? 61.606 48.743  45.890 1.00 23.93  ? 167 TYR A C   1 
ATOM   1070 O O   . TYR A 1 167 ? 61.626 48.811  47.106 1.00 28.52  ? 167 TYR A O   1 
ATOM   1071 C CB  . TYR A 1 167 ? 60.243 50.330  44.572 1.00 23.61  ? 167 TYR A CB  1 
ATOM   1072 C CG  . TYR A 1 167 ? 59.180 50.265  45.626 1.00 20.79  ? 167 TYR A CG  1 
ATOM   1073 C CD1 . TYR A 1 167 ? 58.844 51.394  46.377 1.00 25.90  ? 167 TYR A CD1 1 
ATOM   1074 C CD2 . TYR A 1 167 ? 58.460 49.096  45.834 1.00 18.15  ? 167 TYR A CD2 1 
ATOM   1075 C CE1 . TYR A 1 167 ? 57.811 51.361  47.310 1.00 14.59  ? 167 TYR A CE1 1 
ATOM   1076 C CE2 . TYR A 1 167 ? 57.422 49.052  46.763 1.00 23.02  ? 167 TYR A CE2 1 
ATOM   1077 C CZ  . TYR A 1 167 ? 57.109 50.191  47.498 1.00 16.01  ? 167 TYR A CZ  1 
ATOM   1078 O OH  . TYR A 1 167 ? 56.116 50.142  48.445 1.00 8.94   ? 167 TYR A OH  1 
ATOM   1079 N N   . HIS A 1 168 ? 61.539 47.594  45.243 1.00 18.30  ? 168 HIS A N   1 
ATOM   1080 C CA  . HIS A 1 168 ? 61.512 46.350  45.987 1.00 23.24  ? 168 HIS A CA  1 
ATOM   1081 C C   . HIS A 1 168 ? 62.821 46.097  46.702 1.00 34.14  ? 168 HIS A C   1 
ATOM   1082 O O   . HIS A 1 168 ? 62.827 45.568  47.815 1.00 38.51  ? 168 HIS A O   1 
ATOM   1083 C CB  . HIS A 1 168 ? 61.214 45.162  45.099 1.00 5.65   ? 168 HIS A CB  1 
ATOM   1084 C CG  . HIS A 1 168 ? 61.293 43.866  45.819 1.00 2.02   ? 168 HIS A CG  1 
ATOM   1085 N ND1 . HIS A 1 168 ? 62.456 43.139  45.890 1.00 10.48  ? 168 HIS A ND1 1 
ATOM   1086 C CD2 . HIS A 1 168 ? 60.366 43.164  46.508 1.00 10.07  ? 168 HIS A CD2 1 
ATOM   1087 C CE1 . HIS A 1 168 ? 62.241 42.035  46.588 1.00 19.26  ? 168 HIS A CE1 1 
ATOM   1088 N NE2 . HIS A 1 168 ? 60.980 42.026  46.975 1.00 6.85   ? 168 HIS A NE2 1 
ATOM   1089 N N   . GLN A 1 169 ? 63.932 46.440  46.053 1.00 39.66  ? 169 GLN A N   1 
ATOM   1090 C CA  . GLN A 1 169 ? 65.240 46.236  46.669 1.00 42.05  ? 169 GLN A CA  1 
ATOM   1091 C C   . GLN A 1 169 ? 65.378 47.154  47.874 1.00 35.07  ? 169 GLN A C   1 
ATOM   1092 O O   . GLN A 1 169 ? 65.943 46.764  48.896 1.00 33.16  ? 169 GLN A O   1 
ATOM   1093 C CB  . GLN A 1 169 ? 66.368 46.482  45.665 1.00 46.49  ? 169 GLN A CB  1 
ATOM   1094 C CG  . GLN A 1 169 ? 67.731 46.001  46.140 1.00 54.96  ? 169 GLN A CG  1 
ATOM   1095 C CD  . GLN A 1 169 ? 67.715 44.567  46.671 1.00 62.84  ? 169 GLN A CD  1 
ATOM   1096 O OE1 . GLN A 1 169 ? 68.268 44.287  47.735 1.00 70.71  ? 169 GLN A OE1 1 
ATOM   1097 N NE2 . GLN A 1 169 ? 67.079 43.656  45.931 1.00 67.33  ? 169 GLN A NE2 1 
ATOM   1098 N N   . PHE A 1 170 ? 64.800 48.350  47.754 1.00 34.08  ? 170 PHE A N   1 
ATOM   1099 C CA  . PHE A 1 170 ? 64.803 49.366  48.814 1.00 32.27  ? 170 PHE A CA  1 
ATOM   1100 C C   . PHE A 1 170 ? 64.079 48.799  50.027 1.00 31.86  ? 170 PHE A C   1 
ATOM   1101 O O   . PHE A 1 170 ? 64.624 48.781  51.131 1.00 32.32  ? 170 PHE A O   1 
ATOM   1102 C CB  . PHE A 1 170 ? 64.070 50.617  48.328 1.00 24.82  ? 170 PHE A CB  1 
ATOM   1103 C CG  . PHE A 1 170 ? 64.012 51.719  49.331 1.00 31.25  ? 170 PHE A CG  1 
ATOM   1104 C CD1 . PHE A 1 170 ? 62.874 52.510  49.443 1.00 36.12  ? 170 PHE A CD1 1 
ATOM   1105 C CD2 . PHE A 1 170 ? 65.115 52.029  50.108 1.00 35.06  ? 170 PHE A CD2 1 
ATOM   1106 C CE1 . PHE A 1 170 ? 62.835 53.610  50.312 1.00 37.07  ? 170 PHE A CE1 1 
ATOM   1107 C CE2 . PHE A 1 170 ? 65.088 53.126  50.977 1.00 45.54  ? 170 PHE A CE2 1 
ATOM   1108 C CZ  . PHE A 1 170 ? 63.941 53.920  51.075 1.00 35.17  ? 170 PHE A CZ  1 
ATOM   1109 N N   . ILE A 1 171 ? 62.869 48.295  49.781 1.00 28.19  ? 171 ILE A N   1 
ATOM   1110 C CA  . ILE A 1 171 ? 62.019 47.702  50.805 1.00 20.95  ? 171 ILE A CA  1 
ATOM   1111 C C   . ILE A 1 171 ? 62.743 46.523  51.436 1.00 28.23  ? 171 ILE A C   1 
ATOM   1112 O O   . ILE A 1 171 ? 62.500 46.190  52.591 1.00 35.40  ? 171 ILE A O   1 
ATOM   1113 C CB  . ILE A 1 171 ? 60.675 47.221  50.198 1.00 9.51   ? 171 ILE A CB  1 
ATOM   1114 C CG1 . ILE A 1 171 ? 59.920 48.398  49.604 1.00 4.86   ? 171 ILE A CG1 1 
ATOM   1115 C CG2 . ILE A 1 171 ? 59.813 46.560  51.229 1.00 2.00   ? 171 ILE A CG2 1 
ATOM   1116 C CD1 . ILE A 1 171 ? 59.623 49.503  50.577 1.00 6.32   ? 171 ILE A CD1 1 
ATOM   1117 N N   . VAL A 1 172 ? 63.633 45.891  50.682 1.00 28.51  ? 172 VAL A N   1 
ATOM   1118 C CA  . VAL A 1 172 ? 64.380 44.760  51.212 1.00 36.05  ? 172 VAL A CA  1 
ATOM   1119 C C   . VAL A 1 172 ? 65.314 45.270  52.305 1.00 39.48  ? 172 VAL A C   1 
ATOM   1120 O O   . VAL A 1 172 ? 65.410 44.666  53.376 1.00 40.80  ? 172 VAL A O   1 
ATOM   1121 C CB  . VAL A 1 172 ? 65.199 44.042  50.096 1.00 36.08  ? 172 VAL A CB  1 
ATOM   1122 C CG1 . VAL A 1 172 ? 66.149 43.022  50.682 1.00 27.99  ? 172 VAL A CG1 1 
ATOM   1123 C CG2 . VAL A 1 172 ? 64.268 43.351  49.135 1.00 35.82  ? 172 VAL A CG2 1 
ATOM   1124 N N   . GLU A 1 173 ? 65.922 46.431  52.067 1.00 36.77  ? 173 GLU A N   1 
ATOM   1125 C CA  . GLU A 1 173 ? 66.860 46.999  53.028 1.00 44.87  ? 173 GLU A CA  1 
ATOM   1126 C C   . GLU A 1 173 ? 66.354 48.115  53.932 1.00 44.16  ? 173 GLU A C   1 
ATOM   1127 O O   . GLU A 1 173 ? 67.093 49.032  54.263 1.00 43.97  ? 173 GLU A O   1 
ATOM   1128 C CB  . GLU A 1 173 ? 68.153 47.415  52.320 1.00 50.17  ? 173 GLU A CB  1 
ATOM   1129 C CG  . GLU A 1 173 ? 67.966 48.236  51.062 1.00 50.13  ? 173 GLU A CG  1 
ATOM   1130 C CD  . GLU A 1 173 ? 69.161 48.129  50.129 1.00 51.59  ? 173 GLU A CD  1 
ATOM   1131 O OE1 . GLU A 1 173 ? 69.397 49.077  49.340 1.00 59.48  ? 173 GLU A OE1 1 
ATOM   1132 O OE2 . GLU A 1 173 ? 69.857 47.087  50.181 1.00 48.03  ? 173 GLU A OE2 1 
ATOM   1133 N N   . CYS A 1 174 ? 65.089 48.021  54.330 1.00 51.62  ? 174 CYS A N   1 
ATOM   1134 C CA  . CYS A 1 174 ? 64.447 48.986  55.235 1.00 48.91  ? 174 CYS A CA  1 
ATOM   1135 C C   . CYS A 1 174 ? 63.552 48.166  56.140 1.00 47.75  ? 174 CYS A C   1 
ATOM   1136 O O   . CYS A 1 174 ? 62.974 48.683  57.086 1.00 57.02  ? 174 CYS A O   1 
ATOM   1137 C CB  . CYS A 1 174 ? 63.552 49.968  54.478 1.00 41.81  ? 174 CYS A CB  1 
ATOM   1138 S SG  . CYS A 1 174 ? 64.341 50.780  53.095 1.00 77.01  ? 174 CYS A SG  1 
ATOM   1139 N N   . HIS A 1 175 ? 63.414 46.888  55.804 1.00 45.45  ? 175 HIS A N   1 
ATOM   1140 C CA  . HIS A 1 175 ? 62.570 45.972  56.539 1.00 49.43  ? 175 HIS A CA  1 
ATOM   1141 C C   . HIS A 1 175 ? 61.132 46.485  56.556 1.00 49.86  ? 175 HIS A C   1 
ATOM   1142 O O   . HIS A 1 175 ? 60.457 46.471  57.588 1.00 55.97  ? 175 HIS A O   1 
ATOM   1143 C CB  . HIS A 1 175 ? 63.129 45.761  57.942 1.00 59.14  ? 175 HIS A CB  1 
ATOM   1144 C CG  . HIS A 1 175 ? 64.483 45.126  57.953 1.00 60.57  ? 175 HIS A CG  1 
ATOM   1145 N ND1 . HIS A 1 175 ? 65.529 45.593  57.187 1.00 61.76  ? 175 HIS A ND1 1 
ATOM   1146 C CD2 . HIS A 1 175 ? 64.950 44.033  58.603 1.00 59.95  ? 175 HIS A CD2 1 
ATOM   1147 C CE1 . HIS A 1 175 ? 66.580 44.814  57.360 1.00 64.62  ? 175 HIS A CE1 1 
ATOM   1148 N NE2 . HIS A 1 175 ? 66.255 43.860  58.215 1.00 58.36  ? 175 HIS A NE2 1 
ATOM   1149 N N   . GLY A 1 176 ? 60.689 46.967  55.395 1.00 43.17  ? 176 GLY A N   1 
ATOM   1150 C CA  . GLY A 1 176 ? 59.341 47.480  55.247 1.00 35.11  ? 176 GLY A CA  1 
ATOM   1151 C C   . GLY A 1 176 ? 59.059 48.676  56.122 1.00 37.65  ? 176 GLY A C   1 
ATOM   1152 O O   . GLY A 1 176 ? 57.894 48.967  56.406 1.00 39.88  ? 176 GLY A O   1 
ATOM   1153 N N   . ASN A 1 177 ? 60.121 49.349  56.572 1.00 36.17  ? 177 ASN A N   1 
ATOM   1154 C CA  . ASN A 1 177 ? 60.006 50.532  57.430 1.00 38.39  ? 177 ASN A CA  1 
ATOM   1155 C C   . ASN A 1 177 ? 60.303 51.837  56.699 1.00 37.94  ? 177 ASN A C   1 
ATOM   1156 O O   . ASN A 1 177 ? 61.392 52.407  56.831 1.00 36.44  ? 177 ASN A O   1 
ATOM   1157 C CB  . ASN A 1 177 ? 60.916 50.405  58.647 1.00 38.43  ? 177 ASN A CB  1 
ATOM   1158 C CG  . ASN A 1 177 ? 60.362 49.460  59.679 1.00 58.54  ? 177 ASN A CG  1 
ATOM   1159 O OD1 . ASN A 1 177 ? 59.554 49.857  60.526 1.00 77.26  ? 177 ASN A OD1 1 
ATOM   1160 N ND2 . ASN A 1 177 ? 60.772 48.196  59.614 1.00 57.37  ? 177 ASN A ND2 1 
ATOM   1161 N N   . THR A 1 178 ? 59.320 52.308  55.935 1.00 38.26  ? 178 THR A N   1 
ATOM   1162 C CA  . THR A 1 178 ? 59.459 53.543  55.165 1.00 40.08  ? 178 THR A CA  1 
ATOM   1163 C C   . THR A 1 178 ? 58.191 54.363  55.184 1.00 34.45  ? 178 THR A C   1 
ATOM   1164 O O   . THR A 1 178 ? 57.099 53.842  55.426 1.00 41.37  ? 178 THR A O   1 
ATOM   1165 C CB  . THR A 1 178 ? 59.772 53.282  53.653 1.00 42.73  ? 178 THR A CB  1 
ATOM   1166 O OG1 . THR A 1 178 ? 58.742 52.472  53.063 1.00 26.21  ? 178 THR A OG1 1 
ATOM   1167 C CG2 . THR A 1 178 ? 61.129 52.605  53.478 1.00 50.60  ? 178 THR A CG2 1 
ATOM   1168 N N   . LEU A 1 179 ? 58.353 55.651  54.919 1.00 25.15  ? 179 LEU A N   1 
ATOM   1169 C CA  . LEU A 1 179 ? 57.232 56.565  54.845 1.00 29.40  ? 179 LEU A CA  1 
ATOM   1170 C C   . LEU A 1 179 ? 56.720 56.509  53.401 1.00 30.24  ? 179 LEU A C   1 
ATOM   1171 O O   . LEU A 1 179 ? 55.780 57.218  53.023 1.00 30.19  ? 179 LEU A O   1 
ATOM   1172 C CB  . LEU A 1 179 ? 57.686 57.992  55.156 1.00 30.17  ? 179 LEU A CB  1 
ATOM   1173 C CG  . LEU A 1 179 ? 58.445 58.276  56.449 1.00 27.41  ? 179 LEU A CG  1 
ATOM   1174 C CD1 . LEU A 1 179 ? 58.610 59.792  56.559 1.00 23.23  ? 179 LEU A CD1 1 
ATOM   1175 C CD2 . LEU A 1 179 ? 57.676 57.743  57.643 1.00 30.59  ? 179 LEU A CD2 1 
ATOM   1176 N N   . LEU A 1 180 ? 57.389 55.702  52.583 1.00 28.08  ? 180 LEU A N   1 
ATOM   1177 C CA  . LEU A 1 180 ? 57.025 55.554  51.184 1.00 29.04  ? 180 LEU A CA  1 
ATOM   1178 C C   . LEU A 1 180 ? 55.769 54.724  51.088 1.00 31.60  ? 180 LEU A C   1 
ATOM   1179 O O   . LEU A 1 180 ? 55.527 53.885  51.955 1.00 39.49  ? 180 LEU A O   1 
ATOM   1180 C CB  . LEU A 1 180 ? 58.131 54.819  50.438 1.00 30.33  ? 180 LEU A CB  1 
ATOM   1181 C CG  . LEU A 1 180 ? 59.354 55.572  49.940 1.00 27.84  ? 180 LEU A CG  1 
ATOM   1182 C CD1 . LEU A 1 180 ? 60.101 54.643  48.985 1.00 30.64  ? 180 LEU A CD1 1 
ATOM   1183 C CD2 . LEU A 1 180 ? 58.921 56.853  49.216 1.00 14.93  ? 180 LEU A CD2 1 
ATOM   1184 N N   . PRO A 1 181 ? 54.953 54.929  50.034 1.00 29.44  ? 181 PRO A N   1 
ATOM   1185 C CA  . PRO A 1 181 ? 53.730 54.143  49.891 1.00 24.40  ? 181 PRO A CA  1 
ATOM   1186 C C   . PRO A 1 181 ? 54.153 52.690  49.794 1.00 22.95  ? 181 PRO A C   1 
ATOM   1187 O O   . PRO A 1 181 ? 55.134 52.393  49.127 1.00 21.51  ? 181 PRO A O   1 
ATOM   1188 C CB  . PRO A 1 181 ? 53.177 54.628  48.558 1.00 24.36  ? 181 PRO A CB  1 
ATOM   1189 C CG  . PRO A 1 181 ? 53.606 56.028  48.513 1.00 30.13  ? 181 PRO A CG  1 
ATOM   1190 C CD  . PRO A 1 181 ? 55.048 55.921  48.954 1.00 29.42  ? 181 PRO A CD  1 
ATOM   1191 N N   . GLN A 1 182 ? 53.475 51.809  50.525 1.00 21.00  ? 182 GLN A N   1 
ATOM   1192 C CA  . GLN A 1 182 ? 53.799 50.390  50.494 1.00 21.79  ? 182 GLN A CA  1 
ATOM   1193 C C   . GLN A 1 182 ? 52.814 49.722  49.562 1.00 24.49  ? 182 GLN A C   1 
ATOM   1194 O O   . GLN A 1 182 ? 51.708 49.417  49.966 1.00 30.86  ? 182 GLN A O   1 
ATOM   1195 C CB  . GLN A 1 182 ? 53.672 49.820  51.888 1.00 30.88  ? 182 GLN A CB  1 
ATOM   1196 C CG  . GLN A 1 182 ? 54.633 50.458  52.877 1.00 36.41  ? 182 GLN A CG  1 
ATOM   1197 C CD  . GLN A 1 182 ? 54.072 50.543  54.287 1.00 36.88  ? 182 GLN A CD  1 
ATOM   1198 O OE1 . GLN A 1 182 ? 53.377 49.630  54.769 1.00 25.47  ? 182 GLN A OE1 1 
ATOM   1199 N NE2 . GLN A 1 182 ? 54.368 51.649  54.958 1.00 34.60  ? 182 GLN A NE2 1 
ATOM   1200 N N   . PHE A 1 183 ? 53.203 49.534  48.302 1.00 26.02  ? 183 PHE A N   1 
ATOM   1201 C CA  . PHE A 1 183 ? 52.326 48.939  47.290 1.00 15.25  ? 183 PHE A CA  1 
ATOM   1202 C C   . PHE A 1 183 ? 52.089 47.476  47.583 1.00 15.61  ? 183 PHE A C   1 
ATOM   1203 O O   . PHE A 1 183 ? 53.029 46.710  47.791 1.00 17.36  ? 183 PHE A O   1 
ATOM   1204 C CB  . PHE A 1 183 ? 52.919 49.139  45.897 1.00 9.29   ? 183 PHE A CB  1 
ATOM   1205 C CG  . PHE A 1 183 ? 53.285 50.569  45.610 1.00 9.64   ? 183 PHE A CG  1 
ATOM   1206 C CD1 . PHE A 1 183 ? 54.629 50.976  45.606 1.00 9.18   ? 183 PHE A CD1 1 
ATOM   1207 C CD2 . PHE A 1 183 ? 52.287 51.523  45.407 1.00 2.00   ? 183 PHE A CD2 1 
ATOM   1208 C CE1 . PHE A 1 183 ? 54.968 52.316  45.409 1.00 12.43  ? 183 PHE A CE1 1 
ATOM   1209 C CE2 . PHE A 1 183 ? 52.609 52.862  45.209 1.00 2.00   ? 183 PHE A CE2 1 
ATOM   1210 C CZ  . PHE A 1 183 ? 53.955 53.264  45.211 1.00 4.16   ? 183 PHE A CZ  1 
ATOM   1211 N N   . LEU A 1 184 ? 50.820 47.098  47.634 1.00 12.04  ? 184 LEU A N   1 
ATOM   1212 C CA  . LEU A 1 184 ? 50.474 45.723  47.933 1.00 8.75   ? 184 LEU A CA  1 
ATOM   1213 C C   . LEU A 1 184 ? 49.956 44.995  46.692 1.00 15.26  ? 184 LEU A C   1 
ATOM   1214 O O   . LEU A 1 184 ? 49.901 43.754  46.654 1.00 14.17  ? 184 LEU A O   1 
ATOM   1215 C CB  . LEU A 1 184 ? 49.434 45.693  49.058 1.00 12.13  ? 184 LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 184 ? 49.673 46.548  50.320 1.00 13.00  ? 184 LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 184 ? 48.423 46.535  51.166 1.00 14.23  ? 184 LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 184 ? 50.868 46.074  51.134 1.00 8.05   ? 184 LEU A CD2 1 
ATOM   1219 N N   . GLY A 1 185 ? 49.564 45.752  45.673 1.00 11.71  ? 185 GLY A N   1 
ATOM   1220 C CA  . GLY A 1 185 ? 49.057 45.119  44.464 1.00 17.32  ? 185 GLY A CA  1 
ATOM   1221 C C   . GLY A 1 185 ? 48.666 46.134  43.406 1.00 25.58  ? 185 GLY A C   1 
ATOM   1222 O O   . GLY A 1 185 ? 48.251 47.265  43.735 1.00 21.09  ? 185 GLY A O   1 
ATOM   1223 N N   . MET A 1 186 ? 48.784 45.735  42.139 1.00 19.80  ? 186 MET A N   1 
ATOM   1224 C CA  . MET A 1 186 ? 48.445 46.615  41.019 1.00 20.63  ? 186 MET A CA  1 
ATOM   1225 C C   . MET A 1 186 ? 47.625 45.837  39.984 1.00 22.78  ? 186 MET A C   1 
ATOM   1226 O O   . MET A 1 186 ? 48.082 44.807  39.481 1.00 28.34  ? 186 MET A O   1 
ATOM   1227 C CB  . MET A 1 186 ? 49.731 47.165  40.420 1.00 23.16  ? 186 MET A CB  1 
ATOM   1228 C CG  . MET A 1 186 ? 49.579 47.823  39.093 1.00 22.10  ? 186 MET A CG  1 
ATOM   1229 S SD  . MET A 1 186 ? 51.130 48.533  38.603 1.00 23.52  ? 186 MET A SD  1 
ATOM   1230 C CE  . MET A 1 186 ? 50.613 50.145  38.738 1.00 15.41  ? 186 MET A CE  1 
ATOM   1231 N N   . TYR A 1 187 ? 46.425 46.323  39.656 1.00 20.44  ? 187 TYR A N   1 
ATOM   1232 C CA  . TYR A 1 187 ? 45.558 45.605  38.722 1.00 18.51  ? 187 TYR A CA  1 
ATOM   1233 C C   . TYR A 1 187 ? 44.988 46.454  37.601 1.00 21.08  ? 187 TYR A C   1 
ATOM   1234 O O   . TYR A 1 187 ? 45.025 47.689  37.659 1.00 17.66  ? 187 TYR A O   1 
ATOM   1235 C CB  . TYR A 1 187 ? 44.359 45.023  39.478 1.00 21.56  ? 187 TYR A CB  1 
ATOM   1236 C CG  . TYR A 1 187 ? 44.665 44.396  40.815 1.00 22.42  ? 187 TYR A CG  1 
ATOM   1237 C CD1 . TYR A 1 187 ? 44.598 45.142  41.992 1.00 21.02  ? 187 TYR A CD1 1 
ATOM   1238 C CD2 . TYR A 1 187 ? 45.035 43.065  40.905 1.00 16.83  ? 187 TYR A CD2 1 
ATOM   1239 C CE1 . TYR A 1 187 ? 44.904 44.569  43.230 1.00 12.64  ? 187 TYR A CE1 1 
ATOM   1240 C CE2 . TYR A 1 187 ? 45.336 42.483  42.135 1.00 14.91  ? 187 TYR A CE2 1 
ATOM   1241 C CZ  . TYR A 1 187 ? 45.270 43.237  43.285 1.00 10.89  ? 187 TYR A CZ  1 
ATOM   1242 O OH  . TYR A 1 187 ? 45.567 42.623  44.475 1.00 13.57  ? 187 TYR A OH  1 
ATOM   1243 N N   . ARG A 1 188 ? 44.429 45.769  36.597 1.00 24.20  ? 188 ARG A N   1 
ATOM   1244 C CA  . ARG A 1 188 ? 43.755 46.420  35.463 1.00 27.30  ? 188 ARG A CA  1 
ATOM   1245 C C   . ARG A 1 188 ? 42.476 45.657  35.133 1.00 28.08  ? 188 ARG A C   1 
ATOM   1246 O O   . ARG A 1 188 ? 42.524 44.593  34.500 1.00 29.96  ? 188 ARG A O   1 
ATOM   1247 C CB  . ARG A 1 188 ? 44.620 46.478  34.203 1.00 24.60  ? 188 ARG A CB  1 
ATOM   1248 C CG  . ARG A 1 188 ? 43.947 47.284  33.093 1.00 23.42  ? 188 ARG A CG  1 
ATOM   1249 C CD  . ARG A 1 188 ? 44.510 46.963  31.714 1.00 25.16  ? 188 ARG A CD  1 
ATOM   1250 N NE  . ARG A 1 188 ? 44.180 45.601  31.310 1.00 33.61  ? 188 ARG A NE  1 
ATOM   1251 C CZ  . ARG A 1 188 ? 44.741 44.968  30.286 1.00 41.22  ? 188 ARG A CZ  1 
ATOM   1252 N NH1 . ARG A 1 188 ? 45.662 45.573  29.547 1.00 38.09  ? 188 ARG A NH1 1 
ATOM   1253 N NH2 . ARG A 1 188 ? 44.395 43.719  30.015 1.00 45.46  ? 188 ARG A NH2 1 
ATOM   1254 N N   . LEU A 1 189 ? 41.340 46.191  35.573 1.00 20.39  ? 189 LEU A N   1 
ATOM   1255 C CA  . LEU A 1 189 ? 40.064 45.545  35.319 1.00 22.87  ? 189 LEU A CA  1 
ATOM   1256 C C   . LEU A 1 189 ? 39.452 46.135  34.063 1.00 29.98  ? 189 LEU A C   1 
ATOM   1257 O O   . LEU A 1 189 ? 39.668 47.306  33.790 1.00 37.87  ? 189 LEU A O   1 
ATOM   1258 C CB  . LEU A 1 189 ? 39.089 45.827  36.448 1.00 15.56  ? 189 LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 189 ? 39.500 45.785  37.895 1.00 17.14  ? 189 LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 189 ? 40.170 47.093  38.252 1.00 31.19  ? 189 LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 189 ? 38.245 45.621  38.712 1.00 10.84  ? 189 LEU A CD2 1 
ATOM   1262 N N   . THR A 1 190 ? 38.670 45.355  33.316 1.00 27.10  ? 190 THR A N   1 
ATOM   1263 C CA  . THR A 1 190 ? 37.990 45.879  32.130 1.00 24.90  ? 190 THR A CA  1 
ATOM   1264 C C   . THR A 1 190 ? 36.538 45.417  32.122 1.00 22.73  ? 190 THR A C   1 
ATOM   1265 O O   . THR A 1 190 ? 36.243 44.220  32.302 1.00 22.34  ? 190 THR A O   1 
ATOM   1266 C CB  . THR A 1 190 ? 38.622 45.415  30.807 1.00 34.06  ? 190 THR A CB  1 
ATOM   1267 O OG1 . THR A 1 190 ? 38.401 44.009  30.644 1.00 52.60  ? 190 THR A OG1 1 
ATOM   1268 C CG2 . THR A 1 190 ? 40.106 45.678  30.788 1.00 40.59  ? 190 THR A CG2 1 
ATOM   1269 N N   . VAL A 1 191 ? 35.639 46.383  31.967 1.00 26.14  ? 191 VAL A N   1 
ATOM   1270 C CA  . VAL A 1 191 ? 34.194 46.140  31.890 1.00 32.64  ? 191 VAL A CA  1 
ATOM   1271 C C   . VAL A 1 191 ? 33.689 47.085  30.797 1.00 35.45  ? 191 VAL A C   1 
ATOM   1272 O O   . VAL A 1 191 ? 34.030 48.270  30.801 1.00 41.82  ? 191 VAL A O   1 
ATOM   1273 C CB  . VAL A 1 191 ? 33.450 46.492  33.205 1.00 29.98  ? 191 VAL A CB  1 
ATOM   1274 C CG1 . VAL A 1 191 ? 32.095 45.789  33.239 1.00 26.12  ? 191 VAL A CG1 1 
ATOM   1275 C CG2 . VAL A 1 191 ? 34.285 46.130  34.423 1.00 38.71  ? 191 VAL A CG2 1 
ATOM   1276 N N   . ASP A 1 192 ? 32.875 46.574  29.875 1.00 35.46  ? 192 ASP A N   1 
ATOM   1277 C CA  . ASP A 1 192 ? 32.353 47.384  28.774 1.00 35.59  ? 192 ASP A CA  1 
ATOM   1278 C C   . ASP A 1 192 ? 33.555 47.817  27.965 1.00 37.97  ? 192 ASP A C   1 
ATOM   1279 O O   . ASP A 1 192 ? 33.670 48.989  27.587 1.00 36.96  ? 192 ASP A O   1 
ATOM   1280 C CB  . ASP A 1 192 ? 31.619 48.633  29.279 1.00 38.80  ? 192 ASP A CB  1 
ATOM   1281 C CG  . ASP A 1 192 ? 30.624 48.322  30.376 1.00 56.94  ? 192 ASP A CG  1 
ATOM   1282 O OD1 . ASP A 1 192 ? 29.869 47.336  30.231 1.00 64.97  ? 192 ASP A OD1 1 
ATOM   1283 O OD2 . ASP A 1 192 ? 30.601 49.060  31.389 1.00 63.36  ? 192 ASP A OD2 1 
ATOM   1284 N N   . GLY A 1 193 ? 34.490 46.881  27.789 1.00 35.23  ? 193 GLY A N   1 
ATOM   1285 C CA  . GLY A 1 193 ? 35.707 47.147  27.036 1.00 36.53  ? 193 GLY A CA  1 
ATOM   1286 C C   . GLY A 1 193 ? 36.514 48.317  27.579 1.00 41.44  ? 193 GLY A C   1 
ATOM   1287 O O   . GLY A 1 193 ? 37.506 48.711  26.975 1.00 52.06  ? 193 GLY A O   1 
ATOM   1288 N N   . VAL A 1 194 ? 36.093 48.872  28.714 1.00 36.95  ? 194 VAL A N   1 
ATOM   1289 C CA  . VAL A 1 194 ? 36.780 49.996  29.337 1.00 34.02  ? 194 VAL A CA  1 
ATOM   1290 C C   . VAL A 1 194 ? 37.805 49.516  30.361 1.00 34.79  ? 194 VAL A C   1 
ATOM   1291 O O   . VAL A 1 194 ? 37.452 48.921  31.387 1.00 40.18  ? 194 VAL A O   1 
ATOM   1292 C CB  . VAL A 1 194 ? 35.797 50.927  30.072 1.00 32.55  ? 194 VAL A CB  1 
ATOM   1293 C CG1 . VAL A 1 194 ? 36.532 52.139  30.607 1.00 25.78  ? 194 VAL A CG1 1 
ATOM   1294 C CG2 . VAL A 1 194 ? 34.660 51.332  29.161 1.00 32.15  ? 194 VAL A CG2 1 
ATOM   1295 N N   . GLU A 1 195 ? 39.073 49.795  30.096 1.00 28.82  ? 195 GLU A N   1 
ATOM   1296 C CA  . GLU A 1 195 ? 40.120 49.391  31.019 1.00 28.94  ? 195 GLU A CA  1 
ATOM   1297 C C   . GLU A 1 195 ? 40.193 50.368  32.172 1.00 26.03  ? 195 GLU A C   1 
ATOM   1298 O O   . GLU A 1 195 ? 39.939 51.557  32.003 1.00 33.08  ? 195 GLU A O   1 
ATOM   1299 C CB  . GLU A 1 195 ? 41.465 49.310  30.311 1.00 21.89  ? 195 GLU A CB  1 
ATOM   1300 C CG  . GLU A 1 195 ? 41.383 48.476  29.059 1.00 30.76  ? 195 GLU A CG  1 
ATOM   1301 C CD  . GLU A 1 195 ? 42.588 47.587  28.858 1.00 35.95  ? 195 GLU A CD  1 
ATOM   1302 O OE1 . GLU A 1 195 ? 42.387 46.388  28.568 1.00 38.01  ? 195 GLU A OE1 1 
ATOM   1303 O OE2 . GLU A 1 195 ? 43.731 48.080  28.977 1.00 44.37  ? 195 GLU A OE2 1 
ATOM   1304 N N   . THR A 1 196 ? 40.494 49.843  33.352 1.00 22.72  ? 196 THR A N   1 
ATOM   1305 C CA  . THR A 1 196 ? 40.620 50.637  34.564 1.00 17.35  ? 196 THR A CA  1 
ATOM   1306 C C   . THR A 1 196 ? 41.850 50.122  35.298 1.00 22.93  ? 196 THR A C   1 
ATOM   1307 O O   . THR A 1 196 ? 42.042 48.901  35.437 1.00 26.40  ? 196 THR A O   1 
ATOM   1308 C CB  . THR A 1 196 ? 39.413 50.461  35.469 1.00 18.62  ? 196 THR A CB  1 
ATOM   1309 O OG1 . THR A 1 196 ? 38.211 50.803  34.761 1.00 21.76  ? 196 THR A OG1 1 
ATOM   1310 C CG2 . THR A 1 196 ? 39.558 51.337  36.674 1.00 4.75   ? 196 THR A CG2 1 
ATOM   1311 N N   . TYR A 1 197 ? 42.718 51.034  35.711 1.00 16.45  ? 197 TYR A N   1 
ATOM   1312 C CA  . TYR A 1 197 ? 43.921 50.619  36.423 1.00 27.30  ? 197 TYR A CA  1 
ATOM   1313 C C   . TYR A 1 197 ? 43.782 50.985  37.895 1.00 32.83  ? 197 TYR A C   1 
ATOM   1314 O O   . TYR A 1 197 ? 43.181 52.022  38.232 1.00 38.76  ? 197 TYR A O   1 
ATOM   1315 C CB  . TYR A 1 197 ? 45.163 51.282  35.827 1.00 27.16  ? 197 TYR A CB  1 
ATOM   1316 C CG  . TYR A 1 197 ? 45.431 50.922  34.381 1.00 22.49  ? 197 TYR A CG  1 
ATOM   1317 C CD1 . TYR A 1 197 ? 44.757 51.556  33.345 1.00 20.81  ? 197 TYR A CD1 1 
ATOM   1318 C CD2 . TYR A 1 197 ? 46.391 49.976  34.051 1.00 23.13  ? 197 TYR A CD2 1 
ATOM   1319 C CE1 . TYR A 1 197 ? 45.033 51.264  32.021 1.00 16.16  ? 197 TYR A CE1 1 
ATOM   1320 C CE2 . TYR A 1 197 ? 46.675 49.671  32.730 1.00 23.10  ? 197 TYR A CE2 1 
ATOM   1321 C CZ  . TYR A 1 197 ? 45.991 50.319  31.717 1.00 24.22  ? 197 TYR A CZ  1 
ATOM   1322 O OH  . TYR A 1 197 ? 46.253 49.994  30.399 1.00 30.69  ? 197 TYR A OH  1 
ATOM   1323 N N   . MET A 1 198 ? 44.309 50.126  38.770 1.00 25.66  ? 198 MET A N   1 
ATOM   1324 C CA  . MET A 1 198 ? 44.227 50.361  40.210 1.00 20.91  ? 198 MET A CA  1 
ATOM   1325 C C   . MET A 1 198 ? 45.508 49.946  40.918 1.00 20.10  ? 198 MET A C   1 
ATOM   1326 O O   . MET A 1 198 ? 46.177 49.000  40.483 1.00 21.60  ? 198 MET A O   1 
ATOM   1327 C CB  . MET A 1 198 ? 43.038 49.606  40.814 1.00 19.31  ? 198 MET A CB  1 
ATOM   1328 C CG  . MET A 1 198 ? 41.704 49.964  40.210 1.00 12.97  ? 198 MET A CG  1 
ATOM   1329 S SD  . MET A 1 198 ? 40.345 49.324  41.135 1.00 22.24  ? 198 MET A SD  1 
ATOM   1330 C CE  . MET A 1 198 ? 39.013 50.425  40.631 1.00 8.77   ? 198 MET A CE  1 
ATOM   1331 N N   . VAL A 1 199 ? 45.838 50.661  41.997 1.00 12.67  ? 199 VAL A N   1 
ATOM   1332 C CA  . VAL A 1 199 ? 47.031 50.400  42.791 1.00 16.05  ? 199 VAL A CA  1 
ATOM   1333 C C   . VAL A 1 199 ? 46.673 50.359  44.285 1.00 24.80  ? 199 VAL A C   1 
ATOM   1334 O O   . VAL A 1 199 ? 46.563 51.407  44.951 1.00 28.21  ? 199 VAL A O   1 
ATOM   1335 C CB  . VAL A 1 199 ? 48.095 51.494  42.558 1.00 17.10  ? 199 VAL A CB  1 
ATOM   1336 C CG1 . VAL A 1 199 ? 49.256 51.339  43.543 1.00 21.25  ? 199 VAL A CG1 1 
ATOM   1337 C CG2 . VAL A 1 199 ? 48.607 51.431  41.148 1.00 16.78  ? 199 VAL A CG2 1 
ATOM   1338 N N   . VAL A 1 200 ? 46.499 49.149  44.811 1.00 19.61  ? 200 VAL A N   1 
ATOM   1339 C CA  . VAL A 1 200 ? 46.154 48.965  46.222 1.00 15.49  ? 200 VAL A CA  1 
ATOM   1340 C C   . VAL A 1 200 ? 47.360 49.236  47.135 1.00 21.57  ? 200 VAL A C   1 
ATOM   1341 O O   . VAL A 1 200 ? 48.488 48.780  46.871 1.00 23.27  ? 200 VAL A O   1 
ATOM   1342 C CB  . VAL A 1 200 ? 45.610 47.523  46.483 1.00 9.49   ? 200 VAL A CB  1 
ATOM   1343 C CG1 . VAL A 1 200 ? 45.046 47.409  47.872 1.00 5.25   ? 200 VAL A CG1 1 
ATOM   1344 C CG2 . VAL A 1 200 ? 44.538 47.153  45.478 1.00 8.57   ? 200 VAL A CG2 1 
ATOM   1345 N N   . THR A 1 201 ? 47.118 49.972  48.216 1.00 25.02  ? 201 THR A N   1 
ATOM   1346 C CA  . THR A 1 201 ? 48.166 50.305  49.189 1.00 21.92  ? 201 THR A CA  1 
ATOM   1347 C C   . THR A 1 201 ? 47.647 50.526  50.614 1.00 23.22  ? 201 THR A C   1 
ATOM   1348 O O   . THR A 1 201 ? 46.555 51.083  50.800 1.00 29.33  ? 201 THR A O   1 
ATOM   1349 C CB  . THR A 1 201 ? 48.892 51.567  48.776 1.00 20.22  ? 201 THR A CB  1 
ATOM   1350 O OG1 . THR A 1 201 ? 47.931 52.559  48.398 1.00 15.02  ? 201 THR A OG1 1 
ATOM   1351 C CG2 . THR A 1 201 ? 49.818 51.277  47.614 1.00 26.75  ? 201 THR A CG2 1 
ATOM   1352 N N   . ARG A 1 202 ? 48.423 50.089  51.610 1.00 11.97  ? 202 ARG A N   1 
ATOM   1353 C CA  . ARG A 1 202 ? 48.052 50.268  53.016 1.00 12.69  ? 202 ARG A CA  1 
ATOM   1354 C C   . ARG A 1 202 ? 47.890 51.767  53.260 1.00 12.47  ? 202 ARG A C   1 
ATOM   1355 O O   . ARG A 1 202 ? 48.703 52.532  52.753 1.00 15.63  ? 202 ARG A O   1 
ATOM   1356 C CB  . ARG A 1 202 ? 49.142 49.699  53.901 1.00 2.75   ? 202 ARG A CB  1 
ATOM   1357 C CG  . ARG A 1 202 ? 49.167 50.296  55.266 1.00 16.33  ? 202 ARG A CG  1 
ATOM   1358 C CD  . ARG A 1 202 ? 49.652 49.290  56.291 1.00 16.10  ? 202 ARG A CD  1 
ATOM   1359 N NE  . ARG A 1 202 ? 51.040 48.921  56.102 1.00 2.00   ? 202 ARG A NE  1 
ATOM   1360 C CZ  . ARG A 1 202 ? 51.561 47.822  56.623 1.00 11.95  ? 202 ARG A CZ  1 
ATOM   1361 N NH1 . ARG A 1 202 ? 50.799 47.021  57.361 1.00 9.67   ? 202 ARG A NH1 1 
ATOM   1362 N NH2 . ARG A 1 202 ? 52.816 47.484  56.355 1.00 9.85   ? 202 ARG A NH2 1 
ATOM   1363 N N   . ASN A 1 203 ? 46.834 52.210  53.956 1.00 7.58   ? 203 ASN A N   1 
ATOM   1364 C CA  . ASN A 1 203 ? 46.694 53.655  54.129 1.00 12.15  ? 203 ASN A CA  1 
ATOM   1365 C C   . ASN A 1 203 ? 47.526 54.323  55.193 1.00 17.36  ? 203 ASN A C   1 
ATOM   1366 O O   . ASN A 1 203 ? 48.090 53.671  56.079 1.00 19.41  ? 203 ASN A O   1 
ATOM   1367 C CB  . ASN A 1 203 ? 45.244 54.198  54.104 1.00 18.07  ? 203 ASN A CB  1 
ATOM   1368 C CG  . ASN A 1 203 ? 44.339 53.646  55.207 1.00 18.18  ? 203 ASN A CG  1 
ATOM   1369 O OD1 . ASN A 1 203 ? 44.557 52.540  55.723 1.00 25.85  ? 203 ASN A OD1 1 
ATOM   1370 N ND2 . ASN A 1 203 ? 43.252 54.395  55.511 1.00 2.00   ? 203 ASN A ND2 1 
ATOM   1371 N N   . VAL A 1 204 ? 47.716 55.621  54.981 1.00 18.67  ? 204 VAL A N   1 
ATOM   1372 C CA  . VAL A 1 204 ? 48.506 56.465  55.855 1.00 20.94  ? 204 VAL A CA  1 
ATOM   1373 C C   . VAL A 1 204 ? 47.794 56.606  57.187 1.00 25.66  ? 204 VAL A C   1 
ATOM   1374 O O   . VAL A 1 204 ? 48.376 56.351  58.236 1.00 35.10  ? 204 VAL A O   1 
ATOM   1375 C CB  . VAL A 1 204 ? 48.687 57.872  55.246 1.00 17.10  ? 204 VAL A CB  1 
ATOM   1376 C CG1 . VAL A 1 204 ? 49.660 58.652  56.064 1.00 34.45  ? 204 VAL A CG1 1 
ATOM   1377 C CG2 . VAL A 1 204 ? 49.157 57.790  53.826 1.00 10.09  ? 204 VAL A CG2 1 
ATOM   1378 N N   . PHE A 1 205 ? 46.520 56.977  57.126 1.00 21.06  ? 205 PHE A N   1 
ATOM   1379 C CA  . PHE A 1 205 ? 45.712 57.168  58.311 1.00 22.55  ? 205 PHE A CA  1 
ATOM   1380 C C   . PHE A 1 205 ? 45.298 55.794  58.828 1.00 29.16  ? 205 PHE A C   1 
ATOM   1381 O O   . PHE A 1 205 ? 45.359 54.830  58.074 1.00 38.87  ? 205 PHE A O   1 
ATOM   1382 C CB  . PHE A 1 205 ? 44.496 58.001  57.938 1.00 23.89  ? 205 PHE A CB  1 
ATOM   1383 C CG  . PHE A 1 205 ? 44.831 59.294  57.225 1.00 20.36  ? 205 PHE A CG  1 
ATOM   1384 C CD1 . PHE A 1 205 ? 43.886 59.929  56.442 1.00 18.46  ? 205 PHE A CD1 1 
ATOM   1385 C CD2 . PHE A 1 205 ? 46.076 59.886  57.355 1.00 22.53  ? 205 PHE A CD2 1 
ATOM   1386 C CE1 . PHE A 1 205 ? 44.173 61.117  55.810 1.00 16.47  ? 205 PHE A CE1 1 
ATOM   1387 C CE2 . PHE A 1 205 ? 46.361 61.084  56.717 1.00 16.75  ? 205 PHE A CE2 1 
ATOM   1388 C CZ  . PHE A 1 205 ? 45.408 61.693  55.948 1.00 11.19  ? 205 PHE A CZ  1 
ATOM   1389 N N   . SER A 1 206 ? 44.897 55.689  60.097 1.00 31.47  ? 206 SER A N   1 
ATOM   1390 C CA  . SER A 1 206 ? 44.504 54.390  60.666 1.00 34.82  ? 206 SER A CA  1 
ATOM   1391 C C   . SER A 1 206 ? 43.069 53.980  60.355 1.00 37.18  ? 206 SER A C   1 
ATOM   1392 O O   . SER A 1 206 ? 42.217 54.832  60.087 1.00 38.47  ? 206 SER A O   1 
ATOM   1393 C CB  . SER A 1 206 ? 44.738 54.353  62.182 1.00 41.05  ? 206 SER A CB  1 
ATOM   1394 O OG  . SER A 1 206 ? 44.066 55.411  62.836 1.00 45.47  ? 206 SER A OG  1 
ATOM   1395 N N   . HIS A 1 207 ? 42.809 52.672  60.414 1.00 32.77  ? 207 HIS A N   1 
ATOM   1396 C CA  . HIS A 1 207 ? 41.484 52.129  60.122 1.00 31.78  ? 207 HIS A CA  1 
ATOM   1397 C C   . HIS A 1 207 ? 40.520 52.269  61.277 1.00 32.66  ? 207 HIS A C   1 
ATOM   1398 O O   . HIS A 1 207 ? 39.307 52.121  61.114 1.00 31.11  ? 207 HIS A O   1 
ATOM   1399 C CB  . HIS A 1 207 ? 41.587 50.660  59.742 1.00 37.08  ? 207 HIS A CB  1 
ATOM   1400 C CG  . HIS A 1 207 ? 41.945 49.760  60.882 1.00 38.07  ? 207 HIS A CG  1 
ATOM   1401 N ND1 . HIS A 1 207 ? 43.233 49.645  61.363 1.00 30.05  ? 207 HIS A ND1 1 
ATOM   1402 C CD2 . HIS A 1 207 ? 41.192 48.904  61.615 1.00 36.23  ? 207 HIS A CD2 1 
ATOM   1403 C CE1 . HIS A 1 207 ? 43.258 48.757  62.343 1.00 32.66  ? 207 HIS A CE1 1 
ATOM   1404 N NE2 . HIS A 1 207 ? 42.033 48.294  62.515 1.00 37.33  ? 207 HIS A NE2 1 
ATOM   1405 N N   . ARG A 1 208 ? 41.097 52.450  62.461 1.00 36.12  ? 208 ARG A N   1 
ATOM   1406 C CA  . ARG A 1 208 ? 40.364 52.615  63.713 1.00 37.11  ? 208 ARG A CA  1 
ATOM   1407 C C   . ARG A 1 208 ? 40.181 54.090  64.079 1.00 37.82  ? 208 ARG A C   1 
ATOM   1408 O O   . ARG A 1 208 ? 39.054 54.568  64.124 1.00 41.72  ? 208 ARG A O   1 
ATOM   1409 C CB  . ARG A 1 208 ? 41.105 51.895  64.837 1.00 34.89  ? 208 ARG A CB  1 
ATOM   1410 C CG  . ARG A 1 208 ? 40.555 52.176  66.221 1.00 56.09  ? 208 ARG A CG  1 
ATOM   1411 C CD  . ARG A 1 208 ? 41.083 51.175  67.220 1.00 59.82  ? 208 ARG A CD  1 
ATOM   1412 N NE  . ARG A 1 208 ? 42.513 50.972  67.039 1.00 71.85  ? 208 ARG A NE  1 
ATOM   1413 C CZ  . ARG A 1 208 ? 43.457 51.768  67.531 1.00 82.99  ? 208 ARG A CZ  1 
ATOM   1414 N NH1 . ARG A 1 208 ? 43.135 52.835  68.253 1.00 84.19  ? 208 ARG A NH1 1 
ATOM   1415 N NH2 . ARG A 1 208 ? 44.733 51.504  67.280 1.00 90.16  ? 208 ARG A NH2 1 
ATOM   1416 N N   . LEU A 1 209 ? 41.285 54.801  64.333 1.00 32.25  ? 209 LEU A N   1 
ATOM   1417 C CA  . LEU A 1 209 ? 41.244 56.223  64.695 1.00 35.22  ? 209 LEU A CA  1 
ATOM   1418 C C   . LEU A 1 209 ? 40.863 57.168  63.545 1.00 41.71  ? 209 LEU A C   1 
ATOM   1419 O O   . LEU A 1 209 ? 41.248 56.948  62.390 1.00 48.44  ? 209 LEU A O   1 
ATOM   1420 C CB  . LEU A 1 209 ? 42.582 56.641  65.278 1.00 27.96  ? 209 LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 209 ? 43.093 55.651  66.321 1.00 26.13  ? 209 LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 209 ? 44.468 56.070  66.838 1.00 27.84  ? 209 LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 209 ? 42.089 55.563  67.448 1.00 27.98  ? 209 LEU A CD2 1 
ATOM   1424 N N   . THR A 1 210 ? 40.129 58.233  63.873 1.00 44.31  ? 210 THR A N   1 
ATOM   1425 C CA  . THR A 1 210 ? 39.682 59.198  62.867 1.00 45.56  ? 210 THR A CA  1 
ATOM   1426 C C   . THR A 1 210 ? 40.585 60.418  62.705 1.00 45.05  ? 210 THR A C   1 
ATOM   1427 O O   . THR A 1 210 ? 41.088 60.962  63.687 1.00 51.06  ? 210 THR A O   1 
ATOM   1428 C CB  . THR A 1 210 ? 38.232 59.658  63.128 1.00 39.98  ? 210 THR A CB  1 
ATOM   1429 O OG1 . THR A 1 210 ? 37.882 59.404  64.490 1.00 39.86  ? 210 THR A OG1 1 
ATOM   1430 C CG2 . THR A 1 210 ? 37.268 58.913  62.233 1.00 40.91  ? 210 THR A CG2 1 
ATOM   1431 N N   . VAL A 1 211 ? 40.794 60.832  61.455 1.00 44.17  ? 211 VAL A N   1 
ATOM   1432 C CA  . VAL A 1 211 ? 41.631 61.986  61.143 1.00 45.60  ? 211 VAL A CA  1 
ATOM   1433 C C   . VAL A 1 211 ? 40.850 63.289  61.233 1.00 48.93  ? 211 VAL A C   1 
ATOM   1434 O O   . VAL A 1 211 ? 40.065 63.626  60.347 1.00 55.64  ? 211 VAL A O   1 
ATOM   1435 C CB  . VAL A 1 211 ? 42.261 61.843  59.754 1.00 44.09  ? 211 VAL A CB  1 
ATOM   1436 C CG1 . VAL A 1 211 ? 42.926 63.139  59.325 1.00 45.51  ? 211 VAL A CG1 1 
ATOM   1437 C CG2 . VAL A 1 211 ? 43.278 60.725  59.789 1.00 51.20  ? 211 VAL A CG2 1 
ATOM   1438 N N   . HIS A 1 212 ? 41.063 64.016  62.319 1.00 48.52  ? 212 HIS A N   1 
ATOM   1439 C CA  . HIS A 1 212 ? 40.372 65.275  62.527 1.00 48.55  ? 212 HIS A CA  1 
ATOM   1440 C C   . HIS A 1 212 ? 40.861 66.408  61.614 1.00 54.30  ? 212 HIS A C   1 
ATOM   1441 O O   . HIS A 1 212 ? 40.042 67.178  61.106 1.00 58.63  ? 212 HIS A O   1 
ATOM   1442 C CB  . HIS A 1 212 ? 40.457 65.674  63.996 1.00 42.65  ? 212 HIS A CB  1 
ATOM   1443 C CG  . HIS A 1 212 ? 39.807 64.695  64.917 1.00 33.96  ? 212 HIS A CG  1 
ATOM   1444 N ND1 . HIS A 1 212 ? 38.589 64.117  64.640 1.00 34.02  ? 212 HIS A ND1 1 
ATOM   1445 C CD2 . HIS A 1 212 ? 40.210 64.175  66.099 1.00 33.54  ? 212 HIS A CD2 1 
ATOM   1446 C CE1 . HIS A 1 212 ? 38.270 63.277  65.609 1.00 32.22  ? 212 HIS A CE1 1 
ATOM   1447 N NE2 . HIS A 1 212 ? 39.238 63.294  66.507 1.00 33.11  ? 212 HIS A NE2 1 
ATOM   1448 N N   . ARG A 1 213 ? 42.179 66.525  61.417 1.00 52.46  ? 213 ARG A N   1 
ATOM   1449 C CA  . ARG A 1 213 ? 42.735 67.565  60.539 1.00 49.38  ? 213 ARG A CA  1 
ATOM   1450 C C   . ARG A 1 213 ? 43.792 66.956  59.628 1.00 50.01  ? 213 ARG A C   1 
ATOM   1451 O O   . ARG A 1 213 ? 44.672 66.238  60.097 1.00 50.49  ? 213 ARG A O   1 
ATOM   1452 C CB  . ARG A 1 213 ? 43.316 68.725  61.342 1.00 48.84  ? 213 ARG A CB  1 
ATOM   1453 C CG  . ARG A 1 213 ? 43.872 69.831  60.476 1.00 42.24  ? 213 ARG A CG  1 
ATOM   1454 C CD  . ARG A 1 213 ? 44.163 71.097  61.274 1.00 46.19  ? 213 ARG A CD  1 
ATOM   1455 N NE  . ARG A 1 213 ? 42.981 71.936  61.462 1.00 48.92  ? 213 ARG A NE  1 
ATOM   1456 C CZ  . ARG A 1 213 ? 42.747 73.072  60.806 1.00 53.71  ? 213 ARG A CZ  1 
ATOM   1457 N NH1 . ARG A 1 213 ? 43.612 73.523  59.905 1.00 49.52  ? 213 ARG A NH1 1 
ATOM   1458 N NH2 . ARG A 1 213 ? 41.627 73.751  61.036 1.00 56.11  ? 213 ARG A NH2 1 
ATOM   1459 N N   . LYS A 1 214 ? 43.699 67.261  58.330 1.00 52.57  ? 214 LYS A N   1 
ATOM   1460 C CA  . LYS A 1 214 ? 44.591 66.706  57.301 1.00 47.29  ? 214 LYS A CA  1 
ATOM   1461 C C   . LYS A 1 214 ? 45.464 67.748  56.612 1.00 46.68  ? 214 LYS A C   1 
ATOM   1462 O O   . LYS A 1 214 ? 45.132 68.927  56.603 1.00 46.35  ? 214 LYS A O   1 
ATOM   1463 C CB  . LYS A 1 214 ? 43.738 65.988  56.248 1.00 49.09  ? 214 LYS A CB  1 
ATOM   1464 C CG  . LYS A 1 214 ? 44.492 65.142  55.241 1.00 52.15  ? 214 LYS A CG  1 
ATOM   1465 C CD  . LYS A 1 214 ? 43.577 64.730  54.093 1.00 50.48  ? 214 LYS A CD  1 
ATOM   1466 C CE  . LYS A 1 214 ? 42.308 64.061  54.595 1.00 51.36  ? 214 LYS A CE  1 
ATOM   1467 N NZ  . LYS A 1 214 ? 41.418 63.648  53.478 1.00 51.13  ? 214 LYS A NZ  1 
ATOM   1468 N N   . TYR A 1 215 ? 46.556 67.292  55.999 1.00 50.29  ? 215 TYR A N   1 
ATOM   1469 C CA  . TYR A 1 215 ? 47.501 68.165  55.295 1.00 52.97  ? 215 TYR A CA  1 
ATOM   1470 C C   . TYR A 1 215 ? 48.162 67.462  54.118 1.00 55.79  ? 215 TYR A C   1 
ATOM   1471 O O   . TYR A 1 215 ? 48.281 66.238  54.107 1.00 60.43  ? 215 TYR A O   1 
ATOM   1472 C CB  . TYR A 1 215 ? 48.612 68.618  56.246 1.00 59.91  ? 215 TYR A CB  1 
ATOM   1473 C CG  . TYR A 1 215 ? 48.154 69.532  57.348 1.00 59.91  ? 215 TYR A CG  1 
ATOM   1474 C CD1 . TYR A 1 215 ? 47.888 69.041  58.620 1.00 52.31  ? 215 TYR A CD1 1 
ATOM   1475 C CD2 . TYR A 1 215 ? 47.956 70.887  57.104 1.00 59.43  ? 215 TYR A CD2 1 
ATOM   1476 C CE1 . TYR A 1 215 ? 47.432 69.878  59.617 1.00 66.15  ? 215 TYR A CE1 1 
ATOM   1477 C CE2 . TYR A 1 215 ? 47.501 71.732  58.091 1.00 64.66  ? 215 TYR A CE2 1 
ATOM   1478 C CZ  . TYR A 1 215 ? 47.239 71.228  59.344 1.00 66.40  ? 215 TYR A CZ  1 
ATOM   1479 O OH  . TYR A 1 215 ? 46.782 72.079  60.323 1.00 71.68  ? 215 TYR A OH  1 
ATOM   1480 N N   . ASP A 1 216 ? 48.635 68.245  53.153 1.00 54.15  ? 216 ASP A N   1 
ATOM   1481 C CA  . ASP A 1 216 ? 49.326 67.707  51.987 1.00 55.20  ? 216 ASP A CA  1 
ATOM   1482 C C   . ASP A 1 216 ? 50.612 68.520  51.762 1.00 61.86  ? 216 ASP A C   1 
ATOM   1483 O O   . ASP A 1 216 ? 50.765 69.193  50.749 1.00 76.32  ? 216 ASP A O   1 
ATOM   1484 C CB  . ASP A 1 216 ? 48.419 67.785  50.767 1.00 49.63  ? 216 ASP A CB  1 
ATOM   1485 C CG  . ASP A 1 216 ? 48.960 66.989  49.591 1.00 57.83  ? 216 ASP A CG  1 
ATOM   1486 O OD1 . ASP A 1 216 ? 49.950 67.418  48.968 1.00 51.56  ? 216 ASP A OD1 1 
ATOM   1487 O OD2 . ASP A 1 216 ? 48.393 65.922  49.285 1.00 66.51  ? 216 ASP A OD2 1 
ATOM   1488 N N   . LEU A 1 217 ? 51.543 68.437  52.706 1.00 61.08  ? 217 LEU A N   1 
ATOM   1489 C CA  . LEU A 1 217 ? 52.794 69.190  52.642 1.00 62.04  ? 217 LEU A CA  1 
ATOM   1490 C C   . LEU A 1 217 ? 53.744 68.785  51.512 1.00 67.28  ? 217 LEU A C   1 
ATOM   1491 O O   . LEU A 1 217 ? 54.430 67.768  51.588 1.00 74.02  ? 217 LEU A O   1 
ATOM   1492 C CB  . LEU A 1 217 ? 53.501 69.111  53.996 1.00 58.67  ? 217 LEU A CB  1 
ATOM   1493 C CG  . LEU A 1 217 ? 52.583 69.510  55.149 1.00 59.10  ? 217 LEU A CG  1 
ATOM   1494 C CD1 . LEU A 1 217 ? 53.151 69.042  56.457 1.00 58.07  ? 217 LEU A CD1 1 
ATOM   1495 C CD2 . LEU A 1 217 ? 52.367 71.007  55.141 1.00 55.45  ? 217 LEU A CD2 1 
ATOM   1496 N N   . LYS A 1 218 ? 53.790 69.618  50.477 1.00 71.53  ? 218 LYS A N   1 
ATOM   1497 C CA  . LYS A 1 218 ? 54.634 69.397  49.301 1.00 73.80  ? 218 LYS A CA  1 
ATOM   1498 C C   . LYS A 1 218 ? 56.058 69.881  49.556 1.00 75.53  ? 218 LYS A C   1 
ATOM   1499 O O   . LYS A 1 218 ? 57.017 69.379  48.967 1.00 76.36  ? 218 LYS A O   1 
ATOM   1500 C CB  . LYS A 1 218 ? 54.048 70.151  48.104 1.00 75.19  ? 218 LYS A CB  1 
ATOM   1501 C CG  . LYS A 1 218 ? 52.529 70.076  48.024 1.00 75.26  ? 218 LYS A CG  1 
ATOM   1502 C CD  . LYS A 1 218 ? 51.933 71.417  47.626 1.00 73.34  ? 218 LYS A CD  1 
ATOM   1503 C CE  . LYS A 1 218 ? 50.443 71.474  47.915 1.00 72.89  ? 218 LYS A CE  1 
ATOM   1504 N NZ  . LYS A 1 218 ? 49.667 70.448  47.163 1.00 70.90  ? 218 LYS A NZ  1 
ATOM   1505 N N   . GLY A 1 219 ? 56.182 70.880  50.421 1.00 76.74  ? 219 GLY A N   1 
ATOM   1506 C CA  . GLY A 1 219 ? 57.485 71.426  50.748 1.00 81.10  ? 219 GLY A CA  1 
ATOM   1507 C C   . GLY A 1 219 ? 58.024 72.413  49.733 1.00 82.75  ? 219 GLY A C   1 
ATOM   1508 O O   . GLY A 1 219 ? 59.022 73.085  49.995 1.00 91.42  ? 219 GLY A O   1 
ATOM   1509 N N   . SER A 1 220 ? 57.357 72.529  48.587 1.00 83.23  ? 220 SER A N   1 
ATOM   1510 C CA  . SER A 1 220 ? 57.796 73.435  47.531 1.00 83.25  ? 220 SER A CA  1 
ATOM   1511 C C   . SER A 1 220 ? 57.778 74.901  47.941 1.00 88.29  ? 220 SER A C   1 
ATOM   1512 O O   . SER A 1 220 ? 56.971 75.316  48.775 1.00 90.30  ? 220 SER A O   1 
ATOM   1513 C CB  . SER A 1 220 ? 56.945 73.254  46.275 1.00 80.93  ? 220 SER A CB  1 
ATOM   1514 O OG  . SER A 1 220 ? 55.632 73.749  46.470 1.00 76.24  ? 220 SER A OG  1 
ATOM   1515 N N   . THR A 1 221 ? 58.707 75.667  47.370 1.00 90.55  ? 221 THR A N   1 
ATOM   1516 C CA  . THR A 1 221 ? 58.813 77.103  47.637 1.00 89.90  ? 221 THR A CA  1 
ATOM   1517 C C   . THR A 1 221 ? 57.524 77.790  47.202 1.00 88.97  ? 221 THR A C   1 
ATOM   1518 O O   . THR A 1 221 ? 57.099 77.676  46.050 1.00 92.31  ? 221 THR A O   1 
ATOM   1519 C CB  . THR A 1 221 ? 60.015 77.734  46.891 1.00 91.10  ? 221 THR A CB  1 
ATOM   1520 O OG1 . THR A 1 221 ? 59.951 77.392  45.501 1.00 91.86  ? 221 THR A OG1 1 
ATOM   1521 C CG2 . THR A 1 221 ? 61.337 77.230  47.466 1.00 85.12  ? 221 THR A CG2 1 
ATOM   1522 N N   . VAL A 1 222 ? 56.924 78.497  48.152 1.00 87.75  ? 222 VAL A N   1 
ATOM   1523 C CA  . VAL A 1 222 ? 55.661 79.218  47.990 1.00 90.19  ? 222 VAL A CA  1 
ATOM   1524 C C   . VAL A 1 222 ? 55.088 79.378  46.571 1.00 89.52  ? 222 VAL A C   1 
ATOM   1525 O O   . VAL A 1 222 ? 55.704 79.983  45.683 1.00 90.49  ? 222 VAL A O   1 
ATOM   1526 C CB  . VAL A 1 222 ? 55.738 80.605  48.697 1.00 91.49  ? 222 VAL A CB  1 
ATOM   1527 C CG1 . VAL A 1 222 ? 54.378 81.306  48.701 1.00 90.61  ? 222 VAL A CG1 1 
ATOM   1528 C CG2 . VAL A 1 222 ? 56.230 80.423  50.130 1.00 90.32  ? 222 VAL A CG2 1 
ATOM   1529 N N   . ALA A 1 223 ? 53.878 78.856  46.397 1.00 88.45  ? 223 ALA A N   1 
ATOM   1530 C CA  . ALA A 1 223 ? 53.152 78.914  45.132 1.00 90.29  ? 223 ALA A CA  1 
ATOM   1531 C C   . ALA A 1 223 ? 51.705 78.579  45.498 1.00 91.65  ? 223 ALA A C   1 
ATOM   1532 O O   . ALA A 1 223 ? 51.087 79.304  46.287 1.00 89.88  ? 223 ALA A O   1 
ATOM   1533 C CB  . ALA A 1 223 ? 53.727 77.907  44.129 1.00 89.02  ? 223 ALA A CB  1 
ATOM   1534 N N   . ARG A 1 224 ? 51.139 77.523  44.917 1.00 90.75  ? 224 ARG A N   1 
ATOM   1535 C CA  . ARG A 1 224 ? 49.786 77.141  45.290 1.00 90.57  ? 224 ARG A CA  1 
ATOM   1536 C C   . ARG A 1 224 ? 49.962 76.382  46.607 1.00 86.77  ? 224 ARG A C   1 
ATOM   1537 O O   . ARG A 1 224 ? 49.651 75.197  46.715 1.00 89.65  ? 224 ARG A O   1 
ATOM   1538 C CB  . ARG A 1 224 ? 49.128 76.242  44.233 1.00 92.53  ? 224 ARG A CB  1 
ATOM   1539 C CG  . ARG A 1 224 ? 47.643 76.001  44.533 1.00 87.11  ? 224 ARG A CG  1 
ATOM   1540 C CD  . ARG A 1 224 ? 47.015 74.867  43.732 1.00 84.04  ? 224 ARG A CD  1 
ATOM   1541 N NE  . ARG A 1 224 ? 45.638 74.626  44.169 1.00 79.10  ? 224 ARG A NE  1 
ATOM   1542 C CZ  . ARG A 1 224 ? 45.062 73.428  44.244 1.00 80.37  ? 224 ARG A CZ  1 
ATOM   1543 N NH1 . ARG A 1 224 ? 45.733 72.335  43.903 1.00 76.08  ? 224 ARG A NH1 1 
ATOM   1544 N NH2 . ARG A 1 224 ? 43.820 73.317  44.697 1.00 77.06  ? 224 ARG A NH2 1 
ATOM   1545 N N   . GLU A 1 225 ? 50.505 77.074  47.600 1.00 81.87  ? 225 GLU A N   1 
ATOM   1546 C CA  . GLU A 1 225 ? 50.747 76.476  48.893 1.00 82.91  ? 225 GLU A CA  1 
ATOM   1547 C C   . GLU A 1 225 ? 49.561 76.664  49.836 1.00 82.59  ? 225 GLU A C   1 
ATOM   1548 O O   . GLU A 1 225 ? 49.732 76.830  51.044 1.00 84.29  ? 225 GLU A O   1 
ATOM   1549 C CB  . GLU A 1 225 ? 52.025 77.058  49.493 1.00 82.18  ? 225 GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 225 ? 53.274 76.837  48.649 1.00 81.77  ? 225 GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 225 ? 53.537 75.382  48.313 1.00 79.43  ? 225 GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 225 ? 52.950 74.871  47.335 1.00 78.81  ? 225 GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 225 ? 54.354 74.753  49.012 1.00 76.60  ? 225 GLU A OE2 1 
ATOM   1554 N N   . ALA A 1 226 ? 48.355 76.613  49.277 1.00 80.79  ? 226 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 226 ? 47.131 76.772  50.058 1.00 77.17  ? 226 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 226 ? 45.985 76.087  49.338 1.00 74.04  ? 226 ALA A C   1 
ATOM   1557 O O   . ALA A 1 226 ? 46.078 75.806  48.142 1.00 76.00  ? 226 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 226 ? 46.818 78.252  50.267 1.00 79.08  ? 226 ALA A CB  1 
ATOM   1559 N N   . SER A 1 227 ? 44.910 75.808  50.067 1.00 76.37  ? 227 SER A N   1 
ATOM   1560 C CA  . SER A 1 227 ? 43.759 75.150  49.465 1.00 80.49  ? 227 SER A CA  1 
ATOM   1561 C C   . SER A 1 227 ? 42.580 76.079  49.178 1.00 81.74  ? 227 SER A C   1 
ATOM   1562 O O   . SER A 1 227 ? 42.149 76.856  50.033 1.00 80.77  ? 227 SER A O   1 
ATOM   1563 C CB  . SER A 1 227 ? 43.320 73.951  50.304 1.00 87.97  ? 227 SER A CB  1 
ATOM   1564 O OG  . SER A 1 227 ? 43.406 72.754  49.540 1.00 87.10  ? 227 SER A OG  1 
ATOM   1565 N N   . ASP A 1 228 ? 42.061 75.965  47.958 1.00 81.91  ? 228 ASP A N   1 
ATOM   1566 C CA  . ASP A 1 228 ? 40.949 76.776  47.482 1.00 83.52  ? 228 ASP A CA  1 
ATOM   1567 C C   . ASP A 1 228 ? 39.606 76.417  48.102 1.00 83.80  ? 228 ASP A C   1 
ATOM   1568 O O   . ASP A 1 228 ? 39.321 76.812  49.234 1.00 82.52  ? 228 ASP A O   1 
ATOM   1569 C CB  . ASP A 1 228 ? 40.856 76.680  45.958 1.00 85.76  ? 228 ASP A CB  1 
ATOM   1570 C CG  . ASP A 1 228 ? 42.114 77.165  45.264 1.00 87.35  ? 228 ASP A CG  1 
ATOM   1571 O OD1 . ASP A 1 228 ? 42.228 78.386  45.025 1.00 88.90  ? 228 ASP A OD1 1 
ATOM   1572 O OD2 . ASP A 1 228 ? 42.986 76.326  44.955 1.00 86.93  ? 228 ASP A OD2 1 
ATOM   1573 N N   . LYS A 1 229 ? 38.785 75.683  47.348 1.00 87.46  ? 229 LYS A N   1 
ATOM   1574 C CA  . LYS A 1 229 ? 37.456 75.263  47.799 1.00 89.82  ? 229 LYS A CA  1 
ATOM   1575 C C   . LYS A 1 229 ? 37.530 74.037  48.719 1.00 91.07  ? 229 LYS A C   1 
ATOM   1576 O O   . LYS A 1 229 ? 36.515 73.376  48.965 1.00 90.85  ? 229 LYS A O   1 
ATOM   1577 C CB  . LYS A 1 229 ? 36.559 74.912  46.608 1.00 88.12  ? 229 LYS A CB  1 
ATOM   1578 C CG  . LYS A 1 229 ? 36.617 75.851  45.418 1.00 89.54  ? 229 LYS A CG  1 
ATOM   1579 C CD  . LYS A 1 229 ? 35.782 75.283  44.275 1.00 87.47  ? 229 LYS A CD  1 
ATOM   1580 C CE  . LYS A 1 229 ? 36.242 73.874  43.907 1.00 86.80  ? 229 LYS A CE  1 
ATOM   1581 N NZ  . LYS A 1 229 ? 35.306 73.180  42.980 1.00 86.17  ? 229 LYS A NZ  1 
ATOM   1582 N N   . GLU A 1 230 ? 38.736 73.695  49.169 1.00 89.12  ? 230 GLU A N   1 
ATOM   1583 C CA  . GLU A 1 230 ? 38.909 72.563  50.066 1.00 83.04  ? 230 GLU A CA  1 
ATOM   1584 C C   . GLU A 1 230 ? 38.409 72.941  51.451 1.00 80.87  ? 230 GLU A C   1 
ATOM   1585 O O   . GLU A 1 230 ? 37.768 72.130  52.119 1.00 80.54  ? 230 GLU A O   1 
ATOM   1586 C CB  . GLU A 1 230 ? 40.373 72.132  50.128 1.00 89.50  ? 230 GLU A CB  1 
ATOM   1587 C CG  . GLU A 1 230 ? 40.811 71.258  48.966 1.00 90.23  ? 230 GLU A CG  1 
ATOM   1588 C CD  . GLU A 1 230 ? 40.091 69.928  48.949 1.00 91.51  ? 230 GLU A CD  1 
ATOM   1589 O OE1 . GLU A 1 230 ? 40.494 69.027  49.719 1.00 88.41  ? 230 GLU A OE1 1 
ATOM   1590 O OE2 . GLU A 1 230 ? 39.117 69.789  48.174 1.00 93.10  ? 230 GLU A OE2 1 
ATOM   1591 N N   . LYS A 1 231 ? 38.640 74.196  51.842 1.00 73.39  ? 231 LYS A N   1 
ATOM   1592 C CA  . LYS A 1 231 ? 38.203 74.693  53.142 1.00 75.43  ? 231 LYS A CA  1 
ATOM   1593 C C   . LYS A 1 231 ? 36.697 74.530  53.322 1.00 77.67  ? 231 LYS A C   1 
ATOM   1594 O O   . LYS A 1 231 ? 36.175 74.787  54.405 1.00 78.00  ? 231 LYS A O   1 
ATOM   1595 C CB  . LYS A 1 231 ? 38.533 76.172  53.296 1.00 75.59  ? 231 LYS A CB  1 
ATOM   1596 C CG  . LYS A 1 231 ? 39.989 76.555  53.165 1.00 80.81  ? 231 LYS A CG  1 
ATOM   1597 C CD  . LYS A 1 231 ? 40.106 78.071  53.359 1.00 89.30  ? 231 LYS A CD  1 
ATOM   1598 C CE  . LYS A 1 231 ? 41.482 78.633  52.999 1.00 91.04  ? 231 LYS A CE  1 
ATOM   1599 N NZ  . LYS A 1 231 ? 41.483 80.137  53.015 1.00 89.38  ? 231 LYS A NZ  1 
ATOM   1600 N N   . ALA A 1 232 ? 36.018 74.139  52.242 1.00 83.53  ? 232 ALA A N   1 
ATOM   1601 C CA  . ALA A 1 232 ? 34.565 73.923  52.181 1.00 86.85  ? 232 ALA A CA  1 
ATOM   1602 C C   . ALA A 1 232 ? 33.855 73.562  53.483 1.00 88.25  ? 232 ALA A C   1 
ATOM   1603 O O   . ALA A 1 232 ? 33.332 74.436  54.184 1.00 88.36  ? 232 ALA A O   1 
ATOM   1604 C CB  . ALA A 1 232 ? 34.244 72.877  51.112 1.00 88.43  ? 232 ALA A CB  1 
ATOM   1605 N N   . LYS A 1 233 ? 33.809 72.270  53.788 1.00 88.41  ? 233 LYS A N   1 
ATOM   1606 C CA  . LYS A 1 233 ? 33.150 71.822  54.998 1.00 88.37  ? 233 LYS A CA  1 
ATOM   1607 C C   . LYS A 1 233 ? 33.545 70.389  55.342 1.00 87.99  ? 233 LYS A C   1 
ATOM   1608 O O   . LYS A 1 233 ? 33.603 70.028  56.518 1.00 90.45  ? 233 LYS A O   1 
ATOM   1609 C CB  . LYS A 1 233 ? 31.629 71.949  54.854 1.00 88.30  ? 233 LYS A CB  1 
ATOM   1610 C CG  . LYS A 1 233 ? 30.876 71.917  56.177 1.00 86.63  ? 233 LYS A CG  1 
ATOM   1611 C CD  . LYS A 1 233 ? 29.374 71.821  55.960 1.00 86.13  ? 233 LYS A CD  1 
ATOM   1612 C CE  . LYS A 1 233 ? 28.614 71.829  57.281 1.00 85.94  ? 233 LYS A CE  1 
ATOM   1613 N NZ  . LYS A 1 233 ? 27.162 71.578  57.076 1.00 75.45  ? 233 LYS A NZ  1 
ATOM   1614 N N   . ASP A 1 234 ? 33.834 69.577  54.327 1.00 81.89  ? 234 ASP A N   1 
ATOM   1615 C CA  . ASP A 1 234 ? 34.233 68.190  54.572 1.00 83.97  ? 234 ASP A CA  1 
ATOM   1616 C C   . ASP A 1 234 ? 35.592 68.201  55.290 1.00 81.12  ? 234 ASP A C   1 
ATOM   1617 O O   . ASP A 1 234 ? 35.876 69.106  56.071 1.00 81.91  ? 234 ASP A O   1 
ATOM   1618 C CB  . ASP A 1 234 ? 34.324 67.417  53.240 1.00 88.93  ? 234 ASP A CB  1 
ATOM   1619 C CG  . ASP A 1 234 ? 33.029 66.674  52.886 1.00 90.19  ? 234 ASP A CG  1 
ATOM   1620 O OD1 . ASP A 1 234 ? 32.283 67.129  51.985 1.00 83.11  ? 234 ASP A OD1 1 
ATOM   1621 O OD2 . ASP A 1 234 ? 32.774 65.615  53.499 1.00 88.19  ? 234 ASP A OD2 1 
ATOM   1622 N N   . LEU A 1 235 ? 36.396 67.162  55.092 1.00 80.33  ? 235 LEU A N   1 
ATOM   1623 C CA  . LEU A 1 235 ? 37.729 67.111  55.687 1.00 72.46  ? 235 LEU A CA  1 
ATOM   1624 C C   . LEU A 1 235 ? 38.667 67.714  54.634 1.00 72.34  ? 235 LEU A C   1 
ATOM   1625 O O   . LEU A 1 235 ? 39.000 67.064  53.635 1.00 73.82  ? 235 LEU A O   1 
ATOM   1626 C CB  . LEU A 1 235 ? 38.132 65.667  55.992 1.00 69.88  ? 235 LEU A CB  1 
ATOM   1627 C CG  . LEU A 1 235 ? 39.330 65.524  56.930 1.00 57.62  ? 235 LEU A CG  1 
ATOM   1628 C CD1 . LEU A 1 235 ? 38.905 65.922  58.319 1.00 59.16  ? 235 LEU A CD1 1 
ATOM   1629 C CD2 . LEU A 1 235 ? 39.854 64.104  56.942 1.00 58.18  ? 235 LEU A CD2 1 
ATOM   1630 N N   . PRO A 1 236 ? 39.073 68.978  54.831 1.00 66.39  ? 236 PRO A N   1 
ATOM   1631 C CA  . PRO A 1 236 ? 39.956 69.738  53.945 1.00 66.92  ? 236 PRO A CA  1 
ATOM   1632 C C   . PRO A 1 236 ? 41.373 69.208  53.892 1.00 70.61  ? 236 PRO A C   1 
ATOM   1633 O O   . PRO A 1 236 ? 41.946 68.845  54.926 1.00 73.59  ? 236 PRO A O   1 
ATOM   1634 C CB  . PRO A 1 236 ? 39.943 71.132  54.566 1.00 64.67  ? 236 PRO A CB  1 
ATOM   1635 C CG  . PRO A 1 236 ? 38.692 71.156  55.369 1.00 69.84  ? 236 PRO A CG  1 
ATOM   1636 C CD  . PRO A 1 236 ? 38.688 69.803  55.979 1.00 65.93  ? 236 PRO A CD  1 
ATOM   1637 N N   . THR A 1 237 ? 41.940 69.215  52.687 1.00 65.05  ? 237 THR A N   1 
ATOM   1638 C CA  . THR A 1 237 ? 43.303 68.751  52.457 1.00 68.33  ? 237 THR A CA  1 
ATOM   1639 C C   . THR A 1 237 ? 44.214 69.964  52.475 1.00 65.48  ? 237 THR A C   1 
ATOM   1640 O O   . THR A 1 237 ? 44.746 70.373  51.441 1.00 68.48  ? 237 THR A O   1 
ATOM   1641 C CB  . THR A 1 237 ? 43.427 68.047  51.097 1.00 73.51  ? 237 THR A CB  1 
ATOM   1642 O OG1 . THR A 1 237 ? 42.262 67.246  50.867 1.00 79.19  ? 237 THR A OG1 1 
ATOM   1643 C CG2 . THR A 1 237 ? 44.655 67.147  51.080 1.00 78.22  ? 237 THR A CG2 1 
ATOM   1644 N N   . PHE A 1 238 ? 44.376 70.528  53.669 1.00 61.97  ? 238 PHE A N   1 
ATOM   1645 C CA  . PHE A 1 238 ? 45.189 71.719  53.881 1.00 64.50  ? 238 PHE A CA  1 
ATOM   1646 C C   . PHE A 1 238 ? 46.568 71.603  53.269 1.00 60.04  ? 238 PHE A C   1 
ATOM   1647 O O   . PHE A 1 238 ? 47.093 70.499  53.109 1.00 62.78  ? 238 PHE A O   1 
ATOM   1648 C CB  . PHE A 1 238 ? 45.253 72.057  55.368 1.00 64.50  ? 238 PHE A CB  1 
ATOM   1649 C CG  . PHE A 1 238 ? 43.907 72.348  55.972 1.00 66.61  ? 238 PHE A CG  1 
ATOM   1650 C CD1 . PHE A 1 238 ? 43.479 71.679  57.106 1.00 66.20  ? 238 PHE A CD1 1 
ATOM   1651 C CD2 . PHE A 1 238 ? 43.060 73.283  55.392 1.00 68.84  ? 238 PHE A CD2 1 
ATOM   1652 C CE1 . PHE A 1 238 ? 42.234 71.935  57.652 1.00 64.52  ? 238 PHE A CE1 1 
ATOM   1653 C CE2 . PHE A 1 238 ? 41.814 73.544  55.933 1.00 69.00  ? 238 PHE A CE2 1 
ATOM   1654 C CZ  . PHE A 1 238 ? 41.403 72.868  57.066 1.00 67.43  ? 238 PHE A CZ  1 
ATOM   1655 N N   . LYS A 1 239 ? 47.129 72.747  52.887 1.00 54.24  ? 239 LYS A N   1 
ATOM   1656 C CA  . LYS A 1 239 ? 48.422 72.761  52.227 1.00 54.00  ? 239 LYS A CA  1 
ATOM   1657 C C   . LYS A 1 239 ? 49.515 73.493  52.981 1.00 54.68  ? 239 LYS A C   1 
ATOM   1658 O O   . LYS A 1 239 ? 49.267 74.061  54.041 1.00 51.71  ? 239 LYS A O   1 
ATOM   1659 C CB  . LYS A 1 239 ? 48.268 73.322  50.814 1.00 56.26  ? 239 LYS A CB  1 
ATOM   1660 C CG  . LYS A 1 239 ? 47.086 72.717  50.077 1.00 63.50  ? 239 LYS A CG  1 
ATOM   1661 C CD  . LYS A 1 239 ? 47.300 72.610  48.585 1.00 64.10  ? 239 LYS A CD  1 
ATOM   1662 C CE  . LYS A 1 239 ? 46.247 71.691  47.983 1.00 70.70  ? 239 LYS A CE  1 
ATOM   1663 N NZ  . LYS A 1 239 ? 46.538 71.340  46.571 1.00 78.63  ? 239 LYS A NZ  1 
ATOM   1664 N N   . ASP A 1 240 ? 50.724 73.456  52.422 1.00 57.17  ? 240 ASP A N   1 
ATOM   1665 C CA  . ASP A 1 240 ? 51.899 74.081  53.019 1.00 60.18  ? 240 ASP A CA  1 
ATOM   1666 C C   . ASP A 1 240 ? 51.643 75.335  53.821 1.00 63.78  ? 240 ASP A C   1 
ATOM   1667 O O   . ASP A 1 240 ? 51.816 75.340  55.034 1.00 69.34  ? 240 ASP A O   1 
ATOM   1668 C CB  . ASP A 1 240 ? 52.941 74.414  51.958 1.00 65.33  ? 240 ASP A CB  1 
ATOM   1669 C CG  . ASP A 1 240 ? 53.713 73.209  51.499 1.00 64.28  ? 240 ASP A CG  1 
ATOM   1670 O OD1 . ASP A 1 240 ? 53.197 72.451  50.656 1.00 71.47  ? 240 ASP A OD1 1 
ATOM   1671 O OD2 . ASP A 1 240 ? 54.854 73.035  51.957 1.00 68.74  ? 240 ASP A OD2 1 
ATOM   1672 N N   . ASN A 1 241 ? 51.260 76.404  53.130 1.00 67.43  ? 241 ASN A N   1 
ATOM   1673 C CA  . ASN A 1 241 ? 51.014 77.682  53.778 1.00 71.73  ? 241 ASN A CA  1 
ATOM   1674 C C   . ASN A 1 241 ? 49.870 77.676  54.780 1.00 75.95  ? 241 ASN A C   1 
ATOM   1675 O O   . ASN A 1 241 ? 49.885 78.466  55.726 1.00 75.70  ? 241 ASN A O   1 
ATOM   1676 C CB  . ASN A 1 241 ? 50.863 78.804  52.746 1.00 75.17  ? 241 ASN A CB  1 
ATOM   1677 C CG  . ASN A 1 241 ? 52.193 79.185  52.089 1.00 75.77  ? 241 ASN A CG  1 
ATOM   1678 O OD1 . ASN A 1 241 ? 53.269 78.800  52.550 1.00 79.12  ? 241 ASN A OD1 1 
ATOM   1679 N ND2 . ASN A 1 241 ? 52.118 79.946  51.009 1.00 81.42  ? 241 ASN A ND2 1 
ATOM   1680 N N   . ASP A 1 242 ? 48.889 76.791  54.586 1.00 76.85  ? 242 ASP A N   1 
ATOM   1681 C CA  . ASP A 1 242 ? 47.773 76.677  55.532 1.00 78.25  ? 242 ASP A CA  1 
ATOM   1682 C C   . ASP A 1 242 ? 48.389 76.227  56.858 1.00 78.95  ? 242 ASP A C   1 
ATOM   1683 O O   . ASP A 1 242 ? 48.204 76.849  57.902 1.00 77.21  ? 242 ASP A O   1 
ATOM   1684 C CB  . ASP A 1 242 ? 46.751 75.627  55.067 1.00 80.87  ? 242 ASP A CB  1 
ATOM   1685 C CG  . ASP A 1 242 ? 45.898 76.097  53.892 1.00 84.81  ? 242 ASP A CG  1 
ATOM   1686 O OD1 . ASP A 1 242 ? 45.024 75.325  53.442 1.00 82.32  ? 242 ASP A OD1 1 
ATOM   1687 O OD2 . ASP A 1 242 ? 46.085 77.235  53.417 1.00 92.14  ? 242 ASP A OD2 1 
ATOM   1688 N N   . PHE A 1 243 ? 49.191 75.173  56.771 1.00 76.82  ? 243 PHE A N   1 
ATOM   1689 C CA  . PHE A 1 243 ? 49.887 74.588  57.908 1.00 72.87  ? 243 PHE A CA  1 
ATOM   1690 C C   . PHE A 1 243 ? 50.911 75.547  58.493 1.00 71.47  ? 243 PHE A C   1 
ATOM   1691 O O   . PHE A 1 243 ? 51.081 75.619  59.705 1.00 68.34  ? 243 PHE A O   1 
ATOM   1692 C CB  . PHE A 1 243 ? 50.585 73.310  57.437 1.00 72.47  ? 243 PHE A CB  1 
ATOM   1693 C CG  . PHE A 1 243 ? 51.527 72.710  58.435 1.00 58.28  ? 243 PHE A CG  1 
ATOM   1694 C CD1 . PHE A 1 243 ? 51.118 71.676  59.258 1.00 56.04  ? 243 PHE A CD1 1 
ATOM   1695 C CD2 . PHE A 1 243 ? 52.843 73.134  58.503 1.00 56.48  ? 243 PHE A CD2 1 
ATOM   1696 C CE1 . PHE A 1 243 ? 52.010 71.073  60.130 1.00 61.11  ? 243 PHE A CE1 1 
ATOM   1697 C CE2 . PHE A 1 243 ? 53.741 72.536  59.374 1.00 60.61  ? 243 PHE A CE2 1 
ATOM   1698 C CZ  . PHE A 1 243 ? 53.326 71.506  60.185 1.00 59.06  ? 243 PHE A CZ  1 
ATOM   1699 N N   . LEU A 1 244 ? 51.588 76.281  57.621 1.00 74.71  ? 244 LEU A N   1 
ATOM   1700 C CA  . LEU A 1 244 ? 52.623 77.217  58.042 1.00 78.83  ? 244 LEU A CA  1 
ATOM   1701 C C   . LEU A 1 244 ? 52.093 78.397  58.861 1.00 77.08  ? 244 LEU A C   1 
ATOM   1702 O O   . LEU A 1 244 ? 52.672 78.746  59.892 1.00 72.31  ? 244 LEU A O   1 
ATOM   1703 C CB  . LEU A 1 244 ? 53.421 77.702  56.823 1.00 81.22  ? 244 LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 244 ? 54.848 78.219  57.041 1.00 82.53  ? 244 LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 244 ? 55.665 77.253  57.902 1.00 82.65  ? 244 LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 244 ? 55.518 78.420  55.692 1.00 82.97  ? 244 LEU A CD2 1 
ATOM   1707 N N   . ASN A 1 245 ? 50.965 78.964  58.443 1.00 73.59  ? 245 ASN A N   1 
ATOM   1708 C CA  . ASN A 1 245 ? 50.395 80.102  59.152 1.00 73.16  ? 245 ASN A CA  1 
ATOM   1709 C C   . ASN A 1 245 ? 49.690 79.739  60.459 1.00 72.74  ? 245 ASN A C   1 
ATOM   1710 O O   . ASN A 1 245 ? 49.631 80.545  61.386 1.00 74.58  ? 245 ASN A O   1 
ATOM   1711 C CB  . ASN A 1 245 ? 49.454 80.903  58.235 1.00 75.40  ? 245 ASN A CB  1 
ATOM   1712 C CG  . ASN A 1 245 ? 48.109 80.224  58.008 1.00 75.97  ? 245 ASN A CG  1 
ATOM   1713 O OD1 . ASN A 1 245 ? 47.748 79.274  58.694 1.00 81.71  ? 245 ASN A OD1 1 
ATOM   1714 N ND2 . ASN A 1 245 ? 47.349 80.737  57.048 1.00 81.06  ? 245 ASN A ND2 1 
ATOM   1715 N N   . GLU A 1 246 ? 49.165 78.520  60.527 1.00 69.37  ? 246 GLU A N   1 
ATOM   1716 C CA  . GLU A 1 246 ? 48.429 78.043  61.695 1.00 71.17  ? 246 GLU A CA  1 
ATOM   1717 C C   . GLU A 1 246 ? 49.261 77.783  62.951 1.00 72.49  ? 246 GLU A C   1 
ATOM   1718 O O   . GLU A 1 246 ? 48.735 77.268  63.941 1.00 72.20  ? 246 GLU A O   1 
ATOM   1719 C CB  . GLU A 1 246 ? 47.626 76.787  61.323 1.00 65.23  ? 246 GLU A CB  1 
ATOM   1720 C CG  . GLU A 1 246 ? 46.406 77.074  60.444 1.00 70.48  ? 246 GLU A CG  1 
ATOM   1721 C CD  . GLU A 1 246 ? 45.853 75.848  59.729 1.00 70.83  ? 246 GLU A CD  1 
ATOM   1722 O OE1 . GLU A 1 246 ? 45.960 74.730  60.272 1.00 69.62  ? 246 GLU A OE1 1 
ATOM   1723 O OE2 . GLU A 1 246 ? 45.304 76.012  58.617 1.00 65.41  ? 246 GLU A OE2 1 
ATOM   1724 N N   . GLY A 1 247 ? 50.544 78.151  62.916 1.00 78.94  ? 247 GLY A N   1 
ATOM   1725 C CA  . GLY A 1 247 ? 51.422 77.937  64.063 1.00 81.16  ? 247 GLY A CA  1 
ATOM   1726 C C   . GLY A 1 247 ? 51.410 76.478  64.478 1.00 81.34  ? 247 GLY A C   1 
ATOM   1727 O O   . GLY A 1 247 ? 51.552 76.140  65.655 1.00 75.76  ? 247 GLY A O   1 
ATOM   1728 N N   . GLN A 1 248 ? 51.321 75.614  63.472 1.00 78.97  ? 248 GLN A N   1 
ATOM   1729 C CA  . GLN A 1 248 ? 51.234 74.184  63.672 1.00 79.93  ? 248 GLN A CA  1 
ATOM   1730 C C   . GLN A 1 248 ? 52.121 73.483  64.682 1.00 82.52  ? 248 GLN A C   1 
ATOM   1731 O O   . GLN A 1 248 ? 53.346 73.443  64.583 1.00 81.75  ? 248 GLN A O   1 
ATOM   1732 C CB  . GLN A 1 248 ? 51.225 73.448  62.336 1.00 78.58  ? 248 GLN A CB  1 
ATOM   1733 C CG  . GLN A 1 248 ? 49.822 73.063  61.882 1.00 81.40  ? 248 GLN A CG  1 
ATOM   1734 C CD  . GLN A 1 248 ? 49.218 71.951  62.725 1.00 79.07  ? 248 GLN A CD  1 
ATOM   1735 O OE1 . GLN A 1 248 ? 49.926 71.068  63.210 1.00 79.07  ? 248 GLN A OE1 1 
ATOM   1736 N NE2 . GLN A 1 248 ? 47.903 71.986  62.895 1.00 81.29  ? 248 GLN A NE2 1 
ATOM   1737 N N   . LYS A 1 249 ? 51.428 72.969  65.686 1.00 88.21  ? 249 LYS A N   1 
ATOM   1738 C CA  . LYS A 1 249 ? 51.986 72.210  66.784 1.00 90.60  ? 249 LYS A CA  1 
ATOM   1739 C C   . LYS A 1 249 ? 52.107 70.780  66.245 1.00 88.56  ? 249 LYS A C   1 
ATOM   1740 O O   . LYS A 1 249 ? 51.141 70.235  65.699 1.00 93.72  ? 249 LYS A O   1 
ATOM   1741 C CB  . LYS A 1 249 ? 50.996 72.248  67.965 1.00 90.61  ? 249 LYS A CB  1 
ATOM   1742 C CG  . LYS A 1 249 ? 50.626 73.654  68.469 1.00 85.94  ? 249 LYS A CG  1 
ATOM   1743 C CD  . LYS A 1 249 ? 49.140 73.991  68.247 1.00 79.13  ? 249 LYS A CD  1 
ATOM   1744 C CE  . LYS A 1 249 ? 48.841 74.427  66.814 1.00 76.41  ? 249 LYS A CE  1 
ATOM   1745 N NZ  . LYS A 1 249 ? 47.405 74.768  66.563 1.00 63.02  ? 249 LYS A NZ  1 
ATOM   1746 N N   . LEU A 1 250 ? 53.299 70.203  66.340 1.00 78.95  ? 250 LEU A N   1 
ATOM   1747 C CA  . LEU A 1 250 ? 53.520 68.842  65.868 1.00 72.92  ? 250 LEU A CA  1 
ATOM   1748 C C   . LEU A 1 250 ? 54.618 68.256  66.742 1.00 70.67  ? 250 LEU A C   1 
ATOM   1749 O O   . LEU A 1 250 ? 55.760 68.091  66.318 1.00 71.00  ? 250 LEU A O   1 
ATOM   1750 C CB  . LEU A 1 250 ? 53.931 68.859  64.394 1.00 69.16  ? 250 LEU A CB  1 
ATOM   1751 C CG  . LEU A 1 250 ? 53.242 67.891  63.423 1.00 65.27  ? 250 LEU A CG  1 
ATOM   1752 C CD1 . LEU A 1 250 ? 53.492 66.466  63.854 1.00 70.58  ? 250 LEU A CD1 1 
ATOM   1753 C CD2 . LEU A 1 250 ? 51.755 68.168  63.325 1.00 55.24  ? 250 LEU A CD2 1 
ATOM   1754 N N   . HIS A 1 251 ? 54.257 67.967  67.986 1.00 68.76  ? 251 HIS A N   1 
ATOM   1755 C CA  . HIS A 1 251 ? 55.194 67.435  68.964 1.00 69.61  ? 251 HIS A CA  1 
ATOM   1756 C C   . HIS A 1 251 ? 55.203 65.927  68.931 1.00 68.27  ? 251 HIS A C   1 
ATOM   1757 O O   . HIS A 1 251 ? 54.319 65.289  69.490 1.00 72.04  ? 251 HIS A O   1 
ATOM   1758 C CB  . HIS A 1 251 ? 54.804 67.912  70.360 1.00 73.01  ? 251 HIS A CB  1 
ATOM   1759 C CG  . HIS A 1 251 ? 54.010 69.179  70.359 1.00 74.30  ? 251 HIS A CG  1 
ATOM   1760 N ND1 . HIS A 1 251 ? 52.636 69.190  70.249 1.00 77.28  ? 251 HIS A ND1 1 
ATOM   1761 C CD2 . HIS A 1 251 ? 54.395 70.476  70.421 1.00 78.48  ? 251 HIS A CD2 1 
ATOM   1762 C CE1 . HIS A 1 251 ? 52.208 70.438  70.242 1.00 85.33  ? 251 HIS A CE1 1 
ATOM   1763 N NE2 . HIS A 1 251 ? 53.255 71.240  70.344 1.00 80.80  ? 251 HIS A NE2 1 
ATOM   1764 N N   . VAL A 1 252 ? 56.215 65.365  68.276 1.00 71.05  ? 252 VAL A N   1 
ATOM   1765 C CA  . VAL A 1 252 ? 56.362 63.917  68.148 1.00 70.29  ? 252 VAL A CA  1 
ATOM   1766 C C   . VAL A 1 252 ? 57.266 63.376  69.251 1.00 68.17  ? 252 VAL A C   1 
ATOM   1767 O O   . VAL A 1 252 ? 57.182 62.211  69.634 1.00 69.43  ? 252 VAL A O   1 
ATOM   1768 C CB  . VAL A 1 252 ? 56.935 63.562  66.749 1.00 73.86  ? 252 VAL A CB  1 
ATOM   1769 C CG1 . VAL A 1 252 ? 57.290 62.096  66.658 1.00 66.51  ? 252 VAL A CG1 1 
ATOM   1770 C CG2 . VAL A 1 252 ? 55.919 63.910  65.671 1.00 66.76  ? 252 VAL A CG2 1 
ATOM   1771 N N   . GLY A 1 253 ? 58.075 64.260  69.812 1.00 65.61  ? 253 GLY A N   1 
ATOM   1772 C CA  . GLY A 1 253 ? 58.998 63.871  70.855 1.00 70.61  ? 253 GLY A CA  1 
ATOM   1773 C C   . GLY A 1 253 ? 60.385 64.146  70.316 1.00 75.63  ? 253 GLY A C   1 
ATOM   1774 O O   . GLY A 1 253 ? 60.534 64.933  69.378 1.00 80.36  ? 253 GLY A O   1 
ATOM   1775 N N   . GLU A 1 254 ? 61.403 63.519  70.899 1.00 74.80  ? 254 GLU A N   1 
ATOM   1776 C CA  . GLU A 1 254 ? 62.765 63.716  70.427 1.00 68.22  ? 254 GLU A CA  1 
ATOM   1777 C C   . GLU A 1 254 ? 63.389 62.377  70.050 1.00 62.57  ? 254 GLU A C   1 
ATOM   1778 O O   . GLU A 1 254 ? 64.410 62.330  69.374 1.00 62.43  ? 254 GLU A O   1 
ATOM   1779 C CB  . GLU A 1 254 ? 63.607 64.433  71.477 1.00 71.70  ? 254 GLU A CB  1 
ATOM   1780 C CG  . GLU A 1 254 ? 64.858 65.081  70.904 1.00 84.27  ? 254 GLU A CG  1 
ATOM   1781 C CD  . GLU A 1 254 ? 65.673 65.840  71.940 1.00 86.27  ? 254 GLU A CD  1 
ATOM   1782 O OE1 . GLU A 1 254 ? 65.258 65.888  73.120 1.00 90.23  ? 254 GLU A OE1 1 
ATOM   1783 O OE2 . GLU A 1 254 ? 66.737 66.389  71.570 1.00 90.51  ? 254 GLU A OE2 1 
ATOM   1784 N N   . GLU A 1 255 ? 62.793 61.283  70.505 1.00 51.96  ? 255 GLU A N   1 
ATOM   1785 C CA  . GLU A 1 255 ? 63.310 59.966  70.171 1.00 47.51  ? 255 GLU A CA  1 
ATOM   1786 C C   . GLU A 1 255 ? 62.698 59.516  68.855 1.00 49.66  ? 255 GLU A C   1 
ATOM   1787 O O   . GLU A 1 255 ? 63.374 58.909  68.028 1.00 47.38  ? 255 GLU A O   1 
ATOM   1788 C CB  . GLU A 1 255 ? 62.996 58.966  71.284 1.00 49.73  ? 255 GLU A CB  1 
ATOM   1789 C CG  . GLU A 1 255 ? 63.108 57.495  70.881 1.00 54.53  ? 255 GLU A CG  1 
ATOM   1790 C CD  . GLU A 1 255 ? 64.447 57.131  70.269 1.00 57.22  ? 255 GLU A CD  1 
ATOM   1791 O OE1 . GLU A 1 255 ? 65.457 57.138  71.004 1.00 63.31  ? 255 GLU A OE1 1 
ATOM   1792 O OE2 . GLU A 1 255 ? 64.489 56.822  69.057 1.00 49.49  ? 255 GLU A OE2 1 
ATOM   1793 N N   . SER A 1 256 ? 61.416 59.828  68.667 1.00 52.03  ? 256 SER A N   1 
ATOM   1794 C CA  . SER A 1 256 ? 60.692 59.470  67.449 1.00 50.61  ? 256 SER A CA  1 
ATOM   1795 C C   . SER A 1 256 ? 61.000 60.428  66.298 1.00 46.06  ? 256 SER A C   1 
ATOM   1796 O O   . SER A 1 256 ? 61.002 60.030  65.139 1.00 50.54  ? 256 SER A O   1 
ATOM   1797 C CB  . SER A 1 256 ? 59.187 59.425  67.720 1.00 56.80  ? 256 SER A CB  1 
ATOM   1798 O OG  . SER A 1 256 ? 58.481 58.897  66.610 1.00 65.38  ? 256 SER A OG  1 
ATOM   1799 N N   . LYS A 1 257 ? 61.251 61.691  66.619 1.00 42.35  ? 257 LYS A N   1 
ATOM   1800 C CA  . LYS A 1 257 ? 61.588 62.690  65.608 1.00 40.16  ? 257 LYS A CA  1 
ATOM   1801 C C   . LYS A 1 257 ? 62.860 62.254  64.894 1.00 44.64  ? 257 LYS A C   1 
ATOM   1802 O O   . LYS A 1 257 ? 63.018 62.477  63.698 1.00 43.30  ? 257 LYS A O   1 
ATOM   1803 C CB  . LYS A 1 257 ? 61.807 64.054  66.267 1.00 33.18  ? 257 LYS A CB  1 
ATOM   1804 C CG  . LYS A 1 257 ? 62.391 65.118  65.375 1.00 26.95  ? 257 LYS A CG  1 
ATOM   1805 C CD  . LYS A 1 257 ? 62.625 66.390  66.168 1.00 38.73  ? 257 LYS A CD  1 
ATOM   1806 C CE  . LYS A 1 257 ? 63.299 67.477  65.334 1.00 44.98  ? 257 LYS A CE  1 
ATOM   1807 N NZ  . LYS A 1 257 ? 63.560 68.719  66.135 1.00 44.91  ? 257 LYS A NZ  1 
ATOM   1808 N N   . LYS A 1 258 ? 63.755 61.612  65.640 1.00 50.34  ? 258 LYS A N   1 
ATOM   1809 C CA  . LYS A 1 258 ? 65.025 61.141  65.104 1.00 51.83  ? 258 LYS A CA  1 
ATOM   1810 C C   . LYS A 1 258 ? 64.779 60.032  64.115 1.00 55.43  ? 258 LYS A C   1 
ATOM   1811 O O   . LYS A 1 258 ? 65.223 60.105  62.970 1.00 61.02  ? 258 LYS A O   1 
ATOM   1812 C CB  . LYS A 1 258 ? 65.920 60.609  66.221 1.00 53.80  ? 258 LYS A CB  1 
ATOM   1813 C CG  . LYS A 1 258 ? 67.300 60.175  65.756 1.00 58.56  ? 258 LYS A CG  1 
ATOM   1814 C CD  . LYS A 1 258 ? 68.059 59.445  66.848 1.00 59.46  ? 258 LYS A CD  1 
ATOM   1815 C CE  . LYS A 1 258 ? 69.451 59.053  66.381 1.00 59.12  ? 258 LYS A CE  1 
ATOM   1816 N NZ  . LYS A 1 258 ? 70.213 58.324  67.432 1.00 61.72  ? 258 LYS A NZ  1 
ATOM   1817 N N   . ASN A 1 259 ? 64.054 59.015  64.568 1.00 52.36  ? 259 ASN A N   1 
ATOM   1818 C CA  . ASN A 1 259 ? 63.738 57.852  63.747 1.00 56.07  ? 259 ASN A CA  1 
ATOM   1819 C C   . ASN A 1 259 ? 62.941 58.218  62.495 1.00 50.72  ? 259 ASN A C   1 
ATOM   1820 O O   . ASN A 1 259 ? 63.091 57.592  61.450 1.00 53.56  ? 259 ASN A O   1 
ATOM   1821 C CB  . ASN A 1 259 ? 62.990 56.812  64.583 1.00 59.89  ? 259 ASN A CB  1 
ATOM   1822 C CG  . ASN A 1 259 ? 63.680 56.528  65.921 1.00 75.90  ? 259 ASN A CG  1 
ATOM   1823 O OD1 . ASN A 1 259 ? 63.022 56.404  66.957 1.00 72.07  ? 259 ASN A OD1 1 
ATOM   1824 N ND2 . ASN A 1 259 ? 65.009 56.434  65.902 1.00 72.69  ? 259 ASN A ND2 1 
ATOM   1825 N N   . PHE A 1 260 ? 62.098 59.238  62.604 1.00 41.58  ? 260 PHE A N   1 
ATOM   1826 C CA  . PHE A 1 260 ? 61.300 59.681  61.473 1.00 34.15  ? 260 PHE A CA  1 
ATOM   1827 C C   . PHE A 1 260 ? 62.203 60.353  60.456 1.00 39.67  ? 260 PHE A C   1 
ATOM   1828 O O   . PHE A 1 260 ? 62.263 59.919  59.311 1.00 44.25  ? 260 PHE A O   1 
ATOM   1829 C CB  . PHE A 1 260 ? 60.208 60.644  61.940 1.00 23.98  ? 260 PHE A CB  1 
ATOM   1830 C CG  . PHE A 1 260 ? 59.577 61.442  60.836 1.00 14.43  ? 260 PHE A CG  1 
ATOM   1831 C CD1 . PHE A 1 260 ? 58.508 60.943  60.127 1.00 14.25  ? 260 PHE A CD1 1 
ATOM   1832 C CD2 . PHE A 1 260 ? 60.023 62.722  60.544 1.00 19.91  ? 260 PHE A CD2 1 
ATOM   1833 C CE1 . PHE A 1 260 ? 57.885 61.712  59.141 1.00 27.73  ? 260 PHE A CE1 1 
ATOM   1834 C CE2 . PHE A 1 260 ? 59.407 63.499  59.562 1.00 21.98  ? 260 PHE A CE2 1 
ATOM   1835 C CZ  . PHE A 1 260 ? 58.337 62.994  58.862 1.00 20.98  ? 260 PHE A CZ  1 
ATOM   1836 N N   . LEU A 1 261 ? 62.929 61.388  60.887 1.00 41.20  ? 261 LEU A N   1 
ATOM   1837 C CA  . LEU A 1 261 ? 63.837 62.137  60.009 1.00 36.59  ? 261 LEU A CA  1 
ATOM   1838 C C   . LEU A 1 261 ? 64.930 61.294  59.359 1.00 37.18  ? 261 LEU A C   1 
ATOM   1839 O O   . LEU A 1 261 ? 65.418 61.640  58.282 1.00 40.78  ? 261 LEU A O   1 
ATOM   1840 C CB  . LEU A 1 261 ? 64.466 63.323  60.740 1.00 32.10  ? 261 LEU A CB  1 
ATOM   1841 C CG  . LEU A 1 261 ? 63.622 64.582  60.883 1.00 26.96  ? 261 LEU A CG  1 
ATOM   1842 C CD1 . LEU A 1 261 ? 64.364 65.611  61.689 1.00 14.05  ? 261 LEU A CD1 1 
ATOM   1843 C CD2 . LEU A 1 261 ? 63.305 65.127  59.513 1.00 30.84  ? 261 LEU A CD2 1 
ATOM   1844 N N   . GLU A 1 262 ? 65.338 60.214  60.019 1.00 30.56  ? 262 GLU A N   1 
ATOM   1845 C CA  . GLU A 1 262 ? 66.351 59.338  59.448 1.00 35.62  ? 262 GLU A CA  1 
ATOM   1846 C C   . GLU A 1 262 ? 65.706 58.498  58.366 1.00 36.52  ? 262 GLU A C   1 
ATOM   1847 O O   . GLU A 1 262 ? 66.344 58.120  57.381 1.00 50.72  ? 262 GLU A O   1 
ATOM   1848 C CB  . GLU A 1 262 ? 66.915 58.403  60.498 1.00 31.08  ? 262 GLU A CB  1 
ATOM   1849 C CG  . GLU A 1 262 ? 67.797 59.056  61.502 1.00 46.34  ? 262 GLU A CG  1 
ATOM   1850 C CD  . GLU A 1 262 ? 68.462 58.026  62.369 1.00 54.85  ? 262 GLU A CD  1 
ATOM   1851 O OE1 . GLU A 1 262 ? 69.376 57.353  61.861 1.00 59.84  ? 262 GLU A OE1 1 
ATOM   1852 O OE2 . GLU A 1 262 ? 68.057 57.862  63.538 1.00 57.46  ? 262 GLU A OE2 1 
ATOM   1853 N N   . LYS A 1 263 ? 64.453 58.147  58.625 1.00 33.14  ? 263 LYS A N   1 
ATOM   1854 C CA  . LYS A 1 263 ? 63.639 57.346  57.737 1.00 26.68  ? 263 LYS A CA  1 
ATOM   1855 C C   . LYS A 1 263 ? 63.260 58.198  56.528 1.00 28.57  ? 263 LYS A C   1 
ATOM   1856 O O   . LYS A 1 263 ? 63.230 57.715  55.405 1.00 32.14  ? 263 LYS A O   1 
ATOM   1857 C CB  . LYS A 1 263 ? 62.410 56.886  58.515 1.00 27.39  ? 263 LYS A CB  1 
ATOM   1858 C CG  . LYS A 1 263 ? 61.266 56.382  57.696 1.00 31.03  ? 263 LYS A CG  1 
ATOM   1859 C CD  . LYS A 1 263 ? 60.105 56.028  58.591 1.00 18.76  ? 263 LYS A CD  1 
ATOM   1860 C CE  . LYS A 1 263 ? 60.450 54.882  59.498 1.00 26.13  ? 263 LYS A CE  1 
ATOM   1861 N NZ  . LYS A 1 263 ? 59.261 54.543  60.327 1.00 38.82  ? 263 LYS A NZ  1 
ATOM   1862 N N   . LEU A 1 264 ? 63.009 59.478  56.767 1.00 23.33  ? 264 LEU A N   1 
ATOM   1863 C CA  . LEU A 1 264 ? 62.662 60.424  55.717 1.00 29.98  ? 264 LEU A CA  1 
ATOM   1864 C C   . LEU A 1 264 ? 63.873 60.703  54.818 1.00 40.73  ? 264 LEU A C   1 
ATOM   1865 O O   . LEU A 1 264 ? 63.741 60.773  53.594 1.00 46.58  ? 264 LEU A O   1 
ATOM   1866 C CB  . LEU A 1 264 ? 62.206 61.731  56.352 1.00 24.90  ? 264 LEU A CB  1 
ATOM   1867 C CG  . LEU A 1 264 ? 61.919 62.863  55.374 1.00 25.66  ? 264 LEU A CG  1 
ATOM   1868 C CD1 . LEU A 1 264 ? 60.691 62.509  54.587 1.00 40.59  ? 264 LEU A CD1 1 
ATOM   1869 C CD2 . LEU A 1 264 ? 61.709 64.166  56.106 1.00 24.59  ? 264 LEU A CD2 1 
ATOM   1870 N N   . LYS A 1 265 ? 65.046 60.871  55.438 1.00 49.41  ? 265 LYS A N   1 
ATOM   1871 C CA  . LYS A 1 265 ? 66.299 61.155  54.729 1.00 44.47  ? 265 LYS A CA  1 
ATOM   1872 C C   . LYS A 1 265 ? 66.595 60.146  53.635 1.00 43.07  ? 265 LYS A C   1 
ATOM   1873 O O   . LYS A 1 265 ? 66.939 60.534  52.529 1.00 45.87  ? 265 LYS A O   1 
ATOM   1874 C CB  . LYS A 1 265 ? 67.474 61.174  55.702 1.00 50.69  ? 265 LYS A CB  1 
ATOM   1875 C CG  . LYS A 1 265 ? 68.814 61.371  55.040 1.00 61.98  ? 265 LYS A CG  1 
ATOM   1876 C CD  . LYS A 1 265 ? 69.953 61.083  55.998 1.00 74.06  ? 265 LYS A CD  1 
ATOM   1877 C CE  . LYS A 1 265 ? 71.311 61.274  55.320 1.00 88.81  ? 265 LYS A CE  1 
ATOM   1878 N NZ  . LYS A 1 265 ? 72.477 60.997  56.231 1.00 89.12  ? 265 LYS A NZ  1 
ATOM   1879 N N   . ARG A 1 266 ? 66.454 58.858  53.942 1.00 40.49  ? 266 ARG A N   1 
ATOM   1880 C CA  . ARG A 1 266 ? 66.724 57.802  52.969 1.00 46.33  ? 266 ARG A CA  1 
ATOM   1881 C C   . ARG A 1 266 ? 65.622 57.565  51.931 1.00 47.41  ? 266 ARG A C   1 
ATOM   1882 O O   . ARG A 1 266 ? 65.873 56.970  50.883 1.00 58.61  ? 266 ARG A O   1 
ATOM   1883 C CB  . ARG A 1 266 ? 67.054 56.480  53.668 1.00 45.95  ? 266 ARG A CB  1 
ATOM   1884 C CG  . ARG A 1 266 ? 65.909 55.863  54.430 1.00 54.58  ? 266 ARG A CG  1 
ATOM   1885 C CD  . ARG A 1 266 ? 66.048 54.367  54.453 1.00 60.14  ? 266 ARG A CD  1 
ATOM   1886 N NE  . ARG A 1 266 ? 65.985 53.844  55.809 1.00 73.02  ? 266 ARG A NE  1 
ATOM   1887 C CZ  . ARG A 1 266 ? 66.579 52.720  56.191 1.00 87.26  ? 266 ARG A CZ  1 
ATOM   1888 N NH1 . ARG A 1 266 ? 67.274 52.010  55.308 1.00 92.37  ? 266 ARG A NH1 1 
ATOM   1889 N NH2 . ARG A 1 266 ? 66.503 52.317  57.456 1.00 90.18  ? 266 ARG A NH2 1 
ATOM   1890 N N   . ASP A 1 267 ? 64.400 57.989  52.228 1.00 42.21  ? 267 ASP A N   1 
ATOM   1891 C CA  . ASP A 1 267 ? 63.308 57.797  51.297 1.00 36.16  ? 267 ASP A CA  1 
ATOM   1892 C C   . ASP A 1 267 ? 63.415 58.828  50.213 1.00 31.22  ? 267 ASP A C   1 
ATOM   1893 O O   . ASP A 1 267 ? 63.535 58.496  49.039 1.00 35.77  ? 267 ASP A O   1 
ATOM   1894 C CB  . ASP A 1 267 ? 61.957 57.970  51.982 1.00 42.28  ? 267 ASP A CB  1 
ATOM   1895 C CG  . ASP A 1 267 ? 61.701 56.935  53.046 1.00 49.64  ? 267 ASP A CG  1 
ATOM   1896 O OD1 . ASP A 1 267 ? 62.289 55.828  52.997 1.00 47.83  ? 267 ASP A OD1 1 
ATOM   1897 O OD2 . ASP A 1 267 ? 60.892 57.243  53.944 1.00 58.63  ? 267 ASP A OD2 1 
ATOM   1898 N N   . VAL A 1 268 ? 63.353 60.089  50.616 1.00 27.99  ? 268 VAL A N   1 
ATOM   1899 C CA  . VAL A 1 268 ? 63.416 61.197  49.681 1.00 37.74  ? 268 VAL A CA  1 
ATOM   1900 C C   . VAL A 1 268 ? 64.703 61.110  48.857 1.00 50.58  ? 268 VAL A C   1 
ATOM   1901 O O   . VAL A 1 268 ? 64.773 61.595  47.729 1.00 53.61  ? 268 VAL A O   1 
ATOM   1902 C CB  . VAL A 1 268 ? 63.347 62.522  50.430 1.00 36.23  ? 268 VAL A CB  1 
ATOM   1903 C CG1 . VAL A 1 268 ? 63.164 63.644  49.473 1.00 40.13  ? 268 VAL A CG1 1 
ATOM   1904 C CG2 . VAL A 1 268 ? 62.207 62.505  51.404 1.00 38.21  ? 268 VAL A CG2 1 
ATOM   1905 N N   . GLU A 1 269 ? 65.704 60.443  49.421 1.00 58.47  ? 269 GLU A N   1 
ATOM   1906 C CA  . GLU A 1 269 ? 66.996 60.238  48.770 1.00 60.85  ? 269 GLU A CA  1 
ATOM   1907 C C   . GLU A 1 269 ? 66.849 59.127  47.717 1.00 58.41  ? 269 GLU A C   1 
ATOM   1908 O O   . GLU A 1 269 ? 67.461 59.184  46.650 1.00 58.72  ? 269 GLU A O   1 
ATOM   1909 C CB  . GLU A 1 269 ? 68.016 59.830  49.832 1.00 73.10  ? 269 GLU A CB  1 
ATOM   1910 C CG  . GLU A 1 269 ? 69.472 59.975  49.457 1.00 78.47  ? 269 GLU A CG  1 
ATOM   1911 C CD  . GLU A 1 269 ? 70.380 59.578  50.601 1.00 72.87  ? 269 GLU A CD  1 
ATOM   1912 O OE1 . GLU A 1 269 ? 70.760 58.387  50.660 1.00 72.95  ? 269 GLU A OE1 1 
ATOM   1913 O OE2 . GLU A 1 269 ? 70.692 60.451  51.444 1.00 62.72  ? 269 GLU A OE2 1 
ATOM   1914 N N   . PHE A 1 270 ? 66.067 58.101  48.052 1.00 55.42  ? 270 PHE A N   1 
ATOM   1915 C CA  . PHE A 1 270 ? 65.785 56.985  47.147 1.00 51.95  ? 270 PHE A CA  1 
ATOM   1916 C C   . PHE A 1 270 ? 64.988 57.527  45.974 1.00 49.83  ? 270 PHE A C   1 
ATOM   1917 O O   . PHE A 1 270 ? 65.314 57.261  44.825 1.00 52.39  ? 270 PHE A O   1 
ATOM   1918 C CB  . PHE A 1 270 ? 64.960 55.910  47.864 1.00 56.39  ? 270 PHE A CB  1 
ATOM   1919 C CG  . PHE A 1 270 ? 64.222 54.972  46.936 1.00 48.45  ? 270 PHE A CG  1 
ATOM   1920 C CD1 . PHE A 1 270 ? 64.824 53.802  46.476 1.00 50.99  ? 270 PHE A CD1 1 
ATOM   1921 C CD2 . PHE A 1 270 ? 62.920 55.247  46.547 1.00 42.38  ? 270 PHE A CD2 1 
ATOM   1922 C CE1 . PHE A 1 270 ? 64.144 52.922  45.647 1.00 41.66  ? 270 PHE A CE1 1 
ATOM   1923 C CE2 . PHE A 1 270 ? 62.234 54.378  45.720 1.00 45.87  ? 270 PHE A CE2 1 
ATOM   1924 C CZ  . PHE A 1 270 ? 62.850 53.209  45.268 1.00 50.74  ? 270 PHE A CZ  1 
ATOM   1925 N N   . LEU A 1 271 ? 63.928 58.270  46.269 1.00 43.07  ? 271 LEU A N   1 
ATOM   1926 C CA  . LEU A 1 271 ? 63.106 58.859  45.224 1.00 48.82  ? 271 LEU A CA  1 
ATOM   1927 C C   . LEU A 1 271 ? 63.964 59.754  44.333 1.00 48.66  ? 271 LEU A C   1 
ATOM   1928 O O   . LEU A 1 271 ? 63.755 59.816  43.123 1.00 56.49  ? 271 LEU A O   1 
ATOM   1929 C CB  . LEU A 1 271 ? 61.976 59.689  45.831 1.00 48.24  ? 271 LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 271 ? 61.016 59.013  46.798 1.00 43.27  ? 271 LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 271 ? 59.995 60.037  47.250 1.00 43.18  ? 271 LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 271 ? 60.333 57.849  46.130 1.00 49.12  ? 271 LEU A CD2 1 
ATOM   1933 N N   . ALA A 1 272 ? 64.926 60.445  44.940 1.00 53.40  ? 272 ALA A N   1 
ATOM   1934 C CA  . ALA A 1 272 ? 65.830 61.334  44.209 1.00 55.51  ? 272 ALA A CA  1 
ATOM   1935 C C   . ALA A 1 272 ? 66.687 60.524  43.258 1.00 57.33  ? 272 ALA A C   1 
ATOM   1936 O O   . ALA A 1 272 ? 66.860 60.895  42.108 1.00 60.88  ? 272 ALA A O   1 
ATOM   1937 C CB  . ALA A 1 272 ? 66.715 62.081  45.166 1.00 61.30  ? 272 ALA A CB  1 
ATOM   1938 N N   . GLN A 1 273 ? 67.232 59.425  43.764 1.00 54.88  ? 273 GLN A N   1 
ATOM   1939 C CA  . GLN A 1 273 ? 68.077 58.525  42.991 1.00 59.46  ? 273 GLN A CA  1 
ATOM   1940 C C   . GLN A 1 273 ? 67.398 58.158  41.674 1.00 55.02  ? 273 GLN A C   1 
ATOM   1941 O O   . GLN A 1 273 ? 68.068 58.074  40.649 1.00 57.17  ? 273 GLN A O   1 
ATOM   1942 C CB  . GLN A 1 273 ? 68.355 57.275  43.820 1.00 73.16  ? 273 GLN A CB  1 
ATOM   1943 C CG  . GLN A 1 273 ? 69.574 56.459  43.431 1.00 83.43  ? 273 GLN A CG  1 
ATOM   1944 C CD  . GLN A 1 273 ? 70.062 55.569  44.583 1.00 88.46  ? 273 GLN A CD  1 
ATOM   1945 O OE1 . GLN A 1 273 ? 69.459 55.532  45.663 1.00 89.58  ? 273 GLN A OE1 1 
ATOM   1946 N NE2 . GLN A 1 273 ? 71.166 54.865  44.358 1.00 92.24  ? 273 GLN A NE2 1 
ATOM   1947 N N   . LEU A 1 274 ? 66.074 57.963  41.703 1.00 53.35  ? 274 LEU A N   1 
ATOM   1948 C CA  . LEU A 1 274 ? 65.296 57.630  40.497 1.00 55.03  ? 274 LEU A CA  1 
ATOM   1949 C C   . LEU A 1 274 ? 65.113 58.903  39.674 1.00 57.87  ? 274 LEU A C   1 
ATOM   1950 O O   . LEU A 1 274 ? 65.981 59.262  38.878 1.00 71.28  ? 274 LEU A O   1 
ATOM   1951 C CB  . LEU A 1 274 ? 63.926 57.021  40.851 1.00 42.21  ? 274 LEU A CB  1 
ATOM   1952 C CG  . LEU A 1 274 ? 63.879 55.639  41.528 1.00 41.15  ? 274 LEU A CG  1 
ATOM   1953 C CD1 . LEU A 1 274 ? 62.500 55.354  42.099 1.00 34.25  ? 274 LEU A CD1 1 
ATOM   1954 C CD2 . LEU A 1 274 ? 64.270 54.553  40.557 1.00 40.10  ? 274 LEU A CD2 1 
ATOM   1955 N N   . LYS A 1 275 ? 63.997 59.590  39.873 1.00 55.39  ? 275 LYS A N   1 
ATOM   1956 C CA  . LYS A 1 275 ? 63.707 60.842  39.172 1.00 59.32  ? 275 LYS A CA  1 
ATOM   1957 C C   . LYS A 1 275 ? 62.418 61.405  39.739 1.00 64.23  ? 275 LYS A C   1 
ATOM   1958 O O   . LYS A 1 275 ? 62.023 62.529  39.420 1.00 66.82  ? 275 LYS A O   1 
ATOM   1959 C CB  . LYS A 1 275 ? 63.501 60.622  37.671 1.00 58.79  ? 275 LYS A CB  1 
ATOM   1960 C CG  . LYS A 1 275 ? 63.058 61.898  36.943 1.00 61.03  ? 275 LYS A CG  1 
ATOM   1961 C CD  . LYS A 1 275 ? 62.412 61.630  35.592 1.00 68.18  ? 275 LYS A CD  1 
ATOM   1962 C CE  . LYS A 1 275 ? 61.917 62.927  34.953 1.00 62.52  ? 275 LYS A CE  1 
ATOM   1963 N NZ  . LYS A 1 275 ? 61.490 62.707  33.539 1.00 60.71  ? 275 LYS A NZ  1 
ATOM   1964 N N   . ILE A 1 276 ? 61.771 60.604  40.582 1.00 59.15  ? 276 ILE A N   1 
ATOM   1965 C CA  . ILE A 1 276 ? 60.504 60.956  41.190 1.00 46.96  ? 276 ILE A CA  1 
ATOM   1966 C C   . ILE A 1 276 ? 60.501 62.344  41.808 1.00 48.20  ? 276 ILE A C   1 
ATOM   1967 O O   . ILE A 1 276 ? 61.484 62.770  42.416 1.00 43.01  ? 276 ILE A O   1 
ATOM   1968 C CB  . ILE A 1 276 ? 60.105 59.897  42.206 1.00 46.92  ? 276 ILE A CB  1 
ATOM   1969 C CG1 . ILE A 1 276 ? 60.173 58.522  41.538 1.00 41.35  ? 276 ILE A CG1 1 
ATOM   1970 C CG2 . ILE A 1 276 ? 58.706 60.176  42.737 1.00 46.67  ? 276 ILE A CG2 1 
ATOM   1971 C CD1 . ILE A 1 276 ? 59.795 57.378  42.434 1.00 52.28  ? 276 ILE A CD1 1 
ATOM   1972 N N   . MET A 1 277 ? 59.403 63.060  41.583 1.00 46.83  ? 277 MET A N   1 
ATOM   1973 C CA  . MET A 1 277 ? 59.226 64.413  42.088 1.00 52.67  ? 277 MET A CA  1 
ATOM   1974 C C   . MET A 1 277 ? 57.749 64.715  42.255 1.00 58.45  ? 277 MET A C   1 
ATOM   1975 O O   . MET A 1 277 ? 56.904 63.855  42.006 1.00 58.40  ? 277 MET A O   1 
ATOM   1976 C CB  . MET A 1 277 ? 59.820 65.424  41.114 1.00 57.26  ? 277 MET A CB  1 
ATOM   1977 C CG  . MET A 1 277 ? 61.121 66.035  41.573 1.00 61.38  ? 277 MET A CG  1 
ATOM   1978 S SD  . MET A 1 277 ? 61.561 67.485  40.588 1.00 63.99  ? 277 MET A SD  1 
ATOM   1979 C CE  . MET A 1 277 ? 60.622 68.747  41.446 1.00 67.27  ? 277 MET A CE  1 
ATOM   1980 N N   . ASP A 1 278 ? 57.456 65.945  42.682 1.00 61.53  ? 278 ASP A N   1 
ATOM   1981 C CA  . ASP A 1 278 ? 56.088 66.442  42.895 1.00 66.88  ? 278 ASP A CA  1 
ATOM   1982 C C   . ASP A 1 278 ? 55.283 65.721  43.982 1.00 63.88  ? 278 ASP A C   1 
ATOM   1983 O O   . ASP A 1 278 ? 54.126 66.062  44.251 1.00 59.80  ? 278 ASP A O   1 
ATOM   1984 C CB  . ASP A 1 278 ? 55.334 66.455  41.569 1.00 70.35  ? 278 ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 278 ? 56.132 67.118  40.474 1.00 81.17  ? 278 ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 278 ? 56.703 66.396  39.628 1.00 80.08  ? 278 ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 278 ? 56.229 68.362  40.492 1.00 88.10  ? 278 ASP A OD2 1 
ATOM   1988 N N   . TYR A 1 279 ? 55.925 64.751  44.626 1.00 60.41  ? 279 TYR A N   1 
ATOM   1989 C CA  . TYR A 1 279 ? 55.307 63.982  45.694 1.00 54.56  ? 279 TYR A CA  1 
ATOM   1990 C C   . TYR A 1 279 ? 55.220 64.855  46.937 1.00 54.42  ? 279 TYR A C   1 
ATOM   1991 O O   . TYR A 1 279 ? 56.031 65.767  47.127 1.00 51.85  ? 279 TYR A O   1 
ATOM   1992 C CB  . TYR A 1 279 ? 56.146 62.739  46.006 1.00 54.59  ? 279 TYR A CB  1 
ATOM   1993 C CG  . TYR A 1 279 ? 57.600 63.047  46.299 1.00 53.47  ? 279 TYR A CG  1 
ATOM   1994 C CD1 . TYR A 1 279 ? 58.001 63.539  47.543 1.00 48.66  ? 279 TYR A CD1 1 
ATOM   1995 C CD2 . TYR A 1 279 ? 58.563 62.919  45.304 1.00 57.76  ? 279 TYR A CD2 1 
ATOM   1996 C CE1 . TYR A 1 279 ? 59.324 63.906  47.777 1.00 56.21  ? 279 TYR A CE1 1 
ATOM   1997 C CE2 . TYR A 1 279 ? 59.885 63.282  45.526 1.00 58.41  ? 279 TYR A CE2 1 
ATOM   1998 C CZ  . TYR A 1 279 ? 60.260 63.779  46.756 1.00 56.54  ? 279 TYR A CZ  1 
ATOM   1999 O OH  . TYR A 1 279 ? 61.562 64.184  46.926 1.00 51.57  ? 279 TYR A OH  1 
ATOM   2000 N N   . SER A 1 280 ? 54.251 64.560  47.793 1.00 51.70  ? 280 SER A N   1 
ATOM   2001 C CA  . SER A 1 280 ? 54.078 65.324  49.021 1.00 48.86  ? 280 SER A CA  1 
ATOM   2002 C C   . SER A 1 280 ? 54.027 64.412  50.236 1.00 47.26  ? 280 SER A C   1 
ATOM   2003 O O   . SER A 1 280 ? 54.135 63.190  50.103 1.00 43.99  ? 280 SER A O   1 
ATOM   2004 C CB  . SER A 1 280 ? 52.815 66.187  48.941 1.00 51.07  ? 280 SER A CB  1 
ATOM   2005 O OG  . SER A 1 280 ? 51.742 65.475  48.355 1.00 46.72  ? 280 SER A OG  1 
ATOM   2006 N N   . LEU A 1 281 ? 53.943 65.019  51.418 1.00 36.19  ? 281 LEU A N   1 
ATOM   2007 C CA  . LEU A 1 281 ? 53.862 64.264  52.664 1.00 34.87  ? 281 LEU A CA  1 
ATOM   2008 C C   . LEU A 1 281 ? 52.456 64.445  53.200 1.00 35.04  ? 281 LEU A C   1 
ATOM   2009 O O   . LEU A 1 281 ? 51.994 65.574  53.371 1.00 35.85  ? 281 LEU A O   1 
ATOM   2010 C CB  . LEU A 1 281 ? 54.864 64.778  53.701 1.00 26.64  ? 281 LEU A CB  1 
ATOM   2011 C CG  . LEU A 1 281 ? 54.801 64.074  55.059 1.00 16.90  ? 281 LEU A CG  1 
ATOM   2012 C CD1 . LEU A 1 281 ? 55.868 63.016  55.180 1.00 5.99   ? 281 LEU A CD1 1 
ATOM   2013 C CD2 . LEU A 1 281 ? 54.958 65.106  56.152 1.00 16.36  ? 281 LEU A CD2 1 
ATOM   2014 N N   . LEU A 1 282 ? 51.766 63.334  53.420 1.00 32.81  ? 282 LEU A N   1 
ATOM   2015 C CA  . LEU A 1 282 ? 50.409 63.376  53.931 1.00 30.71  ? 282 LEU A CA  1 
ATOM   2016 C C   . LEU A 1 282 ? 50.485 63.460  55.451 1.00 32.16  ? 282 LEU A C   1 
ATOM   2017 O O   . LEU A 1 282 ? 51.226 62.704  56.097 1.00 32.14  ? 282 LEU A O   1 
ATOM   2018 C CB  . LEU A 1 282 ? 49.644 62.117  53.512 1.00 34.02  ? 282 LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 282 ? 48.191 62.216  53.024 1.00 25.59  ? 282 LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 282 ? 47.534 60.906  53.341 1.00 21.08  ? 282 LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 282 ? 47.417 63.332  53.695 1.00 12.87  ? 282 LEU A CD2 1 
ATOM   2022 N N   . VAL A 1 283 ? 49.703 64.369  56.018 1.00 22.43  ? 283 VAL A N   1 
ATOM   2023 C CA  . VAL A 1 283 ? 49.682 64.562  57.452 1.00 20.56  ? 283 VAL A CA  1 
ATOM   2024 C C   . VAL A 1 283 ? 48.276 64.485  58.029 1.00 26.32  ? 283 VAL A C   1 
ATOM   2025 O O   . VAL A 1 283 ? 47.414 65.294  57.698 1.00 40.45  ? 283 VAL A O   1 
ATOM   2026 C CB  . VAL A 1 283 ? 50.284 65.920  57.806 1.00 14.17  ? 283 VAL A CB  1 
ATOM   2027 C CG1 . VAL A 1 283 ? 50.139 66.208  59.277 1.00 19.49  ? 283 VAL A CG1 1 
ATOM   2028 C CG2 . VAL A 1 283 ? 51.737 65.940  57.418 1.00 25.41  ? 283 VAL A CG2 1 
ATOM   2029 N N   . GLY A 1 284 ? 48.050 63.508  58.896 1.00 23.08  ? 284 GLY A N   1 
ATOM   2030 C CA  . GLY A 1 284 ? 46.760 63.367  59.528 1.00 23.27  ? 284 GLY A CA  1 
ATOM   2031 C C   . GLY A 1 284 ? 46.907 63.560  61.025 1.00 26.59  ? 284 GLY A C   1 
ATOM   2032 O O   . GLY A 1 284 ? 47.790 62.984  61.645 1.00 27.36  ? 284 GLY A O   1 
ATOM   2033 N N   . ILE A 1 285 ? 46.038 64.370  61.611 1.00 29.27  ? 285 ILE A N   1 
ATOM   2034 C CA  . ILE A 1 285 ? 46.081 64.622  63.041 1.00 32.86  ? 285 ILE A CA  1 
ATOM   2035 C C   . ILE A 1 285 ? 44.830 64.048  63.699 1.00 37.33  ? 285 ILE A C   1 
ATOM   2036 O O   . ILE A 1 285 ? 43.724 64.165  63.167 1.00 39.89  ? 285 ILE A O   1 
ATOM   2037 C CB  . ILE A 1 285 ? 46.151 66.131  63.329 1.00 35.33  ? 285 ILE A CB  1 
ATOM   2038 C CG1 . ILE A 1 285 ? 47.423 66.717  62.737 1.00 27.84  ? 285 ILE A CG1 1 
ATOM   2039 C CG2 . ILE A 1 285 ? 46.139 66.394  64.822 1.00 37.30  ? 285 ILE A CG2 1 
ATOM   2040 C CD1 . ILE A 1 285 ? 47.413 68.212  62.716 1.00 29.95  ? 285 ILE A CD1 1 
ATOM   2041 N N   . HIS A 1 286 ? 45.018 63.418  64.851 1.00 34.85  ? 286 HIS A N   1 
ATOM   2042 C CA  . HIS A 1 286 ? 43.919 62.836  65.600 1.00 39.35  ? 286 HIS A CA  1 
ATOM   2043 C C   . HIS A 1 286 ? 43.963 63.286  67.057 1.00 46.98  ? 286 HIS A C   1 
ATOM   2044 O O   . HIS A 1 286 ? 44.864 62.906  67.816 1.00 45.47  ? 286 HIS A O   1 
ATOM   2045 C CB  . HIS A 1 286 ? 43.972 61.317  65.525 1.00 35.64  ? 286 HIS A CB  1 
ATOM   2046 C CG  . HIS A 1 286 ? 43.007 60.632  66.438 1.00 29.89  ? 286 HIS A CG  1 
ATOM   2047 N ND1 . HIS A 1 286 ? 43.371 60.151  67.676 1.00 24.72  ? 286 HIS A ND1 1 
ATOM   2048 C CD2 . HIS A 1 286 ? 41.700 60.319  66.283 1.00 33.61  ? 286 HIS A CD2 1 
ATOM   2049 C CE1 . HIS A 1 286 ? 42.330 59.567  68.243 1.00 32.89  ? 286 HIS A CE1 1 
ATOM   2050 N NE2 . HIS A 1 286 ? 41.304 59.655  67.417 1.00 35.50  ? 286 HIS A NE2 1 
ATOM   2051 N N   . ASP A 1 287 ? 43.000 64.135  67.412 1.00 57.11  ? 287 ASP A N   1 
ATOM   2052 C CA  . ASP A 1 287 ? 42.852 64.672  68.761 1.00 58.53  ? 287 ASP A CA  1 
ATOM   2053 C C   . ASP A 1 287 ? 42.039 63.678  69.581 1.00 56.88  ? 287 ASP A C   1 
ATOM   2054 O O   . ASP A 1 287 ? 40.857 63.460  69.326 1.00 55.76  ? 287 ASP A O   1 
ATOM   2055 C CB  . ASP A 1 287 ? 42.143 66.030  68.723 1.00 68.33  ? 287 ASP A CB  1 
ATOM   2056 C CG  . ASP A 1 287 ? 42.243 66.777  70.041 1.00 77.76  ? 287 ASP A CG  1 
ATOM   2057 O OD1 . ASP A 1 287 ? 41.738 66.257  71.056 1.00 83.43  ? 287 ASP A OD1 1 
ATOM   2058 O OD2 . ASP A 1 287 ? 42.833 67.880  70.067 1.00 82.57  ? 287 ASP A OD2 1 
ATOM   2059 N N   . VAL A 1 288 ? 42.680 63.096  70.583 1.00 56.35  ? 288 VAL A N   1 
ATOM   2060 C CA  . VAL A 1 288 ? 42.041 62.106  71.422 1.00 53.29  ? 288 VAL A CA  1 
ATOM   2061 C C   . VAL A 1 288 ? 40.856 62.640  72.184 1.00 53.95  ? 288 VAL A C   1 
ATOM   2062 O O   . VAL A 1 288 ? 39.770 62.088  72.097 1.00 59.50  ? 288 VAL A O   1 
ATOM   2063 C CB  . VAL A 1 288 ? 43.018 61.521  72.420 1.00 49.87  ? 288 VAL A CB  1 
ATOM   2064 C CG1 . VAL A 1 288 ? 42.342 60.404  73.195 1.00 58.05  ? 288 VAL A CG1 1 
ATOM   2065 C CG2 . VAL A 1 288 ? 44.252 61.017  71.700 1.00 51.24  ? 288 VAL A CG2 1 
ATOM   2066 N N   . ASP A 1 289 ? 41.072 63.710  72.939 1.00 60.16  ? 289 ASP A N   1 
ATOM   2067 C CA  . ASP A 1 289 ? 40.012 64.314  73.745 1.00 62.66  ? 289 ASP A CA  1 
ATOM   2068 C C   . ASP A 1 289 ? 38.758 64.619  72.924 1.00 59.32  ? 289 ASP A C   1 
ATOM   2069 O O   . ASP A 1 289 ? 37.639 64.436  73.398 1.00 60.70  ? 289 ASP A O   1 
ATOM   2070 C CB  . ASP A 1 289 ? 40.524 65.582  74.448 1.00 70.76  ? 289 ASP A CB  1 
ATOM   2071 C CG  . ASP A 1 289 ? 41.712 65.310  75.370 1.00 71.15  ? 289 ASP A CG  1 
ATOM   2072 O OD1 . ASP A 1 289 ? 42.510 66.250  75.591 1.00 65.01  ? 289 ASP A OD1 1 
ATOM   2073 O OD2 . ASP A 1 289 ? 41.847 64.165  75.872 1.00 73.35  ? 289 ASP A OD2 1 
ATOM   2074 N N   . ARG A 1 290 ? 38.958 65.070  71.690 1.00 55.47  ? 290 ARG A N   1 
ATOM   2075 C CA  . ARG A 1 290 ? 37.853 65.379  70.793 1.00 53.69  ? 290 ARG A CA  1 
ATOM   2076 C C   . ARG A 1 290 ? 37.185 64.070  70.412 1.00 56.63  ? 290 ARG A C   1 
ATOM   2077 O O   . ARG A 1 290 ? 35.965 63.979  70.329 1.00 58.23  ? 290 ARG A O   1 
ATOM   2078 C CB  . ARG A 1 290 ? 38.371 66.080  69.537 1.00 52.60  ? 290 ARG A CB  1 
ATOM   2079 C CG  . ARG A 1 290 ? 37.331 66.247  68.453 1.00 49.55  ? 290 ARG A CG  1 
ATOM   2080 C CD  . ARG A 1 290 ? 37.881 67.009  67.266 1.00 55.89  ? 290 ARG A CD  1 
ATOM   2081 N NE  . ARG A 1 290 ? 36.908 67.100  66.180 1.00 59.95  ? 290 ARG A NE  1 
ATOM   2082 C CZ  . ARG A 1 290 ? 36.930 68.030  65.230 1.00 60.00  ? 290 ARG A CZ  1 
ATOM   2083 N NH1 . ARG A 1 290 ? 37.877 68.960  65.221 1.00 64.79  ? 290 ARG A NH1 1 
ATOM   2084 N NH2 . ARG A 1 290 ? 36.006 68.028  64.284 1.00 65.47  ? 290 ARG A NH2 1 
ATOM   2085 N N   . ALA A 1 291 ? 38.007 63.051  70.199 1.00 63.12  ? 291 ALA A N   1 
ATOM   2086 C CA  . ALA A 1 291 ? 37.526 61.730  69.833 1.00 65.72  ? 291 ALA A CA  1 
ATOM   2087 C C   . ALA A 1 291 ? 36.599 61.202  70.911 1.00 67.06  ? 291 ALA A C   1 
ATOM   2088 O O   . ALA A 1 291 ? 35.556 60.641  70.599 1.00 67.08  ? 291 ALA A O   1 
ATOM   2089 C CB  . ALA A 1 291 ? 38.700 60.784  69.632 1.00 74.68  ? 291 ALA A CB  1 
ATOM   2090 N N   . GLU A 1 292 ? 36.978 61.404  72.175 1.00 71.46  ? 292 GLU A N   1 
ATOM   2091 C CA  . GLU A 1 292 ? 36.184 60.958  73.319 1.00 73.34  ? 292 GLU A CA  1 
ATOM   2092 C C   . GLU A 1 292 ? 34.772 61.507  73.230 1.00 77.01  ? 292 GLU A C   1 
ATOM   2093 O O   . GLU A 1 292 ? 33.809 60.746  73.276 1.00 80.54  ? 292 GLU A O   1 
ATOM   2094 C CB  . GLU A 1 292 ? 36.799 61.429  74.635 1.00 79.30  ? 292 GLU A CB  1 
ATOM   2095 C CG  . GLU A 1 292 ? 38.012 60.653  75.107 1.00 86.04  ? 292 GLU A CG  1 
ATOM   2096 C CD  . GLU A 1 292 ? 38.525 61.147  76.452 1.00 90.70  ? 292 GLU A CD  1 
ATOM   2097 O OE1 . GLU A 1 292 ? 38.974 62.314  76.528 1.00 88.53  ? 292 GLU A OE1 1 
ATOM   2098 O OE2 . GLU A 1 292 ? 38.473 60.368  77.430 1.00 84.71  ? 292 GLU A OE2 1 
ATOM   2099 N N   . GLN A 1 293 ? 34.663 62.829  73.103 1.00 74.77  ? 293 GLN A N   1 
ATOM   2100 C CA  . GLN A 1 293 ? 33.375 63.509  73.003 1.00 74.53  ? 293 GLN A CA  1 
ATOM   2101 C C   . GLN A 1 293 ? 32.525 62.907  71.890 1.00 70.82  ? 293 GLN A C   1 
ATOM   2102 O O   . GLN A 1 293 ? 31.351 62.594  72.088 1.00 73.76  ? 293 GLN A O   1 
ATOM   2103 C CB  . GLN A 1 293 ? 33.580 64.992  72.714 1.00 78.44  ? 293 GLN A CB  1 
ATOM   2104 C CG  . GLN A 1 293 ? 34.471 65.711  73.699 1.00 87.34  ? 293 GLN A CG  1 
ATOM   2105 C CD  . GLN A 1 293 ? 34.638 67.179  73.346 1.00 90.03  ? 293 GLN A CD  1 
ATOM   2106 O OE1 . GLN A 1 293 ? 35.630 67.578  72.723 1.00 89.77  ? 293 GLN A OE1 1 
ATOM   2107 N NE2 . GLN A 1 293 ? 33.658 67.994  73.738 1.00 94.14  ? 293 GLN A NE2 1 
ATOM   2108 N N   . GLU A 1 294 ? 33.130 62.752  70.718 1.00 68.87  ? 294 GLU A N   1 
ATOM   2109 C CA  . GLU A 1 294 ? 32.441 62.188  69.566 1.00 65.22  ? 294 GLU A CA  1 
ATOM   2110 C C   . GLU A 1 294 ? 31.966 60.781  69.881 1.00 58.32  ? 294 GLU A C   1 
ATOM   2111 O O   . GLU A 1 294 ? 30.849 60.412  69.569 1.00 61.68  ? 294 GLU A O   1 
ATOM   2112 C CB  . GLU A 1 294 ? 33.374 62.147  68.356 1.00 66.97  ? 294 GLU A CB  1 
ATOM   2113 C CG  . GLU A 1 294 ? 33.849 63.507  67.866 1.00 70.01  ? 294 GLU A CG  1 
ATOM   2114 C CD  . GLU A 1 294 ? 34.853 63.395  66.732 1.00 73.37  ? 294 GLU A CD  1 
ATOM   2115 O OE1 . GLU A 1 294 ? 35.770 62.550  66.834 1.00 73.89  ? 294 GLU A OE1 1 
ATOM   2116 O OE2 . GLU A 1 294 ? 34.723 64.150  65.741 1.00 76.33  ? 294 GLU A OE2 1 
ATOM   2117 N N   . GLU A 1 295 ? 32.826 60.011  70.526 1.00 56.56  ? 295 GLU A N   1 
ATOM   2118 C CA  . GLU A 1 295 ? 32.523 58.640  70.886 1.00 63.47  ? 295 GLU A CA  1 
ATOM   2119 C C   . GLU A 1 295 ? 31.401 58.612  71.919 1.00 62.29  ? 295 GLU A C   1 
ATOM   2120 O O   . GLU A 1 295 ? 30.495 57.789  71.836 1.00 66.82  ? 295 GLU A O   1 
ATOM   2121 C CB  . GLU A 1 295 ? 33.794 57.974  71.432 1.00 76.13  ? 295 GLU A CB  1 
ATOM   2122 C CG  . GLU A 1 295 ? 33.778 56.439  71.516 1.00 82.14  ? 295 GLU A CG  1 
ATOM   2123 C CD  . GLU A 1 295 ? 35.164 55.834  71.819 1.00 87.25  ? 295 GLU A CD  1 
ATOM   2124 O OE1 . GLU A 1 295 ? 36.023 56.538  72.398 1.00 84.66  ? 295 GLU A OE1 1 
ATOM   2125 O OE2 . GLU A 1 295 ? 35.396 54.649  71.477 1.00 82.17  ? 295 GLU A OE2 1 
ATOM   2126 N N   . MET A 1 296 ? 31.426 59.565  72.846 1.00 64.89  ? 296 MET A N   1 
ATOM   2127 C CA  . MET A 1 296 ? 30.426 59.650  73.908 1.00 65.28  ? 296 MET A CA  1 
ATOM   2128 C C   . MET A 1 296 ? 29.018 59.900  73.378 1.00 65.94  ? 296 MET A C   1 
ATOM   2129 O O   . MET A 1 296 ? 28.095 59.164  73.708 1.00 64.85  ? 296 MET A O   1 
ATOM   2130 C CB  . MET A 1 296 ? 30.802 60.740  74.910 1.00 64.74  ? 296 MET A CB  1 
ATOM   2131 C CG  . MET A 1 296 ? 29.916 60.781  76.134 1.00 60.70  ? 296 MET A CG  1 
ATOM   2132 S SD  . MET A 1 296 ? 30.097 62.317  77.043 1.00 62.34  ? 296 MET A SD  1 
ATOM   2133 C CE  . MET A 1 296 ? 28.568 63.198  76.611 1.00 46.21  ? 296 MET A CE  1 
ATOM   2134 N N   . GLU A 1 297 ? 28.855 60.945  72.569 1.00 69.92  ? 297 GLU A N   1 
ATOM   2135 C CA  . GLU A 1 297 ? 27.553 61.268  71.993 1.00 74.80  ? 297 GLU A CA  1 
ATOM   2136 C C   . GLU A 1 297 ? 26.941 60.029  71.343 1.00 73.83  ? 297 GLU A C   1 
ATOM   2137 O O   . GLU A 1 297 ? 25.756 59.766  71.497 1.00 81.81  ? 297 GLU A O   1 
ATOM   2138 C CB  . GLU A 1 297 ? 27.676 62.393  70.962 1.00 76.09  ? 297 GLU A CB  1 
ATOM   2139 C CG  . GLU A 1 297 ? 26.338 62.792  70.341 1.00 82.79  ? 297 GLU A CG  1 
ATOM   2140 C CD  . GLU A 1 297 ? 26.448 63.936  69.346 1.00 86.33  ? 297 GLU A CD  1 
ATOM   2141 O OE1 . GLU A 1 297 ? 26.885 65.039  69.743 1.00 89.26  ? 297 GLU A OE1 1 
ATOM   2142 O OE2 . GLU A 1 297 ? 26.080 63.738  68.167 1.00 86.58  ? 297 GLU A OE2 1 
ATOM   2143 N N   . VAL A 1 298 ? 27.766 59.261  70.642 1.00 74.44  ? 298 VAL A N   1 
ATOM   2144 C CA  . VAL A 1 298 ? 27.327 58.037  69.987 1.00 71.87  ? 298 VAL A CA  1 
ATOM   2145 C C   . VAL A 1 298 ? 26.762 57.082  71.040 1.00 71.68  ? 298 VAL A C   1 
ATOM   2146 O O   . VAL A 1 298 ? 25.736 56.436  70.829 1.00 74.94  ? 298 VAL A O   1 
ATOM   2147 C CB  . VAL A 1 298 ? 28.509 57.369  69.236 1.00 73.76  ? 298 VAL A CB  1 
ATOM   2148 C CG1 . VAL A 1 298 ? 28.194 55.922  68.896 1.00 81.22  ? 298 VAL A CG1 1 
ATOM   2149 C CG2 . VAL A 1 298 ? 28.823 58.142  67.971 1.00 74.23  ? 298 VAL A CG2 1 
ATOM   2150 N N   . GLU A 1 299 ? 27.428 57.017  72.185 1.00 66.72  ? 299 GLU A N   1 
ATOM   2151 C CA  . GLU A 1 299 ? 26.986 56.153  73.266 1.00 68.25  ? 299 GLU A CA  1 
ATOM   2152 C C   . GLU A 1 299 ? 25.829 56.816  74.012 1.00 66.05  ? 299 GLU A C   1 
ATOM   2153 O O   . GLU A 1 299 ? 25.009 56.141  74.633 1.00 68.28  ? 299 GLU A O   1 
ATOM   2154 C CB  . GLU A 1 299 ? 28.148 55.876  74.231 1.00 66.97  ? 299 GLU A CB  1 
ATOM   2155 C CG  . GLU A 1 299 ? 29.361 55.215  73.588 1.00 72.24  ? 299 GLU A CG  1 
ATOM   2156 C CD  . GLU A 1 299 ? 30.535 55.091  74.543 1.00 75.21  ? 299 GLU A CD  1 
ATOM   2157 O OE1 . GLU A 1 299 ? 31.365 56.024  74.593 1.00 74.21  ? 299 GLU A OE1 1 
ATOM   2158 O OE2 . GLU A 1 299 ? 30.630 54.060  75.243 1.00 74.98  ? 299 GLU A OE2 1 
ATOM   2159 N N   . GLU A 1 300 ? 25.740 58.137  73.895 1.00 60.89  ? 300 GLU A N   1 
ATOM   2160 C CA  . GLU A 1 300 ? 24.715 58.910  74.573 1.00 61.22  ? 300 GLU A CA  1 
ATOM   2161 C C   . GLU A 1 300 ? 23.365 58.786  73.902 1.00 64.85  ? 300 GLU A C   1 
ATOM   2162 O O   . GLU A 1 300 ? 22.337 58.879  74.565 1.00 68.10  ? 300 GLU A O   1 
ATOM   2163 C CB  . GLU A 1 300 ? 25.133 60.376  74.637 1.00 64.28  ? 300 GLU A CB  1 
ATOM   2164 C CG  . GLU A 1 300 ? 24.458 61.189  75.741 1.00 79.37  ? 300 GLU A CG  1 
ATOM   2165 C CD  . GLU A 1 300 ? 23.254 62.008  75.276 1.00 86.81  ? 300 GLU A CD  1 
ATOM   2166 O OE1 . GLU A 1 300 ? 22.775 62.838  76.080 1.00 85.63  ? 300 GLU A OE1 1 
ATOM   2167 O OE2 . GLU A 1 300 ? 22.782 61.835  74.126 1.00 89.22  ? 300 GLU A OE2 1 
ATOM   2168 N N   . ARG A 1 301 ? 23.367 58.586  72.587 1.00 75.48  ? 301 ARG A N   1 
ATOM   2169 C CA  . ARG A 1 301 ? 22.126 58.455  71.813 1.00 76.91  ? 301 ARG A CA  1 
ATOM   2170 C C   . ARG A 1 301 ? 21.423 57.134  72.072 1.00 77.48  ? 301 ARG A C   1 
ATOM   2171 O O   . ARG A 1 301 ? 20.197 57.062  72.005 1.00 79.98  ? 301 ARG A O   1 
ATOM   2172 C CB  . ARG A 1 301 ? 22.386 58.619  70.314 1.00 78.98  ? 301 ARG A CB  1 
ATOM   2173 C CG  . ARG A 1 301 ? 22.791 60.022  69.908 1.00 79.93  ? 301 ARG A CG  1 
ATOM   2174 C CD  . ARG A 1 301 ? 22.910 60.142  68.401 1.00 83.47  ? 301 ARG A CD  1 
ATOM   2175 N NE  . ARG A 1 301 ? 23.094 61.523  67.969 1.00 86.47  ? 301 ARG A NE  1 
ATOM   2176 C CZ  . ARG A 1 301 ? 22.277 62.528  68.279 1.00 87.53  ? 301 ARG A CZ  1 
ATOM   2177 N NH1 . ARG A 1 301 ? 21.206 62.322  69.037 1.00 87.88  ? 301 ARG A NH1 1 
ATOM   2178 N NH2 . ARG A 1 301 ? 22.524 63.745  67.814 1.00 89.72  ? 301 ARG A NH2 1 
ATOM   2179 N N   . ALA A 1 302 ? 22.202 56.090  72.347 1.00 76.17  ? 302 ALA A N   1 
ATOM   2180 C CA  . ALA A 1 302 ? 21.641 54.779  72.650 1.00 77.93  ? 302 ALA A CA  1 
ATOM   2181 C C   . ALA A 1 302 ? 20.986 54.834  74.036 1.00 79.64  ? 302 ALA A C   1 
ATOM   2182 O O   . ALA A 1 302 ? 20.213 53.952  74.405 1.00 77.52  ? 302 ALA A O   1 
ATOM   2183 C CB  . ALA A 1 302 ? 22.725 53.718  72.608 1.00 80.08  ? 302 ALA A CB  1 
ATOM   2184 N N   . GLU A 1 303 ? 21.272 55.914  74.768 1.00 81.58  ? 303 GLU A N   1 
ATOM   2185 C CA  . GLU A 1 303 ? 20.734 56.158  76.106 1.00 82.21  ? 303 GLU A CA  1 
ATOM   2186 C C   . GLU A 1 303 ? 19.544 57.125  76.052 1.00 82.01  ? 303 GLU A C   1 
ATOM   2187 O O   . GLU A 1 303 ? 18.565 56.962  76.784 1.00 85.54  ? 303 GLU A O   1 
ATOM   2188 C CB  . GLU A 1 303 ? 21.819 56.750  77.034 1.00 79.84  ? 303 GLU A CB  1 
ATOM   2189 C CG  . GLU A 1 303 ? 23.035 55.839  77.306 1.00 70.54  ? 303 GLU A CG  1 
ATOM   2190 C CD  . GLU A 1 303 ? 23.994 56.391  78.365 1.00 63.59  ? 303 GLU A CD  1 
ATOM   2191 O OE1 . GLU A 1 303 ? 24.711 55.595  79.005 1.00 60.58  ? 303 GLU A OE1 1 
ATOM   2192 O OE2 . GLU A 1 303 ? 24.048 57.619  78.553 1.00 59.93  ? 303 GLU A OE2 1 
ATOM   2193 N N   . ASP A 1 304 ? 19.646 58.140  75.200 1.00 82.58  ? 304 ASP A N   1 
ATOM   2194 C CA  . ASP A 1 304 ? 18.592 59.142  75.056 1.00 87.96  ? 304 ASP A CA  1 
ATOM   2195 C C   . ASP A 1 304 ? 17.546 58.797  73.994 1.00 91.14  ? 304 ASP A C   1 
ATOM   2196 O O   . ASP A 1 304 ? 16.385 58.518  74.319 1.00 88.27  ? 304 ASP A O   1 
ATOM   2197 C CB  . ASP A 1 304 ? 19.203 60.515  74.749 1.00 87.82  ? 304 ASP A CB  1 
ATOM   2198 C CG  . ASP A 1 304 ? 19.383 61.368  75.988 1.00 89.56  ? 304 ASP A CG  1 
ATOM   2199 O OD1 . ASP A 1 304 ? 18.380 61.941  76.464 1.00 91.01  ? 304 ASP A OD1 1 
ATOM   2200 O OD2 . ASP A 1 304 ? 20.522 61.474  76.480 1.00 87.32  ? 304 ASP A OD2 1 
ATOM   2201 N N   . GLU A 1 305 ? 17.962 58.853  72.727 1.00 91.57  ? 305 GLU A N   1 
ATOM   2202 C CA  . GLU A 1 305 ? 17.088 58.559  71.590 1.00 90.22  ? 305 GLU A CA  1 
ATOM   2203 C C   . GLU A 1 305 ? 16.484 57.182  71.744 1.00 88.55  ? 305 GLU A C   1 
ATOM   2204 O O   . GLU A 1 305 ? 15.387 56.916  71.258 1.00 89.21  ? 305 GLU A O   1 
ATOM   2205 C CB  . GLU A 1 305 ? 17.870 58.608  70.283 1.00 93.09  ? 305 GLU A CB  1 
ATOM   2206 C CG  . GLU A 1 305 ? 18.469 59.963  69.948 1.00 91.46  ? 305 GLU A CG  1 
ATOM   2207 C CD  . GLU A 1 305 ? 19.242 59.925  68.645 1.00 90.38  ? 305 GLU A CD  1 
ATOM   2208 O OE1 . GLU A 1 305 ? 19.959 58.923  68.420 1.00 90.20  ? 305 GLU A OE1 1 
ATOM   2209 O OE2 . GLU A 1 305 ? 19.122 60.883  67.843 1.00 92.83  ? 305 GLU A OE2 1 
ATOM   2210 N N   . GLU A 1 306 ? 17.251 56.291  72.360 1.00 86.77  ? 306 GLU A N   1 
ATOM   2211 C CA  . GLU A 1 306 ? 16.802 54.937  72.620 1.00 87.53  ? 306 GLU A CA  1 
ATOM   2212 C C   . GLU A 1 306 ? 16.550 54.862  74.114 1.00 88.68  ? 306 GLU A C   1 
ATOM   2213 O O   . GLU A 1 306 ? 17.545 54.868  74.868 1.00 91.98  ? 306 GLU A O   1 
ATOM   2214 C CB  . GLU A 1 306 ? 17.867 53.923  72.197 1.00 85.39  ? 306 GLU A CB  1 
ATOM   2215 C CG  . GLU A 1 306 ? 17.942 53.714  70.700 1.00 83.65  ? 306 GLU A CG  1 
ATOM   2216 C CD  . GLU A 1 306 ? 19.359 53.748  70.174 1.00 85.01  ? 306 GLU A CD  1 
ATOM   2217 O OE1 . GLU A 1 306 ? 19.742 54.788  69.596 1.00 87.64  ? 306 GLU A OE1 1 
ATOM   2218 O OE2 . GLU A 1 306 ? 20.087 52.741  70.335 1.00 89.18  ? 306 GLU A OE2 1 
ATOM   2219 N N   . PHE A 1 342 ? 42.782 50.353  72.995 1.00 69.85  ? 342 PHE A N   1 
ATOM   2220 C CA  . PHE A 1 342 ? 42.110 51.150  74.062 1.00 74.83  ? 342 PHE A CA  1 
ATOM   2221 C C   . PHE A 1 342 ? 41.911 52.592  73.633 1.00 71.92  ? 342 PHE A C   1 
ATOM   2222 O O   . PHE A 1 342 ? 40.845 53.169  73.850 1.00 73.26  ? 342 PHE A O   1 
ATOM   2223 C CB  . PHE A 1 342 ? 42.887 51.073  75.389 1.00 76.75  ? 342 PHE A CB  1 
ATOM   2224 C CG  . PHE A 1 342 ? 44.385 51.227  75.246 1.00 82.84  ? 342 PHE A CG  1 
ATOM   2225 C CD1 . PHE A 1 342 ? 45.021 52.397  75.654 1.00 77.06  ? 342 PHE A CD1 1 
ATOM   2226 C CD2 . PHE A 1 342 ? 45.160 50.191  74.727 1.00 79.36  ? 342 PHE A CD2 1 
ATOM   2227 C CE1 . PHE A 1 342 ? 46.399 52.536  75.550 1.00 72.76  ? 342 PHE A CE1 1 
ATOM   2228 C CE2 . PHE A 1 342 ? 46.537 50.318  74.618 1.00 80.81  ? 342 PHE A CE2 1 
ATOM   2229 C CZ  . PHE A 1 342 ? 47.158 51.497  75.031 1.00 84.26  ? 342 PHE A CZ  1 
ATOM   2230 N N   . ASP A 1 343 ? 42.949 53.171  73.036 1.00 73.40  ? 343 ASP A N   1 
ATOM   2231 C CA  . ASP A 1 343 ? 42.905 54.547  72.553 1.00 77.43  ? 343 ASP A CA  1 
ATOM   2232 C C   . ASP A 1 343 ? 43.808 54.782  71.338 1.00 80.43  ? 343 ASP A C   1 
ATOM   2233 O O   . ASP A 1 343 ? 43.339 55.258  70.304 1.00 88.87  ? 343 ASP A O   1 
ATOM   2234 C CB  . ASP A 1 343 ? 43.278 55.548  73.655 1.00 74.95  ? 343 ASP A CB  1 
ATOM   2235 C CG  . ASP A 1 343 ? 42.297 55.556  74.790 1.00 74.36  ? 343 ASP A CG  1 
ATOM   2236 O OD1 . ASP A 1 343 ? 42.425 54.705  75.695 1.00 74.64  ? 343 ASP A OD1 1 
ATOM   2237 O OD2 . ASP A 1 343 ? 41.398 56.417  74.780 1.00 77.67  ? 343 ASP A OD2 1 
ATOM   2238 N N   . PRO A 1 344 ? 45.110 54.448  71.439 1.00 77.50  ? 344 PRO A N   1 
ATOM   2239 C CA  . PRO A 1 344 ? 45.968 54.684  70.280 1.00 73.90  ? 344 PRO A CA  1 
ATOM   2240 C C   . PRO A 1 344 ? 46.219 53.532  69.312 1.00 67.86  ? 344 PRO A C   1 
ATOM   2241 O O   . PRO A 1 344 ? 45.744 52.405  69.484 1.00 64.21  ? 344 PRO A O   1 
ATOM   2242 C CB  . PRO A 1 344 ? 47.293 55.130  70.920 1.00 73.32  ? 344 PRO A CB  1 
ATOM   2243 C CG  . PRO A 1 344 ? 46.973 55.332  72.377 1.00 81.92  ? 344 PRO A CG  1 
ATOM   2244 C CD  . PRO A 1 344 ? 45.952 54.277  72.626 1.00 81.22  ? 344 PRO A CD  1 
ATOM   2245 N N   . SER A 1 345 ? 47.059 53.873  68.339 1.00 59.63  ? 345 SER A N   1 
ATOM   2246 C CA  . SER A 1 345 ? 47.540 53.051  67.240 1.00 47.49  ? 345 SER A CA  1 
ATOM   2247 C C   . SER A 1 345 ? 48.145 51.690  67.585 1.00 47.76  ? 345 SER A C   1 
ATOM   2248 O O   . SER A 1 345 ? 48.417 51.381  68.737 1.00 42.38  ? 345 SER A O   1 
ATOM   2249 C CB  . SER A 1 345 ? 48.612 53.865  66.505 1.00 40.94  ? 345 SER A CB  1 
ATOM   2250 O OG  . SER A 1 345 ? 49.678 54.260  67.378 1.00 15.91  ? 345 SER A OG  1 
ATOM   2251 N N   . VAL A 1 346 ? 48.348 50.880  66.552 1.00 49.03  ? 346 VAL A N   1 
ATOM   2252 C CA  . VAL A 1 346 ? 48.999 49.580  66.690 1.00 49.08  ? 346 VAL A CA  1 
ATOM   2253 C C   . VAL A 1 346 ? 50.266 49.778  65.853 1.00 53.52  ? 346 VAL A C   1 
ATOM   2254 O O   . VAL A 1 346 ? 50.180 49.927  64.627 1.00 56.22  ? 346 VAL A O   1 
ATOM   2255 C CB  . VAL A 1 346 ? 48.194 48.453  66.031 1.00 52.81  ? 346 VAL A CB  1 
ATOM   2256 C CG1 . VAL A 1 346 ? 48.646 47.098  66.570 1.00 35.15  ? 346 VAL A CG1 1 
ATOM   2257 C CG2 . VAL A 1 346 ? 46.701 48.687  66.204 1.00 58.68  ? 346 VAL A CG2 1 
ATOM   2258 N N   . ASP A 1 347 ? 51.424 49.851  66.505 1.00 53.33  ? 347 ASP A N   1 
ATOM   2259 C CA  . ASP A 1 347 ? 52.676 50.054  65.789 1.00 53.57  ? 347 ASP A CA  1 
ATOM   2260 C C   . ASP A 1 347 ? 52.684 49.232  64.503 1.00 52.27  ? 347 ASP A C   1 
ATOM   2261 O O   . ASP A 1 347 ? 52.892 49.769  63.427 1.00 54.74  ? 347 ASP A O   1 
ATOM   2262 C CB  . ASP A 1 347 ? 53.867 49.639  66.662 1.00 65.54  ? 347 ASP A CB  1 
ATOM   2263 C CG  . ASP A 1 347 ? 54.214 50.669  67.723 1.00 77.22  ? 347 ASP A CG  1 
ATOM   2264 O OD1 . ASP A 1 347 ? 55.391 50.718  68.156 1.00 85.56  ? 347 ASP A OD1 1 
ATOM   2265 O OD2 . ASP A 1 347 ? 53.315 51.429  68.135 1.00 89.14  ? 347 ASP A OD2 1 
ATOM   2266 N N   . VAL A 1 348 ? 52.329 47.953  64.631 1.00 47.14  ? 348 VAL A N   1 
ATOM   2267 C CA  . VAL A 1 348 ? 52.307 46.999  63.525 1.00 39.41  ? 348 VAL A CA  1 
ATOM   2268 C C   . VAL A 1 348 ? 51.300 47.248  62.407 1.00 37.20  ? 348 VAL A C   1 
ATOM   2269 O O   . VAL A 1 348 ? 51.674 47.262  61.238 1.00 34.46  ? 348 VAL A O   1 
ATOM   2270 C CB  . VAL A 1 348 ? 52.132 45.555  64.061 1.00 43.89  ? 348 VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 348 ? 51.029 45.501  65.093 1.00 55.06  ? 348 VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 348 ? 51.830 44.584  62.928 1.00 61.51  ? 348 VAL A CG2 1 
ATOM   2273 N N   . TYR A 1 349 ? 50.023 47.370  62.765 1.00 35.49  ? 349 TYR A N   1 
ATOM   2274 C CA  . TYR A 1 349 ? 48.959 47.597  61.791 1.00 25.32  ? 349 TYR A CA  1 
ATOM   2275 C C   . TYR A 1 349 ? 48.996 49.016  61.269 1.00 22.51  ? 349 TYR A C   1 
ATOM   2276 O O   . TYR A 1 349 ? 49.271 49.226  60.098 1.00 31.23  ? 349 TYR A O   1 
ATOM   2277 C CB  . TYR A 1 349 ? 47.584 47.290  62.392 1.00 11.02  ? 349 TYR A CB  1 
ATOM   2278 C CG  . TYR A 1 349 ? 47.361 45.825  62.702 1.00 16.99  ? 349 TYR A CG  1 
ATOM   2279 C CD1 . TYR A 1 349 ? 46.723 45.429  63.877 1.00 14.54  ? 349 TYR A CD1 1 
ATOM   2280 C CD2 . TYR A 1 349 ? 47.788 44.833  61.819 1.00 14.56  ? 349 TYR A CD2 1 
ATOM   2281 C CE1 . TYR A 1 349 ? 46.515 44.082  64.165 1.00 16.83  ? 349 TYR A CE1 1 
ATOM   2282 C CE2 . TYR A 1 349 ? 47.585 43.485  62.096 1.00 15.34  ? 349 TYR A CE2 1 
ATOM   2283 C CZ  . TYR A 1 349 ? 46.948 43.117  63.270 1.00 16.90  ? 349 TYR A CZ  1 
ATOM   2284 O OH  . TYR A 1 349 ? 46.744 41.785  63.549 1.00 14.85  ? 349 TYR A OH  1 
ATOM   2285 N N   . ALA A 1 350 ? 48.715 49.981  62.137 1.00 25.38  ? 350 ALA A N   1 
ATOM   2286 C CA  . ALA A 1 350 ? 48.716 51.398  61.775 1.00 27.36  ? 350 ALA A CA  1 
ATOM   2287 C C   . ALA A 1 350 ? 50.159 51.868  61.942 1.00 31.27  ? 350 ALA A C   1 
ATOM   2288 O O   . ALA A 1 350 ? 50.498 52.564  62.901 1.00 37.83  ? 350 ALA A O   1 
ATOM   2289 C CB  . ALA A 1 350 ? 47.753 52.185  62.715 1.00 18.04  ? 350 ALA A CB  1 
ATOM   2290 N N   . MET A 1 351 ? 51.006 51.495  60.988 1.00 28.58  ? 351 MET A N   1 
ATOM   2291 C CA  . MET A 1 351 ? 52.422 51.820  61.063 1.00 24.77  ? 351 MET A CA  1 
ATOM   2292 C C   . MET A 1 351 ? 52.931 53.034  60.343 1.00 25.98  ? 351 MET A C   1 
ATOM   2293 O O   . MET A 1 351 ? 53.763 52.919  59.456 1.00 29.04  ? 351 MET A O   1 
ATOM   2294 C CB  . MET A 1 351 ? 53.260 50.602  60.703 1.00 25.27  ? 351 MET A CB  1 
ATOM   2295 C CG  . MET A 1 351 ? 52.617 49.692  59.711 1.00 35.73  ? 351 MET A CG  1 
ATOM   2296 S SD  . MET A 1 351 ? 52.625 50.457  58.128 1.00 56.91  ? 351 MET A SD  1 
ATOM   2297 C CE  . MET A 1 351 ? 54.324 49.994  57.621 1.00 65.16  ? 351 MET A CE  1 
ATOM   2298 N N   . LYS A 1 352 ? 52.471 54.199  60.797 1.00 35.88  ? 352 LYS A N   1 
ATOM   2299 C CA  . LYS A 1 352 ? 52.841 55.527  60.265 1.00 35.64  ? 352 LYS A CA  1 
ATOM   2300 C C   . LYS A 1 352 ? 52.438 56.563  61.307 1.00 33.39  ? 352 LYS A C   1 
ATOM   2301 O O   . LYS A 1 352 ? 52.685 57.754  61.145 1.00 24.38  ? 352 LYS A O   1 
ATOM   2302 C CB  . LYS A 1 352 ? 52.115 55.847  58.939 1.00 37.75  ? 352 LYS A CB  1 
ATOM   2303 C CG  . LYS A 1 352 ? 52.804 55.299  57.683 1.00 32.28  ? 352 LYS A CG  1 
ATOM   2304 C CD  . LYS A 1 352 ? 51.942 55.375  56.451 1.00 21.98  ? 352 LYS A CD  1 
ATOM   2305 C CE  . LYS A 1 352 ? 52.307 54.257  55.509 1.00 11.87  ? 352 LYS A CE  1 
ATOM   2306 N NZ  . LYS A 1 352 ? 53.755 54.247  55.232 1.00 7.07   ? 352 LYS A NZ  1 
ATOM   2307 N N   . SER A 1 353 ? 51.786 56.075  62.359 1.00 33.15  ? 353 SER A N   1 
ATOM   2308 C CA  . SER A 1 353 ? 51.306 56.879  63.465 1.00 32.83  ? 353 SER A CA  1 
ATOM   2309 C C   . SER A 1 353 ? 52.465 57.367  64.312 1.00 34.36  ? 353 SER A C   1 
ATOM   2310 O O   . SER A 1 353 ? 53.535 56.759  64.324 1.00 40.31  ? 353 SER A O   1 
ATOM   2311 C CB  . SER A 1 353 ? 50.394 56.032  64.331 1.00 37.31  ? 353 SER A CB  1 
ATOM   2312 O OG  . SER A 1 353 ? 51.128 54.948  64.882 1.00 54.72  ? 353 SER A OG  1 
ATOM   2313 N N   . HIS A 1 354 ? 52.194 58.388  65.113 1.00 35.76  ? 354 HIS A N   1 
ATOM   2314 C CA  . HIS A 1 354 ? 53.198 59.005  65.969 1.00 35.45  ? 354 HIS A CA  1 
ATOM   2315 C C   . HIS A 1 354 ? 52.490 59.579  67.179 1.00 42.68  ? 354 HIS A C   1 
ATOM   2316 O O   . HIS A 1 354 ? 51.573 60.385  67.020 1.00 52.26  ? 354 HIS A O   1 
ATOM   2317 C CB  . HIS A 1 354 ? 53.811 60.191  65.231 1.00 34.98  ? 354 HIS A CB  1 
ATOM   2318 C CG  . HIS A 1 354 ? 55.159 59.931  64.650 1.00 21.52  ? 354 HIS A CG  1 
ATOM   2319 N ND1 . HIS A 1 354 ? 55.840 60.882  63.926 1.00 25.39  ? 354 HIS A ND1 1 
ATOM   2320 C CD2 . HIS A 1 354 ? 55.968 58.850  64.710 1.00 28.36  ? 354 HIS A CD2 1 
ATOM   2321 C CE1 . HIS A 1 354 ? 57.014 60.400  63.561 1.00 33.06  ? 354 HIS A CE1 1 
ATOM   2322 N NE2 . HIS A 1 354 ? 57.116 59.168  64.025 1.00 37.80  ? 354 HIS A NE2 1 
ATOM   2323 N N   . GLU A 1 355 ? 52.893 59.199  68.384 1.00 38.23  ? 355 GLU A N   1 
ATOM   2324 C CA  . GLU A 1 355 ? 52.247 59.784  69.544 1.00 33.89  ? 355 GLU A CA  1 
ATOM   2325 C C   . GLU A 1 355 ? 52.873 61.140  69.839 1.00 39.51  ? 355 GLU A C   1 
ATOM   2326 O O   . GLU A 1 355 ? 54.062 61.360  69.586 1.00 44.40  ? 355 GLU A O   1 
ATOM   2327 C CB  . GLU A 1 355 ? 52.351 58.877  70.762 1.00 35.66  ? 355 GLU A CB  1 
ATOM   2328 C CG  . GLU A 1 355 ? 51.493 57.645  70.667 1.00 47.84  ? 355 GLU A CG  1 
ATOM   2329 C CD  . GLU A 1 355 ? 51.382 56.898  71.984 1.00 55.28  ? 355 GLU A CD  1 
ATOM   2330 O OE1 . GLU A 1 355 ? 52.407 56.411  72.506 1.00 60.74  ? 355 GLU A OE1 1 
ATOM   2331 O OE2 . GLU A 1 355 ? 50.253 56.784  72.494 1.00 61.60  ? 355 GLU A OE2 1 
ATOM   2332 N N   . SER A 1 356 ? 52.051 62.063  70.320 1.00 39.68  ? 356 SER A N   1 
ATOM   2333 C CA  . SER A 1 356 ? 52.502 63.400  70.676 1.00 40.87  ? 356 SER A CA  1 
ATOM   2334 C C   . SER A 1 356 ? 53.288 63.334  71.987 1.00 43.79  ? 356 SER A C   1 
ATOM   2335 O O   . SER A 1 356 ? 52.928 62.570  72.882 1.00 43.92  ? 356 SER A O   1 
ATOM   2336 C CB  . SER A 1 356 ? 51.293 64.304  70.853 1.00 41.16  ? 356 SER A CB  1 
ATOM   2337 O OG  . SER A 1 356 ? 50.379 63.704  71.752 1.00 47.28  ? 356 SER A OG  1 
ATOM   2338 N N   . SER A 1 357 ? 54.333 64.154  72.113 1.00 46.06  ? 357 SER A N   1 
ATOM   2339 C CA  . SER A 1 357 ? 55.148 64.176  73.325 1.00 54.44  ? 357 SER A CA  1 
ATOM   2340 C C   . SER A 1 357 ? 54.245 64.259  74.568 1.00 67.61  ? 357 SER A C   1 
ATOM   2341 O O   . SER A 1 357 ? 54.570 63.682  75.610 1.00 70.32  ? 357 SER A O   1 
ATOM   2342 C CB  . SER A 1 357 ? 56.187 65.300  73.273 1.00 51.06  ? 357 SER A CB  1 
ATOM   2343 O OG  . SER A 1 357 ? 57.346 64.970  74.027 1.00 48.04  ? 357 SER A OG  1 
ATOM   2344 N N   . PRO A 1 358 ? 53.114 65.005  74.488 1.00 80.57  ? 358 PRO A N   1 
ATOM   2345 C CA  . PRO A 1 358 ? 52.201 65.084  75.643 1.00 86.06  ? 358 PRO A CA  1 
ATOM   2346 C C   . PRO A 1 358 ? 51.023 64.159  75.278 1.00 82.82  ? 358 PRO A C   1 
ATOM   2347 O O   . PRO A 1 358 ? 50.731 64.011  74.094 1.00 78.40  ? 358 PRO A O   1 
ATOM   2348 C CB  . PRO A 1 358 ? 51.733 66.556  75.635 1.00 88.28  ? 358 PRO A CB  1 
ATOM   2349 C CG  . PRO A 1 358 ? 52.558 67.243  74.554 1.00 91.34  ? 358 PRO A CG  1 
ATOM   2350 C CD  . PRO A 1 358 ? 52.848 66.134  73.579 1.00 87.01  ? 358 PRO A CD  1 
ATOM   2351 N N   . LYS A 1 359 ? 50.368 63.518  76.249 1.00 85.15  ? 359 LYS A N   1 
ATOM   2352 C CA  . LYS A 1 359 ? 49.232 62.651  75.902 1.00 86.05  ? 359 LYS A CA  1 
ATOM   2353 C C   . LYS A 1 359 ? 48.051 63.512  75.426 1.00 84.26  ? 359 LYS A C   1 
ATOM   2354 O O   . LYS A 1 359 ? 47.250 63.986  76.241 1.00 87.25  ? 359 LYS A O   1 
ATOM   2355 C CB  . LYS A 1 359 ? 48.797 61.760  77.075 1.00 88.82  ? 359 LYS A CB  1 
ATOM   2356 C CG  . LYS A 1 359 ? 47.760 60.710  76.647 1.00 88.27  ? 359 LYS A CG  1 
ATOM   2357 C CD  . LYS A 1 359 ? 47.258 59.832  77.787 1.00 91.01  ? 359 LYS A CD  1 
ATOM   2358 C CE  . LYS A 1 359 ? 46.362 58.708  77.242 1.00 88.66  ? 359 LYS A CE  1 
ATOM   2359 N NZ  . LYS A 1 359 ? 45.774 57.823  78.297 1.00 90.39  ? 359 LYS A NZ  1 
ATOM   2360 N N   . LYS A 1 360 ? 47.934 63.684  74.105 1.00 75.28  ? 360 LYS A N   1 
ATOM   2361 C CA  . LYS A 1 360 ? 46.884 64.514  73.536 1.00 56.86  ? 360 LYS A CA  1 
ATOM   2362 C C   . LYS A 1 360 ? 46.549 64.285  72.056 1.00 56.99  ? 360 LYS A C   1 
ATOM   2363 O O   . LYS A 1 360 ? 45.434 64.589  71.638 1.00 61.65  ? 360 LYS A O   1 
ATOM   2364 C CB  . LYS A 1 360 ? 47.265 65.988  73.721 1.00 47.89  ? 360 LYS A CB  1 
ATOM   2365 C CG  . LYS A 1 360 ? 46.227 66.962  73.200 1.00 57.01  ? 360 LYS A CG  1 
ATOM   2366 C CD  . LYS A 1 360 ? 46.808 68.327  72.841 1.00 50.33  ? 360 LYS A CD  1 
ATOM   2367 C CE  . LYS A 1 360 ? 45.853 69.069  71.897 1.00 51.65  ? 360 LYS A CE  1 
ATOM   2368 N NZ  . LYS A 1 360 ? 46.398 70.362  71.406 1.00 52.67  ? 360 LYS A NZ  1 
ATOM   2369 N N   . GLU A 1 361 ? 47.468 63.717  71.274 1.00 52.29  ? 361 GLU A N   1 
ATOM   2370 C CA  . GLU A 1 361 ? 47.237 63.542  69.833 1.00 48.80  ? 361 GLU A CA  1 
ATOM   2371 C C   . GLU A 1 361 ? 48.041 62.425  69.185 1.00 46.66  ? 361 GLU A C   1 
ATOM   2372 O O   . GLU A 1 361 ? 48.986 61.906  69.781 1.00 52.01  ? 361 GLU A O   1 
ATOM   2373 C CB  . GLU A 1 361 ? 47.559 64.848  69.088 1.00 42.33  ? 361 GLU A CB  1 
ATOM   2374 C CG  . GLU A 1 361 ? 46.553 65.966  69.272 1.00 43.30  ? 361 GLU A CG  1 
ATOM   2375 C CD  . GLU A 1 361 ? 46.924 67.242  68.528 1.00 46.75  ? 361 GLU A CD  1 
ATOM   2376 O OE1 . GLU A 1 361 ? 48.120 67.598  68.460 1.00 35.35  ? 361 GLU A OE1 1 
ATOM   2377 O OE2 . GLU A 1 361 ? 46.002 67.908  68.016 1.00 59.49  ? 361 GLU A OE2 1 
ATOM   2378 N N   . VAL A 1 362 ? 47.655 62.072  67.958 1.00 38.15  ? 362 VAL A N   1 
ATOM   2379 C CA  . VAL A 1 362 ? 48.333 61.035  67.186 1.00 33.64  ? 362 VAL A CA  1 
ATOM   2380 C C   . VAL A 1 362 ? 48.488 61.606  65.795 1.00 37.16  ? 362 VAL A C   1 
ATOM   2381 O O   . VAL A 1 362 ? 47.523 62.122  65.238 1.00 37.11  ? 362 VAL A O   1 
ATOM   2382 C CB  . VAL A 1 362 ? 47.504 59.746  67.049 1.00 26.86  ? 362 VAL A CB  1 
ATOM   2383 C CG1 . VAL A 1 362 ? 48.362 58.649  66.509 1.00 29.36  ? 362 VAL A CG1 1 
ATOM   2384 C CG2 . VAL A 1 362 ? 46.898 59.334  68.361 1.00 34.79  ? 362 VAL A CG2 1 
ATOM   2385 N N   . TYR A 1 363 ? 49.697 61.529  65.243 1.00 40.68  ? 363 TYR A N   1 
ATOM   2386 C CA  . TYR A 1 363 ? 49.968 62.047  63.907 1.00 41.59  ? 363 TYR A CA  1 
ATOM   2387 C C   . TYR A 1 363 ? 50.146 60.890  62.931 1.00 43.36  ? 363 TYR A C   1 
ATOM   2388 O O   . TYR A 1 363 ? 50.662 59.836  63.309 1.00 44.35  ? 363 TYR A O   1 
ATOM   2389 C CB  . TYR A 1 363 ? 51.235 62.896  63.908 1.00 47.01  ? 363 TYR A CB  1 
ATOM   2390 C CG  . TYR A 1 363 ? 51.294 63.932  65.002 1.00 49.44  ? 363 TYR A CG  1 
ATOM   2391 C CD1 . TYR A 1 363 ? 52.158 63.771  66.080 1.00 52.25  ? 363 TYR A CD1 1 
ATOM   2392 C CD2 . TYR A 1 363 ? 50.501 65.080  64.954 1.00 50.04  ? 363 TYR A CD2 1 
ATOM   2393 C CE1 . TYR A 1 363 ? 52.235 64.720  67.077 1.00 56.90  ? 363 TYR A CE1 1 
ATOM   2394 C CE2 . TYR A 1 363 ? 50.571 66.036  65.949 1.00 51.69  ? 363 TYR A CE2 1 
ATOM   2395 C CZ  . TYR A 1 363 ? 51.442 65.850  67.010 1.00 60.35  ? 363 TYR A CZ  1 
ATOM   2396 O OH  . TYR A 1 363 ? 51.523 66.785  68.016 1.00 73.52  ? 363 TYR A OH  1 
ATOM   2397 N N   . PHE A 1 364 ? 49.712 61.090  61.686 1.00 35.27  ? 364 PHE A N   1 
ATOM   2398 C CA  . PHE A 1 364 ? 49.817 60.081  60.640 1.00 24.06  ? 364 PHE A CA  1 
ATOM   2399 C C   . PHE A 1 364 ? 50.559 60.741  59.488 1.00 28.15  ? 364 PHE A C   1 
ATOM   2400 O O   . PHE A 1 364 ? 50.002 61.589  58.790 1.00 25.22  ? 364 PHE A O   1 
ATOM   2401 C CB  . PHE A 1 364 ? 48.429 59.655  60.167 1.00 18.50  ? 364 PHE A CB  1 
ATOM   2402 C CG  . PHE A 1 364 ? 47.532 59.129  61.263 1.00 22.80  ? 364 PHE A CG  1 
ATOM   2403 C CD1 . PHE A 1 364 ? 46.362 59.797  61.600 1.00 20.02  ? 364 PHE A CD1 1 
ATOM   2404 C CD2 . PHE A 1 364 ? 47.842 57.955  61.941 1.00 16.43  ? 364 PHE A CD2 1 
ATOM   2405 C CE1 . PHE A 1 364 ? 45.517 59.300  62.591 1.00 18.68  ? 364 PHE A CE1 1 
ATOM   2406 C CE2 . PHE A 1 364 ? 46.999 57.450  62.940 1.00 8.55   ? 364 PHE A CE2 1 
ATOM   2407 C CZ  . PHE A 1 364 ? 45.840 58.119  63.264 1.00 8.55   ? 364 PHE A CZ  1 
ATOM   2408 N N   . MET A 1 365 ? 51.821 60.374  59.291 1.00 30.31  ? 365 MET A N   1 
ATOM   2409 C CA  . MET A 1 365 ? 52.608 60.974  58.216 1.00 30.09  ? 365 MET A CA  1 
ATOM   2410 C C   . MET A 1 365 ? 53.359 59.968  57.336 1.00 33.16  ? 365 MET A C   1 
ATOM   2411 O O   . MET A 1 365 ? 54.064 59.075  57.847 1.00 28.89  ? 365 MET A O   1 
ATOM   2412 C CB  . MET A 1 365 ? 53.607 61.967  58.802 1.00 30.05  ? 365 MET A CB  1 
ATOM   2413 C CG  . MET A 1 365 ? 53.008 62.964  59.773 1.00 37.74  ? 365 MET A CG  1 
ATOM   2414 S SD  . MET A 1 365 ? 54.300 63.708  60.784 1.00 43.77  ? 365 MET A SD  1 
ATOM   2415 C CE  . MET A 1 365 ? 54.647 62.332  61.841 1.00 24.97  ? 365 MET A CE  1 
ATOM   2416 N N   . ALA A 1 366 ? 53.223 60.154  56.016 1.00 33.68  ? 366 ALA A N   1 
ATOM   2417 C CA  . ALA A 1 366 ? 53.870 59.309  55.003 1.00 30.41  ? 366 ALA A CA  1 
ATOM   2418 C C   . ALA A 1 366 ? 53.916 60.032  53.669 1.00 30.41  ? 366 ALA A C   1 
ATOM   2419 O O   . ALA A 1 366 ? 53.035 60.836  53.381 1.00 34.28  ? 366 ALA A O   1 
ATOM   2420 C CB  . ALA A 1 366 ? 53.108 58.016  54.844 1.00 25.92  ? 366 ALA A CB  1 
ATOM   2421 N N   . ILE A 1 367 ? 54.956 59.769  52.876 1.00 33.56  ? 367 ILE A N   1 
ATOM   2422 C CA  . ILE A 1 367 ? 55.127 60.375  51.535 1.00 38.78  ? 367 ILE A CA  1 
ATOM   2423 C C   . ILE A 1 367 ? 53.975 59.875  50.648 1.00 36.42  ? 367 ILE A C   1 
ATOM   2424 O O   . ILE A 1 367 ? 53.577 58.718  50.779 1.00 39.79  ? 367 ILE A O   1 
ATOM   2425 C CB  . ILE A 1 367 ? 56.494 59.974  50.931 1.00 38.38  ? 367 ILE A CB  1 
ATOM   2426 C CG1 . ILE A 1 367 ? 57.629 60.532  51.791 1.00 36.91  ? 367 ILE A CG1 1 
ATOM   2427 C CG2 . ILE A 1 367 ? 56.625 60.499  49.529 1.00 39.44  ? 367 ILE A CG2 1 
ATOM   2428 C CD1 . ILE A 1 367 ? 58.987 59.975  51.446 1.00 31.95  ? 367 ILE A CD1 1 
ATOM   2429 N N   . ILE A 1 368 ? 53.501 60.666  49.684 1.00 28.68  ? 368 ILE A N   1 
ATOM   2430 C CA  . ILE A 1 368 ? 52.339 60.200  48.954 1.00 27.61  ? 368 ILE A CA  1 
ATOM   2431 C C   . ILE A 1 368 ? 52.225 60.098  47.432 1.00 39.17  ? 368 ILE A C   1 
ATOM   2432 O O   . ILE A 1 368 ? 51.924 59.005  46.949 1.00 58.45  ? 368 ILE A O   1 
ATOM   2433 C CB  . ILE A 1 368 ? 51.034 60.788  49.618 1.00 22.88  ? 368 ILE A CB  1 
ATOM   2434 C CG1 . ILE A 1 368 ? 50.000 59.689  49.786 1.00 31.18  ? 368 ILE A CG1 1 
ATOM   2435 C CG2 . ILE A 1 368 ? 50.435 61.909  48.830 1.00 16.77  ? 368 ILE A CG2 1 
ATOM   2436 C CD1 . ILE A 1 368 ? 50.543 58.436  50.483 1.00 37.41  ? 368 ILE A CD1 1 
ATOM   2437 N N   . ASP A 1 369 ? 52.485 61.173  46.677 1.00 40.45  ? 369 ASP A N   1 
ATOM   2438 C CA  . ASP A 1 369 ? 52.361 61.155  45.194 1.00 42.01  ? 369 ASP A CA  1 
ATOM   2439 C C   . ASP A 1 369 ? 53.558 60.606  44.389 1.00 44.74  ? 369 ASP A C   1 
ATOM   2440 O O   . ASP A 1 369 ? 53.914 61.148  43.337 1.00 43.69  ? 369 ASP A O   1 
ATOM   2441 C CB  . ASP A 1 369 ? 52.019 62.560  44.664 1.00 54.11  ? 369 ASP A CB  1 
ATOM   2442 C CG  . ASP A 1 369 ? 50.557 62.952  44.890 1.00 65.18  ? 369 ASP A CG  1 
ATOM   2443 O OD1 . ASP A 1 369 ? 49.669 62.095  44.659 1.00 69.54  ? 369 ASP A OD1 1 
ATOM   2444 O OD2 . ASP A 1 369 ? 50.300 64.127  45.272 1.00 54.62  ? 369 ASP A OD2 1 
ATOM   2445 N N   . ILE A 1 370 ? 54.112 59.493  44.861 1.00 45.28  ? 370 ILE A N   1 
ATOM   2446 C CA  . ILE A 1 370 ? 55.271 58.796  44.289 1.00 44.67  ? 370 ILE A CA  1 
ATOM   2447 C C   . ILE A 1 370 ? 55.246 58.530  42.764 1.00 49.39  ? 370 ILE A C   1 
ATOM   2448 O O   . ILE A 1 370 ? 56.287 58.189  42.174 1.00 49.26  ? 370 ILE A O   1 
ATOM   2449 C CB  . ILE A 1 370 ? 55.469 57.453  45.053 1.00 43.69  ? 370 ILE A CB  1 
ATOM   2450 C CG1 . ILE A 1 370 ? 56.752 56.733  44.653 1.00 37.47  ? 370 ILE A CG1 1 
ATOM   2451 C CG2 . ILE A 1 370 ? 54.283 56.536  44.791 1.00 53.35  ? 370 ILE A CG2 1 
ATOM   2452 C CD1 . ILE A 1 370 ? 56.793 55.281  45.120 1.00 20.10  ? 370 ILE A CD1 1 
ATOM   2453 N N   . LEU A 1 371 ? 54.076 58.651  42.128 1.00 52.52  ? 371 LEU A N   1 
ATOM   2454 C CA  . LEU A 1 371 ? 53.979 58.423  40.678 1.00 56.57  ? 371 LEU A CA  1 
ATOM   2455 C C   . LEU A 1 371 ? 53.678 59.702  39.866 1.00 63.96  ? 371 LEU A C   1 
ATOM   2456 O O   . LEU A 1 371 ? 54.614 60.398  39.453 1.00 70.30  ? 371 LEU A O   1 
ATOM   2457 C CB  . LEU A 1 371 ? 52.994 57.287  40.357 1.00 47.91  ? 371 LEU A CB  1 
ATOM   2458 C CG  . LEU A 1 371 ? 53.300 55.929  41.007 1.00 47.84  ? 371 LEU A CG  1 
ATOM   2459 C CD1 . LEU A 1 371 ? 52.496 54.815  40.361 1.00 41.04  ? 371 LEU A CD1 1 
ATOM   2460 C CD2 . LEU A 1 371 ? 54.779 55.612  40.891 1.00 45.14  ? 371 LEU A CD2 1 
ATOM   2461 N N   . THR A 1 372 ? 52.402 59.993  39.599 1.00 65.54  ? 372 THR A N   1 
ATOM   2462 C CA  . THR A 1 372 ? 52.024 61.210  38.863 1.00 69.24  ? 372 THR A CA  1 
ATOM   2463 C C   . THR A 1 372 ? 50.649 61.736  39.282 1.00 73.43  ? 372 THR A C   1 
ATOM   2464 O O   . THR A 1 372 ? 49.629 61.208  38.784 1.00 77.07  ? 372 THR A O   1 
ATOM   2465 C CB  . THR A 1 372 ? 52.025 61.008  37.332 1.00 66.70  ? 372 THR A CB  1 
ATOM   2466 O OG1 . THR A 1 372 ? 53.265 60.427  36.920 1.00 71.53  ? 372 THR A OG1 1 
ATOM   2467 C CG2 . THR A 1 372 ? 51.867 62.343  36.633 1.00 65.66  ? 372 THR A CG2 1 
ATOM   2468 N N   . ALA A 1 391 ? 54.798 82.471  39.438 1.00 87.86  ? 391 ALA A N   1 
ATOM   2469 C CA  . ALA A 1 391 ? 54.966 83.387  38.271 1.00 90.03  ? 391 ALA A CA  1 
ATOM   2470 C C   . ALA A 1 391 ? 56.434 83.804  38.099 1.00 89.98  ? 391 ALA A C   1 
ATOM   2471 O O   . ALA A 1 391 ? 57.346 83.099  38.546 1.00 92.16  ? 391 ALA A O   1 
ATOM   2472 C CB  . ALA A 1 391 ? 54.072 84.619  38.449 1.00 90.03  ? 391 ALA A CB  1 
ATOM   2473 N N   . GLY A 1 392 ? 56.653 84.939  37.435 1.00 90.54  ? 392 GLY A N   1 
ATOM   2474 C CA  . GLY A 1 392 ? 58.000 85.440  37.220 1.00 89.74  ? 392 GLY A CA  1 
ATOM   2475 C C   . GLY A 1 392 ? 58.722 84.718  36.100 1.00 90.80  ? 392 GLY A C   1 
ATOM   2476 O O   . GLY A 1 392 ? 59.091 85.323  35.091 1.00 90.81  ? 392 GLY A O   1 
ATOM   2477 N N   . ALA A 1 393 ? 58.937 83.421  36.294 1.00 90.17  ? 393 ALA A N   1 
ATOM   2478 C CA  . ALA A 1 393 ? 59.610 82.583  35.314 1.00 89.78  ? 393 ALA A CA  1 
ATOM   2479 C C   . ALA A 1 393 ? 59.308 81.119  35.619 1.00 88.05  ? 393 ALA A C   1 
ATOM   2480 O O   . ALA A 1 393 ? 59.675 80.604  36.679 1.00 90.12  ? 393 ALA A O   1 
ATOM   2481 C CB  . ALA A 1 393 ? 61.119 82.834  35.344 1.00 88.53  ? 393 ALA A CB  1 
ATOM   2482 N N   . GLU A 1 394 ? 58.586 80.476  34.706 1.00 88.00  ? 394 GLU A N   1 
ATOM   2483 C CA  . GLU A 1 394 ? 58.223 79.068  34.842 1.00 89.04  ? 394 GLU A CA  1 
ATOM   2484 C C   . GLU A 1 394 ? 59.352 78.194  34.320 1.00 88.90  ? 394 GLU A C   1 
ATOM   2485 O O   . GLU A 1 394 ? 59.683 77.151  34.897 1.00 90.71  ? 394 GLU A O   1 
ATOM   2486 C CB  . GLU A 1 394 ? 56.954 78.778  34.037 1.00 90.96  ? 394 GLU A CB  1 
ATOM   2487 C CG  . GLU A 1 394 ? 56.642 77.293  33.853 1.00 87.14  ? 394 GLU A CG  1 
ATOM   2488 C CD  . GLU A 1 394 ? 55.345 77.068  33.108 1.00 88.79  ? 394 GLU A CD  1 
ATOM   2489 O OE1 . GLU A 1 394 ? 55.295 77.363  31.895 1.00 89.11  ? 394 GLU A OE1 1 
ATOM   2490 O OE2 . GLU A 1 394 ? 54.373 76.609  33.742 1.00 89.18  ? 394 GLU A OE2 1 
ATOM   2491 N N   . ILE A 1 395 ? 59.939 78.644  33.219 1.00 89.76  ? 395 ILE A N   1 
ATOM   2492 C CA  . ILE A 1 395 ? 61.017 77.925  32.569 1.00 88.85  ? 395 ILE A CA  1 
ATOM   2493 C C   . ILE A 1 395 ? 62.351 78.166  33.284 1.00 89.46  ? 395 ILE A C   1 
ATOM   2494 O O   . ILE A 1 395 ? 63.185 78.951  32.817 1.00 91.48  ? 395 ILE A O   1 
ATOM   2495 C CB  . ILE A 1 395 ? 61.099 78.325  31.078 1.00 89.86  ? 395 ILE A CB  1 
ATOM   2496 C CG1 . ILE A 1 395 ? 59.680 78.573  30.535 1.00 90.67  ? 395 ILE A CG1 1 
ATOM   2497 C CG2 . ILE A 1 395 ? 61.769 77.200  30.267 1.00 87.13  ? 395 ILE A CG2 1 
ATOM   2498 C CD1 . ILE A 1 395 ? 59.625 79.284  29.186 1.00 88.59  ? 395 ILE A CD1 1 
ATOM   2499 N N   . SER A 1 396 ? 62.499 77.506  34.437 1.00 91.75  ? 396 SER A N   1 
ATOM   2500 C CA  . SER A 1 396 ? 63.681 77.546  35.320 1.00 89.98  ? 396 SER A CA  1 
ATOM   2501 C C   . SER A 1 396 ? 63.228 77.245  36.755 1.00 90.20  ? 396 SER A C   1 
ATOM   2502 O O   . SER A 1 396 ? 63.251 78.111  37.634 1.00 88.61  ? 396 SER A O   1 
ATOM   2503 C CB  . SER A 1 396 ? 64.439 78.896  35.258 1.00 88.74  ? 396 SER A CB  1 
ATOM   2504 O OG  . SER A 1 396 ? 63.624 80.015  35.583 1.00 91.75  ? 396 SER A OG  1 
ATOM   2505 N N   . THR A 1 397 ? 62.829 76.001  36.990 1.00 87.66  ? 397 THR A N   1 
ATOM   2506 C CA  . THR A 1 397 ? 62.343 75.608  38.301 1.00 87.54  ? 397 THR A CA  1 
ATOM   2507 C C   . THR A 1 397 ? 63.218 74.601  39.082 1.00 87.99  ? 397 THR A C   1 
ATOM   2508 O O   . THR A 1 397 ? 64.432 74.542  38.877 1.00 85.62  ? 397 THR A O   1 
ATOM   2509 C CB  . THR A 1 397 ? 60.875 75.137  38.182 1.00 90.13  ? 397 THR A CB  1 
ATOM   2510 O OG1 . THR A 1 397 ? 60.759 74.179  37.120 1.00 90.34  ? 397 THR A OG1 1 
ATOM   2511 C CG2 . THR A 1 397 ? 59.968 76.322  37.871 1.00 83.23  ? 397 THR A CG2 1 
ATOM   2512 N N   . VAL A 1 398 ? 62.598 73.844  39.994 1.00 89.96  ? 398 VAL A N   1 
ATOM   2513 C CA  . VAL A 1 398 ? 63.283 72.852  40.838 1.00 87.15  ? 398 VAL A CA  1 
ATOM   2514 C C   . VAL A 1 398 ? 63.329 71.419  40.275 1.00 86.57  ? 398 VAL A C   1 
ATOM   2515 O O   . VAL A 1 398 ? 62.321 70.880  39.816 1.00 90.37  ? 398 VAL A O   1 
ATOM   2516 C CB  . VAL A 1 398 ? 62.651 72.822  42.242 1.00 87.02  ? 398 VAL A CB  1 
ATOM   2517 C CG1 . VAL A 1 398 ? 63.400 71.860  43.145 1.00 86.68  ? 398 VAL A CG1 1 
ATOM   2518 C CG2 . VAL A 1 398 ? 62.651 74.217  42.831 1.00 86.55  ? 398 VAL A CG2 1 
ATOM   2519 N N   . ASN A 1 399 ? 64.506 70.804  40.367 1.00 86.26  ? 399 ASN A N   1 
ATOM   2520 C CA  . ASN A 1 399 ? 64.760 69.449  39.868 1.00 82.80  ? 399 ASN A CA  1 
ATOM   2521 C C   . ASN A 1 399 ? 64.673 68.401  40.974 1.00 79.32  ? 399 ASN A C   1 
ATOM   2522 O O   . ASN A 1 399 ? 64.692 68.749  42.152 1.00 78.32  ? 399 ASN A O   1 
ATOM   2523 C CB  . ASN A 1 399 ? 66.165 69.390  39.253 1.00 87.77  ? 399 ASN A CB  1 
ATOM   2524 C CG  . ASN A 1 399 ? 67.267 69.712  40.265 1.00 88.86  ? 399 ASN A CG  1 
ATOM   2525 O OD1 . ASN A 1 399 ? 67.732 70.853  40.347 1.00 90.67  ? 399 ASN A OD1 1 
ATOM   2526 N ND2 . ASN A 1 399 ? 67.684 68.711  41.039 1.00 82.97  ? 399 ASN A ND2 1 
ATOM   2527 N N   . PRO A 1 400 ? 64.631 67.101  40.601 1.00 71.68  ? 400 PRO A N   1 
ATOM   2528 C CA  . PRO A 1 400 ? 64.554 65.967  41.524 1.00 72.50  ? 400 PRO A CA  1 
ATOM   2529 C C   . PRO A 1 400 ? 65.541 66.038  42.680 1.00 74.24  ? 400 PRO A C   1 
ATOM   2530 O O   . PRO A 1 400 ? 65.138 65.981  43.843 1.00 76.49  ? 400 PRO A O   1 
ATOM   2531 C CB  . PRO A 1 400 ? 64.857 64.785  40.615 1.00 62.60  ? 400 PRO A CB  1 
ATOM   2532 C CG  . PRO A 1 400 ? 64.157 65.170  39.389 1.00 65.46  ? 400 PRO A CG  1 
ATOM   2533 C CD  . PRO A 1 400 ? 64.546 66.618  39.212 1.00 65.05  ? 400 PRO A CD  1 
ATOM   2534 N N   . GLU A 1 401 ? 66.826 66.183  42.360 1.00 80.92  ? 401 GLU A N   1 
ATOM   2535 C CA  . GLU A 1 401 ? 67.868 66.256  43.381 1.00 78.64  ? 401 GLU A CA  1 
ATOM   2536 C C   . GLU A 1 401 ? 67.759 67.465  44.293 1.00 78.75  ? 401 GLU A C   1 
ATOM   2537 O O   . GLU A 1 401 ? 68.245 67.433  45.423 1.00 82.34  ? 401 GLU A O   1 
ATOM   2538 C CB  . GLU A 1 401 ? 69.259 66.178  42.755 1.00 80.38  ? 401 GLU A CB  1 
ATOM   2539 C CG  . GLU A 1 401 ? 69.706 64.753  42.422 1.00 86.89  ? 401 GLU A CG  1 
ATOM   2540 C CD  . GLU A 1 401 ? 69.788 63.830  43.644 1.00 86.83  ? 401 GLU A CD  1 
ATOM   2541 O OE1 . GLU A 1 401 ? 69.782 64.318  44.801 1.00 83.21  ? 401 GLU A OE1 1 
ATOM   2542 O OE2 . GLU A 1 401 ? 69.867 62.601  43.438 1.00 84.71  ? 401 GLU A OE2 1 
ATOM   2543 N N   . GLN A 1 402 ? 67.128 68.527  43.806 1.00 80.07  ? 402 GLN A N   1 
ATOM   2544 C CA  . GLN A 1 402 ? 66.935 69.725  44.616 1.00 85.73  ? 402 GLN A CA  1 
ATOM   2545 C C   . GLN A 1 402 ? 65.664 69.609  45.481 1.00 84.39  ? 402 GLN A C   1 
ATOM   2546 O O   . GLN A 1 402 ? 65.615 70.109  46.612 1.00 87.06  ? 402 GLN A O   1 
ATOM   2547 C CB  . GLN A 1 402 ? 66.869 70.971  43.725 1.00 87.39  ? 402 GLN A CB  1 
ATOM   2548 C CG  . GLN A 1 402 ? 68.229 71.498  43.261 1.00 92.13  ? 402 GLN A CG  1 
ATOM   2549 C CD  . GLN A 1 402 ? 69.001 72.233  44.350 1.00 91.58  ? 402 GLN A CD  1 
ATOM   2550 O OE1 . GLN A 1 402 ? 69.249 71.696  45.437 1.00 87.83  ? 402 GLN A OE1 1 
ATOM   2551 N NE2 . GLN A 1 402 ? 69.403 73.466  44.053 1.00 90.15  ? 402 GLN A NE2 1 
ATOM   2552 N N   . TYR A 1 403 ? 64.664 68.903  44.954 1.00 82.79  ? 403 TYR A N   1 
ATOM   2553 C CA  . TYR A 1 403 ? 63.387 68.702  45.638 1.00 74.66  ? 403 TYR A CA  1 
ATOM   2554 C C   . TYR A 1 403 ? 63.596 67.864  46.893 1.00 68.66  ? 403 TYR A C   1 
ATOM   2555 O O   . TYR A 1 403 ? 62.906 68.053  47.887 1.00 66.95  ? 403 TYR A O   1 
ATOM   2556 C CB  . TYR A 1 403 ? 62.396 68.006  44.694 1.00 70.86  ? 403 TYR A CB  1 
ATOM   2557 C CG  . TYR A 1 403 ? 60.940 68.057  45.111 1.00 71.22  ? 403 TYR A CG  1 
ATOM   2558 C CD1 . TYR A 1 403 ? 60.457 69.068  45.943 1.00 73.41  ? 403 TYR A CD1 1 
ATOM   2559 C CD2 . TYR A 1 403 ? 60.037 67.105  44.648 1.00 69.31  ? 403 TYR A CD2 1 
ATOM   2560 C CE1 . TYR A 1 403 ? 59.108 69.126  46.300 1.00 71.52  ? 403 TYR A CE1 1 
ATOM   2561 C CE2 . TYR A 1 403 ? 58.695 67.154  44.998 1.00 68.67  ? 403 TYR A CE2 1 
ATOM   2562 C CZ  . TYR A 1 403 ? 58.234 68.164  45.823 1.00 75.42  ? 403 TYR A CZ  1 
ATOM   2563 O OH  . TYR A 1 403 ? 56.901 68.210  46.171 1.00 73.09  ? 403 TYR A OH  1 
ATOM   2564 N N   . SER A 1 404 ? 64.575 66.964  46.842 1.00 63.15  ? 404 SER A N   1 
ATOM   2565 C CA  . SER A 1 404 ? 64.893 66.087  47.962 1.00 64.57  ? 404 SER A CA  1 
ATOM   2566 C C   . SER A 1 404 ? 65.220 66.844  49.241 1.00 70.31  ? 404 SER A C   1 
ATOM   2567 O O   . SER A 1 404 ? 64.506 66.732  50.245 1.00 70.32  ? 404 SER A O   1 
ATOM   2568 C CB  . SER A 1 404 ? 66.077 65.196  47.609 1.00 62.22  ? 404 SER A CB  1 
ATOM   2569 O OG  . SER A 1 404 ? 65.815 64.490  46.421 1.00 68.59  ? 404 SER A OG  1 
ATOM   2570 N N   . LYS A 1 405 ? 66.315 67.604  49.194 1.00 77.51  ? 405 LYS A N   1 
ATOM   2571 C CA  . LYS A 1 405 ? 66.787 68.389  50.335 1.00 74.60  ? 405 LYS A CA  1 
ATOM   2572 C C   . LYS A 1 405 ? 65.733 69.353  50.847 1.00 71.93  ? 405 LYS A C   1 
ATOM   2573 O O   . LYS A 1 405 ? 65.673 69.622  52.049 1.00 70.17  ? 405 LYS A O   1 
ATOM   2574 C CB  . LYS A 1 405 ? 68.056 69.162  49.964 1.00 75.90  ? 405 LYS A CB  1 
ATOM   2575 C CG  . LYS A 1 405 ? 69.320 68.650  50.633 1.00 73.11  ? 405 LYS A CG  1 
ATOM   2576 C CD  . LYS A 1 405 ? 70.518 69.509  50.261 1.00 74.23  ? 405 LYS A CD  1 
ATOM   2577 C CE  . LYS A 1 405 ? 71.768 69.072  51.007 1.00 75.31  ? 405 LYS A CE  1 
ATOM   2578 N NZ  . LYS A 1 405 ? 72.947 69.902  50.635 1.00 74.13  ? 405 LYS A NZ  1 
ATOM   2579 N N   . ARG A 1 406 ? 64.913 69.869  49.929 1.00 70.19  ? 406 ARG A N   1 
ATOM   2580 C CA  . ARG A 1 406 ? 63.850 70.803  50.276 1.00 69.51  ? 406 ARG A CA  1 
ATOM   2581 C C   . ARG A 1 406 ? 62.741 70.081  51.029 1.00 72.17  ? 406 ARG A C   1 
ATOM   2582 O O   . ARG A 1 406 ? 62.313 70.520  52.103 1.00 73.97  ? 406 ARG A O   1 
ATOM   2583 C CB  . ARG A 1 406 ? 63.279 71.472  49.022 1.00 64.51  ? 406 ARG A CB  1 
ATOM   2584 C CG  . ARG A 1 406 ? 62.278 72.573  49.340 1.00 64.42  ? 406 ARG A CG  1 
ATOM   2585 C CD  . ARG A 1 406 ? 61.920 73.387  48.123 1.00 64.39  ? 406 ARG A CD  1 
ATOM   2586 N NE  . ARG A 1 406 ? 61.212 72.601  47.121 1.00 72.59  ? 406 ARG A NE  1 
ATOM   2587 C CZ  . ARG A 1 406 ? 60.764 73.096  45.972 1.00 77.80  ? 406 ARG A CZ  1 
ATOM   2588 N NH1 . ARG A 1 406 ? 60.956 74.375  45.677 1.00 77.48  ? 406 ARG A NH1 1 
ATOM   2589 N NH2 . ARG A 1 406 ? 60.091 72.325  45.131 1.00 85.22  ? 406 ARG A NH2 1 
ATOM   2590 N N   . PHE A 1 407 ? 62.301 68.959  50.467 1.00 69.11  ? 407 PHE A N   1 
ATOM   2591 C CA  . PHE A 1 407 ? 61.243 68.155  51.062 1.00 69.27  ? 407 PHE A CA  1 
ATOM   2592 C C   . PHE A 1 407 ? 61.631 67.745  52.472 1.00 66.74  ? 407 PHE A C   1 
ATOM   2593 O O   . PHE A 1 407 ? 60.826 67.857  53.390 1.00 67.38  ? 407 PHE A O   1 
ATOM   2594 C CB  . PHE A 1 407 ? 60.976 66.909  50.206 1.00 70.10  ? 407 PHE A CB  1 
ATOM   2595 C CG  . PHE A 1 407 ? 59.828 66.058  50.691 1.00 62.73  ? 407 PHE A CG  1 
ATOM   2596 C CD1 . PHE A 1 407 ? 58.549 66.246  50.188 1.00 56.76  ? 407 PHE A CD1 1 
ATOM   2597 C CD2 . PHE A 1 407 ? 60.034 65.060  51.638 1.00 62.87  ? 407 PHE A CD2 1 
ATOM   2598 C CE1 . PHE A 1 407 ? 57.500 65.458  50.620 1.00 52.11  ? 407 PHE A CE1 1 
ATOM   2599 C CE2 . PHE A 1 407 ? 58.988 64.269  52.075 1.00 59.79  ? 407 PHE A CE2 1 
ATOM   2600 C CZ  . PHE A 1 407 ? 57.720 64.469  51.565 1.00 62.23  ? 407 PHE A CZ  1 
ATOM   2601 N N   . ASN A 1 408 ? 62.868 67.294  52.649 1.00 64.75  ? 408 ASN A N   1 
ATOM   2602 C CA  . ASN A 1 408 ? 63.319 66.868  53.968 1.00 65.75  ? 408 ASN A CA  1 
ATOM   2603 C C   . ASN A 1 408 ? 63.492 68.039  54.928 1.00 68.49  ? 408 ASN A C   1 
ATOM   2604 O O   . ASN A 1 408 ? 63.231 67.904  56.126 1.00 64.33  ? 408 ASN A O   1 
ATOM   2605 C CB  . ASN A 1 408 ? 64.624 66.084  53.874 1.00 59.10  ? 408 ASN A CB  1 
ATOM   2606 C CG  . ASN A 1 408 ? 64.969 65.388  55.173 1.00 62.41  ? 408 ASN A CG  1 
ATOM   2607 O OD1 . ASN A 1 408 ? 65.131 66.033  56.204 1.00 64.90  ? 408 ASN A OD1 1 
ATOM   2608 N ND2 . ASN A 1 408 ? 65.058 64.062  55.136 1.00 62.32  ? 408 ASN A ND2 1 
ATOM   2609 N N   . GLU A 1 409 ? 63.921 69.180  54.388 1.00 71.42  ? 409 GLU A N   1 
ATOM   2610 C CA  . GLU A 1 409 ? 64.154 70.388  55.178 1.00 71.50  ? 409 GLU A CA  1 
ATOM   2611 C C   . GLU A 1 409 ? 62.849 71.011  55.675 1.00 71.95  ? 409 GLU A C   1 
ATOM   2612 O O   . GLU A 1 409 ? 62.776 71.514  56.801 1.00 79.02  ? 409 GLU A O   1 
ATOM   2613 C CB  . GLU A 1 409 ? 64.968 71.404  54.365 1.00 72.01  ? 409 GLU A CB  1 
ATOM   2614 C CG  . GLU A 1 409 ? 65.337 72.676  55.113 1.00 71.18  ? 409 GLU A CG  1 
ATOM   2615 C CD  . GLU A 1 409 ? 66.110 73.655  54.249 1.00 68.71  ? 409 GLU A CD  1 
ATOM   2616 O OE1 . GLU A 1 409 ? 67.344 73.499  54.128 1.00 65.75  ? 409 GLU A OE1 1 
ATOM   2617 O OE2 . GLU A 1 409 ? 65.485 74.582  53.692 1.00 71.09  ? 409 GLU A OE2 1 
ATOM   2618 N N   . PHE A 1 410 ? 61.818 70.969  54.837 1.00 65.73  ? 410 PHE A N   1 
ATOM   2619 C CA  . PHE A 1 410 ? 60.519 71.511  55.212 1.00 57.89  ? 410 PHE A CA  1 
ATOM   2620 C C   . PHE A 1 410 ? 59.958 70.625  56.317 1.00 55.82  ? 410 PHE A C   1 
ATOM   2621 O O   . PHE A 1 410 ? 59.649 71.095  57.412 1.00 46.61  ? 410 PHE A O   1 
ATOM   2622 C CB  . PHE A 1 410 ? 59.570 71.497  54.014 1.00 55.14  ? 410 PHE A CB  1 
ATOM   2623 C CG  . PHE A 1 410 ? 58.249 72.155  54.282 1.00 53.04  ? 410 PHE A CG  1 
ATOM   2624 C CD1 . PHE A 1 410 ? 57.950 73.390  53.731 1.00 57.37  ? 410 PHE A CD1 1 
ATOM   2625 C CD2 . PHE A 1 410 ? 57.307 71.548  55.100 1.00 60.27  ? 410 PHE A CD2 1 
ATOM   2626 C CE1 . PHE A 1 410 ? 56.738 74.010  53.992 1.00 63.37  ? 410 PHE A CE1 1 
ATOM   2627 C CE2 . PHE A 1 410 ? 56.089 72.163  55.368 1.00 63.23  ? 410 PHE A CE2 1 
ATOM   2628 C CZ  . PHE A 1 410 ? 55.804 73.395  54.814 1.00 62.17  ? 410 PHE A CZ  1 
ATOM   2629 N N   . MET A 1 411 ? 59.871 69.330  56.024 1.00 56.44  ? 411 MET A N   1 
ATOM   2630 C CA  . MET A 1 411 ? 59.357 68.351  56.969 1.00 51.77  ? 411 MET A CA  1 
ATOM   2631 C C   . MET A 1 411 ? 60.227 68.251  58.212 1.00 56.87  ? 411 MET A C   1 
ATOM   2632 O O   . MET A 1 411 ? 59.743 67.867  59.264 1.00 65.49  ? 411 MET A O   1 
ATOM   2633 C CB  . MET A 1 411 ? 59.247 66.968  56.323 1.00 53.43  ? 411 MET A CB  1 
ATOM   2634 C CG  . MET A 1 411 ? 58.615 66.936  54.938 1.00 45.29  ? 411 MET A CG  1 
ATOM   2635 S SD  . MET A 1 411 ? 57.236 68.043  54.764 1.00 42.49  ? 411 MET A SD  1 
ATOM   2636 C CE  . MET A 1 411 ? 57.335 68.430  53.039 1.00 45.58  ? 411 MET A CE  1 
ATOM   2637 N N   . SER A 1 412 ? 61.505 68.597  58.098 1.00 54.73  ? 412 SER A N   1 
ATOM   2638 C CA  . SER A 1 412 ? 62.417 68.527  59.236 1.00 62.28  ? 412 SER A CA  1 
ATOM   2639 C C   . SER A 1 412 ? 61.992 69.457  60.376 1.00 62.78  ? 412 SER A C   1 
ATOM   2640 O O   . SER A 1 412 ? 62.282 69.186  61.548 1.00 57.83  ? 412 SER A O   1 
ATOM   2641 C CB  . SER A 1 412 ? 63.842 68.865  58.791 1.00 67.33  ? 412 SER A CB  1 
ATOM   2642 O OG  . SER A 1 412 ? 64.782 68.629  59.825 1.00 78.41  ? 412 SER A OG  1 
ATOM   2643 N N   . ASN A 1 413 ? 61.289 70.534  60.023 1.00 66.82  ? 413 ASN A N   1 
ATOM   2644 C CA  . ASN A 1 413 ? 60.815 71.519  60.996 1.00 73.35  ? 413 ASN A CA  1 
ATOM   2645 C C   . ASN A 1 413 ? 59.398 71.291  61.545 1.00 74.39  ? 413 ASN A C   1 
ATOM   2646 O O   . ASN A 1 413 ? 59.040 71.842  62.591 1.00 73.06  ? 413 ASN A O   1 
ATOM   2647 C CB  . ASN A 1 413 ? 60.911 72.925  60.410 1.00 80.21  ? 413 ASN A CB  1 
ATOM   2648 C CG  . ASN A 1 413 ? 62.304 73.488  60.488 1.00 80.81  ? 413 ASN A CG  1 
ATOM   2649 O OD1 . ASN A 1 413 ? 62.637 74.206  61.431 1.00 82.50  ? 413 ASN A OD1 1 
ATOM   2650 N ND2 . ASN A 1 413 ? 63.133 73.166  59.499 1.00 84.60  ? 413 ASN A ND2 1 
ATOM   2651 N N   . ILE A 1 414 ? 58.594 70.509  60.828 1.00 69.23  ? 414 ILE A N   1 
ATOM   2652 C CA  . ILE A 1 414 ? 57.227 70.207  61.244 1.00 62.80  ? 414 ILE A CA  1 
ATOM   2653 C C   . ILE A 1 414 ? 57.224 69.646  62.655 1.00 58.67  ? 414 ILE A C   1 
ATOM   2654 O O   . ILE A 1 414 ? 56.629 70.215  63.565 1.00 58.42  ? 414 ILE A O   1 
ATOM   2655 C CB  . ILE A 1 414 ? 56.582 69.143  60.338 1.00 63.99  ? 414 ILE A CB  1 
ATOM   2656 C CG1 . ILE A 1 414 ? 56.517 69.624  58.902 1.00 67.32  ? 414 ILE A CG1 1 
ATOM   2657 C CG2 . ILE A 1 414 ? 55.183 68.828  60.799 1.00 67.63  ? 414 ILE A CG2 1 
ATOM   2658 C CD1 . ILE A 1 414 ? 56.010 68.551  57.974 1.00 78.92  ? 414 ILE A CD1 1 
ATOM   2659 N N   . LEU A 1 415 ? 57.893 68.521  62.839 1.00 53.24  ? 415 LEU A N   1 
ATOM   2660 C CA  . LEU A 1 415 ? 57.917 67.920  64.156 1.00 58.18  ? 415 LEU A CA  1 
ATOM   2661 C C   . LEU A 1 415 ? 59.003 68.475  65.043 1.00 60.81  ? 415 LEU A C   1 
ATOM   2662 O O   . LEU A 1 415 ? 60.002 69.003  64.560 1.00 66.59  ? 415 LEU A O   1 
ATOM   2663 C CB  . LEU A 1 415 ? 57.994 66.393  64.091 1.00 45.52  ? 415 LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 415 ? 58.929 65.706  63.121 1.00 34.81  ? 415 LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 415 ? 59.032 64.274  63.533 1.00 42.23  ? 415 LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 415 ? 58.392 65.798  61.721 1.00 38.29  ? 415 LEU A CD2 1 
ATOM   2667 N N   . THR A 1 416 ? 58.752 68.408  66.346 1.00 62.96  ? 416 THR A N   1 
ATOM   2668 C CA  . THR A 1 416 ? 59.691 68.875  67.354 1.00 61.77  ? 416 THR A CA  1 
ATOM   2669 C C   . THR A 1 416 ? 59.849 67.773  68.398 1.00 65.84  ? 416 THR A C   1 
ATOM   2670 O O   . THR A 1 416 ? 58.874 67.009  68.599 1.00 65.12  ? 416 THR A O   1 
ATOM   2671 C CB  . THR A 1 416 ? 59.186 70.145  68.053 1.00 54.91  ? 416 THR A CB  1 
ATOM   2672 O OG1 . THR A 1 416 ? 57.998 69.837  68.790 1.00 60.42  ? 416 THR A OG1 1 
ATOM   2673 C CG2 . THR A 1 416 ? 58.887 71.237  67.035 1.00 54.22  ? 416 THR A CG2 1 
ATOM   2674 O OXT . THR A 1 416 ? 60.948 67.681  68.987 1.00 67.67  ? 416 THR A OXT 1 
ATOM   2675 N N   . PHE B 1 36  ? 49.501 21.952  42.979 1.00 72.52  ? 36  PHE B N   1 
ATOM   2676 C CA  . PHE B 1 36  ? 50.253 21.424  41.802 1.00 81.69  ? 36  PHE B CA  1 
ATOM   2677 C C   . PHE B 1 36  ? 49.326 20.635  40.872 1.00 83.00  ? 36  PHE B C   1 
ATOM   2678 O O   . PHE B 1 36  ? 48.246 20.201  41.279 1.00 85.76  ? 36  PHE B O   1 
ATOM   2679 C CB  . PHE B 1 36  ? 51.434 20.558  42.260 1.00 80.74  ? 36  PHE B CB  1 
ATOM   2680 C CG  . PHE B 1 36  ? 52.377 21.266  43.192 1.00 84.43  ? 36  PHE B CG  1 
ATOM   2681 C CD1 . PHE B 1 36  ? 52.804 20.654  44.366 1.00 89.79  ? 36  PHE B CD1 1 
ATOM   2682 C CD2 . PHE B 1 36  ? 52.818 22.559  42.911 1.00 90.53  ? 36  PHE B CD2 1 
ATOM   2683 C CE1 . PHE B 1 36  ? 53.662 21.322  45.257 1.00 93.11  ? 36  PHE B CE1 1 
ATOM   2684 C CE2 . PHE B 1 36  ? 53.674 23.237  43.792 1.00 88.75  ? 36  PHE B CE2 1 
ATOM   2685 C CZ  . PHE B 1 36  ? 54.096 22.617  44.968 1.00 93.76  ? 36  PHE B CZ  1 
ATOM   2686 N N   . ARG B 1 37  ? 49.781 20.401  39.642 1.00 82.39  ? 37  ARG B N   1 
ATOM   2687 C CA  . ARG B 1 37  ? 48.977 19.711  38.638 1.00 81.13  ? 37  ARG B CA  1 
ATOM   2688 C C   . ARG B 1 37  ? 49.495 18.343  38.129 1.00 79.31  ? 37  ARG B C   1 
ATOM   2689 O O   . ARG B 1 37  ? 50.298 17.681  38.793 1.00 66.94  ? 37  ARG B O   1 
ATOM   2690 C CB  . ARG B 1 37  ? 48.703 20.680  37.479 1.00 78.73  ? 37  ARG B CB  1 
ATOM   2691 C CG  . ARG B 1 37  ? 48.138 22.037  37.917 1.00 81.78  ? 37  ARG B CG  1 
ATOM   2692 C CD  . ARG B 1 37  ? 46.784 21.904  38.610 1.00 78.97  ? 37  ARG B CD  1 
ATOM   2693 N NE  . ARG B 1 37  ? 46.687 22.757  39.796 1.00 73.28  ? 37  ARG B NE  1 
ATOM   2694 C CZ  . ARG B 1 37  ? 45.543 23.166  40.344 1.00 67.41  ? 37  ARG B CZ  1 
ATOM   2695 N NH1 . ARG B 1 37  ? 44.378 22.814  39.821 1.00 70.41  ? 37  ARG B NH1 1 
ATOM   2696 N NH2 . ARG B 1 37  ? 45.562 23.904  41.443 1.00 63.03  ? 37  ARG B NH2 1 
ATOM   2697 N N   . ALA B 1 38  ? 49.024 17.939  36.947 1.00 83.35  ? 38  ALA B N   1 
ATOM   2698 C CA  . ALA B 1 38  ? 49.356 16.645  36.338 1.00 84.06  ? 38  ALA B CA  1 
ATOM   2699 C C   . ALA B 1 38  ? 50.464 16.580  35.287 1.00 80.36  ? 38  ALA B C   1 
ATOM   2700 O O   . ALA B 1 38  ? 51.311 17.473  35.179 1.00 79.59  ? 38  ALA B O   1 
ATOM   2701 C CB  . ALA B 1 38  ? 48.088 16.037  35.753 1.00 86.37  ? 38  ALA B CB  1 
ATOM   2702 N N   . SER B 1 39  ? 50.442 15.479  34.533 1.00 78.03  ? 39  SER B N   1 
ATOM   2703 C CA  . SER B 1 39  ? 51.396 15.213  33.463 1.00 81.57  ? 39  SER B CA  1 
ATOM   2704 C C   . SER B 1 39  ? 50.972 15.924  32.181 1.00 80.68  ? 39  SER B C   1 
ATOM   2705 O O   . SER B 1 39  ? 51.608 16.891  31.761 1.00 81.98  ? 39  SER B O   1 
ATOM   2706 C CB  . SER B 1 39  ? 51.504 13.702  33.213 1.00 86.02  ? 39  SER B CB  1 
ATOM   2707 O OG  . SER B 1 39  ? 50.262 13.133  32.820 1.00 84.35  ? 39  SER B OG  1 
ATOM   2708 N N   . GLU B 1 40  ? 49.903 15.434  31.557 1.00 76.85  ? 40  GLU B N   1 
ATOM   2709 C CA  . GLU B 1 40  ? 49.382 16.036  30.337 1.00 71.40  ? 40  GLU B CA  1 
ATOM   2710 C C   . GLU B 1 40  ? 48.874 17.433  30.685 1.00 66.85  ? 40  GLU B C   1 
ATOM   2711 O O   . GLU B 1 40  ? 48.206 17.617  31.708 1.00 69.29  ? 40  GLU B O   1 
ATOM   2712 C CB  . GLU B 1 40  ? 48.206 15.221  29.803 1.00 75.98  ? 40  GLU B CB  1 
ATOM   2713 C CG  . GLU B 1 40  ? 48.515 13.797  29.395 1.00 80.46  ? 40  GLU B CG  1 
ATOM   2714 C CD  . GLU B 1 40  ? 47.397 13.212  28.545 1.00 86.43  ? 40  GLU B CD  1 
ATOM   2715 O OE1 . GLU B 1 40  ? 46.681 12.298  29.018 1.00 86.59  ? 40  GLU B OE1 1 
ATOM   2716 O OE2 . GLU B 1 40  ? 47.225 13.688  27.401 1.00 88.13  ? 40  GLU B OE2 1 
ATOM   2717 N N   . PRO B 1 41  ? 49.177 18.438  29.846 1.00 61.74  ? 41  PRO B N   1 
ATOM   2718 C CA  . PRO B 1 41  ? 48.710 19.800  30.134 1.00 56.19  ? 41  PRO B CA  1 
ATOM   2719 C C   . PRO B 1 41  ? 47.189 19.876  30.205 1.00 47.50  ? 41  PRO B C   1 
ATOM   2720 O O   . PRO B 1 41  ? 46.636 20.752  30.858 1.00 46.09  ? 41  PRO B O   1 
ATOM   2721 C CB  . PRO B 1 41  ? 49.267 20.608  28.966 1.00 56.55  ? 41  PRO B CB  1 
ATOM   2722 C CG  . PRO B 1 41  ? 50.541 19.886  28.657 1.00 62.52  ? 41  PRO B CG  1 
ATOM   2723 C CD  . PRO B 1 41  ? 50.077 18.437  28.683 1.00 61.92  ? 41  PRO B CD  1 
ATOM   2724 N N   . ILE B 1 42  ? 46.511 18.946  29.548 1.00 42.33  ? 42  ILE B N   1 
ATOM   2725 C CA  . ILE B 1 42  ? 45.062 18.939  29.590 1.00 40.39  ? 42  ILE B CA  1 
ATOM   2726 C C   . ILE B 1 42  ? 44.601 18.425  30.952 1.00 38.77  ? 42  ILE B C   1 
ATOM   2727 O O   . ILE B 1 42  ? 43.620 18.927  31.492 1.00 43.55  ? 42  ILE B O   1 
ATOM   2728 C CB  . ILE B 1 42  ? 44.442 18.104  28.461 1.00 39.06  ? 42  ILE B CB  1 
ATOM   2729 C CG1 . ILE B 1 42  ? 42.942 18.356  28.421 1.00 46.19  ? 42  ILE B CG1 1 
ATOM   2730 C CG2 . ILE B 1 42  ? 44.733 16.619  28.659 1.00 42.97  ? 42  ILE B CG2 1 
ATOM   2731 C CD1 . ILE B 1 42  ? 42.213 17.486  27.454 1.00 55.26  ? 42  ILE B CD1 1 
ATOM   2732 N N   . LEU B 1 43  ? 45.304 17.446  31.522 1.00 28.25  ? 43  LEU B N   1 
ATOM   2733 C CA  . LEU B 1 43  ? 44.915 16.958  32.837 1.00 29.51  ? 43  LEU B CA  1 
ATOM   2734 C C   . LEU B 1 43  ? 45.117 18.038  33.885 1.00 30.57  ? 43  LEU B C   1 
ATOM   2735 O O   . LEU B 1 43  ? 44.460 18.025  34.923 1.00 40.65  ? 43  LEU B O   1 
ATOM   2736 C CB  . LEU B 1 43  ? 45.684 15.707  33.232 1.00 24.18  ? 43  LEU B CB  1 
ATOM   2737 C CG  . LEU B 1 43  ? 45.354 14.488  32.377 1.00 35.48  ? 43  LEU B CG  1 
ATOM   2738 C CD1 . LEU B 1 43  ? 45.638 13.244  33.190 1.00 33.81  ? 43  LEU B CD1 1 
ATOM   2739 C CD2 . LEU B 1 43  ? 43.892 14.507  31.932 1.00 30.54  ? 43  LEU B CD2 1 
ATOM   2740 N N   . SER B 1 44  ? 46.032 18.966  33.618 1.00 27.66  ? 44  SER B N   1 
ATOM   2741 C CA  . SER B 1 44  ? 46.291 20.066  34.540 1.00 21.78  ? 44  SER B CA  1 
ATOM   2742 C C   . SER B 1 44  ? 45.239 21.138  34.351 1.00 16.63  ? 44  SER B C   1 
ATOM   2743 O O   . SER B 1 44  ? 44.837 21.788  35.316 1.00 22.72  ? 44  SER B O   1 
ATOM   2744 C CB  . SER B 1 44  ? 47.673 20.663  34.318 1.00 18.64  ? 44  SER B CB  1 
ATOM   2745 O OG  . SER B 1 44  ? 48.660 19.726  34.692 1.00 27.72  ? 44  SER B OG  1 
ATOM   2746 N N   . VAL B 1 45  ? 44.789 21.330  33.115 1.00 6.84   ? 45  VAL B N   1 
ATOM   2747 C CA  . VAL B 1 45  ? 43.767 22.330  32.875 1.00 10.87  ? 45  VAL B CA  1 
ATOM   2748 C C   . VAL B 1 45  ? 42.434 21.798  33.404 1.00 13.41  ? 45  VAL B C   1 
ATOM   2749 O O   . VAL B 1 45  ? 41.572 22.577  33.789 1.00 22.76  ? 45  VAL B O   1 
ATOM   2750 C CB  . VAL B 1 45  ? 43.679 22.752  31.381 1.00 13.90  ? 45  VAL B CB  1 
ATOM   2751 C CG1 . VAL B 1 45  ? 42.460 23.626  31.142 1.00 12.17  ? 45  VAL B CG1 1 
ATOM   2752 C CG2 . VAL B 1 45  ? 44.913 23.551  30.992 1.00 7.50   ? 45  VAL B CG2 1 
ATOM   2753 N N   . LEU B 1 46  ? 42.290 20.475  33.494 1.00 10.94  ? 46  LEU B N   1 
ATOM   2754 C CA  . LEU B 1 46  ? 41.045 19.886  34.005 1.00 13.47  ? 46  LEU B CA  1 
ATOM   2755 C C   . LEU B 1 46  ? 40.960 20.150  35.499 1.00 20.45  ? 46  LEU B C   1 
ATOM   2756 O O   . LEU B 1 46  ? 39.988 20.726  35.997 1.00 18.85  ? 46  LEU B O   1 
ATOM   2757 C CB  . LEU B 1 46  ? 40.982 18.371  33.760 1.00 3.40   ? 46  LEU B CB  1 
ATOM   2758 C CG  . LEU B 1 46  ? 39.787 17.640  34.391 1.00 2.00   ? 46  LEU B CG  1 
ATOM   2759 C CD1 . LEU B 1 46  ? 38.500 18.297  34.017 1.00 2.00   ? 46  LEU B CD1 1 
ATOM   2760 C CD2 . LEU B 1 46  ? 39.737 16.205  33.944 1.00 2.94   ? 46  LEU B CD2 1 
ATOM   2761 N N   . MET B 1 47  ? 41.997 19.722  36.209 1.00 24.73  ? 47  MET B N   1 
ATOM   2762 C CA  . MET B 1 47  ? 42.074 19.899  37.653 1.00 23.37  ? 47  MET B CA  1 
ATOM   2763 C C   . MET B 1 47  ? 41.930 21.374  37.998 1.00 21.72  ? 47  MET B C   1 
ATOM   2764 O O   . MET B 1 47  ? 41.242 21.739  38.951 1.00 28.01  ? 47  MET B O   1 
ATOM   2765 C CB  . MET B 1 47  ? 43.404 19.354  38.162 1.00 12.03  ? 47  MET B CB  1 
ATOM   2766 C CG  . MET B 1 47  ? 43.581 17.904  37.820 1.00 16.62  ? 47  MET B CG  1 
ATOM   2767 S SD  . MET B 1 47  ? 45.262 17.389  38.019 1.00 25.88  ? 47  MET B SD  1 
ATOM   2768 C CE  . MET B 1 47  ? 45.331 17.270  39.792 1.00 21.15  ? 47  MET B CE  1 
ATOM   2769 N N   . TRP B 1 48  ? 42.549 22.229  37.195 1.00 13.78  ? 48  TRP B N   1 
ATOM   2770 C CA  . TRP B 1 48  ? 42.453 23.650  37.445 1.00 13.17  ? 48  TRP B CA  1 
ATOM   2771 C C   . TRP B 1 48  ? 41.023 24.111  37.201 1.00 18.28  ? 48  TRP B C   1 
ATOM   2772 O O   . TRP B 1 48  ? 40.523 24.974  37.915 1.00 26.75  ? 48  TRP B O   1 
ATOM   2773 C CB  . TRP B 1 48  ? 43.407 24.405  36.545 1.00 9.96   ? 48  TRP B CB  1 
ATOM   2774 C CG  . TRP B 1 48  ? 43.361 25.876  36.713 1.00 11.33  ? 48  TRP B CG  1 
ATOM   2775 C CD1 . TRP B 1 48  ? 44.285 26.656  37.344 1.00 7.64   ? 48  TRP B CD1 1 
ATOM   2776 C CD2 . TRP B 1 48  ? 42.359 26.767  36.205 1.00 4.73   ? 48  TRP B CD2 1 
ATOM   2777 N NE1 . TRP B 1 48  ? 43.921 27.983  37.254 1.00 9.32   ? 48  TRP B NE1 1 
ATOM   2778 C CE2 . TRP B 1 48  ? 42.742 28.072  36.558 1.00 6.85   ? 48  TRP B CE2 1 
ATOM   2779 C CE3 . TRP B 1 48  ? 41.173 26.583  35.488 1.00 2.00   ? 48  TRP B CE3 1 
ATOM   2780 C CZ2 . TRP B 1 48  ? 41.981 29.184  36.223 1.00 4.85   ? 48  TRP B CZ2 1 
ATOM   2781 C CZ3 . TRP B 1 48  ? 40.410 27.699  35.160 1.00 2.81   ? 48  TRP B CZ3 1 
ATOM   2782 C CH2 . TRP B 1 48  ? 40.818 28.975  35.527 1.00 5.06   ? 48  TRP B CH2 1 
ATOM   2783 N N   . GLY B 1 49  ? 40.359 23.506  36.218 1.00 15.81  ? 49  GLY B N   1 
ATOM   2784 C CA  . GLY B 1 49  ? 38.990 23.875  35.881 1.00 14.44  ? 49  GLY B CA  1 
ATOM   2785 C C   . GLY B 1 49  ? 37.899 23.424  36.847 1.00 19.30  ? 49  GLY B C   1 
ATOM   2786 O O   . GLY B 1 49  ? 37.007 24.205  37.178 1.00 18.55  ? 49  GLY B O   1 
ATOM   2787 N N   . VAL B 1 50  ? 37.934 22.158  37.262 1.00 18.87  ? 50  VAL B N   1 
ATOM   2788 C CA  . VAL B 1 50  ? 36.958 21.614  38.206 1.00 12.83  ? 50  VAL B CA  1 
ATOM   2789 C C   . VAL B 1 50  ? 37.190 22.265  39.564 1.00 18.87  ? 50  VAL B C   1 
ATOM   2790 O O   . VAL B 1 50  ? 36.302 22.293  40.413 1.00 29.76  ? 50  VAL B O   1 
ATOM   2791 C CB  . VAL B 1 50  ? 37.113 20.081  38.338 1.00 15.18  ? 50  VAL B CB  1 
ATOM   2792 C CG1 . VAL B 1 50  ? 36.281 19.547  39.465 1.00 21.45  ? 50  VAL B CG1 1 
ATOM   2793 C CG2 . VAL B 1 50  ? 36.691 19.401  37.050 1.00 22.68  ? 50  VAL B CG2 1 
ATOM   2794 N N   . ASN B 1 51  ? 38.401 22.770  39.781 1.00 21.76  ? 51  ASN B N   1 
ATOM   2795 C CA  . ASN B 1 51  ? 38.730 23.436  41.035 1.00 16.82  ? 51  ASN B CA  1 
ATOM   2796 C C   . ASN B 1 51  ? 38.157 24.848  40.998 1.00 13.42  ? 51  ASN B C   1 
ATOM   2797 O O   . ASN B 1 51  ? 37.464 25.267  41.920 1.00 13.47  ? 51  ASN B O   1 
ATOM   2798 C CB  . ASN B 1 51  ? 40.241 23.503  41.242 1.00 13.65  ? 51  ASN B CB  1 
ATOM   2799 C CG  . ASN B 1 51  ? 40.601 24.056  42.589 1.00 24.35  ? 51  ASN B CG  1 
ATOM   2800 O OD1 . ASN B 1 51  ? 40.860 25.255  42.739 1.00 12.80  ? 51  ASN B OD1 1 
ATOM   2801 N ND2 . ASN B 1 51  ? 40.570 23.195  43.604 1.00 32.69  ? 51  ASN B ND2 1 
ATOM   2802 N N   . HIS B 1 52  ? 38.430 25.557  39.903 1.00 11.16  ? 52  HIS B N   1 
ATOM   2803 C CA  . HIS B 1 52  ? 37.959 26.929  39.704 1.00 6.94   ? 52  HIS B CA  1 
ATOM   2804 C C   . HIS B 1 52  ? 36.452 27.029  39.672 1.00 12.28  ? 52  HIS B C   1 
ATOM   2805 O O   . HIS B 1 52  ? 35.875 27.890  40.328 1.00 10.19  ? 52  HIS B O   1 
ATOM   2806 C CB  . HIS B 1 52  ? 38.465 27.489  38.382 1.00 2.33   ? 52  HIS B CB  1 
ATOM   2807 C CG  . HIS B 1 52  ? 37.988 28.874  38.106 1.00 2.00   ? 52  HIS B CG  1 
ATOM   2808 N ND1 . HIS B 1 52  ? 38.441 29.963  38.812 1.00 10.48  ? 52  HIS B ND1 1 
ATOM   2809 C CD2 . HIS B 1 52  ? 37.060 29.346  37.245 1.00 3.20   ? 52  HIS B CD2 1 
ATOM   2810 C CE1 . HIS B 1 52  ? 37.809 31.048  38.405 1.00 3.84   ? 52  HIS B CE1 1 
ATOM   2811 N NE2 . HIS B 1 52  ? 36.965 30.701  37.454 1.00 2.70   ? 52  HIS B NE2 1 
ATOM   2812 N N   . THR B 1 53  ? 35.835 26.174  38.859 1.00 13.16  ? 53  THR B N   1 
ATOM   2813 C CA  . THR B 1 53  ? 34.394 26.167  38.695 1.00 15.26  ? 53  THR B CA  1 
ATOM   2814 C C   . THR B 1 53  ? 33.663 25.794  39.971 1.00 20.04  ? 53  THR B C   1 
ATOM   2815 O O   . THR B 1 53  ? 32.634 26.395  40.291 1.00 31.65  ? 53  THR B O   1 
ATOM   2816 C CB  . THR B 1 53  ? 33.962 25.232  37.545 1.00 11.15  ? 53  THR B CB  1 
ATOM   2817 O OG1 . THR B 1 53  ? 34.413 23.903  37.822 1.00 17.02  ? 53  THR B OG1 1 
ATOM   2818 C CG2 . THR B 1 53  ? 34.576 25.688  36.223 1.00 11.36  ? 53  THR B CG2 1 
ATOM   2819 N N   . ILE B 1 54  ? 34.185 24.811  40.704 1.00 18.49  ? 54  ILE B N   1 
ATOM   2820 C CA  . ILE B 1 54  ? 33.532 24.385  41.941 1.00 13.99  ? 54  ILE B CA  1 
ATOM   2821 C C   . ILE B 1 54  ? 33.657 25.488  43.008 1.00 13.42  ? 54  ILE B C   1 
ATOM   2822 O O   . ILE B 1 54  ? 32.684 25.807  43.686 1.00 18.95  ? 54  ILE B O   1 
ATOM   2823 C CB  . ILE B 1 54  ? 34.050 22.991  42.417 1.00 6.33   ? 54  ILE B CB  1 
ATOM   2824 C CG1 . ILE B 1 54  ? 32.972 21.944  42.210 1.00 6.29   ? 54  ILE B CG1 1 
ATOM   2825 C CG2 . ILE B 1 54  ? 34.376 22.982  43.869 1.00 11.20  ? 54  ILE B CG2 1 
ATOM   2826 C CD1 . ILE B 1 54  ? 33.099 21.202  40.923 1.00 14.24  ? 54  ILE B CD1 1 
ATOM   2827 N N   . ASN B 1 55  ? 34.835 26.095  43.131 1.00 10.27  ? 55  ASN B N   1 
ATOM   2828 C CA  . ASN B 1 55  ? 35.018 27.164  44.102 1.00 8.85   ? 55  ASN B CA  1 
ATOM   2829 C C   . ASN B 1 55  ? 34.105 28.311  43.677 1.00 11.80  ? 55  ASN B C   1 
ATOM   2830 O O   . ASN B 1 55  ? 33.355 28.849  44.479 1.00 11.91  ? 55  ASN B O   1 
ATOM   2831 C CB  . ASN B 1 55  ? 36.476 27.647  44.134 1.00 8.49   ? 55  ASN B CB  1 
ATOM   2832 C CG  . ASN B 1 55  ? 37.416 26.663  44.817 1.00 13.54  ? 55  ASN B CG  1 
ATOM   2833 O OD1 . ASN B 1 55  ? 38.620 26.650  44.542 1.00 20.16  ? 55  ASN B OD1 1 
ATOM   2834 N ND2 . ASN B 1 55  ? 36.879 25.838  45.708 1.00 14.92  ? 55  ASN B ND2 1 
ATOM   2835 N N   . GLU B 1 56  ? 34.126 28.630  42.391 1.00 9.87   ? 56  GLU B N   1 
ATOM   2836 C CA  . GLU B 1 56  ? 33.311 29.703  41.863 1.00 11.61  ? 56  GLU B CA  1 
ATOM   2837 C C   . GLU B 1 56  ? 31.858 29.438  42.229 1.00 13.46  ? 56  GLU B C   1 
ATOM   2838 O O   . GLU B 1 56  ? 31.125 30.351  42.599 1.00 14.48  ? 56  GLU B O   1 
ATOM   2839 C CB  . GLU B 1 56  ? 33.442 29.766  40.346 1.00 20.57  ? 56  GLU B CB  1 
ATOM   2840 C CG  . GLU B 1 56  ? 33.225 31.142  39.760 1.00 31.74  ? 56  GLU B CG  1 
ATOM   2841 C CD  . GLU B 1 56  ? 34.285 32.120  40.219 1.00 47.71  ? 56  GLU B CD  1 
ATOM   2842 O OE1 . GLU B 1 56  ? 35.487 31.755  40.201 1.00 51.33  ? 56  GLU B OE1 1 
ATOM   2843 O OE2 . GLU B 1 56  ? 33.916 33.246  40.618 1.00 54.23  ? 56  GLU B OE2 1 
ATOM   2844 N N   . LEU B 1 57  ? 31.453 28.178  42.170 1.00 8.91   ? 57  LEU B N   1 
ATOM   2845 C CA  . LEU B 1 57  ? 30.075 27.834  42.490 1.00 17.79  ? 57  LEU B CA  1 
ATOM   2846 C C   . LEU B 1 57  ? 29.784 27.969  43.998 1.00 22.76  ? 57  LEU B C   1 
ATOM   2847 O O   . LEU B 1 57  ? 28.632 28.202  44.392 1.00 22.98  ? 57  LEU B O   1 
ATOM   2848 C CB  . LEU B 1 57  ? 29.743 26.411  42.008 1.00 3.55   ? 57  LEU B CB  1 
ATOM   2849 C CG  . LEU B 1 57  ? 29.082 26.211  40.660 1.00 2.00   ? 57  LEU B CG  1 
ATOM   2850 C CD1 . LEU B 1 57  ? 29.017 24.736  40.322 1.00 2.00   ? 57  LEU B CD1 1 
ATOM   2851 C CD2 . LEU B 1 57  ? 27.690 26.760  40.726 1.00 5.58   ? 57  LEU B CD2 1 
ATOM   2852 N N   . SER B 1 58  ? 30.824 27.878  44.831 1.00 17.51  ? 58  SER B N   1 
ATOM   2853 C CA  . SER B 1 58  ? 30.638 27.945  46.279 1.00 13.71  ? 58  SER B CA  1 
ATOM   2854 C C   . SER B 1 58  ? 30.182 29.307  46.745 1.00 13.28  ? 58  SER B C   1 
ATOM   2855 O O   . SER B 1 58  ? 29.823 29.481  47.911 1.00 16.22  ? 58  SER B O   1 
ATOM   2856 C CB  . SER B 1 58  ? 31.919 27.559  47.017 1.00 12.75  ? 58  SER B CB  1 
ATOM   2857 O OG  . SER B 1 58  ? 32.791 28.664  47.144 1.00 31.65  ? 58  SER B OG  1 
ATOM   2858 N N   . ASN B 1 59  ? 30.247 30.285  45.848 1.00 16.31  ? 59  ASN B N   1 
ATOM   2859 C CA  . ASN B 1 59  ? 29.827 31.640  46.175 1.00 16.72  ? 59  ASN B CA  1 
ATOM   2860 C C   . ASN B 1 59  ? 28.485 31.977  45.539 1.00 14.44  ? 59  ASN B C   1 
ATOM   2861 O O   . ASN B 1 59  ? 27.851 32.941  45.933 1.00 18.94  ? 59  ASN B O   1 
ATOM   2862 C CB  . ASN B 1 59  ? 30.904 32.649  45.777 1.00 17.66  ? 59  ASN B CB  1 
ATOM   2863 C CG  . ASN B 1 59  ? 32.197 32.450  46.559 1.00 20.66  ? 59  ASN B CG  1 
ATOM   2864 O OD1 . ASN B 1 59  ? 32.167 32.250  47.761 1.00 40.78  ? 59  ASN B OD1 1 
ATOM   2865 N ND2 . ASN B 1 59  ? 33.329 32.475  45.873 1.00 28.93  ? 59  ASN B ND2 1 
ATOM   2866 N N   . VAL B 1 60  ? 28.045 31.184  44.564 1.00 7.96   ? 60  VAL B N   1 
ATOM   2867 C CA  . VAL B 1 60  ? 26.751 31.436  43.945 1.00 4.79   ? 60  VAL B CA  1 
ATOM   2868 C C   . VAL B 1 60  ? 25.754 30.539  44.632 1.00 8.09   ? 60  VAL B C   1 
ATOM   2869 O O   . VAL B 1 60  ? 25.769 29.333  44.449 1.00 9.26   ? 60  VAL B O   1 
ATOM   2870 C CB  . VAL B 1 60  ? 26.723 31.228  42.386 1.00 5.90   ? 60  VAL B CB  1 
ATOM   2871 C CG1 . VAL B 1 60  ? 27.903 30.399  41.910 1.00 4.77   ? 60  VAL B CG1 1 
ATOM   2872 C CG2 . VAL B 1 60  ? 25.373 30.596  41.941 1.00 2.20   ? 60  VAL B CG2 1 
ATOM   2873 N N   . PRO B 1 61  ? 24.863 31.128  45.431 1.00 5.27   ? 61  PRO B N   1 
ATOM   2874 C CA  . PRO B 1 61  ? 23.827 30.433  46.184 1.00 8.82   ? 61  PRO B CA  1 
ATOM   2875 C C   . PRO B 1 61  ? 23.012 29.372  45.454 1.00 14.89  ? 61  PRO B C   1 
ATOM   2876 O O   . PRO B 1 61  ? 22.828 29.439  44.243 1.00 21.10  ? 61  PRO B O   1 
ATOM   2877 C CB  . PRO B 1 61  ? 22.955 31.577  46.672 1.00 5.53   ? 61  PRO B CB  1 
ATOM   2878 C CG  . PRO B 1 61  ? 23.233 32.679  45.710 1.00 4.16   ? 61  PRO B CG  1 
ATOM   2879 C CD  . PRO B 1 61  ? 24.690 32.579  45.558 1.00 3.57   ? 61  PRO B CD  1 
ATOM   2880 N N   . VAL B 1 62  ? 22.567 28.372  46.216 1.00 20.34  ? 62  VAL B N   1 
ATOM   2881 C CA  . VAL B 1 62  ? 21.744 27.274  45.715 1.00 15.08  ? 62  VAL B CA  1 
ATOM   2882 C C   . VAL B 1 62  ? 20.303 27.788  45.604 1.00 25.51  ? 62  VAL B C   1 
ATOM   2883 O O   . VAL B 1 62  ? 19.673 28.124  46.612 1.00 28.65  ? 62  VAL B O   1 
ATOM   2884 C CB  . VAL B 1 62  ? 21.763 26.109  46.689 1.00 4.17   ? 62  VAL B CB  1 
ATOM   2885 C CG1 . VAL B 1 62  ? 20.914 24.987  46.182 1.00 6.41   ? 62  VAL B CG1 1 
ATOM   2886 C CG2 . VAL B 1 62  ? 23.172 25.653  46.918 1.00 2.79   ? 62  VAL B CG2 1 
ATOM   2887 N N   . PRO B 1 63  ? 19.754 27.818  44.378 1.00 28.32  ? 63  PRO B N   1 
ATOM   2888 C CA  . PRO B 1 63  ? 18.399 28.286  44.066 1.00 27.56  ? 63  PRO B CA  1 
ATOM   2889 C C   . PRO B 1 63  ? 17.335 27.374  44.642 1.00 28.53  ? 63  PRO B C   1 
ATOM   2890 O O   . PRO B 1 63  ? 17.625 26.221  44.954 1.00 31.01  ? 63  PRO B O   1 
ATOM   2891 C CB  . PRO B 1 63  ? 18.380 28.212  42.551 1.00 29.81  ? 63  PRO B CB  1 
ATOM   2892 C CG  . PRO B 1 63  ? 19.147 26.958  42.305 1.00 29.23  ? 63  PRO B CG  1 
ATOM   2893 C CD  . PRO B 1 63  ? 20.348 27.163  43.201 1.00 28.30  ? 63  PRO B CD  1 
ATOM   2894 N N   . VAL B 1 64  ? 16.102 27.876  44.744 1.00 27.81  ? 64  VAL B N   1 
ATOM   2895 C CA  . VAL B 1 64  ? 14.978 27.087  45.266 1.00 22.07  ? 64  VAL B CA  1 
ATOM   2896 C C   . VAL B 1 64  ? 14.535 26.075  44.229 1.00 27.19  ? 64  VAL B C   1 
ATOM   2897 O O   . VAL B 1 64  ? 13.888 25.088  44.565 1.00 36.26  ? 64  VAL B O   1 
ATOM   2898 C CB  . VAL B 1 64  ? 13.758 27.953  45.630 1.00 18.66  ? 64  VAL B CB  1 
ATOM   2899 C CG1 . VAL B 1 64  ? 14.144 29.017  46.610 1.00 14.79  ? 64  VAL B CG1 1 
ATOM   2900 C CG2 . VAL B 1 64  ? 13.153 28.575  44.394 1.00 30.08  ? 64  VAL B CG2 1 
ATOM   2901 N N   . MET B 1 65  ? 14.875 26.346  42.968 1.00 29.82  ? 65  MET B N   1 
ATOM   2902 C CA  . MET B 1 65  ? 14.556 25.472  41.847 1.00 26.67  ? 65  MET B CA  1 
ATOM   2903 C C   . MET B 1 65  ? 15.378 25.879  40.632 1.00 25.05  ? 65  MET B C   1 
ATOM   2904 O O   . MET B 1 65  ? 15.928 26.979  40.593 1.00 30.82  ? 65  MET B O   1 
ATOM   2905 C CB  . MET B 1 65  ? 13.062 25.546  41.519 1.00 31.79  ? 65  MET B CB  1 
ATOM   2906 C CG  . MET B 1 65  ? 12.601 26.864  40.952 1.00 30.02  ? 65  MET B CG  1 
ATOM   2907 S SD  . MET B 1 65  ? 10.878 26.779  40.413 1.00 45.39  ? 65  MET B SD  1 
ATOM   2908 C CE  . MET B 1 65  ? 10.924 25.553  39.122 1.00 45.39  ? 65  MET B CE  1 
ATOM   2909 N N   . LEU B 1 66  ? 15.493 24.988  39.653 1.00 22.72  ? 66  LEU B N   1 
ATOM   2910 C CA  . LEU B 1 66  ? 16.251 25.305  38.449 1.00 24.14  ? 66  LEU B CA  1 
ATOM   2911 C C   . LEU B 1 66  ? 15.347 25.951  37.408 1.00 33.38  ? 66  LEU B C   1 
ATOM   2912 O O   . LEU B 1 66  ? 14.330 25.370  36.995 1.00 32.73  ? 66  LEU B O   1 
ATOM   2913 C CB  . LEU B 1 66  ? 16.894 24.056  37.845 1.00 16.29  ? 66  LEU B CB  1 
ATOM   2914 C CG  . LEU B 1 66  ? 18.084 23.388  38.529 1.00 12.63  ? 66  LEU B CG  1 
ATOM   2915 C CD1 . LEU B 1 66  ? 18.423 22.069  37.835 1.00 9.55   ? 66  LEU B CD1 1 
ATOM   2916 C CD2 . LEU B 1 66  ? 19.265 24.321  38.493 1.00 14.92  ? 66  LEU B CD2 1 
ATOM   2917 N N   . MET B 1 67  ? 15.697 27.172  37.014 1.00 34.20  ? 67  MET B N   1 
ATOM   2918 C CA  . MET B 1 67  ? 14.938 27.872  35.996 1.00 32.96  ? 67  MET B CA  1 
ATOM   2919 C C   . MET B 1 67  ? 15.297 27.269  34.654 1.00 38.61  ? 67  MET B C   1 
ATOM   2920 O O   . MET B 1 67  ? 16.276 26.527  34.530 1.00 34.95  ? 67  MET B O   1 
ATOM   2921 C CB  . MET B 1 67  ? 15.234 29.365  36.010 1.00 36.74  ? 67  MET B CB  1 
ATOM   2922 C CG  . MET B 1 67  ? 14.337 30.130  36.953 1.00 41.14  ? 67  MET B CG  1 
ATOM   2923 S SD  . MET B 1 67  ? 12.617 29.708  36.643 1.00 39.23  ? 67  MET B SD  1 
ATOM   2924 C CE  . MET B 1 67  ? 12.328 28.435  37.863 1.00 35.77  ? 67  MET B CE  1 
ATOM   2925 N N   . PRO B 1 68  ? 14.482 27.538  33.635 1.00 40.77  ? 68  PRO B N   1 
ATOM   2926 C CA  . PRO B 1 68  ? 14.735 27.004  32.297 1.00 45.84  ? 68  PRO B CA  1 
ATOM   2927 C C   . PRO B 1 68  ? 16.060 27.477  31.671 1.00 47.44  ? 68  PRO B C   1 
ATOM   2928 O O   . PRO B 1 68  ? 16.686 26.727  30.918 1.00 47.98  ? 68  PRO B O   1 
ATOM   2929 C CB  . PRO B 1 68  ? 13.508 27.467  31.516 1.00 42.97  ? 68  PRO B CB  1 
ATOM   2930 C CG  . PRO B 1 68  ? 13.118 28.739  32.232 1.00 47.79  ? 68  PRO B CG  1 
ATOM   2931 C CD  . PRO B 1 68  ? 13.253 28.345  33.661 1.00 41.49  ? 68  PRO B CD  1 
ATOM   2932 N N   . ASP B 1 69  ? 16.494 28.696  32.008 1.00 44.11  ? 69  ASP B N   1 
ATOM   2933 C CA  . ASP B 1 69  ? 17.745 29.256  31.489 1.00 41.10  ? 69  ASP B CA  1 
ATOM   2934 C C   . ASP B 1 69  ? 18.967 28.456  31.911 1.00 35.88  ? 69  ASP B C   1 
ATOM   2935 O O   . ASP B 1 69  ? 19.951 28.384  31.179 1.00 41.22  ? 69  ASP B O   1 
ATOM   2936 C CB  . ASP B 1 69  ? 17.933 30.697  31.959 1.00 48.62  ? 69  ASP B CB  1 
ATOM   2937 C CG  . ASP B 1 69  ? 17.287 31.700  31.040 1.00 58.43  ? 69  ASP B CG  1 
ATOM   2938 O OD1 . ASP B 1 69  ? 16.820 32.735  31.552 1.00 64.61  ? 69  ASP B OD1 1 
ATOM   2939 O OD2 . ASP B 1 69  ? 17.265 31.468  29.809 1.00 57.57  ? 69  ASP B OD2 1 
ATOM   2940 N N   . ASP B 1 70  ? 18.900 27.869  33.100 1.00 32.52  ? 70  ASP B N   1 
ATOM   2941 C CA  . ASP B 1 70  ? 19.996 27.080  33.635 1.00 25.04  ? 70  ASP B CA  1 
ATOM   2942 C C   . ASP B 1 70  ? 20.391 25.924  32.747 1.00 24.92  ? 70  ASP B C   1 
ATOM   2943 O O   . ASP B 1 70  ? 21.488 25.396  32.892 1.00 34.66  ? 70  ASP B O   1 
ATOM   2944 C CB  . ASP B 1 70  ? 19.666 26.578  35.039 1.00 22.77  ? 70  ASP B CB  1 
ATOM   2945 C CG  . ASP B 1 70  ? 19.639 27.692  36.057 1.00 18.44  ? 70  ASP B CG  1 
ATOM   2946 O OD1 . ASP B 1 70  ? 20.631 28.442  36.142 1.00 23.73  ? 70  ASP B OD1 1 
ATOM   2947 O OD2 . ASP B 1 70  ? 18.628 27.825  36.768 1.00 17.36  ? 70  ASP B OD2 1 
ATOM   2948 N N   . PHE B 1 71  ? 19.518 25.535  31.821 1.00 27.05  ? 71  PHE B N   1 
ATOM   2949 C CA  . PHE B 1 71  ? 19.831 24.431  30.906 1.00 28.21  ? 71  PHE B CA  1 
ATOM   2950 C C   . PHE B 1 71  ? 20.415 24.930  29.591 1.00 27.12  ? 71  PHE B C   1 
ATOM   2951 O O   . PHE B 1 71  ? 20.689 24.137  28.688 1.00 34.35  ? 71  PHE B O   1 
ATOM   2952 C CB  . PHE B 1 71  ? 18.592 23.570  30.654 1.00 20.55  ? 71  PHE B CB  1 
ATOM   2953 C CG  . PHE B 1 71  ? 18.043 22.952  31.896 1.00 7.27   ? 71  PHE B CG  1 
ATOM   2954 C CD1 . PHE B 1 71  ? 17.328 23.713  32.793 1.00 2.00   ? 71  PHE B CD1 1 
ATOM   2955 C CD2 . PHE B 1 71  ? 18.297 21.627  32.193 1.00 13.87  ? 71  PHE B CD2 1 
ATOM   2956 C CE1 . PHE B 1 71  ? 16.877 23.160  33.975 1.00 13.32  ? 71  PHE B CE1 1 
ATOM   2957 C CE2 . PHE B 1 71  ? 17.853 21.057  33.374 1.00 6.88   ? 71  PHE B CE2 1 
ATOM   2958 C CZ  . PHE B 1 71  ? 17.143 21.820  34.270 1.00 12.95  ? 71  PHE B CZ  1 
ATOM   2959 N N   . LYS B 1 72  ? 20.657 26.241  29.536 1.00 23.34  ? 72  LYS B N   1 
ATOM   2960 C CA  . LYS B 1 72  ? 21.209 26.931  28.374 1.00 16.94  ? 72  LYS B CA  1 
ATOM   2961 C C   . LYS B 1 72  ? 22.428 27.765  28.743 1.00 20.43  ? 72  LYS B C   1 
ATOM   2962 O O   . LYS B 1 72  ? 23.129 28.257  27.874 1.00 26.18  ? 72  LYS B O   1 
ATOM   2963 C CB  . LYS B 1 72  ? 20.166 27.870  27.807 1.00 16.42  ? 72  LYS B CB  1 
ATOM   2964 C CG  . LYS B 1 72  ? 18.975 27.173  27.214 1.00 26.78  ? 72  LYS B CG  1 
ATOM   2965 C CD  . LYS B 1 72  ? 17.902 28.172  26.865 1.00 40.44  ? 72  LYS B CD  1 
ATOM   2966 C CE  . LYS B 1 72  ? 16.811 27.486  26.091 1.00 58.08  ? 72  LYS B CE  1 
ATOM   2967 N NZ  . LYS B 1 72  ? 15.650 28.398  25.912 1.00 83.59  ? 72  LYS B NZ  1 
ATOM   2968 N N   . ALA B 1 73  ? 22.669 27.934  30.034 1.00 19.91  ? 73  ALA B N   1 
ATOM   2969 C CA  . ALA B 1 73  ? 23.790 28.727  30.531 1.00 15.64  ? 73  ALA B CA  1 
ATOM   2970 C C   . ALA B 1 73  ? 25.110 28.003  30.464 1.00 8.58   ? 73  ALA B C   1 
ATOM   2971 O O   . ALA B 1 73  ? 25.143 26.820  30.152 1.00 12.90  ? 73  ALA B O   1 
ATOM   2972 C CB  . ALA B 1 73  ? 23.519 29.127  31.987 1.00 27.31  ? 73  ALA B CB  1 
ATOM   2973 N N   . TYR B 1 74  ? 26.188 28.729  30.774 1.00 8.46   ? 74  TYR B N   1 
ATOM   2974 C CA  . TYR B 1 74  ? 27.549 28.177  30.834 1.00 11.22  ? 74  TYR B CA  1 
ATOM   2975 C C   . TYR B 1 74  ? 28.521 29.181  31.406 1.00 8.54   ? 74  TYR B C   1 
ATOM   2976 O O   . TYR B 1 74  ? 28.198 30.360  31.513 1.00 12.55  ? 74  TYR B O   1 
ATOM   2977 C CB  . TYR B 1 74  ? 28.058 27.705  29.460 1.00 24.23  ? 74  TYR B CB  1 
ATOM   2978 C CG  . TYR B 1 74  ? 28.272 28.776  28.392 1.00 23.28  ? 74  TYR B CG  1 
ATOM   2979 C CD1 . TYR B 1 74  ? 29.486 29.425  28.260 1.00 19.10  ? 74  TYR B CD1 1 
ATOM   2980 C CD2 . TYR B 1 74  ? 27.264 29.102  27.494 1.00 31.01  ? 74  TYR B CD2 1 
ATOM   2981 C CE1 . TYR B 1 74  ? 29.688 30.373  27.262 1.00 23.57  ? 74  TYR B CE1 1 
ATOM   2982 C CE2 . TYR B 1 74  ? 27.459 30.040  26.496 1.00 24.87  ? 74  TYR B CE2 1 
ATOM   2983 C CZ  . TYR B 1 74  ? 28.671 30.679  26.383 1.00 26.52  ? 74  TYR B CZ  1 
ATOM   2984 O OH  . TYR B 1 74  ? 28.855 31.645  25.404 1.00 16.55  ? 74  TYR B OH  1 
ATOM   2985 N N   . SER B 1 75  ? 29.709 28.713  31.770 1.00 11.69  ? 75  SER B N   1 
ATOM   2986 C CA  . SER B 1 75  ? 30.756 29.589  32.304 1.00 23.56  ? 75  SER B CA  1 
ATOM   2987 C C   . SER B 1 75  ? 31.987 29.400  31.423 1.00 30.67  ? 75  SER B C   1 
ATOM   2988 O O   . SER B 1 75  ? 32.322 28.272  31.048 1.00 37.17  ? 75  SER B O   1 
ATOM   2989 C CB  . SER B 1 75  ? 31.100 29.226  33.748 1.00 19.50  ? 75  SER B CB  1 
ATOM   2990 O OG  . SER B 1 75  ? 31.779 27.978  33.812 1.00 16.62  ? 75  SER B OG  1 
ATOM   2991 N N   . LYS B 1 76  ? 32.672 30.489  31.100 1.00 27.00  ? 76  LYS B N   1 
ATOM   2992 C CA  . LYS B 1 76  ? 33.838 30.396  30.241 1.00 22.71  ? 76  LYS B CA  1 
ATOM   2993 C C   . LYS B 1 76  ? 35.011 31.221  30.822 1.00 30.27  ? 76  LYS B C   1 
ATOM   2994 O O   . LYS B 1 76  ? 34.826 32.365  31.267 1.00 34.35  ? 76  LYS B O   1 
ATOM   2995 C CB  . LYS B 1 76  ? 33.433 30.866  28.846 1.00 23.20  ? 76  LYS B CB  1 
ATOM   2996 C CG  . LYS B 1 76  ? 34.171 30.156  27.746 1.00 28.96  ? 76  LYS B CG  1 
ATOM   2997 C CD  . LYS B 1 76  ? 33.328 30.062  26.493 1.00 41.94  ? 76  LYS B CD  1 
ATOM   2998 C CE  . LYS B 1 76  ? 33.054 31.426  25.856 1.00 46.53  ? 76  LYS B CE  1 
ATOM   2999 N NZ  . LYS B 1 76  ? 32.275 31.284  24.574 1.00 45.36  ? 76  LYS B NZ  1 
ATOM   3000 N N   . ILE B 1 77  ? 36.209 30.632  30.846 1.00 23.75  ? 77  ILE B N   1 
ATOM   3001 C CA  . ILE B 1 77  ? 37.389 31.299  31.405 1.00 16.47  ? 77  ILE B CA  1 
ATOM   3002 C C   . ILE B 1 77  ? 38.591 31.174  30.480 1.00 20.98  ? 77  ILE B C   1 
ATOM   3003 O O   . ILE B 1 77  ? 38.959 30.058  30.083 1.00 25.07  ? 77  ILE B O   1 
ATOM   3004 C CB  . ILE B 1 77  ? 37.818 30.675  32.754 1.00 18.21  ? 77  ILE B CB  1 
ATOM   3005 C CG1 . ILE B 1 77  ? 36.606 30.382  33.640 1.00 41.43  ? 77  ILE B CG1 1 
ATOM   3006 C CG2 . ILE B 1 77  ? 38.717 31.635  33.509 1.00 12.72  ? 77  ILE B CG2 1 
ATOM   3007 C CD1 . ILE B 1 77  ? 36.010 28.954  33.486 1.00 54.35  ? 77  ILE B CD1 1 
ATOM   3008 N N   . LYS B 1 78  ? 39.229 32.306  30.183 1.00 15.09  ? 78  LYS B N   1 
ATOM   3009 C CA  . LYS B 1 78  ? 40.410 32.327  29.323 1.00 21.17  ? 78  LYS B CA  1 
ATOM   3010 C C   . LYS B 1 78  ? 41.644 32.848  30.073 1.00 25.90  ? 78  LYS B C   1 
ATOM   3011 O O   . LYS B 1 78  ? 41.766 34.047  30.341 1.00 30.74  ? 78  LYS B O   1 
ATOM   3012 C CB  . LYS B 1 78  ? 40.147 33.197  28.096 1.00 24.91  ? 78  LYS B CB  1 
ATOM   3013 C CG  . LYS B 1 78  ? 41.294 33.233  27.095 1.00 30.37  ? 78  LYS B CG  1 
ATOM   3014 C CD  . LYS B 1 78  ? 41.034 34.262  26.003 1.00 39.69  ? 78  LYS B CD  1 
ATOM   3015 C CE  . LYS B 1 78  ? 42.327 34.743  25.378 1.00 42.93  ? 78  LYS B CE  1 
ATOM   3016 N NZ  . LYS B 1 78  ? 43.213 33.593  25.012 1.00 51.56  ? 78  LYS B NZ  1 
ATOM   3017 N N   . VAL B 1 79  ? 42.573 31.946  30.364 1.00 22.94  ? 79  VAL B N   1 
ATOM   3018 C CA  . VAL B 1 79  ? 43.800 32.273  31.081 1.00 19.86  ? 79  VAL B CA  1 
ATOM   3019 C C   . VAL B 1 79  ? 45.012 32.491  30.161 1.00 27.27  ? 79  VAL B C   1 
ATOM   3020 O O   . VAL B 1 79  ? 45.235 31.733  29.203 1.00 24.47  ? 79  VAL B O   1 
ATOM   3021 C CB  . VAL B 1 79  ? 44.142 31.157  32.067 1.00 15.81  ? 79  VAL B CB  1 
ATOM   3022 C CG1 . VAL B 1 79  ? 45.347 31.538  32.911 1.00 12.70  ? 79  VAL B CG1 1 
ATOM   3023 C CG2 . VAL B 1 79  ? 42.943 30.859  32.925 1.00 15.13  ? 79  VAL B CG2 1 
ATOM   3024 N N   . ASP B 1 80  ? 45.785 33.535  30.469 1.00 32.55  ? 80  ASP B N   1 
ATOM   3025 C CA  . ASP B 1 80  ? 46.990 33.903  29.721 1.00 39.70  ? 80  ASP B CA  1 
ATOM   3026 C C   . ASP B 1 80  ? 47.981 34.482  30.727 1.00 34.43  ? 80  ASP B C   1 
ATOM   3027 O O   . ASP B 1 80  ? 47.969 35.692  30.959 1.00 32.04  ? 80  ASP B O   1 
ATOM   3028 C CB  . ASP B 1 80  ? 46.696 34.984  28.650 1.00 53.52  ? 80  ASP B CB  1 
ATOM   3029 C CG  . ASP B 1 80  ? 45.496 34.639  27.735 1.00 76.05  ? 80  ASP B CG  1 
ATOM   3030 O OD1 . ASP B 1 80  ? 45.488 33.550  27.102 1.00 80.80  ? 80  ASP B OD1 1 
ATOM   3031 O OD2 . ASP B 1 80  ? 44.561 35.480  27.635 1.00 78.42  ? 80  ASP B OD2 1 
ATOM   3032 N N   . ASN B 1 81  ? 48.763 33.616  31.381 1.00 28.32  ? 81  ASN B N   1 
ATOM   3033 C CA  . ASN B 1 81  ? 49.773 34.036  32.366 1.00 28.66  ? 81  ASN B CA  1 
ATOM   3034 C C   . ASN B 1 81  ? 51.151 34.187  31.739 1.00 27.42  ? 81  ASN B C   1 
ATOM   3035 O O   . ASN B 1 81  ? 51.734 33.217  31.256 1.00 25.32  ? 81  ASN B O   1 
ATOM   3036 C CB  . ASN B 1 81  ? 49.944 33.016  33.488 1.00 23.96  ? 81  ASN B CB  1 
ATOM   3037 C CG  . ASN B 1 81  ? 48.671 32.691  34.189 1.00 24.16  ? 81  ASN B CG  1 
ATOM   3038 O OD1 . ASN B 1 81  ? 48.490 31.557  34.620 1.00 24.25  ? 81  ASN B OD1 1 
ATOM   3039 N ND2 . ASN B 1 81  ? 47.784 33.680  34.346 1.00 23.58  ? 81  ASN B ND2 1 
ATOM   3040 N N   . HIS B 1 82  ? 51.724 35.373  31.854 1.00 27.26  ? 82  HIS B N   1 
ATOM   3041 C CA  . HIS B 1 82  ? 53.028 35.610  31.287 1.00 25.03  ? 82  HIS B CA  1 
ATOM   3042 C C   . HIS B 1 82  ? 54.085 35.420  32.338 1.00 27.11  ? 82  HIS B C   1 
ATOM   3043 O O   . HIS B 1 82  ? 54.077 36.121  33.348 1.00 31.78  ? 82  HIS B O   1 
ATOM   3044 C CB  . HIS B 1 82  ? 53.105 37.028  30.728 1.00 33.72  ? 82  HIS B CB  1 
ATOM   3045 C CG  . HIS B 1 82  ? 54.387 37.326  30.013 1.00 39.50  ? 82  HIS B CG  1 
ATOM   3046 N ND1 . HIS B 1 82  ? 55.063 38.519  30.156 1.00 39.89  ? 82  HIS B ND1 1 
ATOM   3047 C CD2 . HIS B 1 82  ? 55.125 36.572  29.165 1.00 34.98  ? 82  HIS B CD2 1 
ATOM   3048 C CE1 . HIS B 1 82  ? 56.163 38.488  29.431 1.00 39.67  ? 82  HIS B CE1 1 
ATOM   3049 N NE2 . HIS B 1 82  ? 56.225 37.317  28.821 1.00 45.87  ? 82  HIS B NE2 1 
ATOM   3050 N N   . LEU B 1 83  ? 54.969 34.446  32.111 1.00 31.73  ? 83  LEU B N   1 
ATOM   3051 C CA  . LEU B 1 83  ? 56.088 34.138  33.018 1.00 28.10  ? 83  LEU B CA  1 
ATOM   3052 C C   . LEU B 1 83  ? 55.629 33.909  34.443 1.00 30.56  ? 83  LEU B C   1 
ATOM   3053 O O   . LEU B 1 83  ? 56.394 34.103  35.383 1.00 35.87  ? 83  LEU B O   1 
ATOM   3054 C CB  . LEU B 1 83  ? 57.090 35.283  33.020 1.00 25.49  ? 83  LEU B CB  1 
ATOM   3055 C CG  . LEU B 1 83  ? 57.778 35.557  31.696 1.00 24.53  ? 83  LEU B CG  1 
ATOM   3056 C CD1 . LEU B 1 83  ? 58.410 36.956  31.692 1.00 20.85  ? 83  LEU B CD1 1 
ATOM   3057 C CD2 . LEU B 1 83  ? 58.803 34.448  31.493 1.00 19.15  ? 83  LEU B CD2 1 
ATOM   3058 N N   . PHE B 1 84  ? 54.372 33.516  34.593 1.00 31.74  ? 84  PHE B N   1 
ATOM   3059 C CA  . PHE B 1 84  ? 53.794 33.281  35.900 1.00 32.54  ? 84  PHE B CA  1 
ATOM   3060 C C   . PHE B 1 84  ? 53.059 31.969  35.932 1.00 33.43  ? 84  PHE B C   1 
ATOM   3061 O O   . PHE B 1 84  ? 52.474 31.558  34.935 1.00 45.45  ? 84  PHE B O   1 
ATOM   3062 C CB  . PHE B 1 84  ? 52.798 34.392  36.231 1.00 31.80  ? 84  PHE B CB  1 
ATOM   3063 C CG  . PHE B 1 84  ? 51.999 34.138  37.479 1.00 23.65  ? 84  PHE B CG  1 
ATOM   3064 C CD1 . PHE B 1 84  ? 52.585 34.248  38.721 1.00 17.47  ? 84  PHE B CD1 1 
ATOM   3065 C CD2 . PHE B 1 84  ? 50.675 33.769  37.400 1.00 23.19  ? 84  PHE B CD2 1 
ATOM   3066 C CE1 . PHE B 1 84  ? 51.874 33.992  39.862 1.00 22.30  ? 84  PHE B CE1 1 
ATOM   3067 C CE2 . PHE B 1 84  ? 49.952 33.511  38.538 1.00 28.47  ? 84  PHE B CE2 1 
ATOM   3068 C CZ  . PHE B 1 84  ? 50.556 33.622  39.774 1.00 30.33  ? 84  PHE B CZ  1 
ATOM   3069 N N   . ASN B 1 85  ? 53.134 31.297  37.072 1.00 34.21  ? 85  ASN B N   1 
ATOM   3070 C CA  . ASN B 1 85  ? 52.417 30.043  37.300 1.00 34.79  ? 85  ASN B CA  1 
ATOM   3071 C C   . ASN B 1 85  ? 52.496 29.036  36.160 1.00 35.24  ? 85  ASN B C   1 
ATOM   3072 O O   . ASN B 1 85  ? 51.463 28.588  35.665 1.00 42.01  ? 85  ASN B O   1 
ATOM   3073 C CB  . ASN B 1 85  ? 50.942 30.387  37.576 1.00 29.57  ? 85  ASN B CB  1 
ATOM   3074 C CG  . ASN B 1 85  ? 50.246 29.372  38.445 1.00 33.12  ? 85  ASN B CG  1 
ATOM   3075 O OD1 . ASN B 1 85  ? 49.179 29.657  38.989 1.00 39.99  ? 85  ASN B OD1 1 
ATOM   3076 N ND2 . ASN B 1 85  ? 50.839 28.186  38.591 1.00 34.10  ? 85  ASN B ND2 1 
ATOM   3077 N N   . LYS B 1 86  ? 53.699 28.664  35.737 1.00 37.79  ? 86  LYS B N   1 
ATOM   3078 C CA  . LYS B 1 86  ? 53.796 27.705  34.640 1.00 43.35  ? 86  LYS B CA  1 
ATOM   3079 C C   . LYS B 1 86  ? 54.557 26.393  34.886 1.00 44.96  ? 86  LYS B C   1 
ATOM   3080 O O   . LYS B 1 86  ? 54.856 25.647  33.946 1.00 45.23  ? 86  LYS B O   1 
ATOM   3081 C CB  . LYS B 1 86  ? 54.212 28.396  33.329 1.00 43.18  ? 86  LYS B CB  1 
ATOM   3082 C CG  . LYS B 1 86  ? 55.274 29.468  33.438 1.00 60.79  ? 86  LYS B CG  1 
ATOM   3083 C CD  . LYS B 1 86  ? 56.675 28.884  33.564 1.00 73.96  ? 86  LYS B CD  1 
ATOM   3084 C CE  . LYS B 1 86  ? 57.733 29.987  33.591 1.00 83.65  ? 86  LYS B CE  1 
ATOM   3085 N NZ  . LYS B 1 86  ? 57.664 30.894  32.397 1.00 85.62  ? 86  LYS B NZ  1 
ATOM   3086 N N   . GLU B 1 87  ? 54.784 26.070  36.155 1.00 40.07  ? 87  GLU B N   1 
ATOM   3087 C CA  . GLU B 1 87  ? 55.469 24.841  36.516 1.00 34.39  ? 87  GLU B CA  1 
ATOM   3088 C C   . GLU B 1 87  ? 54.568 23.640  36.356 1.00 35.13  ? 87  GLU B C   1 
ATOM   3089 O O   . GLU B 1 87  ? 55.006 22.507  36.527 1.00 39.63  ? 87  GLU B O   1 
ATOM   3090 C CB  . GLU B 1 87  ? 55.961 24.895  37.955 1.00 45.28  ? 87  GLU B CB  1 
ATOM   3091 C CG  . GLU B 1 87  ? 57.240 25.687  38.144 1.00 63.13  ? 87  GLU B CG  1 
ATOM   3092 C CD  . GLU B 1 87  ? 58.402 25.096  37.374 1.00 70.17  ? 87  GLU B CD  1 
ATOM   3093 O OE1 . GLU B 1 87  ? 58.749 23.919  37.629 1.00 66.59  ? 87  GLU B OE1 1 
ATOM   3094 O OE2 . GLU B 1 87  ? 58.955 25.808  36.505 1.00 79.56  ? 87  GLU B OE2 1 
ATOM   3095 N N   . ASN B 1 88  ? 53.294 23.878  36.070 1.00 37.92  ? 88  ASN B N   1 
ATOM   3096 C CA  . ASN B 1 88  ? 52.347 22.776  35.897 1.00 43.38  ? 88  ASN B CA  1 
ATOM   3097 C C   . ASN B 1 88  ? 51.226 23.094  34.922 1.00 44.14  ? 88  ASN B C   1 
ATOM   3098 O O   . ASN B 1 88  ? 50.683 22.192  34.281 1.00 51.81  ? 88  ASN B O   1 
ATOM   3099 C CB  . ASN B 1 88  ? 51.774 22.319  37.245 1.00 45.64  ? 88  ASN B CB  1 
ATOM   3100 C CG  . ASN B 1 88  ? 52.632 21.251  37.914 1.00 48.83  ? 88  ASN B CG  1 
ATOM   3101 O OD1 . ASN B 1 88  ? 52.893 20.199  37.328 1.00 46.82  ? 88  ASN B OD1 1 
ATOM   3102 N ND2 . ASN B 1 88  ? 53.076 21.519  39.139 1.00 47.99  ? 88  ASN B ND2 1 
ATOM   3103 N N   . LEU B 1 89  ? 50.903 24.374  34.778 1.00 41.10  ? 89  LEU B N   1 
ATOM   3104 C CA  . LEU B 1 89  ? 49.844 24.781  33.862 1.00 36.58  ? 89  LEU B CA  1 
ATOM   3105 C C   . LEU B 1 89  ? 50.370 25.421  32.582 1.00 33.45  ? 89  LEU B C   1 
ATOM   3106 O O   . LEU B 1 89  ? 51.497 25.907  32.524 1.00 36.14  ? 89  LEU B O   1 
ATOM   3107 C CB  . LEU B 1 89  ? 48.918 25.801  34.525 1.00 37.60  ? 89  LEU B CB  1 
ATOM   3108 C CG  . LEU B 1 89  ? 48.029 25.447  35.710 1.00 37.23  ? 89  LEU B CG  1 
ATOM   3109 C CD1 . LEU B 1 89  ? 47.272 26.701  36.099 1.00 31.32  ? 89  LEU B CD1 1 
ATOM   3110 C CD2 . LEU B 1 89  ? 47.070 24.326  35.366 1.00 30.33  ? 89  LEU B CD2 1 
ATOM   3111 N N   . PRO B 1 90  ? 49.577 25.362  31.511 1.00 28.64  ? 90  PRO B N   1 
ATOM   3112 C CA  . PRO B 1 90  ? 49.984 25.969  30.249 1.00 27.11  ? 90  PRO B CA  1 
ATOM   3113 C C   . PRO B 1 90  ? 49.881 27.476  30.494 1.00 26.43  ? 90  PRO B C   1 
ATOM   3114 O O   . PRO B 1 90  ? 49.061 27.919  31.285 1.00 32.50  ? 90  PRO B O   1 
ATOM   3115 C CB  . PRO B 1 90  ? 48.882 25.505  29.295 1.00 33.88  ? 90  PRO B CB  1 
ATOM   3116 C CG  . PRO B 1 90  ? 48.475 24.177  29.852 1.00 27.86  ? 90  PRO B CG  1 
ATOM   3117 C CD  . PRO B 1 90  ? 48.399 24.500  31.319 1.00 31.42  ? 90  PRO B CD  1 
ATOM   3118 N N   . SER B 1 91  ? 50.697 28.274  29.832 1.00 23.76  ? 91  SER B N   1 
ATOM   3119 C CA  . SER B 1 91  ? 50.622 29.708  30.049 1.00 22.76  ? 91  SER B CA  1 
ATOM   3120 C C   . SER B 1 91  ? 49.318 30.327  29.537 1.00 25.00  ? 91  SER B C   1 
ATOM   3121 O O   . SER B 1 91  ? 48.893 31.384  30.008 1.00 26.14  ? 91  SER B O   1 
ATOM   3122 C CB  . SER B 1 91  ? 51.840 30.384  29.440 1.00 25.25  ? 91  SER B CB  1 
ATOM   3123 O OG  . SER B 1 91  ? 53.030 29.815  29.977 1.00 46.78  ? 91  SER B OG  1 
ATOM   3124 N N   . ARG B 1 92  ? 48.680 29.663  28.579 1.00 21.99  ? 92  ARG B N   1 
ATOM   3125 C CA  . ARG B 1 92  ? 47.414 30.142  28.031 1.00 21.24  ? 92  ARG B CA  1 
ATOM   3126 C C   . ARG B 1 92  ? 46.551 28.894  27.861 1.00 23.45  ? 92  ARG B C   1 
ATOM   3127 O O   . ARG B 1 92  ? 47.069 27.829  27.510 1.00 22.58  ? 92  ARG B O   1 
ATOM   3128 C CB  . ARG B 1 92  ? 47.609 30.833  26.674 1.00 23.30  ? 92  ARG B CB  1 
ATOM   3129 C CG  . ARG B 1 92  ? 48.584 32.014  26.668 1.00 34.75  ? 92  ARG B CG  1 
ATOM   3130 C CD  . ARG B 1 92  ? 48.709 32.680  25.283 1.00 43.38  ? 92  ARG B CD  1 
ATOM   3131 N NE  . ARG B 1 92  ? 47.522 33.449  24.911 1.00 60.44  ? 92  ARG B NE  1 
ATOM   3132 C CZ  . ARG B 1 92  ? 47.362 34.086  23.751 1.00 71.37  ? 92  ARG B CZ  1 
ATOM   3133 N NH1 . ARG B 1 92  ? 48.314 34.048  22.831 1.00 75.58  ? 92  ARG B NH1 1 
ATOM   3134 N NH2 . ARG B 1 92  ? 46.251 34.776  23.512 1.00 76.09  ? 92  ARG B NH2 1 
ATOM   3135 N N   . PHE B 1 93  ? 45.265 29.010  28.187 1.00 16.42  ? 93  PHE B N   1 
ATOM   3136 C CA  . PHE B 1 93  ? 44.317 27.905  28.073 1.00 17.29  ? 93  PHE B CA  1 
ATOM   3137 C C   . PHE B 1 93  ? 42.912 28.421  28.348 1.00 22.07  ? 93  PHE B C   1 
ATOM   3138 O O   . PHE B 1 93  ? 42.749 29.533  28.851 1.00 22.50  ? 93  PHE B O   1 
ATOM   3139 C CB  . PHE B 1 93  ? 44.657 26.744  29.038 1.00 22.81  ? 93  PHE B CB  1 
ATOM   3140 C CG  . PHE B 1 93  ? 44.654 27.119  30.509 1.00 26.00  ? 93  PHE B CG  1 
ATOM   3141 C CD1 . PHE B 1 93  ? 43.470 27.155  31.233 1.00 35.89  ? 93  PHE B CD1 1 
ATOM   3142 C CD2 . PHE B 1 93  ? 45.838 27.446  31.158 1.00 30.52  ? 93  PHE B CD2 1 
ATOM   3143 C CE1 . PHE B 1 93  ? 43.462 27.517  32.581 1.00 40.80  ? 93  PHE B CE1 1 
ATOM   3144 C CE2 . PHE B 1 93  ? 45.847 27.810  32.503 1.00 31.44  ? 93  PHE B CE2 1 
ATOM   3145 C CZ  . PHE B 1 93  ? 44.657 27.848  33.214 1.00 42.07  ? 93  PHE B CZ  1 
ATOM   3146 N N   . LYS B 1 94  ? 41.896 27.655  27.960 1.00 22.26  ? 94  LYS B N   1 
ATOM   3147 C CA  . LYS B 1 94  ? 40.520 28.064  28.215 1.00 19.47  ? 94  LYS B CA  1 
ATOM   3148 C C   . LYS B 1 94  ? 39.803 26.910  28.890 1.00 21.01  ? 94  LYS B C   1 
ATOM   3149 O O   . LYS B 1 94  ? 40.178 25.747  28.696 1.00 24.52  ? 94  LYS B O   1 
ATOM   3150 C CB  . LYS B 1 94  ? 39.777 28.408  26.918 1.00 26.49  ? 94  LYS B CB  1 
ATOM   3151 C CG  . LYS B 1 94  ? 40.429 29.429  26.000 1.00 26.45  ? 94  LYS B CG  1 
ATOM   3152 C CD  . LYS B 1 94  ? 39.422 29.841  24.924 1.00 41.14  ? 94  LYS B CD  1 
ATOM   3153 C CE  . LYS B 1 94  ? 40.084 30.508  23.727 1.00 52.94  ? 94  LYS B CE  1 
ATOM   3154 N NZ  . LYS B 1 94  ? 40.856 31.728  24.098 1.00 60.29  ? 94  LYS B NZ  1 
ATOM   3155 N N   . PHE B 1 95  ? 38.763 27.228  29.660 1.00 19.65  ? 95  PHE B N   1 
ATOM   3156 C CA  . PHE B 1 95  ? 37.952 26.213  30.353 1.00 16.60  ? 95  PHE B CA  1 
ATOM   3157 C C   . PHE B 1 95  ? 36.478 26.607  30.296 1.00 18.30  ? 95  PHE B C   1 
ATOM   3158 O O   . PHE B 1 95  ? 36.117 27.743  30.613 1.00 23.05  ? 95  PHE B O   1 
ATOM   3159 C CB  . PHE B 1 95  ? 38.373 26.068  31.812 1.00 14.29  ? 95  PHE B CB  1 
ATOM   3160 C CG  . PHE B 1 95  ? 37.898 24.806  32.443 1.00 4.36   ? 95  PHE B CG  1 
ATOM   3161 C CD1 . PHE B 1 95  ? 38.522 23.594  32.152 1.00 10.36  ? 95  PHE B CD1 1 
ATOM   3162 C CD2 . PHE B 1 95  ? 36.812 24.811  33.302 1.00 6.18   ? 95  PHE B CD2 1 
ATOM   3163 C CE1 . PHE B 1 95  ? 38.063 22.397  32.710 1.00 3.57   ? 95  PHE B CE1 1 
ATOM   3164 C CE2 . PHE B 1 95  ? 36.345 23.624  33.863 1.00 2.37   ? 95  PHE B CE2 1 
ATOM   3165 C CZ  . PHE B 1 95  ? 36.971 22.419  33.564 1.00 2.27   ? 95  PHE B CZ  1 
ATOM   3166 N N   . LYS B 1 96  ? 35.619 25.674  29.903 1.00 15.24  ? 96  LYS B N   1 
ATOM   3167 C CA  . LYS B 1 96  ? 34.192 25.975  29.785 1.00 14.80  ? 96  LYS B CA  1 
ATOM   3168 C C   . LYS B 1 96  ? 33.339 24.924  30.468 1.00 22.70  ? 96  LYS B C   1 
ATOM   3169 O O   . LYS B 1 96  ? 33.517 23.720  30.233 1.00 29.02  ? 96  LYS B O   1 
ATOM   3170 C CB  . LYS B 1 96  ? 33.797 26.059  28.321 1.00 9.19   ? 96  LYS B CB  1 
ATOM   3171 C CG  . LYS B 1 96  ? 32.432 26.610  28.102 1.00 6.79   ? 96  LYS B CG  1 
ATOM   3172 C CD  . LYS B 1 96  ? 31.933 26.349  26.692 1.00 4.63   ? 96  LYS B CD  1 
ATOM   3173 C CE  . LYS B 1 96  ? 30.516 26.869  26.578 1.00 10.17  ? 96  LYS B CE  1 
ATOM   3174 N NZ  . LYS B 1 96  ? 29.898 26.474  25.310 1.00 40.43  ? 96  LYS B NZ  1 
ATOM   3175 N N   . GLU B 1 97  ? 32.397 25.374  31.294 1.00 13.36  ? 97  GLU B N   1 
ATOM   3176 C CA  . GLU B 1 97  ? 31.544 24.453  32.008 1.00 8.14   ? 97  GLU B CA  1 
ATOM   3177 C C   . GLU B 1 97  ? 30.101 24.589  31.561 1.00 7.18   ? 97  GLU B C   1 
ATOM   3178 O O   . GLU B 1 97  ? 29.501 25.654  31.681 1.00 19.21  ? 97  GLU B O   1 
ATOM   3179 C CB  . GLU B 1 97  ? 31.661 24.697  33.498 1.00 6.65   ? 97  GLU B CB  1 
ATOM   3180 C CG  . GLU B 1 97  ? 30.759 23.785  34.301 1.00 26.21  ? 97  GLU B CG  1 
ATOM   3181 C CD  . GLU B 1 97  ? 30.689 24.148  35.774 1.00 34.70  ? 97  GLU B CD  1 
ATOM   3182 O OE1 . GLU B 1 97  ? 30.906 25.346  36.120 1.00 23.42  ? 97  GLU B OE1 1 
ATOM   3183 O OE2 . GLU B 1 97  ? 30.415 23.217  36.577 1.00 33.47  ? 97  GLU B OE2 1 
ATOM   3184 N N   . TYR B 1 98  ? 29.524 23.501  31.083 1.00 2.00   ? 98  TYR B N   1 
ATOM   3185 C CA  . TYR B 1 98  ? 28.152 23.543  30.613 1.00 7.27   ? 98  TYR B CA  1 
ATOM   3186 C C   . TYR B 1 98  ? 27.116 23.443  31.723 1.00 11.85  ? 98  TYR B C   1 
ATOM   3187 O O   . TYR B 1 98  ? 27.153 22.523  32.523 1.00 17.85  ? 98  TYR B O   1 
ATOM   3188 C CB  . TYR B 1 98  ? 27.914 22.419  29.593 1.00 17.93  ? 98  TYR B CB  1 
ATOM   3189 C CG  . TYR B 1 98  ? 28.799 22.485  28.356 1.00 18.76  ? 98  TYR B CG  1 
ATOM   3190 C CD1 . TYR B 1 98  ? 29.806 21.553  28.153 1.00 24.16  ? 98  TYR B CD1 1 
ATOM   3191 C CD2 . TYR B 1 98  ? 28.634 23.487  27.400 1.00 12.52  ? 98  TYR B CD2 1 
ATOM   3192 C CE1 . TYR B 1 98  ? 30.629 21.611  27.028 1.00 24.16  ? 98  TYR B CE1 1 
ATOM   3193 C CE2 . TYR B 1 98  ? 29.442 23.558  26.291 1.00 11.46  ? 98  TYR B CE2 1 
ATOM   3194 C CZ  . TYR B 1 98  ? 30.436 22.620  26.103 1.00 23.60  ? 98  TYR B CZ  1 
ATOM   3195 O OH  . TYR B 1 98  ? 31.222 22.682  24.975 1.00 22.89  ? 98  TYR B OH  1 
ATOM   3196 N N   . CYS B 1 99  ? 26.184 24.391  31.756 1.00 18.63  ? 99  CYS B N   1 
ATOM   3197 C CA  . CYS B 1 99  ? 25.090 24.406  32.734 1.00 14.36  ? 99  CYS B CA  1 
ATOM   3198 C C   . CYS B 1 99  ? 25.554 24.125  34.156 1.00 17.59  ? 99  CYS B C   1 
ATOM   3199 O O   . CYS B 1 99  ? 25.130 23.140  34.774 1.00 23.14  ? 99  CYS B O   1 
ATOM   3200 C CB  . CYS B 1 99  ? 24.044 23.349  32.371 1.00 12.14  ? 99  CYS B CB  1 
ATOM   3201 S SG  . CYS B 1 99  ? 23.524 23.283  30.664 1.00 34.27  ? 99  CYS B SG  1 
ATOM   3202 N N   . PRO B 1 100 ? 26.434 24.966  34.694 1.00 8.74   ? 100 PRO B N   1 
ATOM   3203 C CA  . PRO B 1 100 ? 26.955 24.802  36.047 1.00 12.57  ? 100 PRO B CA  1 
ATOM   3204 C C   . PRO B 1 100 ? 25.888 24.470  37.105 1.00 20.48  ? 100 PRO B C   1 
ATOM   3205 O O   . PRO B 1 100 ? 26.037 23.509  37.869 1.00 23.14  ? 100 PRO B O   1 
ATOM   3206 C CB  . PRO B 1 100 ? 27.591 26.155  36.312 1.00 15.67  ? 100 PRO B CB  1 
ATOM   3207 C CG  . PRO B 1 100 ? 28.129 26.496  35.019 1.00 14.84  ? 100 PRO B CG  1 
ATOM   3208 C CD  . PRO B 1 100 ? 27.014 26.147  34.063 1.00 13.60  ? 100 PRO B CD  1 
ATOM   3209 N N   . MET B 1 101 ? 24.793 25.221  37.115 1.00 11.07  ? 101 MET B N   1 
ATOM   3210 C CA  . MET B 1 101 ? 23.755 25.006  38.110 1.00 12.81  ? 101 MET B CA  1 
ATOM   3211 C C   . MET B 1 101 ? 23.024 23.654  38.046 1.00 19.93  ? 101 MET B C   1 
ATOM   3212 O O   . MET B 1 101 ? 22.728 23.059  39.089 1.00 22.80  ? 101 MET B O   1 
ATOM   3213 C CB  . MET B 1 101 ? 22.745 26.148  38.068 1.00 10.47  ? 101 MET B CB  1 
ATOM   3214 C CG  . MET B 1 101 ? 23.349 27.542  38.120 1.00 13.37  ? 101 MET B CG  1 
ATOM   3215 S SD  . MET B 1 101 ? 23.923 28.099  39.743 1.00 21.23  ? 101 MET B SD  1 
ATOM   3216 C CE  . MET B 1 101 ? 22.393 28.344  40.587 1.00 11.77  ? 101 MET B CE  1 
ATOM   3217 N N   . VAL B 1 102 ? 22.733 23.166  36.840 1.00 19.94  ? 102 VAL B N   1 
ATOM   3218 C CA  . VAL B 1 102 ? 22.012 21.904  36.690 1.00 12.75  ? 102 VAL B CA  1 
ATOM   3219 C C   . VAL B 1 102 ? 22.839 20.704  37.107 1.00 15.22  ? 102 VAL B C   1 
ATOM   3220 O O   . VAL B 1 102 ? 22.303 19.766  37.690 1.00 21.82  ? 102 VAL B O   1 
ATOM   3221 C CB  . VAL B 1 102 ? 21.483 21.691  35.255 1.00 5.55   ? 102 VAL B CB  1 
ATOM   3222 C CG1 . VAL B 1 102 ? 20.893 20.304  35.099 1.00 8.67   ? 102 VAL B CG1 1 
ATOM   3223 C CG2 . VAL B 1 102 ? 20.408 22.683  34.952 1.00 9.16   ? 102 VAL B CG2 1 
ATOM   3224 N N   . PHE B 1 103 ? 24.130 20.698  36.795 1.00 11.01  ? 103 PHE B N   1 
ATOM   3225 C CA  . PHE B 1 103 ? 24.951 19.555  37.187 1.00 11.80  ? 103 PHE B CA  1 
ATOM   3226 C C   . PHE B 1 103 ? 25.233 19.622  38.675 1.00 14.52  ? 103 PHE B C   1 
ATOM   3227 O O   . PHE B 1 103 ? 25.214 18.608  39.371 1.00 20.43  ? 103 PHE B O   1 
ATOM   3228 C CB  . PHE B 1 103 ? 26.245 19.498  36.384 1.00 13.69  ? 103 PHE B CB  1 
ATOM   3229 C CG  . PHE B 1 103 ? 26.050 19.024  34.985 1.00 13.10  ? 103 PHE B CG  1 
ATOM   3230 C CD1 . PHE B 1 103 ? 26.095 19.905  33.928 1.00 14.92  ? 103 PHE B CD1 1 
ATOM   3231 C CD2 . PHE B 1 103 ? 25.794 17.690  34.725 1.00 17.97  ? 103 PHE B CD2 1 
ATOM   3232 C CE1 . PHE B 1 103 ? 25.883 19.454  32.618 1.00 20.76  ? 103 PHE B CE1 1 
ATOM   3233 C CE2 . PHE B 1 103 ? 25.582 17.237  33.415 1.00 15.47  ? 103 PHE B CE2 1 
ATOM   3234 C CZ  . PHE B 1 103 ? 25.627 18.117  32.367 1.00 2.00   ? 103 PHE B CZ  1 
ATOM   3235 N N   . ARG B 1 104 ? 25.438 20.833  39.170 1.00 14.15  ? 104 ARG B N   1 
ATOM   3236 C CA  . ARG B 1 104 ? 25.678 21.034  40.581 1.00 14.47  ? 104 ARG B CA  1 
ATOM   3237 C C   . ARG B 1 104 ? 24.494 20.460  41.370 1.00 16.91  ? 104 ARG B C   1 
ATOM   3238 O O   . ARG B 1 104 ? 24.661 19.931  42.468 1.00 31.62  ? 104 ARG B O   1 
ATOM   3239 C CB  . ARG B 1 104 ? 25.805 22.515  40.836 1.00 10.73  ? 104 ARG B CB  1 
ATOM   3240 C CG  . ARG B 1 104 ? 25.769 22.911  42.283 1.00 15.64  ? 104 ARG B CG  1 
ATOM   3241 C CD  . ARG B 1 104 ? 25.068 24.244  42.385 1.00 4.18   ? 104 ARG B CD  1 
ATOM   3242 N NE  . ARG B 1 104 ? 25.670 25.050  43.418 1.00 2.85   ? 104 ARG B NE  1 
ATOM   3243 C CZ  . ARG B 1 104 ? 25.187 26.213  43.817 1.00 14.31  ? 104 ARG B CZ  1 
ATOM   3244 N NH1 . ARG B 1 104 ? 24.086 26.720  43.266 1.00 10.41  ? 104 ARG B NH1 1 
ATOM   3245 N NH2 . ARG B 1 104 ? 25.807 26.858  44.790 1.00 30.79  ? 104 ARG B NH2 1 
ATOM   3246 N N   . ASN B 1 105 ? 23.299 20.567  40.804 1.00 15.59  ? 105 ASN B N   1 
ATOM   3247 C CA  . ASN B 1 105 ? 22.109 20.033  41.453 1.00 17.37  ? 105 ASN B CA  1 
ATOM   3248 C C   . ASN B 1 105 ? 22.081 18.520  41.258 1.00 20.41  ? 105 ASN B C   1 
ATOM   3249 O O   . ASN B 1 105 ? 21.709 17.781  42.163 1.00 27.83  ? 105 ASN B O   1 
ATOM   3250 C CB  . ASN B 1 105 ? 20.841 20.649  40.862 1.00 17.71  ? 105 ASN B CB  1 
ATOM   3251 C CG  . ASN B 1 105 ? 19.599 20.173  41.557 1.00 12.47  ? 105 ASN B CG  1 
ATOM   3252 O OD1 . ASN B 1 105 ? 18.880 19.304  41.063 1.00 18.59  ? 105 ASN B OD1 1 
ATOM   3253 N ND2 . ASN B 1 105 ? 19.346 20.727  42.726 1.00 23.54  ? 105 ASN B ND2 1 
ATOM   3254 N N   . LEU B 1 106 ? 22.467 18.068  40.066 1.00 18.39  ? 106 LEU B N   1 
ATOM   3255 C CA  . LEU B 1 106 ? 22.495 16.647  39.759 1.00 14.27  ? 106 LEU B CA  1 
ATOM   3256 C C   . LEU B 1 106 ? 23.448 15.970  40.731 1.00 17.59  ? 106 LEU B C   1 
ATOM   3257 O O   . LEU B 1 106 ? 23.266 14.810  41.085 1.00 12.60  ? 106 LEU B O   1 
ATOM   3258 C CB  . LEU B 1 106 ? 22.933 16.411  38.307 1.00 6.74   ? 106 LEU B CB  1 
ATOM   3259 C CG  . LEU B 1 106 ? 21.825 16.727  37.294 1.00 14.81  ? 106 LEU B CG  1 
ATOM   3260 C CD1 . LEU B 1 106 ? 22.339 16.703  35.881 1.00 16.99  ? 106 LEU B CD1 1 
ATOM   3261 C CD2 . LEU B 1 106 ? 20.698 15.730  37.454 1.00 17.16  ? 106 LEU B CD2 1 
ATOM   3262 N N   . ARG B 1 107 ? 24.428 16.729  41.211 1.00 20.01  ? 107 ARG B N   1 
ATOM   3263 C CA  . ARG B 1 107 ? 25.407 16.204  42.148 1.00 24.35  ? 107 ARG B CA  1 
ATOM   3264 C C   . ARG B 1 107 ? 24.760 15.934  43.509 1.00 27.28  ? 107 ARG B C   1 
ATOM   3265 O O   . ARG B 1 107 ? 24.765 14.795  43.998 1.00 25.72  ? 107 ARG B O   1 
ATOM   3266 C CB  . ARG B 1 107 ? 26.608 17.156  42.271 1.00 22.27  ? 107 ARG B CB  1 
ATOM   3267 C CG  . ARG B 1 107 ? 27.815 16.753  41.416 1.00 18.21  ? 107 ARG B CG  1 
ATOM   3268 C CD  . ARG B 1 107 ? 28.922 17.811  41.393 1.00 6.16   ? 107 ARG B CD  1 
ATOM   3269 N NE  . ARG B 1 107 ? 28.689 18.751  40.303 1.00 13.83  ? 107 ARG B NE  1 
ATOM   3270 C CZ  . ARG B 1 107 ? 28.931 20.058  40.358 1.00 22.62  ? 107 ARG B CZ  1 
ATOM   3271 N NH1 . ARG B 1 107 ? 29.429 20.611  41.455 1.00 23.50  ? 107 ARG B NH1 1 
ATOM   3272 N NH2 . ARG B 1 107 ? 28.646 20.829  39.317 1.00 22.67  ? 107 ARG B NH2 1 
ATOM   3273 N N   . GLU B 1 108 ? 24.135 16.950  44.095 1.00 29.13  ? 108 GLU B N   1 
ATOM   3274 C CA  . GLU B 1 108 ? 23.511 16.745  45.397 1.00 32.58  ? 108 GLU B CA  1 
ATOM   3275 C C   . GLU B 1 108 ? 22.406 15.728  45.288 1.00 31.79  ? 108 GLU B C   1 
ATOM   3276 O O   . GLU B 1 108 ? 22.126 15.010  46.239 1.00 40.22  ? 108 GLU B O   1 
ATOM   3277 C CB  . GLU B 1 108 ? 22.970 18.049  45.984 1.00 33.35  ? 108 GLU B CB  1 
ATOM   3278 C CG  . GLU B 1 108 ? 21.532 18.357  45.682 1.00 41.86  ? 108 GLU B CG  1 
ATOM   3279 C CD  . GLU B 1 108 ? 21.038 19.564  46.460 1.00 57.58  ? 108 GLU B CD  1 
ATOM   3280 O OE1 . GLU B 1 108 ? 21.297 20.723  46.038 1.00 63.97  ? 108 GLU B OE1 1 
ATOM   3281 O OE2 . GLU B 1 108 ? 20.392 19.344  47.505 1.00 65.58  ? 108 GLU B OE2 1 
ATOM   3282 N N   . ARG B 1 109 ? 21.820 15.641  44.100 1.00 35.61  ? 109 ARG B N   1 
ATOM   3283 C CA  . ARG B 1 109 ? 20.729 14.712  43.839 1.00 31.77  ? 109 ARG B CA  1 
ATOM   3284 C C   . ARG B 1 109 ? 21.243 13.274  43.819 1.00 32.33  ? 109 ARG B C   1 
ATOM   3285 O O   . ARG B 1 109 ? 20.475 12.324  44.005 1.00 33.82  ? 109 ARG B O   1 
ATOM   3286 C CB  . ARG B 1 109 ? 20.060 15.074  42.524 1.00 26.66  ? 109 ARG B CB  1 
ATOM   3287 C CG  . ARG B 1 109 ? 18.628 14.673  42.457 1.00 34.77  ? 109 ARG B CG  1 
ATOM   3288 C CD  . ARG B 1 109 ? 17.842 15.694  41.669 1.00 36.47  ? 109 ARG B CD  1 
ATOM   3289 N NE  . ARG B 1 109 ? 17.469 16.857  42.467 1.00 33.25  ? 109 ARG B NE  1 
ATOM   3290 C CZ  . ARG B 1 109 ? 16.208 17.215  42.684 1.00 33.32  ? 109 ARG B CZ  1 
ATOM   3291 N NH1 . ARG B 1 109 ? 15.220 16.494  42.181 1.00 29.40  ? 109 ARG B NH1 1 
ATOM   3292 N NH2 . ARG B 1 109 ? 15.930 18.328  43.340 1.00 31.48  ? 109 ARG B NH2 1 
ATOM   3293 N N   . PHE B 1 110 ? 22.548 13.133  43.595 1.00 27.08  ? 110 PHE B N   1 
ATOM   3294 C CA  . PHE B 1 110 ? 23.204 11.833  43.571 1.00 22.61  ? 110 PHE B CA  1 
ATOM   3295 C C   . PHE B 1 110 ? 24.019 11.738  44.845 1.00 20.61  ? 110 PHE B C   1 
ATOM   3296 O O   . PHE B 1 110 ? 24.952 10.943  44.944 1.00 27.45  ? 110 PHE B O   1 
ATOM   3297 C CB  . PHE B 1 110 ? 24.124 11.688  42.345 1.00 28.94  ? 110 PHE B CB  1 
ATOM   3298 C CG  . PHE B 1 110 ? 23.392 11.634  41.028 1.00 28.56  ? 110 PHE B CG  1 
ATOM   3299 C CD1 . PHE B 1 110 ? 23.869 12.333  39.930 1.00 19.83  ? 110 PHE B CD1 1 
ATOM   3300 C CD2 . PHE B 1 110 ? 22.233 10.886  40.889 1.00 27.01  ? 110 PHE B CD2 1 
ATOM   3301 C CE1 . PHE B 1 110 ? 23.206 12.289  38.720 1.00 27.64  ? 110 PHE B CE1 1 
ATOM   3302 C CE2 . PHE B 1 110 ? 21.562 10.837  39.681 1.00 34.78  ? 110 PHE B CE2 1 
ATOM   3303 C CZ  . PHE B 1 110 ? 22.049 11.539  38.594 1.00 30.58  ? 110 PHE B CZ  1 
ATOM   3304 N N   . GLY B 1 111 ? 23.713 12.619  45.789 1.00 12.37  ? 111 GLY B N   1 
ATOM   3305 C CA  . GLY B 1 111 ? 24.392 12.597  47.068 1.00 14.77  ? 111 GLY B CA  1 
ATOM   3306 C C   . GLY B 1 111 ? 25.893 12.733  47.034 1.00 22.52  ? 111 GLY B C   1 
ATOM   3307 O O   . GLY B 1 111 ? 26.593 11.983  47.698 1.00 36.76  ? 111 GLY B O   1 
ATOM   3308 N N   . ILE B 1 112 ? 26.397 13.681  46.256 1.00 25.43  ? 112 ILE B N   1 
ATOM   3309 C CA  . ILE B 1 112 ? 27.832 13.916  46.166 1.00 15.05  ? 112 ILE B CA  1 
ATOM   3310 C C   . ILE B 1 112 ? 28.097 15.336  46.634 1.00 23.58  ? 112 ILE B C   1 
ATOM   3311 O O   . ILE B 1 112 ? 27.407 16.276  46.240 1.00 26.66  ? 112 ILE B O   1 
ATOM   3312 C CB  . ILE B 1 112 ? 28.324 13.741  44.739 1.00 4.69   ? 112 ILE B CB  1 
ATOM   3313 C CG1 . ILE B 1 112 ? 28.088 12.294  44.304 1.00 2.00   ? 112 ILE B CG1 1 
ATOM   3314 C CG2 . ILE B 1 112 ? 29.785 14.103  44.635 1.00 5.05   ? 112 ILE B CG2 1 
ATOM   3315 C CD1 . ILE B 1 112 ? 28.584 11.985  42.921 1.00 7.69   ? 112 ILE B CD1 1 
ATOM   3316 N N   . ASP B 1 113 ? 29.050 15.481  47.541 1.00 29.35  ? 113 ASP B N   1 
ATOM   3317 C CA  . ASP B 1 113 ? 29.383 16.793  48.070 1.00 28.11  ? 113 ASP B CA  1 
ATOM   3318 C C   . ASP B 1 113 ? 30.310 17.438  47.076 1.00 23.45  ? 113 ASP B C   1 
ATOM   3319 O O   . ASP B 1 113 ? 31.310 16.832  46.683 1.00 29.28  ? 113 ASP B O   1 
ATOM   3320 C CB  . ASP B 1 113 ? 30.101 16.661  49.405 1.00 37.47  ? 113 ASP B CB  1 
ATOM   3321 C CG  . ASP B 1 113 ? 30.072 17.934  50.197 1.00 52.03  ? 113 ASP B CG  1 
ATOM   3322 O OD1 . ASP B 1 113 ? 30.837 18.869  49.866 1.00 63.91  ? 113 ASP B OD1 1 
ATOM   3323 O OD2 . ASP B 1 113 ? 29.264 18.001  51.145 1.00 67.23  ? 113 ASP B OD2 1 
ATOM   3324 N N   . ASP B 1 114 ? 29.991 18.660  46.670 1.00 14.68  ? 114 ASP B N   1 
ATOM   3325 C CA  . ASP B 1 114 ? 30.820 19.359  45.707 1.00 10.48  ? 114 ASP B CA  1 
ATOM   3326 C C   . ASP B 1 114 ? 32.295 19.332  46.047 1.00 18.11  ? 114 ASP B C   1 
ATOM   3327 O O   . ASP B 1 114 ? 33.126 19.128  45.159 1.00 26.43  ? 114 ASP B O   1 
ATOM   3328 C CB  . ASP B 1 114 ? 30.382 20.794  45.569 1.00 4.61   ? 114 ASP B CB  1 
ATOM   3329 C CG  . ASP B 1 114 ? 29.508 21.007  44.396 1.00 10.24  ? 114 ASP B CG  1 
ATOM   3330 O OD1 . ASP B 1 114 ? 28.732 20.087  44.052 1.00 15.44  ? 114 ASP B OD1 1 
ATOM   3331 O OD2 . ASP B 1 114 ? 29.601 22.107  43.817 1.00 21.54  ? 114 ASP B OD2 1 
ATOM   3332 N N   . GLN B 1 115 ? 32.625 19.504  47.327 1.00 15.87  ? 115 GLN B N   1 
ATOM   3333 C CA  . GLN B 1 115 ? 34.022 19.518  47.721 1.00 16.04  ? 115 GLN B CA  1 
ATOM   3334 C C   . GLN B 1 115 ? 34.640 18.149  47.644 1.00 14.71  ? 115 GLN B C   1 
ATOM   3335 O O   . GLN B 1 115 ? 35.845 18.031  47.449 1.00 15.44  ? 115 GLN B O   1 
ATOM   3336 C CB  . GLN B 1 115 ? 34.217 20.104  49.104 1.00 22.28  ? 115 GLN B CB  1 
ATOM   3337 C CG  . GLN B 1 115 ? 35.665 20.466  49.373 1.00 43.07  ? 115 GLN B CG  1 
ATOM   3338 C CD  . GLN B 1 115 ? 35.859 21.134  50.717 1.00 56.90  ? 115 GLN B CD  1 
ATOM   3339 O OE1 . GLN B 1 115 ? 35.049 21.969  51.138 1.00 61.15  ? 115 GLN B OE1 1 
ATOM   3340 N NE2 . GLN B 1 115 ? 36.938 20.771  51.404 1.00 61.22  ? 115 GLN B NE2 1 
ATOM   3341 N N   . ASP B 1 116 ? 33.825 17.111  47.809 1.00 14.81  ? 116 ASP B N   1 
ATOM   3342 C CA  . ASP B 1 116 ? 34.334 15.751  47.711 1.00 16.33  ? 116 ASP B CA  1 
ATOM   3343 C C   . ASP B 1 116 ? 34.610 15.529  46.246 1.00 23.81  ? 116 ASP B C   1 
ATOM   3344 O O   . ASP B 1 116 ? 35.628 14.936  45.883 1.00 30.82  ? 116 ASP B O   1 
ATOM   3345 C CB  . ASP B 1 116 ? 33.305 14.744  48.194 1.00 25.26  ? 116 ASP B CB  1 
ATOM   3346 C CG  . ASP B 1 116 ? 33.140 14.755  49.702 1.00 37.06  ? 116 ASP B CG  1 
ATOM   3347 O OD1 . ASP B 1 116 ? 32.196 14.104  50.194 1.00 48.57  ? 116 ASP B OD1 1 
ATOM   3348 O OD2 . ASP B 1 116 ? 33.945 15.401  50.403 1.00 22.58  ? 116 ASP B OD2 1 
ATOM   3349 N N   . TYR B 1 117 ? 33.714 16.058  45.410 1.00 20.82  ? 117 TYR B N   1 
ATOM   3350 C CA  . TYR B 1 117 ? 33.833 15.963  43.960 1.00 19.67  ? 117 TYR B CA  1 
ATOM   3351 C C   . TYR B 1 117 ? 35.110 16.680  43.507 1.00 20.59  ? 117 TYR B C   1 
ATOM   3352 O O   . TYR B 1 117 ? 35.937 16.120  42.768 1.00 22.73  ? 117 TYR B O   1 
ATOM   3353 C CB  . TYR B 1 117 ? 32.621 16.608  43.295 1.00 7.94   ? 117 TYR B CB  1 
ATOM   3354 C CG  . TYR B 1 117 ? 32.703 16.628  41.793 1.00 16.54  ? 117 TYR B CG  1 
ATOM   3355 C CD1 . TYR B 1 117 ? 32.808 17.823  41.099 1.00 21.61  ? 117 TYR B CD1 1 
ATOM   3356 C CD2 . TYR B 1 117 ? 32.691 15.446  41.060 1.00 21.65  ? 117 TYR B CD2 1 
ATOM   3357 C CE1 . TYR B 1 117 ? 32.900 17.843  39.712 1.00 17.70  ? 117 TYR B CE1 1 
ATOM   3358 C CE2 . TYR B 1 117 ? 32.778 15.454  39.674 1.00 21.33  ? 117 TYR B CE2 1 
ATOM   3359 C CZ  . TYR B 1 117 ? 32.882 16.658  39.013 1.00 15.96  ? 117 TYR B CZ  1 
ATOM   3360 O OH  . TYR B 1 117 ? 32.970 16.677  37.646 1.00 24.98  ? 117 TYR B OH  1 
ATOM   3361 N N   . GLN B 1 118 ? 35.293 17.889  44.029 1.00 14.59  ? 118 GLN B N   1 
ATOM   3362 C CA  . GLN B 1 118 ? 36.439 18.729  43.705 1.00 18.59  ? 118 GLN B CA  1 
ATOM   3363 C C   . GLN B 1 118 ? 37.786 18.111  44.068 1.00 23.82  ? 118 GLN B C   1 
ATOM   3364 O O   . GLN B 1 118 ? 38.719 18.108  43.251 1.00 25.11  ? 118 GLN B O   1 
ATOM   3365 C CB  . GLN B 1 118 ? 36.286 20.074  44.401 1.00 16.23  ? 118 GLN B CB  1 
ATOM   3366 C CG  . GLN B 1 118 ? 37.476 20.984  44.278 1.00 23.71  ? 118 GLN B CG  1 
ATOM   3367 C CD  . GLN B 1 118 ? 37.209 22.334  44.912 1.00 28.67  ? 118 GLN B CD  1 
ATOM   3368 O OE1 . GLN B 1 118 ? 36.625 22.417  45.996 1.00 28.89  ? 118 GLN B OE1 1 
ATOM   3369 N NE2 . GLN B 1 118 ? 37.598 23.407  44.223 1.00 26.59  ? 118 GLN B NE2 1 
ATOM   3370 N N   . ASN B 1 119 ? 37.882 17.582  45.287 1.00 24.91  ? 119 ASN B N   1 
ATOM   3371 C CA  . ASN B 1 119 ? 39.119 16.964  45.761 1.00 21.60  ? 119 ASN B CA  1 
ATOM   3372 C C   . ASN B 1 119 ? 39.456 15.680  44.997 1.00 21.25  ? 119 ASN B C   1 
ATOM   3373 O O   . ASN B 1 119 ? 40.622 15.372  44.790 1.00 20.79  ? 119 ASN B O   1 
ATOM   3374 C CB  . ASN B 1 119 ? 39.036 16.682  47.260 1.00 24.00  ? 119 ASN B CB  1 
ATOM   3375 C CG  . ASN B 1 119 ? 38.909 17.941  48.073 1.00 29.92  ? 119 ASN B CG  1 
ATOM   3376 O OD1 . ASN B 1 119 ? 39.579 18.930  47.797 1.00 43.84  ? 119 ASN B OD1 1 
ATOM   3377 N ND2 . ASN B 1 119 ? 38.034 17.925  49.073 1.00 33.26  ? 119 ASN B ND2 1 
ATOM   3378 N N   . SER B 1 120 ? 38.440 14.934  44.574 1.00 13.58  ? 120 SER B N   1 
ATOM   3379 C CA  . SER B 1 120 ? 38.689 13.710  43.841 1.00 13.51  ? 120 SER B CA  1 
ATOM   3380 C C   . SER B 1 120 ? 39.409 14.059  42.565 1.00 16.15  ? 120 SER B C   1 
ATOM   3381 O O   . SER B 1 120 ? 40.265 13.301  42.092 1.00 27.17  ? 120 SER B O   1 
ATOM   3382 C CB  . SER B 1 120 ? 37.377 13.006  43.490 1.00 13.98  ? 120 SER B CB  1 
ATOM   3383 O OG  . SER B 1 120 ? 36.697 12.545  44.646 1.00 23.26  ? 120 SER B OG  1 
ATOM   3384 N N   . VAL B 1 121 ? 39.084 15.230  42.026 1.00 16.16  ? 121 VAL B N   1 
ATOM   3385 C CA  . VAL B 1 121 ? 39.671 15.690  40.762 1.00 18.59  ? 121 VAL B CA  1 
ATOM   3386 C C   . VAL B 1 121 ? 40.944 16.540  40.893 1.00 18.47  ? 121 VAL B C   1 
ATOM   3387 O O   . VAL B 1 121 ? 41.818 16.478  40.022 1.00 17.40  ? 121 VAL B O   1 
ATOM   3388 C CB  . VAL B 1 121 ? 38.609 16.450  39.895 1.00 17.08  ? 121 VAL B CB  1 
ATOM   3389 C CG1 . VAL B 1 121 ? 39.189 16.870  38.568 1.00 13.14  ? 121 VAL B CG1 1 
ATOM   3390 C CG2 . VAL B 1 121 ? 37.381 15.579  39.661 1.00 11.41  ? 121 VAL B CG2 1 
ATOM   3391 N N   . THR B 1 122 ? 41.092 17.278  41.992 1.00 13.81  ? 122 THR B N   1 
ATOM   3392 C CA  . THR B 1 122 ? 42.273 18.126  42.145 1.00 14.67  ? 122 THR B CA  1 
ATOM   3393 C C   . THR B 1 122 ? 43.369 17.653  43.094 1.00 17.85  ? 122 THR B C   1 
ATOM   3394 O O   . THR B 1 122 ? 44.515 18.082  42.976 1.00 19.87  ? 122 THR B O   1 
ATOM   3395 C CB  . THR B 1 122 ? 41.887 19.522  42.567 1.00 17.69  ? 122 THR B CB  1 
ATOM   3396 O OG1 . THR B 1 122 ? 41.202 19.453  43.821 1.00 37.22  ? 122 THR B OG1 1 
ATOM   3397 C CG2 . THR B 1 122 ? 40.971 20.151  41.551 1.00 19.23  ? 122 THR B CG2 1 
ATOM   3398 N N   . ARG B 1 123 ? 43.041 16.759  44.018 1.00 26.59  ? 123 ARG B N   1 
ATOM   3399 C CA  . ARG B 1 123 ? 44.027 16.274  44.987 1.00 32.08  ? 123 ARG B CA  1 
ATOM   3400 C C   . ARG B 1 123 ? 45.218 15.625  44.312 1.00 28.81  ? 123 ARG B C   1 
ATOM   3401 O O   . ARG B 1 123 ? 46.348 16.034  44.538 1.00 34.02  ? 123 ARG B O   1 
ATOM   3402 C CB  . ARG B 1 123 ? 43.381 15.328  46.006 1.00 42.02  ? 123 ARG B CB  1 
ATOM   3403 C CG  . ARG B 1 123 ? 44.169 15.172  47.293 1.00 58.10  ? 123 ARG B CG  1 
ATOM   3404 C CD  . ARG B 1 123 ? 43.340 14.477  48.380 1.00 73.47  ? 123 ARG B CD  1 
ATOM   3405 N NE  . ARG B 1 123 ? 44.120 14.176  49.586 1.00 77.21  ? 123 ARG B NE  1 
ATOM   3406 C CZ  . ARG B 1 123 ? 44.543 12.961  49.938 1.00 75.38  ? 123 ARG B CZ  1 
ATOM   3407 N NH1 . ARG B 1 123 ? 44.268 11.899  49.185 1.00 81.26  ? 123 ARG B NH1 1 
ATOM   3408 N NH2 . ARG B 1 123 ? 45.256 12.808  51.048 1.00 77.82  ? 123 ARG B NH2 1 
ATOM   3409 N N   . SER B 1 124 ? 44.960 14.655  43.446 1.00 27.94  ? 124 SER B N   1 
ATOM   3410 C CA  . SER B 1 124 ? 46.025 13.976  42.718 1.00 33.22  ? 124 SER B CA  1 
ATOM   3411 C C   . SER B 1 124 ? 45.562 13.779  41.290 1.00 31.90  ? 124 SER B C   1 
ATOM   3412 O O   . SER B 1 124 ? 44.408 13.418  41.064 1.00 37.95  ? 124 SER B O   1 
ATOM   3413 C CB  . SER B 1 124 ? 46.326 12.617  43.352 1.00 42.46  ? 124 SER B CB  1 
ATOM   3414 O OG  . SER B 1 124 ? 47.176 11.826  42.524 1.00 48.79  ? 124 SER B OG  1 
ATOM   3415 N N   . ALA B 1 125 ? 46.464 13.991  40.334 1.00 28.06  ? 125 ALA B N   1 
ATOM   3416 C CA  . ALA B 1 125 ? 46.141 13.852  38.910 1.00 31.29  ? 125 ALA B CA  1 
ATOM   3417 C C   . ALA B 1 125 ? 45.428 12.535  38.577 1.00 32.59  ? 125 ALA B C   1 
ATOM   3418 O O   . ALA B 1 125 ? 45.847 11.462  39.021 1.00 38.48  ? 125 ALA B O   1 
ATOM   3419 C CB  . ALA B 1 125 ? 47.390 13.987  38.095 1.00 28.41  ? 125 ALA B CB  1 
ATOM   3420 N N   . PRO B 1 126 ? 44.355 12.604  37.774 1.00 27.58  ? 126 PRO B N   1 
ATOM   3421 C CA  . PRO B 1 126 ? 43.560 11.439  37.371 1.00 31.36  ? 126 PRO B CA  1 
ATOM   3422 C C   . PRO B 1 126 ? 44.295 10.450  36.480 1.00 37.38  ? 126 PRO B C   1 
ATOM   3423 O O   . PRO B 1 126 ? 44.760 10.793  35.401 1.00 45.77  ? 126 PRO B O   1 
ATOM   3424 C CB  . PRO B 1 126 ? 42.358 12.067  36.668 1.00 31.51  ? 126 PRO B CB  1 
ATOM   3425 C CG  . PRO B 1 126 ? 42.919 13.320  36.092 1.00 23.79  ? 126 PRO B CG  1 
ATOM   3426 C CD  . PRO B 1 126 ? 43.808 13.842  37.195 1.00 28.22  ? 126 PRO B CD  1 
ATOM   3427 N N   . ILE B 1 127 ? 44.384 9.210   36.942 1.00 42.06  ? 127 ILE B N   1 
ATOM   3428 C CA  . ILE B 1 127 ? 45.069 8.151   36.212 1.00 42.70  ? 127 ILE B CA  1 
ATOM   3429 C C   . ILE B 1 127 ? 44.229 7.608   35.071 1.00 50.85  ? 127 ILE B C   1 
ATOM   3430 O O   . ILE B 1 127 ? 43.005 7.726   35.088 1.00 55.58  ? 127 ILE B O   1 
ATOM   3431 C CB  . ILE B 1 127 ? 45.422 6.994   37.158 1.00 37.06  ? 127 ILE B CB  1 
ATOM   3432 C CG1 . ILE B 1 127 ? 44.152 6.438   37.810 1.00 28.05  ? 127 ILE B CG1 1 
ATOM   3433 C CG2 . ILE B 1 127 ? 46.380 7.484   38.229 1.00 44.06  ? 127 ILE B CG2 1 
ATOM   3434 C CD1 . ILE B 1 127 ? 44.406 5.451   38.922 1.00 28.15  ? 127 ILE B CD1 1 
ATOM   3435 N N   . ASN B 1 128 ? 44.888 7.016   34.079 1.00 61.27  ? 128 ASN B N   1 
ATOM   3436 C CA  . ASN B 1 128 ? 44.186 6.446   32.928 1.00 68.25  ? 128 ASN B CA  1 
ATOM   3437 C C   . ASN B 1 128 ? 43.574 5.108   33.314 1.00 69.72  ? 128 ASN B C   1 
ATOM   3438 O O   . ASN B 1 128 ? 44.017 4.473   34.270 1.00 69.88  ? 128 ASN B O   1 
ATOM   3439 C CB  . ASN B 1 128 ? 45.134 6.280   31.727 1.00 71.67  ? 128 ASN B CB  1 
ATOM   3440 C CG  . ASN B 1 128 ? 45.511 7.616   31.079 1.00 76.84  ? 128 ASN B CG  1 
ATOM   3441 O OD1 . ASN B 1 128 ? 46.318 8.380   31.617 1.00 79.33  ? 128 ASN B OD1 1 
ATOM   3442 N ND2 . ASN B 1 128 ? 44.924 7.898   29.920 1.00 73.79  ? 128 ASN B ND2 1 
ATOM   3443 N N   . SER B 1 129 ? 42.533 4.702   32.597 1.00 73.23  ? 129 SER B N   1 
ATOM   3444 C CA  . SER B 1 129 ? 41.877 3.437   32.886 1.00 82.40  ? 129 SER B CA  1 
ATOM   3445 C C   . SER B 1 129 ? 42.077 2.498   31.694 1.00 87.76  ? 129 SER B C   1 
ATOM   3446 O O   . SER B 1 129 ? 43.002 1.673   31.689 1.00 91.39  ? 129 SER B O   1 
ATOM   3447 C CB  . SER B 1 129 ? 40.393 3.674   33.164 1.00 86.04  ? 129 SER B CB  1 
ATOM   3448 O OG  . SER B 1 129 ? 39.859 2.630   33.957 1.00 88.73  ? 129 SER B OG  1 
ATOM   3449 N N   . ASP B 1 130 ? 41.302 2.740   30.634 1.00 90.23  ? 130 ASP B N   1 
ATOM   3450 C CA  . ASP B 1 130 ? 41.378 1.955   29.404 1.00 91.14  ? 130 ASP B CA  1 
ATOM   3451 C C   . ASP B 1 130 ? 40.358 2.437   28.370 1.00 91.57  ? 130 ASP B C   1 
ATOM   3452 O O   . ASP B 1 130 ? 39.234 1.935   28.302 1.00 88.99  ? 130 ASP B O   1 
ATOM   3453 C CB  . ASP B 1 130 ? 41.158 0.470   29.697 1.00 89.81  ? 130 ASP B CB  1 
ATOM   3454 C CG  . ASP B 1 130 ? 41.678 -0.415  28.592 1.00 89.93  ? 130 ASP B CG  1 
ATOM   3455 O OD1 . ASP B 1 130 ? 42.849 -0.222  28.198 1.00 89.25  ? 130 ASP B OD1 1 
ATOM   3456 O OD2 . ASP B 1 130 ? 40.921 -1.293  28.120 1.00 87.91  ? 130 ASP B OD2 1 
ATOM   3457 N N   . SER B 1 131 ? 40.754 3.421   27.572 1.00 89.73  ? 131 SER B N   1 
ATOM   3458 C CA  . SER B 1 131 ? 39.872 3.966   26.546 1.00 87.15  ? 131 SER B CA  1 
ATOM   3459 C C   . SER B 1 131 ? 39.672 2.960   25.427 1.00 87.98  ? 131 SER B C   1 
ATOM   3460 O O   . SER B 1 131 ? 40.510 2.832   24.533 1.00 88.98  ? 131 SER B O   1 
ATOM   3461 C CB  . SER B 1 131 ? 40.432 5.282   26.003 1.00 88.36  ? 131 SER B CB  1 
ATOM   3462 O OG  . SER B 1 131 ? 41.851 5.279   25.941 1.00 90.70  ? 131 SER B OG  1 
ATOM   3463 N N   . GLN B 1 132 ? 38.543 2.262   25.477 1.00 88.06  ? 132 GLN B N   1 
ATOM   3464 C CA  . GLN B 1 132 ? 38.210 1.229   24.495 1.00 90.57  ? 132 GLN B CA  1 
ATOM   3465 C C   . GLN B 1 132 ? 38.610 1.491   23.039 1.00 89.97  ? 132 GLN B C   1 
ATOM   3466 O O   . GLN B 1 132 ? 38.595 2.635   22.573 1.00 88.70  ? 132 GLN B O   1 
ATOM   3467 C CB  . GLN B 1 132 ? 36.730 0.851   24.608 1.00 88.85  ? 132 GLN B CB  1 
ATOM   3468 C CG  . GLN B 1 132 ? 36.368 0.300   25.987 1.00 89.77  ? 132 GLN B CG  1 
ATOM   3469 C CD  . GLN B 1 132 ? 37.492 -0.538  26.592 1.00 93.04  ? 132 GLN B CD  1 
ATOM   3470 O OE1 . GLN B 1 132 ? 37.941 -1.526  26.002 1.00 90.89  ? 132 GLN B OE1 1 
ATOM   3471 N NE2 . GLN B 1 132 ? 37.967 -0.126  27.763 1.00 88.19  ? 132 GLN B NE2 1 
ATOM   3472 N N   . GLY B 1 133 ? 38.972 0.413   22.339 1.00 88.94  ? 133 GLY B N   1 
ATOM   3473 C CA  . GLY B 1 133 ? 39.417 0.501   20.954 1.00 90.73  ? 133 GLY B CA  1 
ATOM   3474 C C   . GLY B 1 133 ? 38.431 0.814   19.835 1.00 88.33  ? 133 GLY B C   1 
ATOM   3475 O O   . GLY B 1 133 ? 38.565 0.274   18.727 1.00 90.52  ? 133 GLY B O   1 
ATOM   3476 N N   . ARG B 1 134 ? 37.478 1.711   20.093 1.00 89.54  ? 134 ARG B N   1 
ATOM   3477 C CA  . ARG B 1 134 ? 36.488 2.092   19.088 1.00 87.74  ? 134 ARG B CA  1 
ATOM   3478 C C   . ARG B 1 134 ? 36.022 3.546   19.231 1.00 88.02  ? 134 ARG B C   1 
ATOM   3479 O O   . ARG B 1 134 ? 36.838 4.449   19.442 1.00 88.22  ? 134 ARG B O   1 
ATOM   3480 C CB  . ARG B 1 134 ? 35.290 1.143   19.140 1.00 89.08  ? 134 ARG B CB  1 
ATOM   3481 C CG  . ARG B 1 134 ? 34.912 0.565   17.785 1.00 86.93  ? 134 ARG B CG  1 
ATOM   3482 C CD  . ARG B 1 134 ? 33.599 -0.198  17.861 1.00 89.41  ? 134 ARG B CD  1 
ATOM   3483 N NE  . ARG B 1 134 ? 33.538 -1.300  16.901 1.00 91.73  ? 134 ARG B NE  1 
ATOM   3484 C CZ  . ARG B 1 134 ? 32.420 -1.730  16.322 1.00 94.45  ? 134 ARG B CZ  1 
ATOM   3485 N NH1 . ARG B 1 134 ? 31.257 -1.144  16.593 1.00 91.42  ? 134 ARG B NH1 1 
ATOM   3486 N NH2 . ARG B 1 134 ? 32.457 -2.781  15.511 1.00 88.76  ? 134 ARG B NH2 1 
ATOM   3487 N N   . CYS B 1 135 ? 34.717 3.769   19.115 1.00 86.15  ? 135 CYS B N   1 
ATOM   3488 C CA  . CYS B 1 135 ? 34.105 5.103   19.194 1.00 86.26  ? 135 CYS B CA  1 
ATOM   3489 C C   . CYS B 1 135 ? 34.504 5.786   20.504 1.00 85.38  ? 135 CYS B C   1 
ATOM   3490 O O   . CYS B 1 135 ? 34.300 5.267   21.598 1.00 86.60  ? 135 CYS B O   1 
ATOM   3491 C CB  . CYS B 1 135 ? 32.581 4.983   19.137 1.00 86.28  ? 135 CYS B CB  1 
ATOM   3492 S SG  . CYS B 1 135 ? 31.986 4.188   17.611 1.00 20.00  ? 135 CYS B SG  1 
ATOM   3493 N N   . GLY B 1 136 ? 35.042 7.003   20.363 1.00 85.01  ? 136 GLY B N   1 
ATOM   3494 C CA  . GLY B 1 136 ? 35.461 7.777   21.516 1.00 81.47  ? 136 GLY B CA  1 
ATOM   3495 C C   . GLY B 1 136 ? 36.934 8.116   21.414 1.00 81.54  ? 136 GLY B C   1 
ATOM   3496 O O   . GLY B 1 136 ? 37.512 8.060   20.326 1.00 81.87  ? 136 GLY B O   1 
ATOM   3497 N N   . THR B 1 137 ? 37.548 8.458   22.543 1.00 81.08  ? 137 THR B N   1 
ATOM   3498 C CA  . THR B 1 137 ? 38.965 8.806   22.566 1.00 81.58  ? 137 THR B CA  1 
ATOM   3499 C C   . THR B 1 137 ? 39.685 8.353   23.832 1.00 83.08  ? 137 THR B C   1 
ATOM   3500 O O   . THR B 1 137 ? 40.653 7.595   23.758 1.00 80.23  ? 137 THR B O   1 
ATOM   3501 C CB  . THR B 1 137 ? 39.189 10.328  22.391 1.00 82.23  ? 137 THR B CB  1 
ATOM   3502 O OG1 . THR B 1 137 ? 38.240 11.050  23.184 1.00 80.49  ? 137 THR B OG1 1 
ATOM   3503 C CG2 . THR B 1 137 ? 39.057 10.735  20.931 1.00 81.79  ? 137 THR B CG2 1 
ATOM   3504 N N   . ARG B 1 138 ? 39.208 8.806   24.990 1.00 85.39  ? 138 ARG B N   1 
ATOM   3505 C CA  . ARG B 1 138 ? 39.842 8.453   26.261 1.00 82.54  ? 138 ARG B CA  1 
ATOM   3506 C C   . ARG B 1 138 ? 38.910 8.176   27.426 1.00 79.32  ? 138 ARG B C   1 
ATOM   3507 O O   . ARG B 1 138 ? 37.775 8.652   27.476 1.00 79.54  ? 138 ARG B O   1 
ATOM   3508 C CB  . ARG B 1 138 ? 40.851 9.521   26.695 1.00 82.70  ? 138 ARG B CB  1 
ATOM   3509 C CG  . ARG B 1 138 ? 42.237 9.357   26.101 1.00 88.55  ? 138 ARG B CG  1 
ATOM   3510 C CD  . ARG B 1 138 ? 43.252 10.213  26.849 1.00 92.14  ? 138 ARG B CD  1 
ATOM   3511 N NE  . ARG B 1 138 ? 44.521 10.318  26.129 1.00 91.39  ? 138 ARG B NE  1 
ATOM   3512 C CZ  . ARG B 1 138 ? 45.254 11.427  26.064 1.00 90.38  ? 138 ARG B CZ  1 
ATOM   3513 N NH1 . ARG B 1 138 ? 44.852 12.533  26.684 1.00 92.16  ? 138 ARG B NH1 1 
ATOM   3514 N NH2 . ARG B 1 138 ? 46.369 11.441  25.342 1.00 88.52  ? 138 ARG B NH2 1 
ATOM   3515 N N   . PHE B 1 139 ? 39.429 7.402   28.371 1.00 71.14  ? 139 PHE B N   1 
ATOM   3516 C CA  . PHE B 1 139 ? 38.705 7.044   29.575 1.00 67.42  ? 139 PHE B CA  1 
ATOM   3517 C C   . PHE B 1 139 ? 39.628 7.163   30.774 1.00 64.97  ? 139 PHE B C   1 
ATOM   3518 O O   . PHE B 1 139 ? 40.590 6.402   30.928 1.00 66.18  ? 139 PHE B O   1 
ATOM   3519 C CB  . PHE B 1 139 ? 38.145 5.630   29.482 1.00 70.45  ? 139 PHE B CB  1 
ATOM   3520 C CG  . PHE B 1 139 ? 36.669 5.585   29.246 1.00 76.74  ? 139 PHE B CG  1 
ATOM   3521 C CD1 . PHE B 1 139 ? 35.786 5.576   30.319 1.00 77.49  ? 139 PHE B CD1 1 
ATOM   3522 C CD2 . PHE B 1 139 ? 36.158 5.555   27.953 1.00 76.17  ? 139 PHE B CD2 1 
ATOM   3523 C CE1 . PHE B 1 139 ? 34.411 5.537   30.112 1.00 80.98  ? 139 PHE B CE1 1 
ATOM   3524 C CE2 . PHE B 1 139 ? 34.787 5.516   27.732 1.00 77.78  ? 139 PHE B CE2 1 
ATOM   3525 C CZ  . PHE B 1 139 ? 33.908 5.506   28.816 1.00 82.74  ? 139 PHE B CZ  1 
ATOM   3526 N N   . LEU B 1 140 ? 39.344 8.169   31.593 1.00 57.02  ? 140 LEU B N   1 
ATOM   3527 C CA  . LEU B 1 140 ? 40.103 8.439   32.801 1.00 43.67  ? 140 LEU B CA  1 
ATOM   3528 C C   . LEU B 1 140 ? 39.270 8.125   34.035 1.00 38.01  ? 140 LEU B C   1 
ATOM   3529 O O   . LEU B 1 140 ? 38.081 7.803   33.947 1.00 34.71  ? 140 LEU B O   1 
ATOM   3530 C CB  . LEU B 1 140 ? 40.517 9.906   32.852 1.00 31.89  ? 140 LEU B CB  1 
ATOM   3531 C CG  . LEU B 1 140 ? 41.665 10.373  31.964 1.00 21.35  ? 140 LEU B CG  1 
ATOM   3532 C CD1 . LEU B 1 140 ? 41.905 11.848  32.207 1.00 30.17  ? 140 LEU B CD1 1 
ATOM   3533 C CD2 . LEU B 1 140 ? 42.908 9.602   32.316 1.00 5.89   ? 140 LEU B CD2 1 
ATOM   3534 N N   . THR B 1 141 ? 39.926 8.197   35.184 1.00 32.82  ? 141 THR B N   1 
ATOM   3535 C CA  . THR B 1 141 ? 39.288 7.961   36.459 1.00 24.90  ? 141 THR B CA  1 
ATOM   3536 C C   . THR B 1 141 ? 40.118 8.719   37.473 1.00 22.91  ? 141 THR B C   1 
ATOM   3537 O O   . THR B 1 141 ? 41.346 8.785   37.369 1.00 16.57  ? 141 THR B O   1 
ATOM   3538 C CB  . THR B 1 141 ? 39.217 6.464   36.807 1.00 22.17  ? 141 THR B CB  1 
ATOM   3539 O OG1 . THR B 1 141 ? 38.111 6.238   37.689 1.00 28.57  ? 141 THR B OG1 1 
ATOM   3540 C CG2 . THR B 1 141 ? 40.478 6.002   37.496 1.00 22.86  ? 141 THR B CG2 1 
ATOM   3541 N N   . THR B 1 142 ? 39.436 9.376   38.395 1.00 23.15  ? 142 THR B N   1 
ATOM   3542 C CA  . THR B 1 142 ? 40.112 10.149  39.420 1.00 28.01  ? 142 THR B CA  1 
ATOM   3543 C C   . THR B 1 142 ? 41.065 9.219   40.157 1.00 31.92  ? 142 THR B C   1 
ATOM   3544 O O   . THR B 1 142 ? 40.944 7.994   40.048 1.00 31.17  ? 142 THR B O   1 
ATOM   3545 C CB  . THR B 1 142 ? 39.098 10.794  40.376 1.00 28.44  ? 142 THR B CB  1 
ATOM   3546 O OG1 . THR B 1 142 ? 38.089 9.833   40.722 1.00 29.40  ? 142 THR B OG1 1 
ATOM   3547 C CG2 . THR B 1 142 ? 38.443 11.992  39.703 1.00 22.35  ? 142 THR B CG2 1 
ATOM   3548 N N   . TYR B 1 143 ? 42.052 9.796   40.840 1.00 34.78  ? 143 TYR B N   1 
ATOM   3549 C CA  . TYR B 1 143 ? 43.038 8.998   41.563 1.00 30.50  ? 143 TYR B CA  1 
ATOM   3550 C C   . TYR B 1 143 ? 42.332 8.033   42.491 1.00 27.30  ? 143 TYR B C   1 
ATOM   3551 O O   . TYR B 1 143 ? 42.765 6.897   42.640 1.00 34.56  ? 143 TYR B O   1 
ATOM   3552 C CB  . TYR B 1 143 ? 44.029 9.891   42.333 1.00 28.63  ? 143 TYR B CB  1 
ATOM   3553 C CG  . TYR B 1 143 ? 43.504 10.499  43.609 1.00 30.25  ? 143 TYR B CG  1 
ATOM   3554 C CD1 . TYR B 1 143 ? 43.599 9.807   44.815 1.00 42.39  ? 143 TYR B CD1 1 
ATOM   3555 C CD2 . TYR B 1 143 ? 42.913 11.756  43.621 1.00 27.28  ? 143 TYR B CD2 1 
ATOM   3556 C CE1 . TYR B 1 143 ? 43.115 10.348  46.009 1.00 38.37  ? 143 TYR B CE1 1 
ATOM   3557 C CE2 . TYR B 1 143 ? 42.422 12.306  44.813 1.00 38.14  ? 143 TYR B CE2 1 
ATOM   3558 C CZ  . TYR B 1 143 ? 42.528 11.588  46.002 1.00 32.41  ? 143 TYR B CZ  1 
ATOM   3559 O OH  . TYR B 1 143 ? 42.032 12.079  47.186 1.00 32.17  ? 143 TYR B OH  1 
ATOM   3560 N N   . ASP B 1 144 ? 41.191 8.460   43.028 1.00 22.21  ? 144 ASP B N   1 
ATOM   3561 C CA  . ASP B 1 144 ? 40.421 7.627   43.937 1.00 25.30  ? 144 ASP B CA  1 
ATOM   3562 C C   . ASP B 1 144 ? 39.425 6.677   43.284 1.00 27.34  ? 144 ASP B C   1 
ATOM   3563 O O   . ASP B 1 144 ? 38.569 6.126   43.971 1.00 33.69  ? 144 ASP B O   1 
ATOM   3564 C CB  . ASP B 1 144 ? 39.714 8.482   44.979 1.00 27.91  ? 144 ASP B CB  1 
ATOM   3565 C CG  . ASP B 1 144 ? 38.817 9.516   44.366 1.00 33.84  ? 144 ASP B CG  1 
ATOM   3566 O OD1 . ASP B 1 144 ? 38.075 9.184   43.424 1.00 34.56  ? 144 ASP B OD1 1 
ATOM   3567 O OD2 . ASP B 1 144 ? 38.862 10.668  44.832 1.00 38.00  ? 144 ASP B OD2 1 
ATOM   3568 N N   . ARG B 1 145 ? 39.514 6.516   41.965 1.00 26.41  ? 145 ARG B N   1 
ATOM   3569 C CA  . ARG B 1 145 ? 38.651 5.601   41.204 1.00 29.96  ? 145 ARG B CA  1 
ATOM   3570 C C   . ARG B 1 145 ? 37.139 5.857   41.286 1.00 28.35  ? 145 ARG B C   1 
ATOM   3571 O O   . ARG B 1 145 ? 36.355 5.139   40.654 1.00 25.74  ? 145 ARG B O   1 
ATOM   3572 C CB  . ARG B 1 145 ? 38.891 4.149   41.645 1.00 46.20  ? 145 ARG B CB  1 
ATOM   3573 C CG  . ARG B 1 145 ? 40.178 3.454   41.204 1.00 51.44  ? 145 ARG B CG  1 
ATOM   3574 C CD  . ARG B 1 145 ? 40.174 2.054   41.831 1.00 65.13  ? 145 ARG B CD  1 
ATOM   3575 N NE  . ARG B 1 145 ? 41.239 1.158   41.376 1.00 73.03  ? 145 ARG B NE  1 
ATOM   3576 C CZ  . ARG B 1 145 ? 41.231 -0.162  41.574 1.00 78.28  ? 145 ARG B CZ  1 
ATOM   3577 N NH1 . ARG B 1 145 ? 40.218 -0.742  42.216 1.00 77.13  ? 145 ARG B NH1 1 
ATOM   3578 N NH2 . ARG B 1 145 ? 42.228 -0.912  41.123 1.00 74.23  ? 145 ARG B NH2 1 
ATOM   3579 N N   . ARG B 1 146 ? 36.734 6.883   42.028 1.00 23.79  ? 146 ARG B N   1 
ATOM   3580 C CA  . ARG B 1 146 ? 35.315 7.168   42.217 1.00 22.72  ? 146 ARG B CA  1 
ATOM   3581 C C   . ARG B 1 146 ? 34.584 7.818   41.052 1.00 27.42  ? 146 ARG B C   1 
ATOM   3582 O O   . ARG B 1 146 ? 33.398 7.555   40.839 1.00 32.32  ? 146 ARG B O   1 
ATOM   3583 C CB  . ARG B 1 146 ? 35.119 7.990   43.487 1.00 23.70  ? 146 ARG B CB  1 
ATOM   3584 C CG  . ARG B 1 146 ? 34.009 7.470   44.352 1.00 26.72  ? 146 ARG B CG  1 
ATOM   3585 C CD  . ARG B 1 146 ? 34.037 8.108   45.733 1.00 38.93  ? 146 ARG B CD  1 
ATOM   3586 N NE  . ARG B 1 146 ? 35.292 7.882   46.448 1.00 39.62  ? 146 ARG B NE  1 
ATOM   3587 C CZ  . ARG B 1 146 ? 35.448 8.093   47.753 1.00 44.55  ? 146 ARG B CZ  1 
ATOM   3588 N NH1 . ARG B 1 146 ? 34.428 8.527   48.482 1.00 39.41  ? 146 ARG B NH1 1 
ATOM   3589 N NH2 . ARG B 1 146 ? 36.628 7.888   48.327 1.00 46.77  ? 146 ARG B NH2 1 
ATOM   3590 N N   . PHE B 1 147 ? 35.272 8.683   40.312 1.00 24.94  ? 147 PHE B N   1 
ATOM   3591 C CA  . PHE B 1 147 ? 34.657 9.363   39.176 1.00 22.25  ? 147 PHE B CA  1 
ATOM   3592 C C   . PHE B 1 147 ? 35.458 9.040   37.932 1.00 22.82  ? 147 PHE B C   1 
ATOM   3593 O O   . PHE B 1 147 ? 36.670 8.827   38.002 1.00 23.73  ? 147 PHE B O   1 
ATOM   3594 C CB  . PHE B 1 147 ? 34.600 10.878  39.412 1.00 11.21  ? 147 PHE B CB  1 
ATOM   3595 C CG  . PHE B 1 147 ? 33.910 11.258  40.694 1.00 15.24  ? 147 PHE B CG  1 
ATOM   3596 C CD1 . PHE B 1 147 ? 34.583 11.983  41.669 1.00 11.80  ? 147 PHE B CD1 1 
ATOM   3597 C CD2 . PHE B 1 147 ? 32.613 10.815  40.960 1.00 8.11   ? 147 PHE B CD2 1 
ATOM   3598 C CE1 . PHE B 1 147 ? 33.984 12.257  42.893 1.00 12.87  ? 147 PHE B CE1 1 
ATOM   3599 C CE2 . PHE B 1 147 ? 31.994 11.083  42.181 1.00 2.70   ? 147 PHE B CE2 1 
ATOM   3600 C CZ  . PHE B 1 147 ? 32.672 11.798  43.150 1.00 16.95  ? 147 PHE B CZ  1 
ATOM   3601 N N   . VAL B 1 148 ? 34.761 8.954   36.806 1.00 20.12  ? 148 VAL B N   1 
ATOM   3602 C CA  . VAL B 1 148 ? 35.377 8.641   35.537 1.00 12.84  ? 148 VAL B CA  1 
ATOM   3603 C C   . VAL B 1 148 ? 35.226 9.811   34.610 1.00 20.30  ? 148 VAL B C   1 
ATOM   3604 O O   . VAL B 1 148 ? 34.144 10.389  34.511 1.00 26.62  ? 148 VAL B O   1 
ATOM   3605 C CB  . VAL B 1 148 ? 34.718 7.414   34.919 1.00 12.83  ? 148 VAL B CB  1 
ATOM   3606 C CG1 . VAL B 1 148 ? 34.872 7.413   33.413 1.00 25.85  ? 148 VAL B CG1 1 
ATOM   3607 C CG2 . VAL B 1 148 ? 35.362 6.173   35.493 1.00 21.22  ? 148 VAL B CG2 1 
ATOM   3608 N N   . ILE B 1 149 ? 36.310 10.154  33.924 1.00 23.34  ? 149 ILE B N   1 
ATOM   3609 C CA  . ILE B 1 149 ? 36.286 11.266  32.984 1.00 29.97  ? 149 ILE B CA  1 
ATOM   3610 C C   . ILE B 1 149 ? 36.387 10.733  31.554 1.00 30.45  ? 149 ILE B C   1 
ATOM   3611 O O   . ILE B 1 149 ? 37.461 10.301  31.115 1.00 35.12  ? 149 ILE B O   1 
ATOM   3612 C CB  . ILE B 1 149 ? 37.436 12.253  33.283 1.00 31.80  ? 149 ILE B CB  1 
ATOM   3613 C CG1 . ILE B 1 149 ? 37.446 12.561  34.781 1.00 25.73  ? 149 ILE B CG1 1 
ATOM   3614 C CG2 . ILE B 1 149 ? 37.243 13.553  32.478 1.00 32.37  ? 149 ILE B CG2 1 
ATOM   3615 C CD1 . ILE B 1 149 ? 38.705 13.205  35.274 1.00 34.40  ? 149 ILE B CD1 1 
ATOM   3616 N N   . LYS B 1 150 ? 35.248 10.669  30.868 1.00 23.54  ? 150 LYS B N   1 
ATOM   3617 C CA  . LYS B 1 150 ? 35.246 10.184  29.498 1.00 26.63  ? 150 LYS B CA  1 
ATOM   3618 C C   . LYS B 1 150 ? 35.324 11.364  28.575 1.00 25.72  ? 150 LYS B C   1 
ATOM   3619 O O   . LYS B 1 150 ? 34.641 12.367  28.788 1.00 32.29  ? 150 LYS B O   1 
ATOM   3620 C CB  . LYS B 1 150 ? 33.997 9.350   29.175 1.00 26.49  ? 150 LYS B CB  1 
ATOM   3621 C CG  . LYS B 1 150 ? 33.767 9.214   27.672 1.00 28.77  ? 150 LYS B CG  1 
ATOM   3622 C CD  . LYS B 1 150 ? 32.803 8.108   27.295 1.00 34.62  ? 150 LYS B CD  1 
ATOM   3623 C CE  . LYS B 1 150 ? 32.258 8.299   25.860 1.00 49.31  ? 150 LYS B CE  1 
ATOM   3624 N NZ  . LYS B 1 150 ? 33.264 8.539   24.760 1.00 50.69  ? 150 LYS B NZ  1 
ATOM   3625 N N   . THR B 1 151 ? 36.201 11.272  27.584 1.00 27.09  ? 151 THR B N   1 
ATOM   3626 C CA  . THR B 1 151 ? 36.341 12.351  26.617 1.00 32.37  ? 151 THR B CA  1 
ATOM   3627 C C   . THR B 1 151 ? 35.305 12.126  25.525 1.00 35.31  ? 151 THR B C   1 
ATOM   3628 O O   . THR B 1 151 ? 35.450 11.223  24.708 1.00 40.83  ? 151 THR B O   1 
ATOM   3629 C CB  . THR B 1 151 ? 37.727 12.373  25.961 1.00 25.83  ? 151 THR B CB  1 
ATOM   3630 O OG1 . THR B 1 151 ? 38.744 12.186  26.948 1.00 37.84  ? 151 THR B OG1 1 
ATOM   3631 C CG2 . THR B 1 151 ? 37.950 13.699  25.329 1.00 38.27  ? 151 THR B CG2 1 
ATOM   3632 N N   . VAL B 1 152 ? 34.220 12.893  25.560 1.00 37.59  ? 152 VAL B N   1 
ATOM   3633 C CA  . VAL B 1 152 ? 33.174 12.767  24.551 1.00 32.76  ? 152 VAL B CA  1 
ATOM   3634 C C   . VAL B 1 152 ? 33.530 13.591  23.305 1.00 40.28  ? 152 VAL B C   1 
ATOM   3635 O O   . VAL B 1 152 ? 34.634 14.153  23.198 1.00 37.87  ? 152 VAL B O   1 
ATOM   3636 C CB  . VAL B 1 152 ? 31.795 13.212  25.084 1.00 29.34  ? 152 VAL B CB  1 
ATOM   3637 C CG1 . VAL B 1 152 ? 31.372 12.341  26.235 1.00 21.94  ? 152 VAL B CG1 1 
ATOM   3638 C CG2 . VAL B 1 152 ? 31.835 14.674  25.507 1.00 30.38  ? 152 VAL B CG2 1 
ATOM   3639 N N   . SER B 1 153 ? 32.591 13.648  22.366 1.00 43.24  ? 153 SER B N   1 
ATOM   3640 C CA  . SER B 1 153 ? 32.775 14.372  21.116 1.00 46.29  ? 153 SER B CA  1 
ATOM   3641 C C   . SER B 1 153 ? 31.845 15.565  21.087 1.00 46.21  ? 153 SER B C   1 
ATOM   3642 O O   . SER B 1 153 ? 30.880 15.610  21.844 1.00 48.28  ? 153 SER B O   1 
ATOM   3643 C CB  . SER B 1 153 ? 32.415 13.469  19.946 1.00 56.75  ? 153 SER B CB  1 
ATOM   3644 O OG  . SER B 1 153 ? 31.013 13.217  19.938 1.00 52.53  ? 153 SER B OG  1 
ATOM   3645 N N   . SER B 1 154 ? 32.092 16.488  20.160 1.00 40.65  ? 154 SER B N   1 
ATOM   3646 C CA  . SER B 1 154 ? 31.268 17.677  20.031 1.00 41.66  ? 154 SER B CA  1 
ATOM   3647 C C   . SER B 1 154 ? 29.815 17.281  19.798 1.00 42.69  ? 154 SER B C   1 
ATOM   3648 O O   . SER B 1 154 ? 28.892 17.998  20.199 1.00 44.75  ? 154 SER B O   1 
ATOM   3649 C CB  . SER B 1 154 ? 31.758 18.537  18.873 1.00 45.07  ? 154 SER B CB  1 
ATOM   3650 O OG  . SER B 1 154 ? 31.005 19.732  18.793 1.00 57.36  ? 154 SER B OG  1 
ATOM   3651 N N   . GLU B 1 155 ? 29.625 16.126  19.166 1.00 42.48  ? 155 GLU B N   1 
ATOM   3652 C CA  . GLU B 1 155 ? 28.293 15.607  18.871 1.00 42.25  ? 155 GLU B CA  1 
ATOM   3653 C C   . GLU B 1 155 ? 27.620 15.285  20.190 1.00 36.49  ? 155 GLU B C   1 
ATOM   3654 O O   . GLU B 1 155 ? 26.545 15.791  20.489 1.00 35.99  ? 155 GLU B O   1 
ATOM   3655 C CB  . GLU B 1 155 ? 28.391 14.322  18.037 1.00 56.45  ? 155 GLU B CB  1 
ATOM   3656 C CG  . GLU B 1 155 ? 29.392 14.359  16.880 1.00 68.01  ? 155 GLU B CG  1 
ATOM   3657 C CD  . GLU B 1 155 ? 28.967 15.287  15.757 1.00 80.12  ? 155 GLU B CD  1 
ATOM   3658 O OE1 . GLU B 1 155 ? 29.230 16.509  15.846 1.00 85.71  ? 155 GLU B OE1 1 
ATOM   3659 O OE2 . GLU B 1 155 ? 28.370 14.788  14.777 1.00 90.61  ? 155 GLU B OE2 1 
ATOM   3660 N N   . ASP B 1 156 ? 28.299 14.477  20.998 1.00 33.06  ? 156 ASP B N   1 
ATOM   3661 C CA  . ASP B 1 156 ? 27.779 14.063  22.296 1.00 35.73  ? 156 ASP B CA  1 
ATOM   3662 C C   . ASP B 1 156 ? 27.387 15.236  23.204 1.00 32.35  ? 156 ASP B C   1 
ATOM   3663 O O   . ASP B 1 156 ? 26.289 15.245  23.777 1.00 30.78  ? 156 ASP B O   1 
ATOM   3664 C CB  . ASP B 1 156 ? 28.794 13.158  22.995 1.00 42.06  ? 156 ASP B CB  1 
ATOM   3665 C CG  . ASP B 1 156 ? 29.202 11.977  22.139 1.00 42.90  ? 156 ASP B CG  1 
ATOM   3666 O OD1 . ASP B 1 156 ? 28.334 11.393  21.457 1.00 51.15  ? 156 ASP B OD1 1 
ATOM   3667 O OD2 . ASP B 1 156 ? 30.396 11.633  22.140 1.00 49.02  ? 156 ASP B OD2 1 
ATOM   3668 N N   . VAL B 1 157 ? 28.268 16.232  23.304 1.00 26.59  ? 157 VAL B N   1 
ATOM   3669 C CA  . VAL B 1 157 ? 28.019 17.416  24.124 1.00 18.17  ? 157 VAL B CA  1 
ATOM   3670 C C   . VAL B 1 157 ? 26.711 18.070  23.704 1.00 26.94  ? 157 VAL B C   1 
ATOM   3671 O O   . VAL B 1 157 ? 26.030 18.685  24.513 1.00 29.13  ? 157 VAL B O   1 
ATOM   3672 C CB  . VAL B 1 157 ? 29.166 18.424  24.006 1.00 10.00  ? 157 VAL B CB  1 
ATOM   3673 C CG1 . VAL B 1 157 ? 28.803 19.725  24.661 1.00 4.94   ? 157 VAL B CG1 1 
ATOM   3674 C CG2 . VAL B 1 157 ? 30.406 17.863  24.661 1.00 4.24   ? 157 VAL B CG2 1 
ATOM   3675 N N   . ALA B 1 158 ? 26.353 17.902  22.435 1.00 34.60  ? 158 ALA B N   1 
ATOM   3676 C CA  . ALA B 1 158 ? 25.113 18.449  21.909 1.00 33.63  ? 158 ALA B CA  1 
ATOM   3677 C C   . ALA B 1 158 ? 23.977 17.524  22.299 1.00 38.20  ? 158 ALA B C   1 
ATOM   3678 O O   . ALA B 1 158 ? 22.842 17.971  22.484 1.00 45.50  ? 158 ALA B O   1 
ATOM   3679 C CB  . ALA B 1 158 ? 25.190 18.582  20.411 1.00 36.85  ? 158 ALA B CB  1 
ATOM   3680 N N   . GLU B 1 159 ? 24.275 16.238  22.454 1.00 35.78  ? 159 GLU B N   1 
ATOM   3681 C CA  . GLU B 1 159 ? 23.226 15.312  22.843 1.00 46.40  ? 159 GLU B CA  1 
ATOM   3682 C C   . GLU B 1 159 ? 22.871 15.539  24.309 1.00 46.93  ? 159 GLU B C   1 
ATOM   3683 O O   . GLU B 1 159 ? 21.689 15.622  24.666 1.00 52.74  ? 159 GLU B O   1 
ATOM   3684 C CB  . GLU B 1 159 ? 23.624 13.862  22.609 1.00 46.70  ? 159 GLU B CB  1 
ATOM   3685 C CG  . GLU B 1 159 ? 22.409 12.931  22.570 1.00 51.25  ? 159 GLU B CG  1 
ATOM   3686 C CD  . GLU B 1 159 ? 22.783 11.462  22.614 1.00 56.11  ? 159 GLU B CD  1 
ATOM   3687 O OE1 . GLU B 1 159 ? 23.863 11.102  22.091 1.00 54.75  ? 159 GLU B OE1 1 
ATOM   3688 O OE2 . GLU B 1 159 ? 21.993 10.668  23.176 1.00 60.26  ? 159 GLU B OE2 1 
ATOM   3689 N N   . MET B 1 160 ? 23.895 15.687  25.149 1.00 44.03  ? 160 MET B N   1 
ATOM   3690 C CA  . MET B 1 160 ? 23.684 15.931  26.573 1.00 38.83  ? 160 MET B CA  1 
ATOM   3691 C C   . MET B 1 160 ? 22.734 17.102  26.778 1.00 36.54  ? 160 MET B C   1 
ATOM   3692 O O   . MET B 1 160 ? 21.869 17.050  27.640 1.00 36.89  ? 160 MET B O   1 
ATOM   3693 C CB  . MET B 1 160 ? 25.006 16.229  27.278 1.00 24.45  ? 160 MET B CB  1 
ATOM   3694 C CG  . MET B 1 160 ? 25.501 15.106  28.157 1.00 30.54  ? 160 MET B CG  1 
ATOM   3695 S SD  . MET B 1 160 ? 24.406 14.733  29.527 1.00 40.97  ? 160 MET B SD  1 
ATOM   3696 C CE  . MET B 1 160 ? 24.094 16.329  30.125 1.00 29.73  ? 160 MET B CE  1 
ATOM   3697 N N   . HIS B 1 161 ? 22.867 18.131  25.948 1.00 31.86  ? 161 HIS B N   1 
ATOM   3698 C CA  . HIS B 1 161 ? 22.026 19.305  26.076 1.00 37.23  ? 161 HIS B CA  1 
ATOM   3699 C C   . HIS B 1 161 ? 20.599 19.063  25.684 1.00 41.49  ? 161 HIS B C   1 
ATOM   3700 O O   . HIS B 1 161 ? 19.682 19.576  26.326 1.00 47.48  ? 161 HIS B O   1 
ATOM   3701 C CB  . HIS B 1 161 ? 22.623 20.491  25.325 1.00 41.00  ? 161 HIS B CB  1 
ATOM   3702 C CG  . HIS B 1 161 ? 23.659 21.220  26.117 1.00 48.08  ? 161 HIS B CG  1 
ATOM   3703 N ND1 . HIS B 1 161 ? 25.007 20.953  26.009 1.00 56.17  ? 161 HIS B ND1 1 
ATOM   3704 C CD2 . HIS B 1 161 ? 23.538 22.145  27.099 1.00 49.85  ? 161 HIS B CD2 1 
ATOM   3705 C CE1 . HIS B 1 161 ? 25.672 21.676  26.893 1.00 56.11  ? 161 HIS B CE1 1 
ATOM   3706 N NE2 . HIS B 1 161 ? 24.803 22.408  27.566 1.00 57.58  ? 161 HIS B NE2 1 
ATOM   3707 N N   . ASN B 1 162 ? 20.403 18.261  24.645 1.00 47.83  ? 162 ASN B N   1 
ATOM   3708 C CA  . ASN B 1 162 ? 19.054 17.951  24.200 1.00 49.15  ? 162 ASN B CA  1 
ATOM   3709 C C   . ASN B 1 162 ? 18.320 17.134  25.253 1.00 47.67  ? 162 ASN B C   1 
ATOM   3710 O O   . ASN B 1 162 ? 17.173 17.436  25.588 1.00 55.28  ? 162 ASN B O   1 
ATOM   3711 C CB  . ASN B 1 162 ? 19.076 17.197  22.870 1.00 56.98  ? 162 ASN B CB  1 
ATOM   3712 C CG  . ASN B 1 162 ? 18.875 18.113  21.685 1.00 62.88  ? 162 ASN B CG  1 
ATOM   3713 O OD1 . ASN B 1 162 ? 19.831 18.472  20.997 1.00 72.87  ? 162 ASN B OD1 1 
ATOM   3714 N ND2 . ASN B 1 162 ? 17.626 18.514  21.447 1.00 67.00  ? 162 ASN B ND2 1 
ATOM   3715 N N   . ILE B 1 163 ? 19.003 16.146  25.826 1.00 37.16  ? 163 ILE B N   1 
ATOM   3716 C CA  . ILE B 1 163 ? 18.372 15.297  26.821 1.00 29.71  ? 163 ILE B CA  1 
ATOM   3717 C C   . ILE B 1 163 ? 18.381 15.830  28.250 1.00 30.65  ? 163 ILE B C   1 
ATOM   3718 O O   . ILE B 1 163 ? 17.438 15.594  28.993 1.00 34.62  ? 163 ILE B O   1 
ATOM   3719 C CB  . ILE B 1 163 ? 18.949 13.865  26.797 1.00 20.22  ? 163 ILE B CB  1 
ATOM   3720 C CG1 . ILE B 1 163 ? 20.326 13.818  27.420 1.00 17.73  ? 163 ILE B CG1 1 
ATOM   3721 C CG2 . ILE B 1 163 ? 19.084 13.378  25.377 1.00 15.32  ? 163 ILE B CG2 1 
ATOM   3722 C CD1 . ILE B 1 163 ? 20.862 12.410  27.502 1.00 19.21  ? 163 ILE B CD1 1 
ATOM   3723 N N   . LEU B 1 164 ? 19.378 16.644  28.586 1.00 35.55  ? 164 LEU B N   1 
ATOM   3724 C CA  . LEU B 1 164 ? 19.556 17.184  29.945 1.00 31.67  ? 164 LEU B CA  1 
ATOM   3725 C C   . LEU B 1 164 ? 18.352 17.645  30.747 1.00 30.97  ? 164 LEU B C   1 
ATOM   3726 O O   . LEU B 1 164 ? 18.285 17.385  31.946 1.00 30.44  ? 164 LEU B O   1 
ATOM   3727 C CB  . LEU B 1 164 ? 20.618 18.287  29.975 1.00 21.68  ? 164 LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 164 ? 21.168 18.639  31.361 1.00 12.90  ? 164 LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 164 ? 21.645 17.384  32.071 1.00 3.13   ? 164 LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 164 ? 22.308 19.653  31.240 1.00 8.70   ? 164 LEU B CD2 1 
ATOM   3731 N N   . LYS B 1 165 ? 17.403 18.316  30.111 1.00 32.52  ? 165 LYS B N   1 
ATOM   3732 C CA  . LYS B 1 165 ? 16.240 18.807  30.850 1.00 39.29  ? 165 LYS B CA  1 
ATOM   3733 C C   . LYS B 1 165 ? 15.331 17.668  31.308 1.00 35.13  ? 165 LYS B C   1 
ATOM   3734 O O   . LYS B 1 165 ? 15.017 17.559  32.485 1.00 36.62  ? 165 LYS B O   1 
ATOM   3735 C CB  . LYS B 1 165 ? 15.484 19.845  30.016 1.00 50.49  ? 165 LYS B CB  1 
ATOM   3736 C CG  . LYS B 1 165 ? 16.434 20.774  29.232 1.00 66.07  ? 165 LYS B CG  1 
ATOM   3737 C CD  . LYS B 1 165 ? 15.740 21.915  28.482 1.00 72.93  ? 165 LYS B CD  1 
ATOM   3738 C CE  . LYS B 1 165 ? 16.773 22.785  27.759 1.00 73.52  ? 165 LYS B CE  1 
ATOM   3739 N NZ  . LYS B 1 165 ? 16.294 24.167  27.446 1.00 78.51  ? 165 LYS B NZ  1 
ATOM   3740 N N   . LYS B 1 166 ? 14.961 16.786  30.389 1.00 38.74  ? 166 LYS B N   1 
ATOM   3741 C CA  . LYS B 1 166 ? 14.104 15.648  30.710 1.00 37.89  ? 166 LYS B CA  1 
ATOM   3742 C C   . LYS B 1 166 ? 14.796 14.727  31.713 1.00 33.69  ? 166 LYS B C   1 
ATOM   3743 O O   . LYS B 1 166 ? 14.225 14.372  32.741 1.00 33.63  ? 166 LYS B O   1 
ATOM   3744 C CB  . LYS B 1 166 ? 13.744 14.889  29.433 1.00 50.15  ? 166 LYS B CB  1 
ATOM   3745 C CG  . LYS B 1 166 ? 12.811 15.652  28.492 1.00 62.09  ? 166 LYS B CG  1 
ATOM   3746 C CD  . LYS B 1 166 ? 12.478 14.820  27.256 1.00 75.24  ? 166 LYS B CD  1 
ATOM   3747 C CE  . LYS B 1 166 ? 11.408 15.475  26.388 1.00 81.20  ? 166 LYS B CE  1 
ATOM   3748 N NZ  . LYS B 1 166 ? 11.105 14.663  25.168 1.00 86.01  ? 166 LYS B NZ  1 
ATOM   3749 N N   . TYR B 1 167 ? 16.042 14.370  31.411 1.00 35.23  ? 167 TYR B N   1 
ATOM   3750 C CA  . TYR B 1 167 ? 16.860 13.518  32.272 1.00 30.77  ? 167 TYR B CA  1 
ATOM   3751 C C   . TYR B 1 167 ? 16.887 14.071  33.690 1.00 35.97  ? 167 TYR B C   1 
ATOM   3752 O O   . TYR B 1 167 ? 16.790 13.316  34.654 1.00 40.02  ? 167 TYR B O   1 
ATOM   3753 C CB  . TYR B 1 167 ? 18.284 13.452  31.731 1.00 19.03  ? 167 TYR B CB  1 
ATOM   3754 C CG  . TYR B 1 167 ? 19.302 12.880  32.690 1.00 22.33  ? 167 TYR B CG  1 
ATOM   3755 C CD1 . TYR B 1 167 ? 19.572 11.518  32.710 1.00 25.94  ? 167 TYR B CD1 1 
ATOM   3756 C CD2 . TYR B 1 167 ? 20.069 13.712  33.508 1.00 23.12  ? 167 TYR B CD2 1 
ATOM   3757 C CE1 . TYR B 1 167 ? 20.582 10.996  33.502 1.00 16.14  ? 167 TYR B CE1 1 
ATOM   3758 C CE2 . TYR B 1 167 ? 21.084 13.194  34.302 1.00 12.62  ? 167 TYR B CE2 1 
ATOM   3759 C CZ  . TYR B 1 167 ? 21.331 11.832  34.284 1.00 9.43   ? 167 TYR B CZ  1 
ATOM   3760 O OH  . TYR B 1 167 ? 22.350 11.298  35.027 1.00 13.21  ? 167 TYR B OH  1 
ATOM   3761 N N   . HIS B 1 168 ? 17.033 15.387  33.819 1.00 32.85  ? 168 HIS B N   1 
ATOM   3762 C CA  . HIS B 1 168 ? 17.050 15.992  35.139 1.00 29.12  ? 168 HIS B CA  1 
ATOM   3763 C C   . HIS B 1 168 ? 15.714 15.848  35.843 1.00 31.64  ? 168 HIS B C   1 
ATOM   3764 O O   . HIS B 1 168 ? 15.684 15.633  37.051 1.00 38.25  ? 168 HIS B O   1 
ATOM   3765 C CB  . HIS B 1 168 ? 17.407 17.462  35.081 1.00 25.15  ? 168 HIS B CB  1 
ATOM   3766 C CG  . HIS B 1 168 ? 17.302 18.138  36.406 1.00 20.64  ? 168 HIS B CG  1 
ATOM   3767 N ND1 . HIS B 1 168 ? 16.143 18.736  36.842 1.00 13.86  ? 168 HIS B ND1 1 
ATOM   3768 C CD2 . HIS B 1 168 ? 18.204 18.288  37.403 1.00 23.21  ? 168 HIS B CD2 1 
ATOM   3769 C CE1 . HIS B 1 168 ? 16.337 19.235  38.048 1.00 18.68  ? 168 HIS B CE1 1 
ATOM   3770 N NE2 . HIS B 1 168 ? 17.578 18.975  38.412 1.00 21.03  ? 168 HIS B NE2 1 
ATOM   3771 N N   . GLN B 1 169 ? 14.616 16.004  35.102 1.00 33.16  ? 169 GLN B N   1 
ATOM   3772 C CA  . GLN B 1 169 ? 13.289 15.868  35.691 1.00 28.68  ? 169 GLN B CA  1 
ATOM   3773 C C   . GLN B 1 169 ? 13.069 14.429  36.144 1.00 29.50  ? 169 GLN B C   1 
ATOM   3774 O O   . GLN B 1 169 ? 12.420 14.192  37.162 1.00 26.85  ? 169 GLN B O   1 
ATOM   3775 C CB  . GLN B 1 169 ? 12.210 16.278  34.702 1.00 35.19  ? 169 GLN B CB  1 
ATOM   3776 C CG  . GLN B 1 169 ? 10.833 16.440  35.334 1.00 53.85  ? 169 GLN B CG  1 
ATOM   3777 C CD  . GLN B 1 169 ? 10.852 17.323  36.577 1.00 65.89  ? 169 GLN B CD  1 
ATOM   3778 O OE1 . GLN B 1 169 ? 10.254 16.984  37.600 1.00 74.67  ? 169 GLN B OE1 1 
ATOM   3779 N NE2 . GLN B 1 169 ? 11.544 18.459  36.496 1.00 70.73  ? 169 GLN B NE2 1 
ATOM   3780 N N   . PHE B 1 170 ? 13.644 13.485  35.393 1.00 32.39  ? 170 PHE B N   1 
ATOM   3781 C CA  . PHE B 1 170 ? 13.572 12.049  35.682 1.00 28.14  ? 170 PHE B CA  1 
ATOM   3782 C C   . PHE B 1 170 ? 14.260 11.805  37.012 1.00 33.25  ? 170 PHE B C   1 
ATOM   3783 O O   . PHE B 1 170 ? 13.673 11.200  37.914 1.00 38.43  ? 170 PHE B O   1 
ATOM   3784 C CB  . PHE B 1 170 ? 14.316 11.269  34.599 1.00 29.92  ? 170 PHE B CB  1 
ATOM   3785 C CG  . PHE B 1 170 ? 14.303 9.776   34.789 1.00 30.25  ? 170 PHE B CG  1 
ATOM   3786 C CD1 . PHE B 1 170 ? 15.428 9.021   34.496 1.00 34.33  ? 170 PHE B CD1 1 
ATOM   3787 C CD2 . PHE B 1 170 ? 13.160 9.120   35.203 1.00 32.36  ? 170 PHE B CD2 1 
ATOM   3788 C CE1 . PHE B 1 170 ? 15.415 7.634   34.606 1.00 31.28  ? 170 PHE B CE1 1 
ATOM   3789 C CE2 . PHE B 1 170 ? 13.139 7.739   35.316 1.00 27.82  ? 170 PHE B CE2 1 
ATOM   3790 C CZ  . PHE B 1 170 ? 14.271 6.994   35.015 1.00 26.94  ? 170 PHE B CZ  1 
ATOM   3791 N N   . ILE B 1 171 ? 15.493 12.318  37.124 1.00 32.43  ? 171 ILE B N   1 
ATOM   3792 C CA  . ILE B 1 171 ? 16.317 12.200  38.329 1.00 23.82  ? 171 ILE B CA  1 
ATOM   3793 C C   . ILE B 1 171 ? 15.586 12.826  39.508 1.00 27.09  ? 171 ILE B C   1 
ATOM   3794 O O   . ILE B 1 171 ? 15.749 12.394  40.651 1.00 31.53  ? 171 ILE B O   1 
ATOM   3795 C CB  . ILE B 1 171 ? 17.679 12.886  38.133 1.00 16.48  ? 171 ILE B CB  1 
ATOM   3796 C CG1 . ILE B 1 171 ? 18.438 12.222  36.976 1.00 23.84  ? 171 ILE B CG1 1 
ATOM   3797 C CG2 . ILE B 1 171 ? 18.527 12.764  39.369 1.00 15.70  ? 171 ILE B CG2 1 
ATOM   3798 C CD1 . ILE B 1 171 ? 18.733 10.745  37.170 1.00 17.32  ? 171 ILE B CD1 1 
ATOM   3799 N N   . VAL B 1 172 ? 14.760 13.828  39.227 1.00 27.39  ? 172 VAL B N   1 
ATOM   3800 C CA  . VAL B 1 172 ? 13.991 14.479  40.274 1.00 34.28  ? 172 VAL B CA  1 
ATOM   3801 C C   . VAL B 1 172 ? 13.002 13.474  40.862 1.00 41.12  ? 172 VAL B C   1 
ATOM   3802 O O   . VAL B 1 172 ? 12.882 13.356  42.081 1.00 47.17  ? 172 VAL B O   1 
ATOM   3803 C CB  . VAL B 1 172 ? 13.235 15.718  39.730 1.00 35.70  ? 172 VAL B CB  1 
ATOM   3804 C CG1 . VAL B 1 172 ? 12.242 16.256  40.757 1.00 37.86  ? 172 VAL B CG1 1 
ATOM   3805 C CG2 . VAL B 1 172 ? 14.228 16.813  39.355 1.00 36.52  ? 172 VAL B CG2 1 
ATOM   3806 N N   . GLU B 1 173 ? 12.371 12.685  39.996 1.00 42.16  ? 173 GLU B N   1 
ATOM   3807 C CA  . GLU B 1 173 ? 11.390 11.700  40.441 1.00 44.77  ? 173 GLU B CA  1 
ATOM   3808 C C   . GLU B 1 173 ? 11.851 10.247  40.570 1.00 45.33  ? 173 GLU B C   1 
ATOM   3809 O O   . GLU B 1 173 ? 11.083 9.323   40.330 1.00 43.77  ? 173 GLU B O   1 
ATOM   3810 C CB  . GLU B 1 173 ? 10.125 11.802  39.589 1.00 44.72  ? 173 GLU B CB  1 
ATOM   3811 C CG  . GLU B 1 173 ? 10.370 11.846  38.085 1.00 51.93  ? 173 GLU B CG  1 
ATOM   3812 C CD  . GLU B 1 173 ? 9.230  12.517  37.328 1.00 54.91  ? 173 GLU B CD  1 
ATOM   3813 O OE1 . GLU B 1 173 ? 9.026  12.196  36.133 1.00 45.90  ? 173 GLU B OE1 1 
ATOM   3814 O OE2 . GLU B 1 173 ? 8.546  13.377  37.932 1.00 56.51  ? 173 GLU B OE2 1 
ATOM   3815 N N   . CYS B 1 174 ? 13.100 10.061  40.977 1.00 50.16  ? 174 CYS B N   1 
ATOM   3816 C CA  . CYS B 1 174 ? 13.695 8.737   41.191 1.00 55.43  ? 174 CYS B CA  1 
ATOM   3817 C C   . CYS B 1 174 ? 14.570 8.865   42.429 1.00 56.17  ? 174 CYS B C   1 
ATOM   3818 O O   . CYS B 1 174 ? 15.113 7.883   42.935 1.00 57.82  ? 174 CYS B O   1 
ATOM   3819 C CB  . CYS B 1 174 ? 14.607 8.337   40.029 1.00 46.43  ? 174 CYS B CB  1 
ATOM   3820 S SG  . CYS B 1 174 ? 13.859 8.476   38.428 1.00 67.57  ? 174 CYS B SG  1 
ATOM   3821 N N   . HIS B 1 175 ? 14.740 10.106  42.873 1.00 57.81  ? 175 HIS B N   1 
ATOM   3822 C CA  . HIS B 1 175 ? 15.565 10.409  44.023 1.00 62.97  ? 175 HIS B CA  1 
ATOM   3823 C C   . HIS B 1 175 ? 16.990 9.908   43.775 1.00 67.33  ? 175 HIS B C   1 
ATOM   3824 O O   . HIS B 1 175 ? 17.616 9.285   44.632 1.00 76.69  ? 175 HIS B O   1 
ATOM   3825 C CB  . HIS B 1 175 ? 14.945 9.816   45.290 1.00 62.86  ? 175 HIS B CB  1 
ATOM   3826 C CG  . HIS B 1 175 ? 13.607 10.398  45.629 1.00 61.89  ? 175 HIS B CG  1 
ATOM   3827 N ND1 . HIS B 1 175 ? 12.590 10.508  44.706 1.00 59.40  ? 175 HIS B ND1 1 
ATOM   3828 C CD2 . HIS B 1 175 ? 13.129 10.930  46.780 1.00 60.00  ? 175 HIS B CD2 1 
ATOM   3829 C CE1 . HIS B 1 175 ? 11.543 11.082  45.271 1.00 61.63  ? 175 HIS B CE1 1 
ATOM   3830 N NE2 . HIS B 1 175 ? 11.844 11.348  46.529 1.00 56.96  ? 175 HIS B NE2 1 
ATOM   3831 N N   . GLY B 1 176 ? 17.481 10.170  42.567 1.00 63.32  ? 176 GLY B N   1 
ATOM   3832 C CA  . GLY B 1 176 ? 18.823 9.771   42.206 1.00 55.26  ? 176 GLY B CA  1 
ATOM   3833 C C   . GLY B 1 176 ? 19.057 8.281   42.223 1.00 52.88  ? 176 GLY B C   1 
ATOM   3834 O O   . GLY B 1 176 ? 20.190 7.850   42.363 1.00 55.93  ? 176 GLY B O   1 
ATOM   3835 N N   . ASN B 1 177 ? 18.004 7.482   42.094 1.00 57.47  ? 177 ASN B N   1 
ATOM   3836 C CA  . ASN B 1 177 ? 18.187 6.034   42.072 1.00 58.18  ? 177 ASN B CA  1 
ATOM   3837 C C   . ASN B 1 177 ? 17.893 5.462   40.682 1.00 57.23  ? 177 ASN B C   1 
ATOM   3838 O O   . ASN B 1 177 ? 16.729 5.264   40.321 1.00 57.72  ? 177 ASN B O   1 
ATOM   3839 C CB  . ASN B 1 177 ? 17.312 5.348   43.121 1.00 65.83  ? 177 ASN B CB  1 
ATOM   3840 C CG  . ASN B 1 177 ? 17.624 3.864   43.251 1.00 76.88  ? 177 ASN B CG  1 
ATOM   3841 O OD1 . ASN B 1 177 ? 18.752 3.427   42.995 1.00 83.95  ? 177 ASN B OD1 1 
ATOM   3842 N ND2 . ASN B 1 177 ? 16.625 3.079   43.637 1.00 84.76  ? 177 ASN B ND2 1 
ATOM   3843 N N   . THR B 1 178 ? 18.950 5.225   39.903 1.00 45.26  ? 178 THR B N   1 
ATOM   3844 C CA  . THR B 1 178 ? 18.829 4.684   38.550 1.00 39.02  ? 178 THR B CA  1 
ATOM   3845 C C   . THR B 1 178 ? 20.106 3.978   38.118 1.00 41.78  ? 178 THR B C   1 
ATOM   3846 O O   . THR B 1 178 ? 21.192 4.243   38.641 1.00 41.13  ? 178 THR B O   1 
ATOM   3847 C CB  . THR B 1 178 ? 18.581 5.792   37.482 1.00 39.70  ? 178 THR B CB  1 
ATOM   3848 O OG1 . THR B 1 178 ? 19.622 6.772   37.545 1.00 30.02  ? 178 THR B OG1 1 
ATOM   3849 C CG2 . THR B 1 178 ? 17.241 6.472   37.674 1.00 45.42  ? 178 THR B CG2 1 
ATOM   3850 N N   . LEU B 1 179 ? 19.964 3.096   37.134 1.00 38.77  ? 179 LEU B N   1 
ATOM   3851 C CA  . LEU B 1 179 ? 21.097 2.382   36.578 1.00 35.52  ? 179 LEU B CA  1 
ATOM   3852 C C   . LEU B 1 179 ? 21.661 3.277   35.468 1.00 38.85  ? 179 LEU B C   1 
ATOM   3853 O O   . LEU B 1 179 ? 22.640 2.924   34.807 1.00 43.13  ? 179 LEU B O   1 
ATOM   3854 C CB  . LEU B 1 179 ? 20.649 1.049   35.982 1.00 37.87  ? 179 LEU B CB  1 
ATOM   3855 C CG  . LEU B 1 179 ? 19.820 0.080   36.829 1.00 44.01  ? 179 LEU B CG  1 
ATOM   3856 C CD1 . LEU B 1 179 ? 19.617 -1.216  36.045 1.00 50.58  ? 179 LEU B CD1 1 
ATOM   3857 C CD2 . LEU B 1 179 ? 20.518 -0.218  38.129 1.00 42.06  ? 179 LEU B CD2 1 
ATOM   3858 N N   . LEU B 1 180 ? 21.004 4.416   35.231 1.00 33.30  ? 180 LEU B N   1 
ATOM   3859 C CA  . LEU B 1 180 ? 21.431 5.362   34.203 1.00 26.86  ? 180 LEU B CA  1 
ATOM   3860 C C   . LEU B 1 180 ? 22.688 6.056   34.659 1.00 28.02  ? 180 LEU B C   1 
ATOM   3861 O O   . LEU B 1 180 ? 22.898 6.214   35.858 1.00 32.60  ? 180 LEU B O   1 
ATOM   3862 C CB  . LEU B 1 180 ? 20.367 6.426   34.000 1.00 21.05  ? 180 LEU B CB  1 
ATOM   3863 C CG  . LEU B 1 180 ? 19.150 6.133   33.142 1.00 22.81  ? 180 LEU B CG  1 
ATOM   3864 C CD1 . LEU B 1 180 ? 18.431 7.462   32.889 1.00 16.50  ? 180 LEU B CD1 1 
ATOM   3865 C CD2 . LEU B 1 180 ? 19.604 5.507   31.826 1.00 28.94  ? 180 LEU B CD2 1 
ATOM   3866 N N   . PRO B 1 181 ? 23.545 6.484   33.717 1.00 29.54  ? 181 PRO B N   1 
ATOM   3867 C CA  . PRO B 1 181 ? 24.775 7.171   34.110 1.00 28.27  ? 181 PRO B CA  1 
ATOM   3868 C C   . PRO B 1 181 ? 24.348 8.414   34.868 1.00 30.29  ? 181 PRO B C   1 
ATOM   3869 O O   . PRO B 1 181 ? 23.384 9.072   34.477 1.00 26.24  ? 181 PRO B O   1 
ATOM   3870 C CB  . PRO B 1 181 ? 25.403 7.546   32.766 1.00 30.94  ? 181 PRO B CB  1 
ATOM   3871 C CG  . PRO B 1 181 ? 24.963 6.479   31.873 1.00 31.21  ? 181 PRO B CG  1 
ATOM   3872 C CD  . PRO B 1 181 ? 23.492 6.329   32.257 1.00 37.00  ? 181 PRO B CD  1 
ATOM   3873 N N   . GLN B 1 182 ? 25.001 8.682   35.996 1.00 26.77  ? 182 GLN B N   1 
ATOM   3874 C CA  . GLN B 1 182 ? 24.670 9.859   36.791 1.00 24.91  ? 182 GLN B CA  1 
ATOM   3875 C C   . GLN B 1 182 ? 25.709 10.920  36.440 1.00 25.51  ? 182 GLN B C   1 
ATOM   3876 O O   . GLN B 1 182 ? 26.849 10.878  36.915 1.00 33.70  ? 182 GLN B O   1 
ATOM   3877 C CB  . GLN B 1 182 ? 24.717 9.504   38.272 1.00 30.40  ? 182 GLN B CB  1 
ATOM   3878 C CG  . GLN B 1 182 ? 23.717 8.439   38.686 1.00 34.53  ? 182 GLN B CG  1 
ATOM   3879 C CD  . GLN B 1 182 ? 24.248 7.527   39.773 1.00 37.59  ? 182 GLN B CD  1 
ATOM   3880 O OE1 . GLN B 1 182 ? 24.948 7.970   40.690 1.00 28.99  ? 182 GLN B OE1 1 
ATOM   3881 N NE2 . GLN B 1 182 ? 23.935 6.237   39.666 1.00 32.24  ? 182 GLN B NE2 1 
ATOM   3882 N N   . PHE B 1 183 ? 25.337 11.832  35.548 1.00 21.15  ? 183 PHE B N   1 
ATOM   3883 C CA  . PHE B 1 183 ? 26.257 12.876  35.107 1.00 17.10  ? 183 PHE B CA  1 
ATOM   3884 C C   . PHE B 1 183 ? 26.485 13.888  36.206 1.00 16.85  ? 183 PHE B C   1 
ATOM   3885 O O   . PHE B 1 183 ? 25.533 14.442  36.760 1.00 16.11  ? 183 PHE B O   1 
ATOM   3886 C CB  . PHE B 1 183 ? 25.716 13.549  33.850 1.00 17.43  ? 183 PHE B CB  1 
ATOM   3887 C CG  . PHE B 1 183 ? 25.372 12.580  32.753 1.00 19.20  ? 183 PHE B CG  1 
ATOM   3888 C CD1 . PHE B 1 183 ? 24.042 12.292  32.454 1.00 20.60  ? 183 PHE B CD1 1 
ATOM   3889 C CD2 . PHE B 1 183 ? 26.373 11.908  32.065 1.00 19.30  ? 183 PHE B CD2 1 
ATOM   3890 C CE1 . PHE B 1 183 ? 23.716 11.352  31.494 1.00 17.81  ? 183 PHE B CE1 1 
ATOM   3891 C CE2 . PHE B 1 183 ? 26.061 10.962  31.105 1.00 18.63  ? 183 PHE B CE2 1 
ATOM   3892 C CZ  . PHE B 1 183 ? 24.725 10.683  30.819 1.00 19.61  ? 183 PHE B CZ  1 
ATOM   3893 N N   . LEU B 1 184 ? 27.749 14.101  36.543 1.00 9.79   ? 184 LEU B N   1 
ATOM   3894 C CA  . LEU B 1 184 ? 28.082 15.040  37.597 1.00 8.87   ? 184 LEU B CA  1 
ATOM   3895 C C   . LEU B 1 184 ? 28.640 16.365  37.026 1.00 15.73  ? 184 LEU B C   1 
ATOM   3896 O O   . LEU B 1 184 ? 28.669 17.394  37.715 1.00 18.06  ? 184 LEU B O   1 
ATOM   3897 C CB  . LEU B 1 184 ? 29.079 14.383  38.566 1.00 15.26  ? 184 LEU B CB  1 
ATOM   3898 C CG  . LEU B 1 184 ? 28.782 12.959  39.091 1.00 6.67   ? 184 LEU B CG  1 
ATOM   3899 C CD1 . LEU B 1 184 ? 29.962 12.413  39.860 1.00 2.00   ? 184 LEU B CD1 1 
ATOM   3900 C CD2 . LEU B 1 184 ? 27.569 12.937  39.968 1.00 2.00   ? 184 LEU B CD2 1 
ATOM   3901 N N   . GLY B 1 185 ? 29.066 16.348  35.767 1.00 13.71  ? 185 GLY B N   1 
ATOM   3902 C CA  . GLY B 1 185 ? 29.608 17.555  35.167 1.00 19.36  ? 185 GLY B CA  1 
ATOM   3903 C C   . GLY B 1 185 ? 30.068 17.336  33.737 1.00 20.32  ? 185 GLY B C   1 
ATOM   3904 O O   . GLY B 1 185 ? 30.502 16.243  33.381 1.00 20.38  ? 185 GLY B O   1 
ATOM   3905 N N   . MET B 1 186 ? 30.015 18.389  32.933 1.00 18.11  ? 186 MET B N   1 
ATOM   3906 C CA  . MET B 1 186 ? 30.415 18.323  31.535 1.00 16.81  ? 186 MET B CA  1 
ATOM   3907 C C   . MET B 1 186 ? 31.243 19.565  31.173 1.00 23.53  ? 186 MET B C   1 
ATOM   3908 O O   . MET B 1 186 ? 30.757 20.697  31.282 1.00 27.89  ? 186 MET B O   1 
ATOM   3909 C CB  . MET B 1 186 ? 29.154 18.237  30.697 1.00 24.80  ? 186 MET B CB  1 
ATOM   3910 C CG  . MET B 1 186 ? 29.322 18.547  29.246 1.00 34.55  ? 186 MET B CG  1 
ATOM   3911 S SD  . MET B 1 186 ? 27.788 18.274  28.350 1.00 24.32  ? 186 MET B SD  1 
ATOM   3912 C CE  . MET B 1 186 ? 28.319 16.903  27.518 1.00 18.94  ? 186 MET B CE  1 
ATOM   3913 N N   . TYR B 1 187 ? 32.471 19.358  30.699 1.00 25.50  ? 187 TYR B N   1 
ATOM   3914 C CA  . TYR B 1 187 ? 33.371 20.477  30.387 1.00 24.20  ? 187 TYR B CA  1 
ATOM   3915 C C   . TYR B 1 187 ? 33.991 20.462  28.996 1.00 24.31  ? 187 TYR B C   1 
ATOM   3916 O O   . TYR B 1 187 ? 33.991 19.436  28.323 1.00 30.48  ? 187 TYR B O   1 
ATOM   3917 C CB  . TYR B 1 187 ? 34.548 20.473  31.380 1.00 20.09  ? 187 TYR B CB  1 
ATOM   3918 C CG  . TYR B 1 187 ? 34.185 20.194  32.814 1.00 13.07  ? 187 TYR B CG  1 
ATOM   3919 C CD1 . TYR B 1 187 ? 34.207 18.893  33.323 1.00 21.57  ? 187 TYR B CD1 1 
ATOM   3920 C CD2 . TYR B 1 187 ? 33.818 21.218  33.662 1.00 8.79   ? 187 TYR B CD2 1 
ATOM   3921 C CE1 . TYR B 1 187 ? 33.870 18.622  34.655 1.00 6.83   ? 187 TYR B CE1 1 
ATOM   3922 C CE2 . TYR B 1 187 ? 33.482 20.958  34.986 1.00 14.92  ? 187 TYR B CE2 1 
ATOM   3923 C CZ  . TYR B 1 187 ? 33.515 19.658  35.471 1.00 7.76   ? 187 TYR B CZ  1 
ATOM   3924 O OH  . TYR B 1 187 ? 33.212 19.420  36.785 1.00 16.85  ? 187 TYR B OH  1 
ATOM   3925 N N   . ARG B 1 188 ? 34.571 21.595  28.607 1.00 17.54  ? 188 ARG B N   1 
ATOM   3926 C CA  . ARG B 1 188 ? 35.289 21.706  27.346 1.00 19.61  ? 188 ARG B CA  1 
ATOM   3927 C C   . ARG B 1 188 ? 36.580 22.486  27.572 1.00 21.14  ? 188 ARG B C   1 
ATOM   3928 O O   . ARG B 1 188 ? 36.555 23.707  27.678 1.00 24.90  ? 188 ARG B O   1 
ATOM   3929 C CB  . ARG B 1 188 ? 34.475 22.401  26.252 1.00 25.01  ? 188 ARG B CB  1 
ATOM   3930 C CG  . ARG B 1 188 ? 35.205 22.383  24.870 1.00 15.76  ? 188 ARG B CG  1 
ATOM   3931 C CD  . ARG B 1 188 ? 34.730 23.483  23.903 1.00 2.00   ? 188 ARG B CD  1 
ATOM   3932 N NE  . ARG B 1 188 ? 35.104 24.813  24.387 1.00 2.00   ? 188 ARG B NE  1 
ATOM   3933 C CZ  . ARG B 1 188 ? 34.557 25.944  23.952 1.00 2.96   ? 188 ARG B CZ  1 
ATOM   3934 N NH1 . ARG B 1 188 ? 33.623 25.920  23.020 1.00 14.95  ? 188 ARG B NH1 1 
ATOM   3935 N NH2 . ARG B 1 188 ? 34.917 27.104  24.467 1.00 5.60   ? 188 ARG B NH2 1 
ATOM   3936 N N   . LEU B 1 189 ? 37.702 21.778  27.656 1.00 22.14  ? 189 LEU B N   1 
ATOM   3937 C CA  . LEU B 1 189 ? 39.001 22.414  27.861 1.00 24.64  ? 189 LEU B CA  1 
ATOM   3938 C C   . LEU B 1 189 ? 39.660 22.659  26.524 1.00 24.16  ? 189 LEU B C   1 
ATOM   3939 O O   . LEU B 1 189 ? 39.465 21.871  25.603 1.00 28.60  ? 189 LEU B O   1 
ATOM   3940 C CB  . LEU B 1 189 ? 39.936 21.490  28.631 1.00 24.41  ? 189 LEU B CB  1 
ATOM   3941 C CG  . LEU B 1 189 ? 39.447 20.656  29.797 1.00 26.86  ? 189 LEU B CG  1 
ATOM   3942 C CD1 . LEU B 1 189 ? 38.761 19.422  29.289 1.00 28.58  ? 189 LEU B CD1 1 
ATOM   3943 C CD2 . LEU B 1 189 ? 40.651 20.255  30.606 1.00 31.06  ? 189 LEU B CD2 1 
ATOM   3944 N N   . THR B 1 190 ? 40.472 23.711  26.425 1.00 24.63  ? 190 THR B N   1 
ATOM   3945 C CA  . THR B 1 190 ? 41.202 23.993  25.182 1.00 34.39  ? 190 THR B CA  1 
ATOM   3946 C C   . THR B 1 190 ? 42.668 24.322  25.464 1.00 28.61  ? 190 THR B C   1 
ATOM   3947 O O   . THR B 1 190 ? 42.978 25.166  26.298 1.00 22.98  ? 190 THR B O   1 
ATOM   3948 C CB  . THR B 1 190 ? 40.607 25.170  24.347 1.00 40.36  ? 190 THR B CB  1 
ATOM   3949 O OG1 . THR B 1 190 ? 40.865 26.407  25.013 1.00 47.40  ? 190 THR B OG1 1 
ATOM   3950 C CG2 . THR B 1 190 ? 39.104 25.012  24.131 1.00 41.04  ? 190 THR B CG2 1 
ATOM   3951 N N   . VAL B 1 191 ? 43.557 23.601  24.795 1.00 30.32  ? 191 VAL B N   1 
ATOM   3952 C CA  . VAL B 1 191 ? 44.997 23.800  24.917 1.00 38.26  ? 191 VAL B CA  1 
ATOM   3953 C C   . VAL B 1 191 ? 45.537 23.656  23.485 1.00 47.37  ? 191 VAL B C   1 
ATOM   3954 O O   . VAL B 1 191 ? 45.187 22.703  22.771 1.00 50.01  ? 191 VAL B O   1 
ATOM   3955 C CB  . VAL B 1 191 ? 45.676 22.726  25.810 1.00 34.44  ? 191 VAL B CB  1 
ATOM   3956 C CG1 . VAL B 1 191 ? 47.025 23.231  26.308 1.00 41.75  ? 191 VAL B CG1 1 
ATOM   3957 C CG2 . VAL B 1 191 ? 44.793 22.346  26.972 1.00 39.18  ? 191 VAL B CG2 1 
ATOM   3958 N N   . ASP B 1 192 ? 46.396 24.587  23.071 1.00 48.33  ? 192 ASP B N   1 
ATOM   3959 C CA  . ASP B 1 192 ? 46.956 24.575  21.721 1.00 45.33  ? 192 ASP B CA  1 
ATOM   3960 C C   . ASP B 1 192 ? 45.770 24.742  20.782 1.00 42.45  ? 192 ASP B C   1 
ATOM   3961 O O   . ASP B 1 192 ? 45.641 24.025  19.795 1.00 47.24  ? 192 ASP B O   1 
ATOM   3962 C CB  . ASP B 1 192 ? 47.671 23.250  21.421 1.00 51.05  ? 192 ASP B CB  1 
ATOM   3963 C CG  . ASP B 1 192 ? 48.641 22.841  22.514 1.00 62.91  ? 192 ASP B CG  1 
ATOM   3964 O OD1 . ASP B 1 192 ? 49.411 23.707  22.982 1.00 68.20  ? 192 ASP B OD1 1 
ATOM   3965 O OD2 . ASP B 1 192 ? 48.628 21.651  22.910 1.00 61.15  ? 192 ASP B OD2 1 
ATOM   3966 N N   . GLY B 1 193 ? 44.859 25.635  21.154 1.00 40.41  ? 193 GLY B N   1 
ATOM   3967 C CA  . GLY B 1 193 ? 43.676 25.886  20.351 1.00 41.12  ? 193 GLY B CA  1 
ATOM   3968 C C   . GLY B 1 193 ? 42.846 24.642  20.085 1.00 43.71  ? 193 GLY B C   1 
ATOM   3969 O O   . GLY B 1 193 ? 41.862 24.709  19.345 1.00 52.19  ? 193 GLY B O   1 
ATOM   3970 N N   . VAL B 1 194 ? 43.232 23.514  20.681 1.00 37.44  ? 194 VAL B N   1 
ATOM   3971 C CA  . VAL B 1 194 ? 42.518 22.256  20.500 1.00 37.78  ? 194 VAL B CA  1 
ATOM   3972 C C   . VAL B 1 194 ? 41.462 22.055  21.583 1.00 37.81  ? 194 VAL B C   1 
ATOM   3973 O O   . VAL B 1 194 ? 41.791 21.908  22.767 1.00 40.90  ? 194 VAL B O   1 
ATOM   3974 C CB  . VAL B 1 194 ? 43.464 21.067  20.577 1.00 42.07  ? 194 VAL B CB  1 
ATOM   3975 C CG1 . VAL B 1 194 ? 42.700 19.788  20.285 1.00 44.37  ? 194 VAL B CG1 1 
ATOM   3976 C CG2 . VAL B 1 194 ? 44.627 21.254  19.622 1.00 48.25  ? 194 VAL B CG2 1 
ATOM   3977 N N   . GLU B 1 195 ? 40.199 22.007  21.174 1.00 28.00  ? 195 GLU B N   1 
ATOM   3978 C CA  . GLU B 1 195 ? 39.115 21.824  22.121 1.00 17.63  ? 195 GLU B CA  1 
ATOM   3979 C C   . GLU B 1 195 ? 39.007 20.374  22.479 1.00 19.04  ? 195 GLU B C   1 
ATOM   3980 O O   . GLU B 1 195 ? 39.294 19.511  21.660 1.00 30.27  ? 195 GLU B O   1 
ATOM   3981 C CB  . GLU B 1 195 ? 37.801 22.329  21.550 1.00 6.64   ? 195 GLU B CB  1 
ATOM   3982 C CG  . GLU B 1 195 ? 37.939 23.739  21.033 1.00 24.54  ? 195 GLU B CG  1 
ATOM   3983 C CD  . GLU B 1 195 ? 36.752 24.605  21.333 1.00 32.25  ? 195 GLU B CD  1 
ATOM   3984 O OE1 . GLU B 1 195 ? 36.964 25.755  21.788 1.00 36.33  ? 195 GLU B OE1 1 
ATOM   3985 O OE2 . GLU B 1 195 ? 35.615 24.137  21.111 1.00 40.38  ? 195 GLU B OE2 1 
ATOM   3986 N N   . THR B 1 196 ? 38.656 20.119  23.732 1.00 17.98  ? 196 THR B N   1 
ATOM   3987 C CA  . THR B 1 196 ? 38.483 18.772  24.243 1.00 18.84  ? 196 THR B CA  1 
ATOM   3988 C C   . THR B 1 196 ? 37.217 18.771  25.082 1.00 23.89  ? 196 THR B C   1 
ATOM   3989 O O   . THR B 1 196 ? 37.010 19.677  25.882 1.00 34.89  ? 196 THR B O   1 
ATOM   3990 C CB  . THR B 1 196 ? 39.647 18.370  25.118 1.00 10.14  ? 196 THR B CB  1 
ATOM   3991 O OG1 . THR B 1 196 ? 40.860 18.491  24.364 1.00 23.91  ? 196 THR B OG1 1 
ATOM   3992 C CG2 . THR B 1 196 ? 39.483 16.941  25.583 1.00 7.72   ? 196 THR B CG2 1 
ATOM   3993 N N   . TYR B 1 197 ? 36.338 17.802  24.854 1.00 21.27  ? 197 TYR B N   1 
ATOM   3994 C CA  . TYR B 1 197 ? 35.109 17.738  25.622 1.00 20.65  ? 197 TYR B CA  1 
ATOM   3995 C C   . TYR B 1 197 ? 35.204 16.578  26.600 1.00 28.52  ? 197 TYR B C   1 
ATOM   3996 O O   . TYR B 1 197 ? 35.819 15.548  26.288 1.00 35.06  ? 197 TYR B O   1 
ATOM   3997 C CB  . TYR B 1 197 ? 33.903 17.559  24.700 1.00 8.23   ? 197 TYR B CB  1 
ATOM   3998 C CG  . TYR B 1 197 ? 33.677 18.703  23.739 1.00 9.32   ? 197 TYR B CG  1 
ATOM   3999 C CD1 . TYR B 1 197 ? 34.386 18.789  22.556 1.00 3.60   ? 197 TYR B CD1 1 
ATOM   4000 C CD2 . TYR B 1 197 ? 32.726 19.677  24.002 1.00 8.87   ? 197 TYR B CD2 1 
ATOM   4001 C CE1 . TYR B 1 197 ? 34.153 19.808  21.653 1.00 19.23  ? 197 TYR B CE1 1 
ATOM   4002 C CE2 . TYR B 1 197 ? 32.490 20.701  23.112 1.00 29.51  ? 197 TYR B CE2 1 
ATOM   4003 C CZ  . TYR B 1 197 ? 33.206 20.768  21.933 1.00 24.97  ? 197 TYR B CZ  1 
ATOM   4004 O OH  . TYR B 1 197 ? 32.982 21.814  21.060 1.00 30.08  ? 197 TYR B OH  1 
ATOM   4005 N N   . MET B 1 198 ? 34.624 16.751  27.788 1.00 25.67  ? 198 MET B N   1 
ATOM   4006 C CA  . MET B 1 198 ? 34.643 15.704  28.806 1.00 19.69  ? 198 MET B CA  1 
ATOM   4007 C C   . MET B 1 198 ? 33.330 15.651  29.567 1.00 15.02  ? 198 MET B C   1 
ATOM   4008 O O   . MET B 1 198 ? 32.657 16.674  29.726 1.00 11.07  ? 198 MET B O   1 
ATOM   4009 C CB  . MET B 1 198 ? 35.803 15.921  29.781 1.00 21.33  ? 198 MET B CB  1 
ATOM   4010 C CG  . MET B 1 198 ? 37.170 16.002  29.126 1.00 17.88  ? 198 MET B CG  1 
ATOM   4011 S SD  . MET B 1 198 ? 38.482 15.870  30.317 1.00 29.68  ? 198 MET B SD  1 
ATOM   4012 C CE  . MET B 1 198 ? 39.825 15.296  29.298 1.00 30.37  ? 198 MET B CE  1 
ATOM   4013 N N   . VAL B 1 199 ? 32.975 14.449  30.023 1.00 16.37  ? 199 VAL B N   1 
ATOM   4014 C CA  . VAL B 1 199 ? 31.745 14.207  30.785 1.00 17.97  ? 199 VAL B CA  1 
ATOM   4015 C C   . VAL B 1 199 ? 32.022 13.366  32.027 1.00 22.88  ? 199 VAL B C   1 
ATOM   4016 O O   . VAL B 1 199 ? 32.068 12.145  31.944 1.00 34.10  ? 199 VAL B O   1 
ATOM   4017 C CB  . VAL B 1 199 ? 30.699 13.477  29.935 1.00 18.69  ? 199 VAL B CB  1 
ATOM   4018 C CG1 . VAL B 1 199 ? 29.517 13.014  30.814 1.00 6.62   ? 199 VAL B CG1 1 
ATOM   4019 C CG2 . VAL B 1 199 ? 30.230 14.397  28.803 1.00 14.56  ? 199 VAL B CG2 1 
ATOM   4020 N N   . VAL B 1 200 ? 32.185 14.022  33.177 1.00 21.80  ? 200 VAL B N   1 
ATOM   4021 C CA  . VAL B 1 200 ? 32.485 13.332  34.428 1.00 10.42  ? 200 VAL B CA  1 
ATOM   4022 C C   . VAL B 1 200 ? 31.250 12.614  34.965 1.00 16.64  ? 200 VAL B C   1 
ATOM   4023 O O   . VAL B 1 200 ? 30.134 13.156  34.946 1.00 23.42  ? 200 VAL B O   1 
ATOM   4024 C CB  . VAL B 1 200 ? 33.052 14.321  35.483 1.00 6.64   ? 200 VAL B CB  1 
ATOM   4025 C CG1 . VAL B 1 200 ? 33.532 13.589  36.703 1.00 2.00   ? 200 VAL B CG1 1 
ATOM   4026 C CG2 . VAL B 1 200 ? 34.190 15.135  34.895 1.00 2.00   ? 200 VAL B CG2 1 
ATOM   4027 N N   . THR B 1 201 ? 31.448 11.382  35.430 1.00 19.86  ? 201 THR B N   1 
ATOM   4028 C CA  . THR B 1 201 ? 30.357 10.564  35.985 1.00 23.28  ? 201 THR B CA  1 
ATOM   4029 C C   . THR B 1 201 ? 30.833 9.530   37.014 1.00 27.53  ? 201 THR B C   1 
ATOM   4030 O O   . THR B 1 201 ? 31.930 8.970   36.887 1.00 32.13  ? 201 THR B O   1 
ATOM   4031 C CB  . THR B 1 201 ? 29.646 9.802   34.888 1.00 19.07  ? 201 THR B CB  1 
ATOM   4032 O OG1 . THR B 1 201 ? 30.620 9.208   34.021 1.00 14.07  ? 201 THR B OG1 1 
ATOM   4033 C CG2 . THR B 1 201 ? 28.770 10.739  34.093 1.00 30.41  ? 201 THR B CG2 1 
ATOM   4034 N N   . ARG B 1 202 ? 30.010 9.291   38.038 1.00 24.28  ? 202 ARG B N   1 
ATOM   4035 C CA  . ARG B 1 202 ? 30.325 8.310   39.086 1.00 18.90  ? 202 ARG B CA  1 
ATOM   4036 C C   . ARG B 1 202 ? 30.488 6.956   38.421 1.00 14.18  ? 202 ARG B C   1 
ATOM   4037 O O   . ARG B 1 202 ? 29.667 6.612   37.589 1.00 20.54  ? 202 ARG B O   1 
ATOM   4038 C CB  . ARG B 1 202 ? 29.172 8.249   40.073 1.00 15.03  ? 202 ARG B CB  1 
ATOM   4039 C CG  . ARG B 1 202 ? 29.141 6.973   40.861 1.00 18.45  ? 202 ARG B CG  1 
ATOM   4040 C CD  . ARG B 1 202 ? 28.620 7.210   42.262 1.00 13.68  ? 202 ARG B CD  1 
ATOM   4041 N NE  . ARG B 1 202 ? 27.263 7.717   42.270 1.00 5.74   ? 202 ARG B NE  1 
ATOM   4042 C CZ  . ARG B 1 202 ? 26.733 8.317   43.321 1.00 12.28  ? 202 ARG B CZ  1 
ATOM   4043 N NH1 . ARG B 1 202 ? 27.456 8.466   44.425 1.00 2.00   ? 202 ARG B NH1 1 
ATOM   4044 N NH2 . ARG B 1 202 ? 25.502 8.806   43.255 1.00 24.79  ? 202 ARG B NH2 1 
ATOM   4045 N N   . ASN B 1 203 ? 31.516 6.178   38.752 1.00 10.83  ? 203 ASN B N   1 
ATOM   4046 C CA  . ASN B 1 203 ? 31.645 4.918   38.034 1.00 15.10  ? 203 ASN B CA  1 
ATOM   4047 C C   . ASN B 1 203 ? 30.778 3.773   38.464 1.00 27.79  ? 203 ASN B C   1 
ATOM   4048 O O   . ASN B 1 203 ? 30.180 3.792   39.542 1.00 38.92  ? 203 ASN B O   1 
ATOM   4049 C CB  . ASN B 1 203 ? 33.094 4.477   37.734 1.00 18.20  ? 203 ASN B CB  1 
ATOM   4050 C CG  . ASN B 1 203 ? 33.925 4.240   38.955 1.00 18.06  ? 203 ASN B CG  1 
ATOM   4051 O OD1 . ASN B 1 203 ? 33.647 4.780   40.022 1.00 36.72  ? 203 ASN B OD1 1 
ATOM   4052 N ND2 . ASN B 1 203 ? 35.011 3.476   38.790 1.00 11.25  ? 203 ASN B ND2 1 
ATOM   4053 N N   . VAL B 1 204 ? 30.603 2.846   37.525 1.00 30.79  ? 204 VAL B N   1 
ATOM   4054 C CA  . VAL B 1 204 ? 29.773 1.675   37.715 1.00 29.45  ? 204 VAL B CA  1 
ATOM   4055 C C   . VAL B 1 204 ? 30.422 0.767   38.728 1.00 34.81  ? 204 VAL B C   1 
ATOM   4056 O O   . VAL B 1 204 ? 29.792 0.373   39.710 1.00 35.10  ? 204 VAL B O   1 
ATOM   4057 C CB  . VAL B 1 204 ? 29.588 0.921   36.386 1.00 32.35  ? 204 VAL B CB  1 
ATOM   4058 C CG1 . VAL B 1 204 ? 28.590 -0.212  36.563 1.00 38.69  ? 204 VAL B CG1 1 
ATOM   4059 C CG2 . VAL B 1 204 ? 29.120 1.877   35.298 1.00 14.30  ? 204 VAL B CG2 1 
ATOM   4060 N N   . PHE B 1 205 ? 31.698 0.471   38.493 1.00 33.58  ? 205 PHE B N   1 
ATOM   4061 C CA  . PHE B 1 205 ? 32.472 -0.398  39.371 1.00 37.82  ? 205 PHE B CA  1 
ATOM   4062 C C   . PHE B 1 205 ? 32.871 0.407   40.608 1.00 42.29  ? 205 PHE B C   1 
ATOM   4063 O O   . PHE B 1 205 ? 32.870 1.635   40.566 1.00 45.13  ? 205 PHE B O   1 
ATOM   4064 C CB  . PHE B 1 205 ? 33.709 -0.896  38.626 1.00 36.34  ? 205 PHE B CB  1 
ATOM   4065 C CG  . PHE B 1 205 ? 33.409 -1.506  37.273 1.00 36.41  ? 205 PHE B CG  1 
ATOM   4066 C CD1 . PHE B 1 205 ? 34.403 -1.589  36.300 1.00 30.03  ? 205 PHE B CD1 1 
ATOM   4067 C CD2 . PHE B 1 205 ? 32.144 -2.009  36.979 1.00 38.45  ? 205 PHE B CD2 1 
ATOM   4068 C CE1 . PHE B 1 205 ? 34.144 -2.159  35.065 1.00 31.07  ? 205 PHE B CE1 1 
ATOM   4069 C CE2 . PHE B 1 205 ? 31.874 -2.584  35.739 1.00 37.70  ? 205 PHE B CE2 1 
ATOM   4070 C CZ  . PHE B 1 205 ? 32.879 -2.658  34.783 1.00 38.99  ? 205 PHE B CZ  1 
ATOM   4071 N N   . SER B 1 206 ? 33.198 -0.270  41.706 1.00 44.25  ? 206 SER B N   1 
ATOM   4072 C CA  . SER B 1 206 ? 33.566 0.424   42.941 1.00 43.02  ? 206 SER B CA  1 
ATOM   4073 C C   . SER B 1 206 ? 35.008 0.918   42.968 1.00 43.25  ? 206 SER B C   1 
ATOM   4074 O O   . SER B 1 206 ? 35.867 0.373   42.282 1.00 49.05  ? 206 SER B O   1 
ATOM   4075 C CB  . SER B 1 206 ? 33.280 -0.467  44.161 1.00 48.12  ? 206 SER B CB  1 
ATOM   4076 O OG  . SER B 1 206 ? 33.895 -1.747  44.049 1.00 36.38  ? 206 SER B OG  1 
ATOM   4077 N N   . HIS B 1 207 ? 35.270 1.942   43.779 1.00 43.44  ? 207 HIS B N   1 
ATOM   4078 C CA  . HIS B 1 207 ? 36.614 2.518   43.894 1.00 39.56  ? 207 HIS B CA  1 
ATOM   4079 C C   . HIS B 1 207 ? 37.545 1.688   44.746 1.00 41.32  ? 207 HIS B C   1 
ATOM   4080 O O   . HIS B 1 207 ? 38.752 1.922   44.773 1.00 38.55  ? 207 HIS B O   1 
ATOM   4081 C CB  . HIS B 1 207 ? 36.551 3.924   44.479 1.00 37.12  ? 207 HIS B CB  1 
ATOM   4082 C CG  . HIS B 1 207 ? 36.145 3.964   45.916 1.00 32.85  ? 207 HIS B CG  1 
ATOM   4083 N ND1 . HIS B 1 207 ? 34.841 3.779   46.329 1.00 27.30  ? 207 HIS B ND1 1 
ATOM   4084 C CD2 . HIS B 1 207 ? 36.864 4.203   47.037 1.00 31.96  ? 207 HIS B CD2 1 
ATOM   4085 C CE1 . HIS B 1 207 ? 34.776 3.907   47.643 1.00 37.97  ? 207 HIS B CE1 1 
ATOM   4086 N NE2 . HIS B 1 207 ? 35.989 4.164   48.096 1.00 40.16  ? 207 HIS B NE2 1 
ATOM   4087 N N   . ARG B 1 208 ? 36.968 0.728   45.452 1.00 45.57  ? 208 ARG B N   1 
ATOM   4088 C CA  . ARG B 1 208 ? 37.726 -0.141  46.326 1.00 46.81  ? 208 ARG B CA  1 
ATOM   4089 C C   . ARG B 1 208 ? 37.910 -1.522  45.652 1.00 47.77  ? 208 ARG B C   1 
ATOM   4090 O O   . ARG B 1 208 ? 38.982 -1.825  45.105 1.00 44.81  ? 208 ARG B O   1 
ATOM   4091 C CB  . ARG B 1 208 ? 36.966 -0.254  47.652 1.00 50.29  ? 208 ARG B CB  1 
ATOM   4092 C CG  . ARG B 1 208 ? 37.803 -0.577  48.863 1.00 58.59  ? 208 ARG B CG  1 
ATOM   4093 C CD  . ARG B 1 208 ? 36.899 -0.797  50.075 1.00 70.46  ? 208 ARG B CD  1 
ATOM   4094 N NE  . ARG B 1 208 ? 37.654 -1.162  51.274 1.00 78.29  ? 208 ARG B NE  1 
ATOM   4095 C CZ  . ARG B 1 208 ? 37.122 -1.318  52.485 1.00 71.03  ? 208 ARG B CZ  1 
ATOM   4096 N NH1 . ARG B 1 208 ? 35.822 -1.142  52.675 1.00 65.53  ? 208 ARG B NH1 1 
ATOM   4097 N NH2 . ARG B 1 208 ? 37.901 -1.617  53.516 1.00 65.16  ? 208 ARG B NH2 1 
ATOM   4098 N N   . LEU B 1 209 ? 36.827 -2.303  45.609 1.00 43.03  ? 209 LEU B N   1 
ATOM   4099 C CA  . LEU B 1 209 ? 36.821 -3.655  45.039 1.00 34.76  ? 209 LEU B CA  1 
ATOM   4100 C C   . LEU B 1 209 ? 37.233 -3.746  43.570 1.00 38.61  ? 209 LEU B C   1 
ATOM   4101 O O   . LEU B 1 209 ? 36.900 -2.877  42.762 1.00 42.54  ? 209 LEU B O   1 
ATOM   4102 C CB  . LEU B 1 209 ? 35.443 -4.266  45.216 1.00 17.96  ? 209 LEU B CB  1 
ATOM   4103 C CG  . LEU B 1 209 ? 34.909 -4.073  46.625 1.00 18.82  ? 209 LEU B CG  1 
ATOM   4104 C CD1 . LEU B 1 209 ? 33.525 -4.682  46.756 1.00 21.61  ? 209 LEU B CD1 1 
ATOM   4105 C CD2 . LEU B 1 209 ? 35.880 -4.690  47.622 1.00 23.84  ? 209 LEU B CD2 1 
ATOM   4106 N N   . THR B 1 210 ? 37.935 -4.820  43.224 1.00 44.20  ? 210 THR B N   1 
ATOM   4107 C CA  . THR B 1 210 ? 38.408 -5.021  41.854 1.00 48.65  ? 210 THR B CA  1 
ATOM   4108 C C   . THR B 1 210 ? 37.501 -5.877  40.985 1.00 51.18  ? 210 THR B C   1 
ATOM   4109 O O   . THR B 1 210 ? 36.951 -6.883  41.440 1.00 53.75  ? 210 THR B O   1 
ATOM   4110 C CB  . THR B 1 210 ? 39.834 -5.604  41.820 1.00 49.85  ? 210 THR B CB  1 
ATOM   4111 O OG1 . THR B 1 210 ? 40.124 -6.252  43.066 1.00 60.41  ? 210 THR B OG1 1 
ATOM   4112 C CG2 . THR B 1 210 ? 40.849 -4.504  41.567 1.00 56.70  ? 210 THR B CG2 1 
ATOM   4113 N N   . VAL B 1 211 ? 37.346 -5.465  39.728 1.00 49.25  ? 211 VAL B N   1 
ATOM   4114 C CA  . VAL B 1 211 ? 36.503 -6.184  38.779 1.00 52.41  ? 211 VAL B CA  1 
ATOM   4115 C C   . VAL B 1 211 ? 37.270 -7.318  38.103 1.00 57.93  ? 211 VAL B C   1 
ATOM   4116 O O   . VAL B 1 211 ? 38.101 -7.094  37.223 1.00 64.44  ? 211 VAL B O   1 
ATOM   4117 C CB  . VAL B 1 211 ? 35.919 -5.227  37.724 1.00 49.85  ? 211 VAL B CB  1 
ATOM   4118 C CG1 . VAL B 1 211 ? 35.248 -6.005  36.597 1.00 51.50  ? 211 VAL B CG1 1 
ATOM   4119 C CG2 . VAL B 1 211 ? 34.920 -4.303  38.378 1.00 45.37  ? 211 VAL B CG2 1 
ATOM   4120 N N   . HIS B 1 212 ? 37.001 -8.539  38.540 1.00 55.11  ? 212 HIS B N   1 
ATOM   4121 C CA  . HIS B 1 212 ? 37.666 -9.699  37.988 1.00 50.16  ? 212 HIS B CA  1 
ATOM   4122 C C   . HIS B 1 212 ? 37.207 -10.050 36.574 1.00 53.92  ? 212 HIS B C   1 
ATOM   4123 O O   . HIS B 1 212 ? 38.037 -10.370 35.729 1.00 58.59  ? 212 HIS B O   1 
ATOM   4124 C CB  . HIS B 1 212 ? 37.495 -10.871 38.940 1.00 47.54  ? 212 HIS B CB  1 
ATOM   4125 C CG  . HIS B 1 212 ? 38.118 -10.639 40.280 1.00 48.69  ? 212 HIS B CG  1 
ATOM   4126 N ND1 . HIS B 1 212 ? 39.336 -10.011 40.433 1.00 48.91  ? 212 HIS B ND1 1 
ATOM   4127 C CD2 . HIS B 1 212 ? 37.696 -10.950 41.528 1.00 42.20  ? 212 HIS B CD2 1 
ATOM   4128 C CE1 . HIS B 1 212 ? 39.637 -9.945  41.719 1.00 49.10  ? 212 HIS B CE1 1 
ATOM   4129 N NE2 . HIS B 1 212 ? 38.658 -10.508 42.404 1.00 52.24  ? 212 HIS B NE2 1 
ATOM   4130 N N   . ARG B 1 213 ? 35.901 -9.998  36.314 1.00 56.06  ? 213 ARG B N   1 
ATOM   4131 C CA  . ARG B 1 213 ? 35.376 -10.294 34.976 1.00 57.81  ? 213 ARG B CA  1 
ATOM   4132 C C   . ARG B 1 213 ? 34.361 -9.231  34.561 1.00 62.23  ? 213 ARG B C   1 
ATOM   4133 O O   . ARG B 1 213 ? 33.440 -8.920  35.320 1.00 67.41  ? 213 ARG B O   1 
ATOM   4134 C CB  . ARG B 1 213 ? 34.750 -11.690 34.922 1.00 58.58  ? 213 ARG B CB  1 
ATOM   4135 C CG  . ARG B 1 213 ? 34.200 -12.061 33.552 1.00 53.43  ? 213 ARG B CG  1 
ATOM   4136 C CD  . ARG B 1 213 ? 33.868 -13.540 33.453 1.00 54.49  ? 213 ARG B CD  1 
ATOM   4137 N NE  . ARG B 1 213 ? 35.038 -14.356 33.141 1.00 55.51  ? 213 ARG B NE  1 
ATOM   4138 C CZ  . ARG B 1 213 ? 35.284 -14.889 31.947 1.00 55.45  ? 213 ARG B CZ  1 
ATOM   4139 N NH1 . ARG B 1 213 ? 34.442 -14.697 30.938 1.00 53.70  ? 213 ARG B NH1 1 
ATOM   4140 N NH2 . ARG B 1 213 ? 36.378 -15.613 31.759 1.00 55.08  ? 213 ARG B NH2 1 
ATOM   4141 N N   . LYS B 1 214 ? 34.519 -8.710  33.341 1.00 59.05  ? 214 LYS B N   1 
ATOM   4142 C CA  . LYS B 1 214 ? 33.667 -7.640  32.811 1.00 57.86  ? 214 LYS B CA  1 
ATOM   4143 C C   . LYS B 1 214 ? 32.791 -8.040  31.615 1.00 56.66  ? 214 LYS B C   1 
ATOM   4144 O O   . LYS B 1 214 ? 33.085 -9.002  30.916 1.00 55.56  ? 214 LYS B O   1 
ATOM   4145 C CB  . LYS B 1 214 ? 34.567 -6.466  32.423 1.00 58.92  ? 214 LYS B CB  1 
ATOM   4146 C CG  . LYS B 1 214 ? 33.863 -5.165  32.087 1.00 59.99  ? 214 LYS B CG  1 
ATOM   4147 C CD  . LYS B 1 214 ? 34.837 -4.186  31.425 1.00 56.97  ? 214 LYS B CD  1 
ATOM   4148 C CE  . LYS B 1 214 ? 36.098 -4.010  32.252 1.00 52.89  ? 214 LYS B CE  1 
ATOM   4149 N NZ  . LYS B 1 214 ? 37.015 -3.032  31.625 1.00 54.21  ? 214 LYS B NZ  1 
ATOM   4150 N N   . TYR B 1 215 ? 31.736 -7.267  31.370 1.00 58.71  ? 215 TYR B N   1 
ATOM   4151 C CA  . TYR B 1 215 ? 30.810 -7.526  30.268 1.00 65.40  ? 215 TYR B CA  1 
ATOM   4152 C C   . TYR B 1 215 ? 30.204 -6.245  29.710 1.00 69.00  ? 215 TYR B C   1 
ATOM   4153 O O   . TYR B 1 215 ? 30.103 -5.243  30.416 1.00 78.43  ? 215 TYR B O   1 
ATOM   4154 C CB  . TYR B 1 215 ? 29.661 -8.416  30.737 1.00 71.82  ? 215 TYR B CB  1 
ATOM   4155 C CG  . TYR B 1 215 ? 30.076 -9.818  31.086 1.00 77.63  ? 215 TYR B CG  1 
ATOM   4156 C CD1 . TYR B 1 215 ? 30.296 -10.188 32.407 1.00 77.70  ? 215 TYR B CD1 1 
ATOM   4157 C CD2 . TYR B 1 215 ? 30.268 -10.775 30.091 1.00 83.55  ? 215 TYR B CD2 1 
ATOM   4158 C CE1 . TYR B 1 215 ? 30.701 -11.472 32.730 1.00 81.81  ? 215 TYR B CE1 1 
ATOM   4159 C CE2 . TYR B 1 215 ? 30.672 -12.066 30.404 1.00 80.45  ? 215 TYR B CE2 1 
ATOM   4160 C CZ  . TYR B 1 215 ? 30.887 -12.405 31.724 1.00 79.82  ? 215 TYR B CZ  1 
ATOM   4161 O OH  . TYR B 1 215 ? 31.290 -13.676 32.041 1.00 78.26  ? 215 TYR B OH  1 
ATOM   4162 N N   . ASP B 1 216 ? 29.748 -6.301  28.460 1.00 65.23  ? 216 ASP B N   1 
ATOM   4163 C CA  . ASP B 1 216 ? 29.122 -5.151  27.808 1.00 63.57  ? 216 ASP B CA  1 
ATOM   4164 C C   . ASP B 1 216 ? 27.839 -5.622  27.110 1.00 65.83  ? 216 ASP B C   1 
ATOM   4165 O O   . ASP B 1 216 ? 27.716 -5.542  25.888 1.00 71.38  ? 216 ASP B O   1 
ATOM   4166 C CB  . ASP B 1 216 ? 30.088 -4.526  26.797 1.00 54.27  ? 216 ASP B CB  1 
ATOM   4167 C CG  . ASP B 1 216 ? 29.611 -3.186  26.292 1.00 54.14  ? 216 ASP B CG  1 
ATOM   4168 O OD1 . ASP B 1 216 ? 28.629 -3.138  25.528 1.00 47.72  ? 216 ASP B OD1 1 
ATOM   4169 O OD2 . ASP B 1 216 ? 30.218 -2.170  26.666 1.00 57.43  ? 216 ASP B OD2 1 
ATOM   4170 N N   . LEU B 1 217 ? 26.878 -6.088  27.902 1.00 66.10  ? 217 LEU B N   1 
ATOM   4171 C CA  . LEU B 1 217 ? 25.613 -6.606  27.385 1.00 66.45  ? 217 LEU B CA  1 
ATOM   4172 C C   . LEU B 1 217 ? 24.700 -5.591  26.684 1.00 71.21  ? 217 LEU B C   1 
ATOM   4173 O O   . LEU B 1 217 ? 23.981 -4.830  27.330 1.00 75.02  ? 217 LEU B O   1 
ATOM   4174 C CB  . LEU B 1 217 ? 24.862 -7.317  28.509 1.00 61.30  ? 217 LEU B CB  1 
ATOM   4175 C CG  . LEU B 1 217 ? 25.722 -8.367  29.221 1.00 61.69  ? 217 LEU B CG  1 
ATOM   4176 C CD1 . LEU B 1 217 ? 25.093 -8.763  30.539 1.00 57.41  ? 217 LEU B CD1 1 
ATOM   4177 C CD2 . LEU B 1 217 ? 25.920 -9.574  28.330 1.00 53.74  ? 217 LEU B CD2 1 
ATOM   4178 N N   . LYS B 1 218 ? 24.718 -5.622  25.352 1.00 70.37  ? 218 LYS B N   1 
ATOM   4179 C CA  . LYS B 1 218 ? 23.918 -4.736  24.506 1.00 70.95  ? 218 LYS B CA  1 
ATOM   4180 C C   . LYS B 1 218 ? 22.482 -5.234  24.393 1.00 72.03  ? 218 LYS B C   1 
ATOM   4181 O O   . LYS B 1 218 ? 21.559 -4.452  24.184 1.00 70.15  ? 218 LYS B O   1 
ATOM   4182 C CB  . LYS B 1 218 ? 24.539 -4.670  23.115 1.00 66.68  ? 218 LYS B CB  1 
ATOM   4183 C CG  . LYS B 1 218 ? 26.065 -4.624  23.138 1.00 74.72  ? 218 LYS B CG  1 
ATOM   4184 C CD  . LYS B 1 218 ? 26.668 -5.502  22.043 1.00 78.41  ? 218 LYS B CD  1 
ATOM   4185 C CE  . LYS B 1 218 ? 28.147 -5.768  22.276 1.00 70.58  ? 218 LYS B CE  1 
ATOM   4186 N NZ  . LYS B 1 218 ? 28.968 -4.529  22.280 1.00 68.10  ? 218 LYS B NZ  1 
ATOM   4187 N N   . GLY B 1 219 ? 22.306 -6.545  24.504 1.00 76.00  ? 219 GLY B N   1 
ATOM   4188 C CA  . GLY B 1 219 ? 20.979 -7.133  24.417 1.00 82.07  ? 219 GLY B CA  1 
ATOM   4189 C C   . GLY B 1 219 ? 20.463 -7.323  23.001 1.00 86.33  ? 219 GLY B C   1 
ATOM   4190 O O   . GLY B 1 219 ? 19.442 -7.987  22.795 1.00 85.12  ? 219 GLY B O   1 
ATOM   4191 N N   . SER B 1 220 ? 21.187 -6.777  22.022 1.00 91.07  ? 220 SER B N   1 
ATOM   4192 C CA  . SER B 1 220 ? 20.790 -6.868  20.620 1.00 86.56  ? 220 SER B CA  1 
ATOM   4193 C C   . SER B 1 220 ? 20.771 -8.295  20.091 1.00 89.65  ? 220 SER B C   1 
ATOM   4194 O O   . SER B 1 220 ? 21.542 -9.146  20.542 1.00 88.71  ? 220 SER B O   1 
ATOM   4195 C CB  . SER B 1 220 ? 21.699 -6.004  19.738 1.00 82.87  ? 220 SER B CB  1 
ATOM   4196 O OG  . SER B 1 220 ? 22.994 -6.566  19.641 1.00 81.20  ? 220 SER B OG  1 
ATOM   4197 N N   . THR B 1 221 ? 19.864 -8.541  19.148 1.00 90.53  ? 221 THR B N   1 
ATOM   4198 C CA  . THR B 1 221 ? 19.721 -9.846  18.511 1.00 90.56  ? 221 THR B CA  1 
ATOM   4199 C C   . THR B 1 221 ? 21.007 -10.192 17.768 1.00 90.19  ? 221 THR B C   1 
ATOM   4200 O O   . THR B 1 221 ? 21.450 -9.455  16.879 1.00 88.63  ? 221 THR B O   1 
ATOM   4201 C CB  . THR B 1 221 ? 18.551 -9.868  17.504 1.00 90.24  ? 221 THR B CB  1 
ATOM   4202 O OG1 . THR B 1 221 ? 18.690 -8.779  16.585 1.00 91.75  ? 221 THR B OG1 1 
ATOM   4203 C CG2 . THR B 1 221 ? 17.210 -9.757  18.224 1.00 90.92  ? 221 THR B CG2 1 
ATOM   4204 N N   . VAL B 1 222 ? 21.591 -11.313 18.180 1.00 91.54  ? 222 VAL B N   1 
ATOM   4205 C CA  . VAL B 1 222 ? 22.838 -11.857 17.641 1.00 90.38  ? 222 VAL B CA  1 
ATOM   4206 C C   . VAL B 1 222 ? 23.478 -11.151 16.434 1.00 91.73  ? 222 VAL B C   1 
ATOM   4207 O O   . VAL B 1 222 ? 22.927 -11.148 15.321 1.00 90.38  ? 222 VAL B O   1 
ATOM   4208 C CB  . VAL B 1 222 ? 22.710 -13.396 17.390 1.00 93.72  ? 222 VAL B CB  1 
ATOM   4209 C CG1 . VAL B 1 222 ? 24.075 -14.013 17.047 1.00 91.20  ? 222 VAL B CG1 1 
ATOM   4210 C CG2 . VAL B 1 222 ? 22.131 -14.084 18.629 1.00 89.07  ? 222 VAL B CG2 1 
ATOM   4211 N N   . ALA B 1 223 ? 24.577 -10.451 16.736 1.00 90.29  ? 223 ALA B N   1 
ATOM   4212 C CA  . ALA B 1 223 ? 25.401 -9.716  15.765 1.00 91.46  ? 223 ALA B CA  1 
ATOM   4213 C C   . ALA B 1 223 ? 26.888 -9.764  16.198 1.00 91.57  ? 223 ALA B C   1 
ATOM   4214 O O   . ALA B 1 223 ? 27.493 -10.839 16.200 1.00 92.04  ? 223 ALA B O   1 
ATOM   4215 C CB  . ALA B 1 223 ? 24.917 -8.279  15.666 1.00 92.89  ? 223 ALA B CB  1 
ATOM   4216 N N   . ARG B 1 224 ? 27.490 -8.616  16.519 1.00 87.99  ? 224 ARG B N   1 
ATOM   4217 C CA  . ARG B 1 224 ? 28.880 -8.601  16.988 1.00 89.90  ? 224 ARG B CA  1 
ATOM   4218 C C   . ARG B 1 224 ? 28.785 -8.747  18.507 1.00 89.70  ? 224 ARG B C   1 
ATOM   4219 O O   . ARG B 1 224 ? 28.164 -7.904  19.167 1.00 88.94  ? 224 ARG B O   1 
ATOM   4220 C CB  . ARG B 1 224 ? 29.595 -7.284  16.637 1.00 91.43  ? 224 ARG B CB  1 
ATOM   4221 C CG  . ARG B 1 224 ? 31.103 -7.278  17.003 1.00 91.16  ? 224 ARG B CG  1 
ATOM   4222 C CD  . ARG B 1 224 ? 31.761 -5.884  16.929 1.00 90.48  ? 224 ARG B CD  1 
ATOM   4223 N NE  . ARG B 1 224 ? 33.175 -5.917  17.329 1.00 89.99  ? 224 ARG B NE  1 
ATOM   4224 C CZ  . ARG B 1 224 ? 33.709 -5.203  18.324 1.00 92.09  ? 224 ARG B CZ  1 
ATOM   4225 N NH1 . ARG B 1 224 ? 32.961 -4.379  19.047 1.00 90.96  ? 224 ARG B NH1 1 
ATOM   4226 N NH2 . ARG B 1 224 ? 35.004 -5.312  18.600 1.00 88.42  ? 224 ARG B NH2 1 
ATOM   4227 N N   . GLU B 1 225 ? 29.378 -9.815  19.053 1.00 89.80  ? 225 GLU B N   1 
ATOM   4228 C CA  . GLU B 1 225 ? 29.329 -10.076 20.495 1.00 85.68  ? 225 GLU B CA  1 
ATOM   4229 C C   . GLU B 1 225 ? 30.141 -11.287 20.949 1.00 84.07  ? 225 GLU B C   1 
ATOM   4230 O O   . GLU B 1 225 ? 29.577 -12.250 21.482 1.00 81.00  ? 225 GLU B O   1 
ATOM   4231 C CB  . GLU B 1 225 ? 27.877 -10.292 20.921 1.00 87.16  ? 225 GLU B CB  1 
ATOM   4232 C CG  . GLU B 1 225 ? 27.198 -11.423 20.160 1.00 88.98  ? 225 GLU B CG  1 
ATOM   4233 C CD  . GLU B 1 225 ? 25.845 -11.034 19.622 1.00 89.45  ? 225 GLU B CD  1 
ATOM   4234 O OE1 . GLU B 1 225 ? 24.951 -11.901 19.605 1.00 82.77  ? 225 GLU B OE1 1 
ATOM   4235 O OE2 . GLU B 1 225 ? 25.678 -9.863  19.217 1.00 90.23  ? 225 GLU B OE2 1 
ATOM   4236 N N   . ALA B 1 226 ? 31.460 -11.233 20.798 1.00 82.41  ? 226 ALA B N   1 
ATOM   4237 C CA  . ALA B 1 226 ? 32.274 -12.371 21.214 1.00 90.49  ? 226 ALA B CA  1 
ATOM   4238 C C   . ALA B 1 226 ? 33.796 -12.180 21.200 1.00 89.80  ? 226 ALA B C   1 
ATOM   4239 O O   . ALA B 1 226 ? 34.304 -11.071 21.416 1.00 89.90  ? 226 ALA B O   1 
ATOM   4240 C CB  . ALA B 1 226 ? 31.874 -13.634 20.407 1.00 88.33  ? 226 ALA B CB  1 
ATOM   4241 N N   . SER B 1 227 ? 34.501 -13.294 20.986 1.00 88.79  ? 227 SER B N   1 
ATOM   4242 C CA  . SER B 1 227 ? 35.959 -13.364 20.938 1.00 88.05  ? 227 SER B CA  1 
ATOM   4243 C C   . SER B 1 227 ? 36.661 -12.261 20.158 1.00 89.54  ? 227 SER B C   1 
ATOM   4244 O O   . SER B 1 227 ? 36.445 -12.089 18.957 1.00 88.56  ? 227 SER B O   1 
ATOM   4245 C CB  . SER B 1 227 ? 36.390 -14.726 20.386 1.00 90.01  ? 227 SER B CB  1 
ATOM   4246 O OG  . SER B 1 227 ? 35.853 -14.949 19.091 1.00 91.13  ? 227 SER B OG  1 
ATOM   4247 N N   . ASP B 1 228 ? 37.538 -11.549 20.854 1.00 85.32  ? 228 ASP B N   1 
ATOM   4248 C CA  . ASP B 1 228 ? 38.311 -10.462 20.269 1.00 86.70  ? 228 ASP B CA  1 
ATOM   4249 C C   . ASP B 1 228 ? 39.727 -10.570 20.837 1.00 89.00  ? 228 ASP B C   1 
ATOM   4250 O O   . ASP B 1 228 ? 40.018 -11.496 21.597 1.00 90.65  ? 228 ASP B O   1 
ATOM   4251 C CB  . ASP B 1 228 ? 37.684 -9.122  20.673 1.00 84.12  ? 228 ASP B CB  1 
ATOM   4252 C CG  . ASP B 1 228 ? 38.204 -7.956  19.847 1.00 84.32  ? 228 ASP B CG  1 
ATOM   4253 O OD1 . ASP B 1 228 ? 37.751 -7.794  18.694 1.00 85.73  ? 228 ASP B OD1 1 
ATOM   4254 O OD2 . ASP B 1 228 ? 39.062 -7.201  20.350 1.00 85.49  ? 228 ASP B OD2 1 
ATOM   4255 N N   . LYS B 1 229 ? 40.618 -9.665  20.434 1.00 89.36  ? 229 LYS B N   1 
ATOM   4256 C CA  . LYS B 1 229 ? 41.983 -9.655  20.968 1.00 89.37  ? 229 LYS B CA  1 
ATOM   4257 C C   . LYS B 1 229 ? 41.809 -9.416  22.466 1.00 89.56  ? 229 LYS B C   1 
ATOM   4258 O O   . LYS B 1 229 ? 42.623 -9.852  23.284 1.00 87.78  ? 229 LYS B O   1 
ATOM   4259 C CB  . LYS B 1 229 ? 42.796 -8.496  20.384 1.00 89.57  ? 229 LYS B CB  1 
ATOM   4260 C CG  . LYS B 1 229 ? 42.828 -8.418  18.868 1.00 88.24  ? 229 LYS B CG  1 
ATOM   4261 C CD  . LYS B 1 229 ? 43.623 -7.200  18.411 1.00 90.16  ? 229 LYS B CD  1 
ATOM   4262 C CE  . LYS B 1 229 ? 43.024 -5.908  18.955 1.00 89.46  ? 229 LYS B CE  1 
ATOM   4263 N NZ  . LYS B 1 229 ? 43.845 -4.713  18.613 1.00 87.55  ? 229 LYS B NZ  1 
ATOM   4264 N N   . GLU B 1 230 ? 40.726 -8.708  22.794 1.00 90.64  ? 230 GLU B N   1 
ATOM   4265 C CA  . GLU B 1 230 ? 40.361 -8.387  24.165 1.00 90.17  ? 230 GLU B CA  1 
ATOM   4266 C C   . GLU B 1 230 ? 40.413 -9.625  25.052 1.00 90.56  ? 230 GLU B C   1 
ATOM   4267 O O   . GLU B 1 230 ? 40.982 -9.573  26.139 1.00 91.01  ? 230 GLU B O   1 
ATOM   4268 C CB  . GLU B 1 230 ? 38.957 -7.777  24.220 1.00 87.04  ? 230 GLU B CB  1 
ATOM   4269 C CG  . GLU B 1 230 ? 38.834 -6.391  23.610 1.00 82.71  ? 230 GLU B CG  1 
ATOM   4270 C CD  . GLU B 1 230 ? 37.462 -5.774  23.831 1.00 82.16  ? 230 GLU B CD  1 
ATOM   4271 O OE1 . GLU B 1 230 ? 36.464 -6.521  23.916 1.00 84.49  ? 230 GLU B OE1 1 
ATOM   4272 O OE2 . GLU B 1 230 ? 37.376 -4.533  23.919 1.00 83.46  ? 230 GLU B OE2 1 
ATOM   4273 N N   . LYS B 1 231 ? 39.838 -10.736 24.583 1.00 89.55  ? 231 LYS B N   1 
ATOM   4274 C CA  . LYS B 1 231 ? 39.840 -11.990 25.348 1.00 89.40  ? 231 LYS B CA  1 
ATOM   4275 C C   . LYS B 1 231 ? 41.243 -12.292 25.855 1.00 90.62  ? 231 LYS B C   1 
ATOM   4276 O O   . LYS B 1 231 ? 41.427 -12.859 26.942 1.00 89.17  ? 231 LYS B O   1 
ATOM   4277 C CB  . LYS B 1 231 ? 39.327 -13.160 24.499 1.00 86.29  ? 231 LYS B CB  1 
ATOM   4278 C CG  . LYS B 1 231 ? 37.812 -13.217 24.382 1.00 88.97  ? 231 LYS B CG  1 
ATOM   4279 C CD  . LYS B 1 231 ? 37.328 -14.594 23.963 1.00 88.56  ? 231 LYS B CD  1 
ATOM   4280 C CE  . LYS B 1 231 ? 35.835 -14.739 24.220 1.00 88.42  ? 231 LYS B CE  1 
ATOM   4281 N NZ  . LYS B 1 231 ? 35.288 -16.010 23.669 1.00 90.21  ? 231 LYS B NZ  1 
ATOM   4282 N N   . ALA B 1 232 ? 42.219 -11.870 25.055 1.00 89.50  ? 232 ALA B N   1 
ATOM   4283 C CA  . ALA B 1 232 ? 43.629 -12.032 25.359 1.00 88.03  ? 232 ALA B CA  1 
ATOM   4284 C C   . ALA B 1 232 ? 44.204 -10.666 25.741 1.00 83.67  ? 232 ALA B C   1 
ATOM   4285 O O   . ALA B 1 232 ? 45.260 -10.261 25.255 1.00 78.06  ? 232 ALA B O   1 
ATOM   4286 C CB  . ALA B 1 232 ? 44.355 -12.609 24.146 1.00 89.36  ? 232 ALA B CB  1 
ATOM   4287 N N   . LYS B 1 233 ? 43.496 -9.963  26.620 1.00 83.46  ? 233 LYS B N   1 
ATOM   4288 C CA  . LYS B 1 233 ? 43.918 -8.638  27.076 1.00 89.85  ? 233 LYS B CA  1 
ATOM   4289 C C   . LYS B 1 233 ? 44.039 -8.597  28.605 1.00 91.81  ? 233 LYS B C   1 
ATOM   4290 O O   . LYS B 1 233 ? 43.771 -9.592  29.286 1.00 90.92  ? 233 LYS B O   1 
ATOM   4291 C CB  . LYS B 1 233 ? 42.916 -7.573  26.598 1.00 88.89  ? 233 LYS B CB  1 
ATOM   4292 C CG  . LYS B 1 233 ? 43.341 -6.122  26.802 1.00 87.35  ? 233 LYS B CG  1 
ATOM   4293 C CD  . LYS B 1 233 ? 42.239 -5.153  26.402 1.00 90.18  ? 233 LYS B CD  1 
ATOM   4294 C CE  . LYS B 1 233 ? 40.973 -5.376  27.215 1.00 89.54  ? 233 LYS B CE  1 
ATOM   4295 N NZ  . LYS B 1 233 ? 39.924 -4.350  26.951 1.00 85.47  ? 233 LYS B NZ  1 
ATOM   4296 N N   . ASP B 1 234 ? 44.481 -7.450  29.119 1.00 87.76  ? 234 ASP B N   1 
ATOM   4297 C CA  . ASP B 1 234 ? 44.647 -7.199  30.550 1.00 84.56  ? 234 ASP B CA  1 
ATOM   4298 C C   . ASP B 1 234 ? 43.339 -7.575  31.262 1.00 84.71  ? 234 ASP B C   1 
ATOM   4299 O O   . ASP B 1 234 ? 43.313 -8.462  32.118 1.00 86.12  ? 234 ASP B O   1 
ATOM   4300 C CB  . ASP B 1 234 ? 44.963 -5.712  30.757 1.00 88.30  ? 234 ASP B CB  1 
ATOM   4301 C CG  . ASP B 1 234 ? 45.748 -5.107  29.587 1.00 90.38  ? 234 ASP B CG  1 
ATOM   4302 O OD1 . ASP B 1 234 ? 46.819 -5.653  29.236 1.00 91.97  ? 234 ASP B OD1 1 
ATOM   4303 O OD2 . ASP B 1 234 ? 45.281 -4.100  29.004 1.00 87.36  ? 234 ASP B OD2 1 
ATOM   4304 N N   . LEU B 1 235 ? 42.260 -6.888  30.895 1.00 81.94  ? 235 LEU B N   1 
ATOM   4305 C CA  . LEU B 1 235 ? 40.931 -7.161  31.433 1.00 77.75  ? 235 LEU B CA  1 
ATOM   4306 C C   . LEU B 1 235 ? 39.991 -7.012  30.237 1.00 80.22  ? 235 LEU B C   1 
ATOM   4307 O O   . LEU B 1 235 ? 39.647 -5.900  29.831 1.00 82.42  ? 235 LEU B O   1 
ATOM   4308 C CB  . LEU B 1 235 ? 40.551 -6.168  32.533 1.00 72.68  ? 235 LEU B CB  1 
ATOM   4309 C CG  . LEU B 1 235 ? 39.341 -6.608  33.363 1.00 67.60  ? 235 LEU B CG  1 
ATOM   4310 C CD1 . LEU B 1 235 ? 39.757 -7.785  34.230 1.00 73.33  ? 235 LEU B CD1 1 
ATOM   4311 C CD2 . LEU B 1 235 ? 38.813 -5.472  34.225 1.00 60.07  ? 235 LEU B CD2 1 
ATOM   4312 N N   . PRO B 1 236 ? 39.593 -8.140  29.635 1.00 77.67  ? 236 PRO B N   1 
ATOM   4313 C CA  . PRO B 1 236 ? 38.705 -8.216  28.474 1.00 76.38  ? 236 PRO B CA  1 
ATOM   4314 C C   . PRO B 1 236 ? 37.285 -7.757  28.747 1.00 74.81  ? 236 PRO B C   1 
ATOM   4315 O O   . PRO B 1 236 ? 36.712 -8.073  29.794 1.00 75.01  ? 236 PRO B O   1 
ATOM   4316 C CB  . PRO B 1 236 ? 38.715 -9.703  28.137 1.00 70.07  ? 236 PRO B CB  1 
ATOM   4317 C CG  . PRO B 1 236 ? 39.971 -10.215 28.766 1.00 78.90  ? 236 PRO B CG  1 
ATOM   4318 C CD  . PRO B 1 236 ? 39.991 -9.486  30.061 1.00 79.24  ? 236 PRO B CD  1 
ATOM   4319 N N   . THR B 1 237 ? 36.718 -7.050  27.773 1.00 73.94  ? 237 THR B N   1 
ATOM   4320 C CA  . THR B 1 237 ? 35.350 -6.543  27.853 1.00 73.42  ? 237 THR B CA  1 
ATOM   4321 C C   . THR B 1 237 ? 34.431 -7.517  27.089 1.00 70.30  ? 237 THR B C   1 
ATOM   4322 O O   . THR B 1 237 ? 33.941 -7.193  26.010 1.00 72.92  ? 237 THR B O   1 
ATOM   4323 C CB  . THR B 1 237 ? 35.250 -5.132  27.201 1.00 75.29  ? 237 THR B CB  1 
ATOM   4324 O OG1 . THR B 1 237 ? 36.414 -4.360  27.526 1.00 77.88  ? 237 THR B OG1 1 
ATOM   4325 C CG2 . THR B 1 237 ? 34.016 -4.394  27.702 1.00 75.24  ? 237 THR B CG2 1 
ATOM   4326 N N   . PHE B 1 238 ? 34.185 -8.702  27.640 1.00 66.44  ? 238 PHE B N   1 
ATOM   4327 C CA  . PHE B 1 238 ? 33.345 -9.695  26.958 1.00 65.83  ? 238 PHE B CA  1 
ATOM   4328 C C   . PHE B 1 238 ? 31.938 -9.186  26.669 1.00 65.45  ? 238 PHE B C   1 
ATOM   4329 O O   . PHE B 1 238 ? 31.418 -8.359  27.404 1.00 67.30  ? 238 PHE B O   1 
ATOM   4330 C CB  . PHE B 1 238 ? 33.301 -11.001 27.755 1.00 69.55  ? 238 PHE B CB  1 
ATOM   4331 C CG  . PHE B 1 238 ? 34.663 -11.531 28.118 1.00 66.78  ? 238 PHE B CG  1 
ATOM   4332 C CD1 . PHE B 1 238 ? 34.995 -11.787 29.443 1.00 71.08  ? 238 PHE B CD1 1 
ATOM   4333 C CD2 . PHE B 1 238 ? 35.631 -11.718 27.146 1.00 63.60  ? 238 PHE B CD2 1 
ATOM   4334 C CE1 . PHE B 1 238 ? 36.270 -12.212 29.791 1.00 66.22  ? 238 PHE B CE1 1 
ATOM   4335 C CE2 . PHE B 1 238 ? 36.905 -12.143 27.491 1.00 61.27  ? 238 PHE B CE2 1 
ATOM   4336 C CZ  . PHE B 1 238 ? 37.222 -12.387 28.816 1.00 58.18  ? 238 PHE B CZ  1 
ATOM   4337 N N   . LYS B 1 239 ? 31.329 -9.686  25.598 1.00 65.66  ? 239 LYS B N   1 
ATOM   4338 C CA  . LYS B 1 239 ? 29.991 -9.248  25.192 1.00 73.57  ? 239 LYS B CA  1 
ATOM   4339 C C   . LYS B 1 239 ? 28.848 -10.239 25.477 1.00 74.05  ? 239 LYS B C   1 
ATOM   4340 O O   . LYS B 1 239 ? 29.052 -11.264 26.126 1.00 78.90  ? 239 LYS B O   1 
ATOM   4341 C CB  . LYS B 1 239 ? 29.991 -8.886  23.701 1.00 78.73  ? 239 LYS B CB  1 
ATOM   4342 C CG  . LYS B 1 239 ? 31.183 -8.058  23.221 1.00 81.92  ? 239 LYS B CG  1 
ATOM   4343 C CD  . LYS B 1 239 ? 31.202 -6.667  23.828 1.00 86.35  ? 239 LYS B CD  1 
ATOM   4344 C CE  . LYS B 1 239 ? 32.270 -5.786  23.181 1.00 88.24  ? 239 LYS B CE  1 
ATOM   4345 N NZ  . LYS B 1 239 ? 32.005 -5.514  21.732 1.00 89.03  ? 239 LYS B NZ  1 
ATOM   4346 N N   . ASP B 1 240 ? 27.662 -9.927  24.943 1.00 72.62  ? 240 ASP B N   1 
ATOM   4347 C CA  . ASP B 1 240 ? 26.428 -10.710 25.108 1.00 73.54  ? 240 ASP B CA  1 
ATOM   4348 C C   . ASP B 1 240 ? 26.529 -12.217 25.071 1.00 76.05  ? 240 ASP B C   1 
ATOM   4349 O O   . ASP B 1 240 ? 26.266 -12.883 26.068 1.00 76.59  ? 240 ASP B O   1 
ATOM   4350 C CB  . ASP B 1 240 ? 25.399 -10.312 24.055 1.00 75.32  ? 240 ASP B CB  1 
ATOM   4351 C CG  . ASP B 1 240 ? 24.752 -8.995  24.343 1.00 79.51  ? 240 ASP B CG  1 
ATOM   4352 O OD1 . ASP B 1 240 ? 25.374 -7.953  24.041 1.00 88.59  ? 240 ASP B OD1 1 
ATOM   4353 O OD2 . ASP B 1 240 ? 23.612 -9.012  24.850 1.00 75.84  ? 240 ASP B OD2 1 
ATOM   4354 N N   . ASN B 1 241 ? 26.841 -12.748 23.893 1.00 83.20  ? 241 ASN B N   1 
ATOM   4355 C CA  . ASN B 1 241 ? 26.939 -14.189 23.705 1.00 84.85  ? 241 ASN B CA  1 
ATOM   4356 C C   . ASN B 1 241 ? 28.034 -14.860 24.531 1.00 83.65  ? 241 ASN B C   1 
ATOM   4357 O O   . ASN B 1 241 ? 27.904 -16.031 24.887 1.00 85.95  ? 241 ASN B O   1 
ATOM   4358 C CB  . ASN B 1 241 ? 27.039 -14.537 22.213 1.00 86.48  ? 241 ASN B CB  1 
ATOM   4359 C CG  . ASN B 1 241 ? 25.703 -14.359 21.472 1.00 86.58  ? 241 ASN B CG  1 
ATOM   4360 O OD1 . ASN B 1 241 ? 24.643 -14.211 22.092 1.00 76.85  ? 241 ASN B OD1 1 
ATOM   4361 N ND2 . ASN B 1 241 ? 25.757 -14.381 20.141 1.00 79.77  ? 241 ASN B ND2 1 
ATOM   4362 N N   . ASP B 1 242 ? 29.098 -14.127 24.852 1.00 79.82  ? 242 ASP B N   1 
ATOM   4363 C CA  . ASP B 1 242 ? 30.161 -14.682 25.682 1.00 80.63  ? 242 ASP B CA  1 
ATOM   4364 C C   . ASP B 1 242 ? 29.519 -14.999 27.022 1.00 80.08  ? 242 ASP B C   1 
ATOM   4365 O O   . ASP B 1 242 ? 29.591 -16.121 27.512 1.00 80.16  ? 242 ASP B O   1 
ATOM   4366 C CB  . ASP B 1 242 ? 31.287 -13.663 25.891 1.00 87.06  ? 242 ASP B CB  1 
ATOM   4367 C CG  . ASP B 1 242 ? 32.153 -13.473 24.655 1.00 91.41  ? 242 ASP B CG  1 
ATOM   4368 O OD1 . ASP B 1 242 ? 33.121 -12.678 24.724 1.00 84.62  ? 242 ASP B OD1 1 
ATOM   4369 O OD2 . ASP B 1 242 ? 31.875 -14.123 23.622 1.00 93.43  ? 242 ASP B OD2 1 
ATOM   4370 N N   . PHE B 1 243 ? 28.835 -13.999 27.565 1.00 79.42  ? 243 PHE B N   1 
ATOM   4371 C CA  . PHE B 1 243 ? 28.134 -14.093 28.842 1.00 80.24  ? 243 PHE B CA  1 
ATOM   4372 C C   . PHE B 1 243 ? 26.989 -15.107 28.790 1.00 81.61  ? 243 PHE B C   1 
ATOM   4373 O O   . PHE B 1 243 ? 26.743 -15.837 29.750 1.00 82.97  ? 243 PHE B O   1 
ATOM   4374 C CB  . PHE B 1 243 ? 27.588 -12.705 29.194 1.00 72.99  ? 243 PHE B CB  1 
ATOM   4375 C CG  . PHE B 1 243 ? 26.645 -12.681 30.362 1.00 71.29  ? 243 PHE B CG  1 
ATOM   4376 C CD1 . PHE B 1 243 ? 27.102 -12.331 31.624 1.00 69.53  ? 243 PHE B CD1 1 
ATOM   4377 C CD2 . PHE B 1 243 ? 25.286 -12.952 30.187 1.00 70.25  ? 243 PHE B CD2 1 
ATOM   4378 C CE1 . PHE B 1 243 ? 26.218 -12.248 32.695 1.00 74.34  ? 243 PHE B CE1 1 
ATOM   4379 C CE2 . PHE B 1 243 ? 24.395 -12.871 31.251 1.00 69.93  ? 243 PHE B CE2 1 
ATOM   4380 C CZ  . PHE B 1 243 ? 24.859 -12.519 32.505 1.00 69.53  ? 243 PHE B CZ  1 
ATOM   4381 N N   . LEU B 1 244 ? 26.298 -15.153 27.659 1.00 79.66  ? 244 LEU B N   1 
ATOM   4382 C CA  . LEU B 1 244 ? 25.164 -16.046 27.501 1.00 80.68  ? 244 LEU B CA  1 
ATOM   4383 C C   . LEU B 1 244 ? 25.548 -17.525 27.514 1.00 82.44  ? 244 LEU B C   1 
ATOM   4384 O O   . LEU B 1 244 ? 24.900 -18.328 28.191 1.00 81.13  ? 244 LEU B O   1 
ATOM   4385 C CB  . LEU B 1 244 ? 24.390 -15.681 26.227 1.00 81.61  ? 244 LEU B CB  1 
ATOM   4386 C CG  . LEU B 1 244 ? 22.913 -16.090 26.123 1.00 86.51  ? 244 LEU B CG  1 
ATOM   4387 C CD1 . LEU B 1 244 ? 22.148 -15.713 27.387 1.00 86.80  ? 244 LEU B CD1 1 
ATOM   4388 C CD2 . LEU B 1 244 ? 22.288 -15.420 24.907 1.00 83.89  ? 244 LEU B CD2 1 
ATOM   4389 N N   . ASN B 1 245 ? 26.632 -17.873 26.821 1.00 83.57  ? 245 ASN B N   1 
ATOM   4390 C CA  . ASN B 1 245 ? 27.069 -19.267 26.751 1.00 85.68  ? 245 ASN B CA  1 
ATOM   4391 C C   . ASN B 1 245 ? 27.706 -19.768 28.034 1.00 84.46  ? 245 ASN B C   1 
ATOM   4392 O O   . ASN B 1 245 ? 27.680 -20.964 28.324 1.00 88.52  ? 245 ASN B O   1 
ATOM   4393 C CB  . ASN B 1 245 ? 28.001 -19.506 25.550 1.00 83.08  ? 245 ASN B CB  1 
ATOM   4394 C CG  . ASN B 1 245 ? 29.412 -18.948 25.751 1.00 83.86  ? 245 ASN B CG  1 
ATOM   4395 O OD1 . ASN B 1 245 ? 29.824 -18.598 26.859 1.00 80.42  ? 245 ASN B OD1 1 
ATOM   4396 N ND2 . ASN B 1 245 ? 30.171 -18.893 24.663 1.00 91.14  ? 245 ASN B ND2 1 
ATOM   4397 N N   . GLU B 1 246 ? 28.241 -18.838 28.817 1.00 84.24  ? 246 GLU B N   1 
ATOM   4398 C CA  . GLU B 1 246 ? 28.883 -19.174 30.077 1.00 82.58  ? 246 GLU B CA  1 
ATOM   4399 C C   . GLU B 1 246 ? 27.844 -19.572 31.129 1.00 79.39  ? 246 GLU B C   1 
ATOM   4400 O O   . GLU B 1 246 ? 28.186 -19.792 32.298 1.00 74.75  ? 246 GLU B O   1 
ATOM   4401 C CB  . GLU B 1 246 ? 29.715 -17.984 30.559 1.00 82.03  ? 246 GLU B CB  1 
ATOM   4402 C CG  . GLU B 1 246 ? 30.864 -17.609 29.618 1.00 86.40  ? 246 GLU B CG  1 
ATOM   4403 C CD  . GLU B 1 246 ? 31.545 -16.289 29.990 1.00 91.70  ? 246 GLU B CD  1 
ATOM   4404 O OE1 . GLU B 1 246 ? 31.791 -16.055 31.193 1.00 92.33  ? 246 GLU B OE1 1 
ATOM   4405 O OE2 . GLU B 1 246 ? 31.849 -15.487 29.077 1.00 92.26  ? 246 GLU B OE2 1 
ATOM   4406 N N   . GLY B 1 247 ? 26.582 -19.667 30.696 1.00 80.42  ? 247 GLY B N   1 
ATOM   4407 C CA  . GLY B 1 247 ? 25.480 -20.017 31.582 1.00 84.04  ? 247 GLY B CA  1 
ATOM   4408 C C   . GLY B 1 247 ? 25.542 -19.137 32.810 1.00 86.50  ? 247 GLY B C   1 
ATOM   4409 O O   . GLY B 1 247 ? 25.083 -19.509 33.893 1.00 86.05  ? 247 GLY B O   1 
ATOM   4410 N N   . GLN B 1 248 ? 26.127 -17.957 32.597 1.00 89.32  ? 248 GLN B N   1 
ATOM   4411 C CA  . GLN B 1 248 ? 26.372 -16.947 33.616 1.00 90.44  ? 248 GLN B CA  1 
ATOM   4412 C C   . GLN B 1 248 ? 25.535 -16.934 34.865 1.00 90.02  ? 248 GLN B C   1 
ATOM   4413 O O   . GLN B 1 248 ? 24.304 -16.843 34.847 1.00 90.54  ? 248 GLN B O   1 
ATOM   4414 C CB  . GLN B 1 248 ? 26.480 -15.557 33.001 1.00 88.20  ? 248 GLN B CB  1 
ATOM   4415 C CG  . GLN B 1 248 ? 27.869 -15.281 32.445 1.00 89.01  ? 248 GLN B CG  1 
ATOM   4416 C CD  . GLN B 1 248 ? 28.909 -15.098 33.530 1.00 91.88  ? 248 GLN B CD  1 
ATOM   4417 O OE1 . GLN B 1 248 ? 29.264 -13.976 33.870 1.00 92.18  ? 248 GLN B OE1 1 
ATOM   4418 N NE2 . GLN B 1 248 ? 29.400 -16.201 34.082 1.00 89.86  ? 248 GLN B NE2 1 
ATOM   4419 N N   . LYS B 1 249 ? 26.260 -17.043 35.963 1.00 89.35  ? 249 LYS B N   1 
ATOM   4420 C CA  . LYS B 1 249 ? 25.675 -17.085 37.274 1.00 88.13  ? 249 LYS B CA  1 
ATOM   4421 C C   . LYS B 1 249 ? 25.558 -15.649 37.753 1.00 85.49  ? 249 LYS B C   1 
ATOM   4422 O O   . LYS B 1 249 ? 26.538 -14.909 37.745 1.00 80.89  ? 249 LYS B O   1 
ATOM   4423 C CB  . LYS B 1 249 ? 26.588 -17.897 38.200 1.00 90.94  ? 249 LYS B CB  1 
ATOM   4424 C CG  . LYS B 1 249 ? 26.939 -19.312 37.697 1.00 90.86  ? 249 LYS B CG  1 
ATOM   4425 C CD  . LYS B 1 249 ? 28.440 -19.481 37.387 1.00 88.83  ? 249 LYS B CD  1 
ATOM   4426 C CE  . LYS B 1 249 ? 28.833 -18.894 36.025 1.00 87.75  ? 249 LYS B CE  1 
ATOM   4427 N NZ  . LYS B 1 249 ? 30.291 -19.014 35.699 1.00 83.98  ? 249 LYS B NZ  1 
ATOM   4428 N N   . LEU B 1 250 ? 24.341 -15.245 38.099 1.00 83.72  ? 250 LEU B N   1 
ATOM   4429 C CA  . LEU B 1 250 ? 24.076 -13.896 38.592 1.00 80.80  ? 250 LEU B CA  1 
ATOM   4430 C C   . LEU B 1 250 ? 22.897 -13.991 39.564 1.00 80.97  ? 250 LEU B C   1 
ATOM   4431 O O   . LEU B 1 250 ? 21.776 -13.565 39.266 1.00 75.79  ? 250 LEU B O   1 
ATOM   4432 C CB  . LEU B 1 250 ? 23.752 -12.956 37.426 1.00 74.00  ? 250 LEU B CB  1 
ATOM   4433 C CG  . LEU B 1 250 ? 24.477 -11.604 37.363 1.00 66.76  ? 250 LEU B CG  1 
ATOM   4434 C CD1 . LEU B 1 250 ? 24.149 -10.793 38.599 1.00 65.82  ? 250 LEU B CD1 1 
ATOM   4435 C CD2 . LEU B 1 250 ? 25.985 -11.787 37.206 1.00 54.10  ? 250 LEU B CD2 1 
ATOM   4436 N N   . HIS B 1 251 ? 23.173 -14.579 40.725 1.00 79.79  ? 251 HIS B N   1 
ATOM   4437 C CA  . HIS B 1 251 ? 22.167 -14.789 41.756 1.00 77.90  ? 251 HIS B CA  1 
ATOM   4438 C C   . HIS B 1 251 ? 22.128 -13.609 42.710 1.00 81.78  ? 251 HIS B C   1 
ATOM   4439 O O   . HIS B 1 251 ? 22.964 -13.487 43.611 1.00 80.16  ? 251 HIS B O   1 
ATOM   4440 C CB  . HIS B 1 251 ? 22.476 -16.069 42.532 1.00 78.97  ? 251 HIS B CB  1 
ATOM   4441 C CG  . HIS B 1 251 ? 23.305 -17.049 41.768 1.00 74.71  ? 251 HIS B CG  1 
ATOM   4442 N ND1 . HIS B 1 251 ? 24.682 -17.005 41.764 1.00 79.13  ? 251 HIS B ND1 1 
ATOM   4443 C CD2 . HIS B 1 251 ? 22.957 -18.071 40.952 1.00 75.29  ? 251 HIS B CD2 1 
ATOM   4444 C CE1 . HIS B 1 251 ? 25.149 -17.958 40.978 1.00 78.13  ? 251 HIS B CE1 1 
ATOM   4445 N NE2 . HIS B 1 251 ? 24.122 -18.618 40.472 1.00 79.08  ? 251 HIS B NE2 1 
ATOM   4446 N N   . VAL B 1 252 ? 21.148 -12.742 42.498 1.00 80.51  ? 252 VAL B N   1 
ATOM   4447 C CA  . VAL B 1 252 ? 20.965 -11.548 43.317 1.00 79.95  ? 252 VAL B CA  1 
ATOM   4448 C C   . VAL B 1 252 ? 19.973 -11.829 44.450 1.00 77.21  ? 252 VAL B C   1 
ATOM   4449 O O   . VAL B 1 252 ? 19.995 -11.179 45.500 1.00 69.52  ? 252 VAL B O   1 
ATOM   4450 C CB  . VAL B 1 252 ? 20.466 -10.373 42.423 1.00 80.03  ? 252 VAL B CB  1 
ATOM   4451 C CG1 . VAL B 1 252 ? 20.069 -9.180  43.259 1.00 78.50  ? 252 VAL B CG1 1 
ATOM   4452 C CG2 . VAL B 1 252 ? 21.556 -9.975  41.428 1.00 75.37  ? 252 VAL B CG2 1 
ATOM   4453 N N   . GLY B 1 253 ? 19.157 -12.858 44.247 1.00 77.99  ? 253 GLY B N   1 
ATOM   4454 C CA  . GLY B 1 253 ? 18.143 -13.230 45.213 1.00 78.88  ? 253 GLY B CA  1 
ATOM   4455 C C   . GLY B 1 253 ? 16.806 -13.062 44.521 1.00 81.71  ? 253 GLY B C   1 
ATOM   4456 O O   . GLY B 1 253 ? 16.743 -13.065 43.290 1.00 78.05  ? 253 GLY B O   1 
ATOM   4457 N N   . GLU B 1 254 ? 15.734 -12.936 45.293 1.00 86.04  ? 254 GLU B N   1 
ATOM   4458 C CA  . GLU B 1 254 ? 14.412 -12.748 44.699 1.00 85.84  ? 254 GLU B CA  1 
ATOM   4459 C C   . GLU B 1 254 ? 13.827 -11.453 45.234 1.00 87.25  ? 254 GLU B C   1 
ATOM   4460 O O   . GLU B 1 254 ? 12.805 -10.960 44.744 1.00 81.81  ? 254 GLU B O   1 
ATOM   4461 C CB  . GLU B 1 254 ? 13.503 -13.929 45.014 1.00 87.54  ? 254 GLU B CB  1 
ATOM   4462 C CG  . GLU B 1 254 ? 12.315 -14.039 44.072 1.00 85.82  ? 254 GLU B CG  1 
ATOM   4463 C CD  . GLU B 1 254 ? 11.466 -15.283 44.321 1.00 88.80  ? 254 GLU B CD  1 
ATOM   4464 O OE1 . GLU B 1 254 ? 11.811 -16.095 45.223 1.00 90.46  ? 254 GLU B OE1 1 
ATOM   4465 O OE2 . GLU B 1 254 ? 10.445 -15.446 43.607 1.00 90.42  ? 254 GLU B OE2 1 
ATOM   4466 N N   . GLU B 1 255 ? 14.553 -10.894 46.202 1.00 87.42  ? 255 GLU B N   1 
ATOM   4467 C CA  . GLU B 1 255 ? 14.232 -9.641  46.872 1.00 85.74  ? 255 GLU B CA  1 
ATOM   4468 C C   . GLU B 1 255 ? 14.920 -8.485  46.131 1.00 82.51  ? 255 GLU B C   1 
ATOM   4469 O O   . GLU B 1 255 ? 14.291 -7.473  45.813 1.00 76.29  ? 255 GLU B O   1 
ATOM   4470 C CB  . GLU B 1 255 ? 14.746 -9.712  48.321 1.00 89.21  ? 255 GLU B CB  1 
ATOM   4471 C CG  . GLU B 1 255 ? 14.711 -8.400  49.121 1.00 90.18  ? 255 GLU B CG  1 
ATOM   4472 C CD  . GLU B 1 255 ? 13.342 -8.073  49.691 1.00 89.32  ? 255 GLU B CD  1 
ATOM   4473 O OE1 . GLU B 1 255 ? 12.793 -8.908  50.448 1.00 85.69  ? 255 GLU B OE1 1 
ATOM   4474 O OE2 . GLU B 1 255 ? 12.829 -6.972  49.391 1.00 91.26  ? 255 GLU B OE2 1 
ATOM   4475 N N   . SER B 1 256 ? 16.204 -8.670  45.830 1.00 74.84  ? 256 SER B N   1 
ATOM   4476 C CA  . SER B 1 256 ? 16.998 -7.651  45.151 1.00 74.83  ? 256 SER B CA  1 
ATOM   4477 C C   . SER B 1 256 ? 16.887 -7.693  43.629 1.00 65.97  ? 256 SER B C   1 
ATOM   4478 O O   . SER B 1 256 ? 16.975 -6.664  42.966 1.00 64.12  ? 256 SER B O   1 
ATOM   4479 C CB  . SER B 1 256 ? 18.460 -7.751  45.587 1.00 80.04  ? 256 SER B CB  1 
ATOM   4480 O OG  . SER B 1 256 ? 19.216 -6.652  45.103 1.00 86.46  ? 256 SER B OG  1 
ATOM   4481 N N   . LYS B 1 257 ? 16.733 -8.890  43.078 1.00 65.89  ? 257 LYS B N   1 
ATOM   4482 C CA  . LYS B 1 257 ? 16.574 -9.054  41.633 1.00 62.56  ? 257 LYS B CA  1 
ATOM   4483 C C   . LYS B 1 257 ? 15.317 -8.301  41.186 1.00 64.16  ? 257 LYS B C   1 
ATOM   4484 O O   . LYS B 1 257 ? 15.277 -7.742  40.093 1.00 66.17  ? 257 LYS B O   1 
ATOM   4485 C CB  . LYS B 1 257 ? 16.440 -10.542 41.284 1.00 58.14  ? 257 LYS B CB  1 
ATOM   4486 C CG  . LYS B 1 257 ? 15.998 -10.844 39.870 1.00 52.10  ? 257 LYS B CG  1 
ATOM   4487 C CD  . LYS B 1 257 ? 15.813 -12.339 39.685 1.00 51.44  ? 257 LYS B CD  1 
ATOM   4488 C CE  . LYS B 1 257 ? 15.312 -12.676 38.291 1.00 51.46  ? 257 LYS B CE  1 
ATOM   4489 N NZ  . LYS B 1 257 ? 15.119 -14.145 38.120 1.00 49.27  ? 257 LYS B NZ  1 
ATOM   4490 N N   . LYS B 1 258 ? 14.308 -8.274  42.053 1.00 63.11  ? 258 LYS B N   1 
ATOM   4491 C CA  . LYS B 1 258 ? 13.053 -7.599  41.759 1.00 62.79  ? 258 LYS B CA  1 
ATOM   4492 C C   . LYS B 1 258 ? 13.272 -6.103  41.685 1.00 64.33  ? 258 LYS B C   1 
ATOM   4493 O O   . LYS B 1 258 ? 12.935 -5.459  40.688 1.00 69.55  ? 258 LYS B O   1 
ATOM   4494 C CB  . LYS B 1 258 ? 12.026 -7.888  42.850 1.00 65.06  ? 258 LYS B CB  1 
ATOM   4495 C CG  . LYS B 1 258 ? 10.652 -7.293  42.571 1.00 61.05  ? 258 LYS B CG  1 
ATOM   4496 C CD  . LYS B 1 258 ? 9.728  -7.417  43.769 1.00 62.31  ? 258 LYS B CD  1 
ATOM   4497 C CE  . LYS B 1 258 ? 8.355  -6.837  43.465 1.00 62.47  ? 258 LYS B CE  1 
ATOM   4498 N NZ  . LYS B 1 258 ? 7.437  -6.926  44.633 1.00 63.59  ? 258 LYS B NZ  1 
ATOM   4499 N N   . ASN B 1 259 ? 13.845 -5.563  42.755 1.00 62.24  ? 259 ASN B N   1 
ATOM   4500 C CA  . ASN B 1 259 ? 14.119 -4.132  42.862 1.00 61.58  ? 259 ASN B CA  1 
ATOM   4501 C C   . ASN B 1 259 ? 15.054 -3.626  41.752 1.00 56.58  ? 259 ASN B C   1 
ATOM   4502 O O   . ASN B 1 259 ? 14.922 -2.496  41.283 1.00 48.10  ? 259 ASN B O   1 
ATOM   4503 C CB  . ASN B 1 259 ? 14.702 -3.821  44.248 1.00 63.69  ? 259 ASN B CB  1 
ATOM   4504 C CG  . ASN B 1 259 ? 13.882 -4.434  45.379 1.00 62.79  ? 259 ASN B CG  1 
ATOM   4505 O OD1 . ASN B 1 259 ? 14.435 -4.963  46.346 1.00 59.35  ? 259 ASN B OD1 1 
ATOM   4506 N ND2 . ASN B 1 259 ? 12.560 -4.378  45.252 1.00 61.49  ? 259 ASN B ND2 1 
ATOM   4507 N N   . PHE B 1 260 ? 15.988 -4.474  41.333 1.00 53.78  ? 260 PHE B N   1 
ATOM   4508 C CA  . PHE B 1 260 ? 16.923 -4.119  40.277 1.00 46.87  ? 260 PHE B CA  1 
ATOM   4509 C C   . PHE B 1 260 ? 16.180 -4.045  38.956 1.00 45.01  ? 260 PHE B C   1 
ATOM   4510 O O   . PHE B 1 260 ? 16.178 -3.006  38.310 1.00 47.48  ? 260 PHE B O   1 
ATOM   4511 C CB  . PHE B 1 260 ? 18.062 -5.141  40.204 1.00 37.89  ? 260 PHE B CB  1 
ATOM   4512 C CG  . PHE B 1 260 ? 18.864 -5.080  38.936 1.00 39.01  ? 260 PHE B CG  1 
ATOM   4513 C CD1 . PHE B 1 260 ? 19.965 -4.253  38.834 1.00 45.67  ? 260 PHE B CD1 1 
ATOM   4514 C CD2 . PHE B 1 260 ? 18.547 -5.890  37.857 1.00 43.09  ? 260 PHE B CD2 1 
ATOM   4515 C CE1 . PHE B 1 260 ? 20.747 -4.237  37.672 1.00 50.96  ? 260 PHE B CE1 1 
ATOM   4516 C CE2 . PHE B 1 260 ? 19.320 -5.884  36.692 1.00 47.87  ? 260 PHE B CE2 1 
ATOM   4517 C CZ  . PHE B 1 260 ? 20.421 -5.057  36.601 1.00 45.33  ? 260 PHE B CZ  1 
ATOM   4518 N N   . LEU B 1 261 ? 15.519 -5.137  38.578 1.00 50.88  ? 261 LEU B N   1 
ATOM   4519 C CA  . LEU B 1 261 ? 14.774 -5.203  37.312 1.00 55.71  ? 261 LEU B CA  1 
ATOM   4520 C C   . LEU B 1 261 ? 13.673 -4.152  37.172 1.00 54.75  ? 261 LEU B C   1 
ATOM   4521 O O   . LEU B 1 261 ? 13.333 -3.754  36.050 1.00 54.28  ? 261 LEU B O   1 
ATOM   4522 C CB  . LEU B 1 261 ? 14.201 -6.609  37.068 1.00 51.77  ? 261 LEU B CB  1 
ATOM   4523 C CG  . LEU B 1 261 ? 15.151 -7.672  36.525 1.00 42.11  ? 261 LEU B CG  1 
ATOM   4524 C CD1 . LEU B 1 261 ? 14.434 -9.007  36.443 1.00 40.26  ? 261 LEU B CD1 1 
ATOM   4525 C CD2 . LEU B 1 261 ? 15.648 -7.249  35.155 1.00 40.32  ? 261 LEU B CD2 1 
ATOM   4526 N N   . GLU B 1 262 ? 13.110 -3.721  38.299 1.00 51.81  ? 262 GLU B N   1 
ATOM   4527 C CA  . GLU B 1 262 ? 12.078 -2.696  38.269 1.00 55.22  ? 262 GLU B CA  1 
ATOM   4528 C C   . GLU B 1 262 ? 12.699 -1.336  37.950 1.00 58.57  ? 262 GLU B C   1 
ATOM   4529 O O   . GLU B 1 262 ? 12.034 -0.473  37.379 1.00 60.80  ? 262 GLU B O   1 
ATOM   4530 C CB  . GLU B 1 262 ? 11.341 -2.623  39.590 1.00 57.64  ? 262 GLU B CB  1 
ATOM   4531 C CG  . GLU B 1 262 ? 10.425 -3.787  39.854 1.00 73.05  ? 262 GLU B CG  1 
ATOM   4532 C CD  . GLU B 1 262 ? 9.581  -3.543  41.082 1.00 79.88  ? 262 GLU B CD  1 
ATOM   4533 O OE1 . GLU B 1 262 ? 8.641  -2.722  40.994 1.00 87.15  ? 262 GLU B OE1 1 
ATOM   4534 O OE2 . GLU B 1 262 ? 9.880  -4.138  42.140 1.00 84.67  ? 262 GLU B OE2 1 
ATOM   4535 N N   . LYS B 1 263 ? 13.958 -1.117  38.337 1.00 60.46  ? 263 LYS B N   1 
ATOM   4536 C CA  . LYS B 1 263 ? 14.611 0.151   38.005 1.00 48.36  ? 263 LYS B CA  1 
ATOM   4537 C C   . LYS B 1 263 ? 14.699 0.093   36.498 1.00 45.95  ? 263 LYS B C   1 
ATOM   4538 O O   . LYS B 1 263 ? 14.049 0.864   35.795 1.00 42.29  ? 263 LYS B O   1 
ATOM   4539 C CB  . LYS B 1 263 ? 16.046 0.228   38.542 1.00 48.56  ? 263 LYS B CB  1 
ATOM   4540 C CG  . LYS B 1 263 ? 16.199 0.414   40.038 1.00 48.80  ? 263 LYS B CG  1 
ATOM   4541 C CD  . LYS B 1 263 ? 17.676 0.475   40.420 1.00 47.31  ? 263 LYS B CD  1 
ATOM   4542 C CE  . LYS B 1 263 ? 17.843 0.501   41.924 1.00 51.42  ? 263 LYS B CE  1 
ATOM   4543 N NZ  . LYS B 1 263 ? 19.263 0.611   42.336 1.00 52.28  ? 263 LYS B NZ  1 
ATOM   4544 N N   . LEU B 1 264 ? 15.372 -0.960  36.035 1.00 42.53  ? 264 LEU B N   1 
ATOM   4545 C CA  . LEU B 1 264 ? 15.615 -1.190  34.624 1.00 46.25  ? 264 LEU B CA  1 
ATOM   4546 C C   . LEU B 1 264 ? 14.411 -0.873  33.749 1.00 52.09  ? 264 LEU B C   1 
ATOM   4547 O O   . LEU B 1 264 ? 14.537 -0.187  32.729 1.00 54.71  ? 264 LEU B O   1 
ATOM   4548 C CB  . LEU B 1 264 ? 16.047 -2.633  34.390 1.00 45.00  ? 264 LEU B CB  1 
ATOM   4549 C CG  . LEU B 1 264 ? 16.367 -2.938  32.927 1.00 50.23  ? 264 LEU B CG  1 
ATOM   4550 C CD1 . LEU B 1 264 ? 17.608 -2.168  32.516 1.00 46.76  ? 264 LEU B CD1 1 
ATOM   4551 C CD2 . LEU B 1 264 ? 16.569 -4.425  32.724 1.00 56.00  ? 264 LEU B CD2 1 
ATOM   4552 N N   . LYS B 1 265 ? 13.245 -1.355  34.166 1.00 53.45  ? 265 LYS B N   1 
ATOM   4553 C CA  . LYS B 1 265 ? 12.011 -1.138  33.419 1.00 54.72  ? 265 LYS B CA  1 
ATOM   4554 C C   . LYS B 1 265 ? 11.744 0.327   33.140 1.00 54.51  ? 265 LYS B C   1 
ATOM   4555 O O   . LYS B 1 265 ? 11.423 0.683   32.009 1.00 61.60  ? 265 LYS B O   1 
ATOM   4556 C CB  . LYS B 1 265 ? 10.816 -1.733  34.164 1.00 60.20  ? 265 LYS B CB  1 
ATOM   4557 C CG  . LYS B 1 265 ? 9.478  -1.485  33.488 1.00 65.92  ? 265 LYS B CG  1 
ATOM   4558 C CD  . LYS B 1 265 ? 8.327  -1.824  34.417 1.00 75.71  ? 265 LYS B CD  1 
ATOM   4559 C CE  . LYS B 1 265 ? 6.980  -1.525  33.766 1.00 84.97  ? 265 LYS B CE  1 
ATOM   4560 N NZ  . LYS B 1 265 ? 5.823  -1.820  34.674 1.00 86.08  ? 265 LYS B NZ  1 
ATOM   4561 N N   . ARG B 1 266 ? 11.895 1.171   34.161 1.00 49.66  ? 266 ARG B N   1 
ATOM   4562 C CA  . ARG B 1 266 ? 11.635 2.602   34.014 1.00 55.41  ? 266 ARG B CA  1 
ATOM   4563 C C   . ARG B 1 266 ? 12.736 3.408   33.328 1.00 50.52  ? 266 ARG B C   1 
ATOM   4564 O O   . ARG B 1 266 ? 12.490 4.508   32.827 1.00 49.69  ? 266 ARG B O   1 
ATOM   4565 C CB  . ARG B 1 266 ? 11.301 3.239   35.364 1.00 60.08  ? 266 ARG B CB  1 
ATOM   4566 C CG  . ARG B 1 266 ? 12.460 3.275   36.344 1.00 70.94  ? 266 ARG B CG  1 
ATOM   4567 C CD  . ARG B 1 266 ? 12.344 4.468   37.273 1.00 74.06  ? 266 ARG B CD  1 
ATOM   4568 N NE  . ARG B 1 266 ? 12.382 4.069   38.674 1.00 83.77  ? 266 ARG B NE  1 
ATOM   4569 C CZ  . ARG B 1 266 ? 11.786 4.743   39.653 1.00 87.25  ? 266 ARG B CZ  1 
ATOM   4570 N NH1 . ARG B 1 266 ? 11.107 5.850   39.377 1.00 90.44  ? 266 ARG B NH1 1 
ATOM   4571 N NH2 . ARG B 1 266 ? 11.856 4.301   40.902 1.00 88.28  ? 266 ARG B NH2 1 
ATOM   4572 N N   . ASP B 1 267 ? 13.952 2.884   33.332 1.00 46.52  ? 267 ASP B N   1 
ATOM   4573 C CA  . ASP B 1 267 ? 15.055 3.580   32.700 1.00 47.81  ? 267 ASP B CA  1 
ATOM   4574 C C   . ASP B 1 267 ? 14.944 3.419   31.203 1.00 51.53  ? 267 ASP B C   1 
ATOM   4575 O O   . ASP B 1 267 ? 14.815 4.390   30.470 1.00 55.16  ? 267 ASP B O   1 
ATOM   4576 C CB  . ASP B 1 267 ? 16.394 3.000   33.140 1.00 49.46  ? 267 ASP B CB  1 
ATOM   4577 C CG  . ASP B 1 267 ? 16.653 3.171   34.606 1.00 51.44  ? 267 ASP B CG  1 
ATOM   4578 O OD1 . ASP B 1 267 ? 16.051 4.076   35.242 1.00 55.71  ? 267 ASP B OD1 1 
ATOM   4579 O OD2 . ASP B 1 267 ? 17.480 2.386   35.115 1.00 54.68  ? 267 ASP B OD2 1 
ATOM   4580 N N   . VAL B 1 268 ? 15.005 2.170   30.761 1.00 56.96  ? 268 VAL B N   1 
ATOM   4581 C CA  . VAL B 1 268 ? 14.931 1.839   29.348 1.00 56.89  ? 268 VAL B CA  1 
ATOM   4582 C C   . VAL B 1 268 ? 13.648 2.417   28.746 1.00 58.34  ? 268 VAL B C   1 
ATOM   4583 O O   . VAL B 1 268 ? 13.583 2.721   27.558 1.00 59.70  ? 268 VAL B O   1 
ATOM   4584 C CB  . VAL B 1 268 ? 14.984 0.313   29.160 1.00 63.40  ? 268 VAL B CB  1 
ATOM   4585 C CG1 . VAL B 1 268 ? 15.154 -0.013  27.728 1.00 62.88  ? 268 VAL B CG1 1 
ATOM   4586 C CG2 . VAL B 1 268 ? 16.141 -0.289  29.956 1.00 61.44  ? 268 VAL B CG2 1 
ATOM   4587 N N   . GLU B 1 269 ? 12.649 2.608   29.596 1.00 55.11  ? 269 GLU B N   1 
ATOM   4588 C CA  . GLU B 1 269 ? 11.374 3.171   29.192 1.00 61.16  ? 269 GLU B CA  1 
ATOM   4589 C C   . GLU B 1 269 ? 11.551 4.685   29.016 1.00 63.15  ? 269 GLU B C   1 
ATOM   4590 O O   . GLU B 1 269 ? 10.969 5.290   28.112 1.00 64.04  ? 269 GLU B O   1 
ATOM   4591 C CB  . GLU B 1 269 ? 10.348 2.872   30.279 1.00 66.66  ? 269 GLU B CB  1 
ATOM   4592 C CG  . GLU B 1 269 ? 8.896  3.008   29.880 1.00 76.49  ? 269 GLU B CG  1 
ATOM   4593 C CD  . GLU B 1 269 ? 7.972  2.657   31.028 1.00 79.53  ? 269 GLU B CD  1 
ATOM   4594 O OE1 . GLU B 1 269 ? 7.585  3.587   31.774 1.00 81.28  ? 269 GLU B OE1 1 
ATOM   4595 O OE2 . GLU B 1 269 ? 7.655  1.454   31.196 1.00 81.57  ? 269 GLU B OE2 1 
ATOM   4596 N N   . PHE B 1 270 ? 12.333 5.294   29.908 1.00 62.08  ? 270 PHE B N   1 
ATOM   4597 C CA  . PHE B 1 270 ? 12.616 6.731   29.855 1.00 57.82  ? 270 PHE B CA  1 
ATOM   4598 C C   . PHE B 1 270 ? 13.402 7.002   28.583 1.00 58.39  ? 270 PHE B C   1 
ATOM   4599 O O   . PHE B 1 270 ? 13.058 7.896   27.812 1.00 57.76  ? 270 PHE B O   1 
ATOM   4600 C CB  . PHE B 1 270 ? 13.436 7.158   31.085 1.00 60.63  ? 270 PHE B CB  1 
ATOM   4601 C CG  . PHE B 1 270 ? 14.192 8.457   30.911 1.00 59.42  ? 270 PHE B CG  1 
ATOM   4602 C CD1 . PHE B 1 270 ? 13.592 9.675   31.209 1.00 59.62  ? 270 PHE B CD1 1 
ATOM   4603 C CD2 . PHE B 1 270 ? 15.507 8.457   30.453 1.00 55.85  ? 270 PHE B CD2 1 
ATOM   4604 C CE1 . PHE B 1 270 ? 14.290 10.874  31.054 1.00 57.24  ? 270 PHE B CE1 1 
ATOM   4605 C CE2 . PHE B 1 270 ? 16.207 9.646   30.294 1.00 52.30  ? 270 PHE B CE2 1 
ATOM   4606 C CZ  . PHE B 1 270 ? 15.596 10.856  30.596 1.00 55.10  ? 270 PHE B CZ  1 
ATOM   4607 N N   . LEU B 1 271 ? 14.459 6.220   28.372 1.00 56.22  ? 271 LEU B N   1 
ATOM   4608 C CA  . LEU B 1 271 ? 15.300 6.360   27.190 1.00 59.04  ? 271 LEU B CA  1 
ATOM   4609 C C   . LEU B 1 271 ? 14.438 6.194   25.946 1.00 63.52  ? 271 LEU B C   1 
ATOM   4610 O O   . LEU B 1 271 ? 14.634 6.887   24.948 1.00 64.03  ? 271 LEU B O   1 
ATOM   4611 C CB  . LEU B 1 271 ? 16.415 5.309   27.192 1.00 52.05  ? 271 LEU B CB  1 
ATOM   4612 C CG  . LEU B 1 271 ? 17.376 5.267   28.379 1.00 46.44  ? 271 LEU B CG  1 
ATOM   4613 C CD1 . LEU B 1 271 ? 18.367 4.154   28.171 1.00 42.33  ? 271 LEU B CD1 1 
ATOM   4614 C CD2 . LEU B 1 271 ? 18.098 6.589   28.526 1.00 48.67  ? 271 LEU B CD2 1 
ATOM   4615 N N   . ALA B 1 272 ? 13.469 5.282   26.023 1.00 65.53  ? 272 ALA B N   1 
ATOM   4616 C CA  . ALA B 1 272 ? 12.568 5.028   24.905 1.00 70.26  ? 272 ALA B CA  1 
ATOM   4617 C C   . ALA B 1 272 ? 11.750 6.273   24.634 1.00 71.51  ? 272 ALA B C   1 
ATOM   4618 O O   . ALA B 1 272 ? 11.556 6.654   23.482 1.00 76.10  ? 272 ALA B O   1 
ATOM   4619 C CB  . ALA B 1 272 ? 11.658 3.861   25.213 1.00 74.22  ? 272 ALA B CB  1 
ATOM   4620 N N   . GLN B 1 273 ? 11.319 6.931   25.708 1.00 71.94  ? 273 GLN B N   1 
ATOM   4621 C CA  . GLN B 1 273 ? 10.535 8.156   25.608 1.00 72.49  ? 273 GLN B CA  1 
ATOM   4622 C C   . GLN B 1 273 ? 11.294 9.174   24.765 1.00 70.59  ? 273 GLN B C   1 
ATOM   4623 O O   . GLN B 1 273 ? 10.692 10.057  24.158 1.00 70.88  ? 273 GLN B O   1 
ATOM   4624 C CB  . GLN B 1 273 ? 10.266 8.725   27.011 1.00 76.72  ? 273 GLN B CB  1 
ATOM   4625 C CG  . GLN B 1 273 ? 9.558  10.089  27.055 1.00 75.60  ? 273 GLN B CG  1 
ATOM   4626 C CD  . GLN B 1 273 ? 10.475 11.249  27.457 1.00 78.87  ? 273 GLN B CD  1 
ATOM   4627 O OE1 . GLN B 1 273 ? 11.310 11.127  28.360 1.00 72.58  ? 273 GLN B OE1 1 
ATOM   4628 N NE2 . GLN B 1 273 ? 10.302 12.386  26.796 1.00 71.16  ? 273 GLN B NE2 1 
ATOM   4629 N N   . LEU B 1 274 ? 12.616 9.021   24.712 1.00 69.11  ? 274 LEU B N   1 
ATOM   4630 C CA  . LEU B 1 274 ? 13.467 9.925   23.951 1.00 72.11  ? 274 LEU B CA  1 
ATOM   4631 C C   . LEU B 1 274 ? 14.552 9.196   23.165 1.00 74.72  ? 274 LEU B C   1 
ATOM   4632 O O   . LEU B 1 274 ? 15.650 8.998   23.674 1.00 77.98  ? 274 LEU B O   1 
ATOM   4633 C CB  . LEU B 1 274 ? 14.083 10.990  24.885 1.00 62.49  ? 274 LEU B CB  1 
ATOM   4634 C CG  . LEU B 1 274 ? 14.442 10.687  26.353 1.00 56.94  ? 274 LEU B CG  1 
ATOM   4635 C CD1 . LEU B 1 274 ? 15.773 9.978   26.479 1.00 48.86  ? 274 LEU B CD1 1 
ATOM   4636 C CD2 . LEU B 1 274 ? 14.503 11.979  27.124 1.00 49.37  ? 274 LEU B CD2 1 
ATOM   4637 N N   . LYS B 1 275 ? 14.225 8.797   21.935 1.00 74.40  ? 275 LYS B N   1 
ATOM   4638 C CA  . LYS B 1 275 ? 15.138 8.086   21.017 1.00 78.87  ? 275 LYS B CA  1 
ATOM   4639 C C   . LYS B 1 275 ? 16.590 7.898   21.472 1.00 75.54  ? 275 LYS B C   1 
ATOM   4640 O O   . LYS B 1 275 ? 17.474 8.647   21.045 1.00 78.79  ? 275 LYS B O   1 
ATOM   4641 C CB  . LYS B 1 275 ? 15.151 8.801   19.653 1.00 89.08  ? 275 LYS B CB  1 
ATOM   4642 C CG  . LYS B 1 275 ? 16.177 8.257   18.639 1.00 91.26  ? 275 LYS B CG  1 
ATOM   4643 C CD  . LYS B 1 275 ? 16.643 9.334   17.665 1.00 88.13  ? 275 LYS B CD  1 
ATOM   4644 C CE  . LYS B 1 275 ? 17.785 8.806   16.813 1.00 90.06  ? 275 LYS B CE  1 
ATOM   4645 N NZ  . LYS B 1 275 ? 18.265 9.791   15.807 1.00 86.79  ? 275 LYS B NZ  1 
ATOM   4646 N N   . ILE B 1 276 ? 16.856 6.918   22.330 1.00 72.18  ? 276 ILE B N   1 
ATOM   4647 C CA  . ILE B 1 276 ? 18.233 6.734   22.758 1.00 73.97  ? 276 ILE B CA  1 
ATOM   4648 C C   . ILE B 1 276 ? 18.992 5.661   22.004 1.00 77.98  ? 276 ILE B C   1 
ATOM   4649 O O   . ILE B 1 276 ? 18.619 4.484   21.980 1.00 71.03  ? 276 ILE B O   1 
ATOM   4650 C CB  . ILE B 1 276 ? 18.397 6.616   24.289 1.00 76.27  ? 276 ILE B CB  1 
ATOM   4651 C CG1 . ILE B 1 276 ? 18.264 8.001   24.927 1.00 65.87  ? 276 ILE B CG1 1 
ATOM   4652 C CG2 . ILE B 1 276 ? 19.783 6.083   24.641 1.00 79.74  ? 276 ILE B CG2 1 
ATOM   4653 C CD1 . ILE B 1 276 ? 19.240 9.032   24.366 1.00 54.01  ? 276 ILE B CD1 1 
ATOM   4654 N N   . MET B 1 277 ? 20.077 6.133   21.396 1.00 82.26  ? 277 MET B N   1 
ATOM   4655 C CA  . MET B 1 277 ? 20.992 5.361   20.570 1.00 83.81  ? 277 MET B CA  1 
ATOM   4656 C C   . MET B 1 277 ? 21.824 4.284   21.260 1.00 83.20  ? 277 MET B C   1 
ATOM   4657 O O   . MET B 1 277 ? 22.590 4.566   22.183 1.00 81.54  ? 277 MET B O   1 
ATOM   4658 C CB  . MET B 1 277 ? 21.913 6.335   19.820 1.00 87.76  ? 277 MET B CB  1 
ATOM   4659 C CG  . MET B 1 277 ? 21.181 7.179   18.771 1.00 86.87  ? 277 MET B CG  1 
ATOM   4660 S SD  . MET B 1 277 ? 21.587 8.941   18.762 1.00 90.98  ? 277 MET B SD  1 
ATOM   4661 C CE  . MET B 1 277 ? 20.030 9.658   19.325 1.00 80.98  ? 277 MET B CE  1 
ATOM   4662 N N   . ASP B 1 278 ? 21.650 3.056   20.773 1.00 80.62  ? 278 ASP B N   1 
ATOM   4663 C CA  . ASP B 1 278 ? 22.350 1.844   21.218 1.00 77.55  ? 278 ASP B CA  1 
ATOM   4664 C C   . ASP B 1 278 ? 23.154 1.908   22.532 1.00 73.49  ? 278 ASP B C   1 
ATOM   4665 O O   . ASP B 1 278 ? 24.361 2.156   22.504 1.00 77.85  ? 278 ASP B O   1 
ATOM   4666 C CB  . ASP B 1 278 ? 23.280 1.345   20.090 1.00 85.87  ? 278 ASP B CB  1 
ATOM   4667 C CG  . ASP B 1 278 ? 22.548 1.097   18.754 1.00 89.68  ? 278 ASP B CG  1 
ATOM   4668 O OD1 . ASP B 1 278 ? 21.922 2.038   18.210 1.00 84.85  ? 278 ASP B OD1 1 
ATOM   4669 O OD2 . ASP B 1 278 ? 22.643 -0.039  18.227 1.00 80.81  ? 278 ASP B OD2 1 
ATOM   4670 N N   . TYR B 1 279 ? 22.486 1.678   23.664 1.00 65.55  ? 279 TYR B N   1 
ATOM   4671 C CA  . TYR B 1 279 ? 23.115 1.681   24.995 1.00 60.49  ? 279 TYR B CA  1 
ATOM   4672 C C   . TYR B 1 279 ? 23.218 0.242   25.483 1.00 58.61  ? 279 TYR B C   1 
ATOM   4673 O O   . TYR B 1 279 ? 22.415 -0.604  25.096 1.00 59.21  ? 279 TYR B O   1 
ATOM   4674 C CB  . TYR B 1 279 ? 22.262 2.475   25.989 1.00 49.86  ? 279 TYR B CB  1 
ATOM   4675 C CG  . TYR B 1 279 ? 20.819 2.037   25.998 1.00 44.10  ? 279 TYR B CG  1 
ATOM   4676 C CD1 . TYR B 1 279 ? 20.415 0.887   26.672 1.00 45.22  ? 279 TYR B CD1 1 
ATOM   4677 C CD2 . TYR B 1 279 ? 19.870 2.730   25.268 1.00 50.92  ? 279 TYR B CD2 1 
ATOM   4678 C CE1 . TYR B 1 279 ? 19.099 0.434   26.608 1.00 44.92  ? 279 TYR B CE1 1 
ATOM   4679 C CE2 . TYR B 1 279 ? 18.557 2.292   25.197 1.00 53.68  ? 279 TYR B CE2 1 
ATOM   4680 C CZ  . TYR B 1 279 ? 18.182 1.142   25.865 1.00 49.80  ? 279 TYR B CZ  1 
ATOM   4681 O OH  . TYR B 1 279 ? 16.895 0.700   25.752 1.00 50.61  ? 279 TYR B OH  1 
ATOM   4682 N N   . SER B 1 280 ? 24.175 -0.030  26.360 1.00 55.23  ? 280 SER B N   1 
ATOM   4683 C CA  . SER B 1 280 ? 24.339 -1.380  26.885 1.00 57.59  ? 280 SER B CA  1 
ATOM   4684 C C   . SER B 1 280 ? 24.359 -1.392  28.408 1.00 55.41  ? 280 SER B C   1 
ATOM   4685 O O   . SER B 1 280 ? 24.254 -0.343  29.036 1.00 55.64  ? 280 SER B O   1 
ATOM   4686 C CB  . SER B 1 280 ? 25.622 -2.011  26.328 1.00 61.97  ? 280 SER B CB  1 
ATOM   4687 O OG  . SER B 1 280 ? 26.701 -1.090  26.320 1.00 58.49  ? 280 SER B OG  1 
ATOM   4688 N N   . LEU B 1 281 ? 24.422 -2.586  28.992 1.00 47.99  ? 281 LEU B N   1 
ATOM   4689 C CA  . LEU B 1 281 ? 24.481 -2.735  30.440 1.00 44.34  ? 281 LEU B CA  1 
ATOM   4690 C C   . LEU B 1 281 ? 25.881 -3.211  30.780 1.00 44.89  ? 281 LEU B C   1 
ATOM   4691 O O   . LEU B 1 281 ? 26.351 -4.221  30.248 1.00 41.06  ? 281 LEU B O   1 
ATOM   4692 C CB  . LEU B 1 281 ? 23.472 -3.762  30.936 1.00 48.87  ? 281 LEU B CB  1 
ATOM   4693 C CG  . LEU B 1 281 ? 23.518 -4.028  32.447 1.00 46.21  ? 281 LEU B CG  1 
ATOM   4694 C CD1 . LEU B 1 281 ? 22.374 -3.287  33.118 1.00 39.08  ? 281 LEU B CD1 1 
ATOM   4695 C CD2 . LEU B 1 281 ? 23.398 -5.532  32.735 1.00 48.44  ? 281 LEU B CD2 1 
ATOM   4696 N N   . LEU B 1 282 ? 26.557 -2.454  31.637 1.00 48.50  ? 282 LEU B N   1 
ATOM   4697 C CA  . LEU B 1 282 ? 27.916 -2.781  32.045 1.00 44.05  ? 282 LEU B CA  1 
ATOM   4698 C C   . LEU B 1 282 ? 27.812 -3.770  33.195 1.00 47.87  ? 282 LEU B C   1 
ATOM   4699 O O   . LEU B 1 282 ? 26.990 -3.594  34.108 1.00 50.97  ? 282 LEU B O   1 
ATOM   4700 C CB  . LEU B 1 282 ? 28.646 -1.520  32.501 1.00 39.19  ? 282 LEU B CB  1 
ATOM   4701 C CG  . LEU B 1 282 ? 30.090 -1.299  32.067 1.00 37.85  ? 282 LEU B CG  1 
ATOM   4702 C CD1 . LEU B 1 282 ? 30.758 -0.438  33.107 1.00 29.43  ? 282 LEU B CD1 1 
ATOM   4703 C CD2 . LEU B 1 282 ? 30.828 -2.608  31.965 1.00 40.95  ? 282 LEU B CD2 1 
ATOM   4704 N N   . VAL B 1 283 ? 28.627 -4.820  33.133 1.00 43.15  ? 283 VAL B N   1 
ATOM   4705 C CA  . VAL B 1 283 ? 28.625 -5.855  34.158 1.00 37.91  ? 283 VAL B CA  1 
ATOM   4706 C C   . VAL B 1 283 ? 30.024 -6.140  34.681 1.00 39.52  ? 283 VAL B C   1 
ATOM   4707 O O   . VAL B 1 283 ? 30.922 -6.526  33.933 1.00 39.78  ? 283 VAL B O   1 
ATOM   4708 C CB  . VAL B 1 283 ? 28.001 -7.152  33.629 1.00 26.54  ? 283 VAL B CB  1 
ATOM   4709 C CG1 . VAL B 1 283 ? 28.129 -8.260  34.651 1.00 27.95  ? 283 VAL B CG1 1 
ATOM   4710 C CG2 . VAL B 1 283 ? 26.549 -6.916  33.293 1.00 30.88  ? 283 VAL B CG2 1 
ATOM   4711 N N   . GLY B 1 284 ? 30.204 -5.911  35.974 1.00 40.78  ? 284 GLY B N   1 
ATOM   4712 C CA  . GLY B 1 284 ? 31.486 -6.158  36.595 1.00 43.51  ? 284 GLY B CA  1 
ATOM   4713 C C   . GLY B 1 284 ? 31.310 -7.204  37.675 1.00 47.88  ? 284 GLY B C   1 
ATOM   4714 O O   . GLY B 1 284 ? 30.386 -7.115  38.497 1.00 48.44  ? 284 GLY B O   1 
ATOM   4715 N N   . ILE B 1 285 ? 32.190 -8.200  37.668 1.00 46.17  ? 285 ILE B N   1 
ATOM   4716 C CA  . ILE B 1 285 ? 32.136 -9.277  38.645 1.00 44.22  ? 285 ILE B CA  1 
ATOM   4717 C C   . ILE B 1 285 ? 33.351 -9.214  39.546 1.00 49.36  ? 285 ILE B C   1 
ATOM   4718 O O   . ILE B 1 285 ? 34.465 -8.975  39.078 1.00 51.65  ? 285 ILE B O   1 
ATOM   4719 C CB  . ILE B 1 285 ? 32.096 -10.655 37.956 1.00 47.52  ? 285 ILE B CB  1 
ATOM   4720 C CG1 . ILE B 1 285 ? 30.833 -10.776 37.104 1.00 51.10  ? 285 ILE B CG1 1 
ATOM   4721 C CG2 . ILE B 1 285 ? 32.098 -11.762 38.993 1.00 45.23  ? 285 ILE B CG2 1 
ATOM   4722 C CD1 . ILE B 1 285 ? 30.846 -11.955 36.185 1.00 42.87  ? 285 ILE B CD1 1 
ATOM   4723 N N   . HIS B 1 286 ? 33.123 -9.404  40.842 1.00 46.11  ? 286 HIS B N   1 
ATOM   4724 C CA  . HIS B 1 286 ? 34.197 -9.386  41.819 1.00 50.57  ? 286 HIS B CA  1 
ATOM   4725 C C   . HIS B 1 286 ? 34.143 -10.628 42.698 1.00 59.60  ? 286 HIS B C   1 
ATOM   4726 O O   . HIS B 1 286 ? 33.219 -10.799 43.505 1.00 62.65  ? 286 HIS B O   1 
ATOM   4727 C CB  . HIS B 1 286 ? 34.121 -8.131  42.687 1.00 41.46  ? 286 HIS B CB  1 
ATOM   4728 C CG  . HIS B 1 286 ? 35.078 -8.137  43.841 1.00 38.82  ? 286 HIS B CG  1 
ATOM   4729 N ND1 . HIS B 1 286 ? 34.697 -8.496  45.118 1.00 36.01  ? 286 HIS B ND1 1 
ATOM   4730 C CD2 . HIS B 1 286 ? 36.395 -7.823  43.917 1.00 29.14  ? 286 HIS B CD2 1 
ATOM   4731 C CE1 . HIS B 1 286 ? 35.736 -8.402  45.930 1.00 37.00  ? 286 HIS B CE1 1 
ATOM   4732 N NE2 . HIS B 1 286 ? 36.779 -7.996  45.227 1.00 33.65  ? 286 HIS B NE2 1 
ATOM   4733 N N   . ASP B 1 287 ? 35.113 -11.515 42.479 1.00 67.11  ? 287 ASP B N   1 
ATOM   4734 C CA  . ASP B 1 287 ? 35.262 -12.754 43.238 1.00 67.29  ? 287 ASP B CA  1 
ATOM   4735 C C   . ASP B 1 287 ? 36.058 -12.445 44.509 1.00 64.18  ? 287 ASP B C   1 
ATOM   4736 O O   . ASP B 1 287 ? 37.250 -12.112 44.457 1.00 57.93  ? 287 ASP B O   1 
ATOM   4737 C CB  . ASP B 1 287 ? 36.001 -13.803 42.399 1.00 75.40  ? 287 ASP B CB  1 
ATOM   4738 C CG  . ASP B 1 287 ? 35.922 -15.193 42.994 1.00 82.55  ? 287 ASP B CG  1 
ATOM   4739 O OD1 . ASP B 1 287 ? 36.419 -15.396 44.125 1.00 88.71  ? 287 ASP B OD1 1 
ATOM   4740 O OD2 . ASP B 1 287 ? 35.359 -16.087 42.324 1.00 90.95  ? 287 ASP B OD2 1 
ATOM   4741 N N   . VAL B 1 288 ? 35.391 -12.586 45.648 1.00 60.18  ? 288 VAL B N   1 
ATOM   4742 C CA  . VAL B 1 288 ? 36.000 -12.306 46.934 1.00 58.08  ? 288 VAL B CA  1 
ATOM   4743 C C   . VAL B 1 288 ? 37.192 -13.189 47.245 1.00 60.79  ? 288 VAL B C   1 
ATOM   4744 O O   . VAL B 1 288 ? 38.280 -12.690 47.525 1.00 60.48  ? 288 VAL B O   1 
ATOM   4745 C CB  . VAL B 1 288 ? 34.985 -12.455 48.058 1.00 59.18  ? 288 VAL B CB  1 
ATOM   4746 C CG1 . VAL B 1 288 ? 35.620 -12.061 49.385 1.00 63.20  ? 288 VAL B CG1 1 
ATOM   4747 C CG2 . VAL B 1 288 ? 33.753 -11.608 47.760 1.00 58.40  ? 288 VAL B CG2 1 
ATOM   4748 N N   . ASP B 1 289 ? 36.979 -14.501 47.194 1.00 65.65  ? 289 ASP B N   1 
ATOM   4749 C CA  . ASP B 1 289 ? 38.032 -15.469 47.493 1.00 67.02  ? 289 ASP B CA  1 
ATOM   4750 C C   . ASP B 1 289 ? 39.307 -15.202 46.695 1.00 66.18  ? 289 ASP B C   1 
ATOM   4751 O O   . ASP B 1 289 ? 40.421 -15.316 47.226 1.00 61.52  ? 289 ASP B O   1 
ATOM   4752 C CB  . ASP B 1 289 ? 37.522 -16.898 47.257 1.00 69.82  ? 289 ASP B CB  1 
ATOM   4753 C CG  . ASP B 1 289 ? 36.328 -17.256 48.146 1.00 73.07  ? 289 ASP B CG  1 
ATOM   4754 O OD1 . ASP B 1 289 ? 35.555 -18.153 47.752 1.00 72.65  ? 289 ASP B OD1 1 
ATOM   4755 O OD2 . ASP B 1 289 ? 36.158 -16.653 49.234 1.00 71.48  ? 289 ASP B OD2 1 
ATOM   4756 N N   . ARG B 1 290 ? 39.128 -14.820 45.430 1.00 69.06  ? 290 ARG B N   1 
ATOM   4757 C CA  . ARG B 1 290 ? 40.242 -14.505 44.541 1.00 71.45  ? 290 ARG B CA  1 
ATOM   4758 C C   . ARG B 1 290 ? 40.900 -13.231 45.043 1.00 76.65  ? 290 ARG B C   1 
ATOM   4759 O O   . ARG B 1 290 ? 42.133 -13.100 45.038 1.00 76.61  ? 290 ARG B O   1 
ATOM   4760 C CB  . ARG B 1 290 ? 39.746 -14.296 43.108 1.00 64.71  ? 290 ARG B CB  1 
ATOM   4761 C CG  . ARG B 1 290 ? 40.822 -13.794 42.160 1.00 63.18  ? 290 ARG B CG  1 
ATOM   4762 C CD  . ARG B 1 290 ? 40.303 -13.672 40.745 1.00 65.93  ? 290 ARG B CD  1 
ATOM   4763 N NE  . ARG B 1 290 ? 41.298 -13.084 39.853 1.00 67.06  ? 290 ARG B NE  1 
ATOM   4764 C CZ  . ARG B 1 290 ? 41.307 -13.244 38.533 1.00 65.94  ? 290 ARG B CZ  1 
ATOM   4765 N NH1 . ARG B 1 290 ? 40.375 -13.978 37.940 1.00 64.88  ? 290 ARG B NH1 1 
ATOM   4766 N NH2 . ARG B 1 290 ? 42.250 -12.664 37.803 1.00 64.69  ? 290 ARG B NH2 1 
ATOM   4767 N N   . ALA B 1 291 ? 40.056 -12.300 45.481 1.00 81.42  ? 291 ALA B N   1 
ATOM   4768 C CA  . ALA B 1 291 ? 40.511 -11.023 46.006 1.00 87.37  ? 291 ALA B CA  1 
ATOM   4769 C C   . ALA B 1 291 ? 41.422 -11.251 47.210 1.00 87.25  ? 291 ALA B C   1 
ATOM   4770 O O   . ALA B 1 291 ? 42.473 -10.615 47.327 1.00 83.07  ? 291 ALA B O   1 
ATOM   4771 C CB  . ALA B 1 291 ? 39.317 -10.159 46.395 1.00 93.03  ? 291 ALA B CB  1 
ATOM   4772 N N   . GLU B 1 292 ? 41.023 -12.181 48.079 1.00 88.29  ? 292 GLU B N   1 
ATOM   4773 C CA  . GLU B 1 292 ? 41.799 -12.522 49.273 1.00 87.76  ? 292 GLU B CA  1 
ATOM   4774 C C   . GLU B 1 292 ? 43.232 -12.882 48.898 1.00 86.91  ? 292 GLU B C   1 
ATOM   4775 O O   . GLU B 1 292 ? 44.184 -12.282 49.402 1.00 77.23  ? 292 GLU B O   1 
ATOM   4776 C CB  . GLU B 1 292 ? 41.172 -13.710 50.007 1.00 89.08  ? 292 GLU B CB  1 
ATOM   4777 C CG  . GLU B 1 292 ? 39.935 -13.386 50.817 1.00 90.31  ? 292 GLU B CG  1 
ATOM   4778 C CD  . GLU B 1 292 ? 39.420 -14.592 51.590 1.00 93.41  ? 292 GLU B CD  1 
ATOM   4779 O OE1 . GLU B 1 292 ? 38.986 -15.568 50.941 1.00 89.34  ? 292 GLU B OE1 1 
ATOM   4780 O OE2 . GLU B 1 292 ? 39.447 -14.564 52.842 1.00 88.18  ? 292 GLU B OE2 1 
ATOM   4781 N N   . GLN B 1 293 ? 43.364 -13.863 48.006 1.00 87.02  ? 293 GLN B N   1 
ATOM   4782 C CA  . GLN B 1 293 ? 44.663 -14.333 47.536 1.00 86.81  ? 293 GLN B CA  1 
ATOM   4783 C C   . GLN B 1 293 ? 45.513 -13.177 47.029 1.00 85.27  ? 293 GLN B C   1 
ATOM   4784 O O   . GLN B 1 293 ? 46.679 -13.040 47.394 1.00 83.05  ? 293 GLN B O   1 
ATOM   4785 C CB  . GLN B 1 293 ? 44.485 -15.344 46.407 1.00 85.79  ? 293 GLN B CB  1 
ATOM   4786 C CG  . GLN B 1 293 ? 43.597 -16.526 46.746 1.00 89.01  ? 293 GLN B CG  1 
ATOM   4787 C CD  . GLN B 1 293 ? 43.469 -17.493 45.578 1.00 88.20  ? 293 GLN B CD  1 
ATOM   4788 O OE1 . GLN B 1 293 ? 42.494 -17.447 44.816 1.00 89.38  ? 293 GLN B OE1 1 
ATOM   4789 N NE2 . GLN B 1 293 ? 44.462 -18.369 45.424 1.00 90.61  ? 293 GLN B NE2 1 
ATOM   4790 N N   . GLU B 1 294 ? 44.920 -12.352 46.177 1.00 83.25  ? 294 GLU B N   1 
ATOM   4791 C CA  . GLU B 1 294 ? 45.619 -11.205 45.623 1.00 83.99  ? 294 GLU B CA  1 
ATOM   4792 C C   . GLU B 1 294 ? 46.077 -10.269 46.739 1.00 81.19  ? 294 GLU B C   1 
ATOM   4793 O O   . GLU B 1 294 ? 47.212 -9.786  46.742 1.00 83.59  ? 294 GLU B O   1 
ATOM   4794 C CB  . GLU B 1 294 ? 44.696 -10.443 44.671 1.00 86.70  ? 294 GLU B CB  1 
ATOM   4795 C CG  . GLU B 1 294 ? 44.258 -11.226 43.444 1.00 81.29  ? 294 GLU B CG  1 
ATOM   4796 C CD  . GLU B 1 294 ? 43.272 -10.455 42.586 1.00 80.26  ? 294 GLU B CD  1 
ATOM   4797 O OE1 . GLU B 1 294 ? 42.341 -9.844  43.153 1.00 78.49  ? 294 GLU B OE1 1 
ATOM   4798 O OE2 . GLU B 1 294 ? 43.428 -10.458 41.347 1.00 82.98  ? 294 GLU B OE2 1 
ATOM   4799 N N   . GLU B 1 295 ? 45.186 -10.045 47.697 1.00 79.79  ? 295 GLU B N   1 
ATOM   4800 C CA  . GLU B 1 295 ? 45.456 -9.164  48.820 1.00 82.27  ? 295 GLU B CA  1 
ATOM   4801 C C   . GLU B 1 295 ? 46.561 -9.752  49.693 1.00 82.98  ? 295 GLU B C   1 
ATOM   4802 O O   . GLU B 1 295 ? 47.455 -9.035  50.147 1.00 85.02  ? 295 GLU B O   1 
ATOM   4803 C CB  . GLU B 1 295 ? 44.162 -8.971  49.622 1.00 88.70  ? 295 GLU B CB  1 
ATOM   4804 C CG  . GLU B 1 295 ? 44.156 -7.814  50.624 1.00 84.65  ? 295 GLU B CG  1 
ATOM   4805 C CD  . GLU B 1 295 ? 42.765 -7.527  51.198 1.00 88.72  ? 295 GLU B CD  1 
ATOM   4806 O OE1 . GLU B 1 295 ? 41.912 -8.442  51.218 1.00 83.19  ? 295 GLU B OE1 1 
ATOM   4807 O OE2 . GLU B 1 295 ? 42.523 -6.379  51.631 1.00 86.34  ? 295 GLU B OE2 1 
ATOM   4808 N N   . MET B 1 296 ? 46.535 -11.073 49.854 1.00 85.00  ? 296 MET B N   1 
ATOM   4809 C CA  . MET B 1 296 ? 47.519 -11.781 50.674 1.00 84.62  ? 296 MET B CA  1 
ATOM   4810 C C   . MET B 1 296 ? 48.948 -11.654 50.141 1.00 81.79  ? 296 MET B C   1 
ATOM   4811 O O   . MET B 1 296 ? 49.850 -11.288 50.885 1.00 72.82  ? 296 MET B O   1 
ATOM   4812 C CB  . MET B 1 296 ? 47.142 -13.264 50.806 1.00 79.94  ? 296 MET B CB  1 
ATOM   4813 C CG  . MET B 1 296 ? 48.034 -14.043 51.757 1.00 72.77  ? 296 MET B CG  1 
ATOM   4814 S SD  . MET B 1 296 ? 47.864 -15.825 51.568 1.00 70.28  ? 296 MET B SD  1 
ATOM   4815 C CE  . MET B 1 296 ? 49.401 -16.228 50.709 1.00 67.84  ? 296 MET B CE  1 
ATOM   4816 N N   . GLU B 1 297 ? 49.145 -11.974 48.862 1.00 84.09  ? 297 GLU B N   1 
ATOM   4817 C CA  . GLU B 1 297 ? 50.464 -11.890 48.238 1.00 85.92  ? 297 GLU B CA  1 
ATOM   4818 C C   . GLU B 1 297 ? 51.064 -10.509 48.483 1.00 84.77  ? 297 GLU B C   1 
ATOM   4819 O O   . GLU B 1 297 ? 52.255 -10.384 48.785 1.00 79.90  ? 297 GLU B O   1 
ATOM   4820 C CB  . GLU B 1 297 ? 50.377 -12.165 46.727 1.00 87.77  ? 297 GLU B CB  1 
ATOM   4821 C CG  . GLU B 1 297 ? 51.731 -12.111 46.020 1.00 87.11  ? 297 GLU B CG  1 
ATOM   4822 C CD  . GLU B 1 297 ? 51.647 -12.413 44.534 1.00 89.77  ? 297 GLU B CD  1 
ATOM   4823 O OE1 . GLU B 1 297 ? 51.221 -13.530 44.173 1.00 89.86  ? 297 GLU B OE1 1 
ATOM   4824 O OE2 . GLU B 1 297 ? 52.024 -11.537 43.727 1.00 91.00  ? 297 GLU B OE2 1 
ATOM   4825 N N   . VAL B 1 298 ? 50.223 -9.483  48.368 1.00 86.28  ? 298 VAL B N   1 
ATOM   4826 C CA  . VAL B 1 298 ? 50.642 -8.104  48.593 1.00 89.47  ? 298 VAL B CA  1 
ATOM   4827 C C   . VAL B 1 298 ? 51.185 -7.968  50.019 1.00 89.92  ? 298 VAL B C   1 
ATOM   4828 O O   . VAL B 1 298 ? 52.212 -7.318  50.252 1.00 89.01  ? 298 VAL B O   1 
ATOM   4829 C CB  . VAL B 1 298 ? 49.460 -7.126  48.375 1.00 88.84  ? 298 VAL B CB  1 
ATOM   4830 C CG1 . VAL B 1 298 ? 49.767 -5.760  48.972 1.00 87.68  ? 298 VAL B CG1 1 
ATOM   4831 C CG2 . VAL B 1 298 ? 49.169 -6.989  46.889 1.00 87.17  ? 298 VAL B CG2 1 
ATOM   4832 N N   . GLU B 1 299 ? 50.496 -8.607  50.962 1.00 90.66  ? 299 GLU B N   1 
ATOM   4833 C CA  . GLU B 1 299 ? 50.900 -8.589  52.364 1.00 89.41  ? 299 GLU B CA  1 
ATOM   4834 C C   . GLU B 1 299 ? 52.057 -9.571  52.587 1.00 86.54  ? 299 GLU B C   1 
ATOM   4835 O O   . GLU B 1 299 ? 52.839 -9.421  53.528 1.00 87.50  ? 299 GLU B O   1 
ATOM   4836 C CB  . GLU B 1 299 ? 49.714 -8.973  53.257 1.00 84.48  ? 299 GLU B CB  1 
ATOM   4837 C CG  . GLU B 1 299 ? 48.505 -8.060  53.122 1.00 82.89  ? 299 GLU B CG  1 
ATOM   4838 C CD  . GLU B 1 299 ? 47.316 -8.546  53.928 1.00 79.29  ? 299 GLU B CD  1 
ATOM   4839 O OE1 . GLU B 1 299 ? 46.505 -9.324  53.383 1.00 76.05  ? 299 GLU B OE1 1 
ATOM   4840 O OE2 . GLU B 1 299 ? 47.193 -8.151  55.106 1.00 78.64  ? 299 GLU B OE2 1 
ATOM   4841 N N   . GLU B 1 300 ? 52.180 -10.542 51.684 1.00 83.88  ? 300 GLU B N   1 
ATOM   4842 C CA  . GLU B 1 300 ? 53.211 -11.566 51.768 1.00 84.49  ? 300 GLU B CA  1 
ATOM   4843 C C   . GLU B 1 300 ? 54.572 -11.039 51.337 1.00 84.00  ? 300 GLU B C   1 
ATOM   4844 O O   . GLU B 1 300 ? 55.605 -11.484 51.838 1.00 86.63  ? 300 GLU B O   1 
ATOM   4845 C CB  . GLU B 1 300 ? 52.818 -12.775 50.911 1.00 80.71  ? 300 GLU B CB  1 
ATOM   4846 C CG  . GLU B 1 300 ? 53.491 -14.089 51.315 1.00 83.04  ? 300 GLU B CG  1 
ATOM   4847 C CD  . GLU B 1 300 ? 54.721 -14.442 50.484 1.00 84.04  ? 300 GLU B CD  1 
ATOM   4848 O OE1 . GLU B 1 300 ? 55.209 -15.583 50.624 1.00 85.50  ? 300 GLU B OE1 1 
ATOM   4849 O OE2 . GLU B 1 300 ? 55.199 -13.600 49.692 1.00 84.93  ? 300 GLU B OE2 1 
ATOM   4850 N N   . ARG B 1 301 ? 54.569 -10.090 50.407 1.00 88.17  ? 301 ARG B N   1 
ATOM   4851 C CA  . ARG B 1 301 ? 55.814 -9.512  49.911 1.00 89.47  ? 301 ARG B CA  1 
ATOM   4852 C C   . ARG B 1 301 ? 56.493 -8.624  50.947 1.00 89.33  ? 301 ARG B C   1 
ATOM   4853 O O   . ARG B 1 301 ? 57.722 -8.541  50.992 1.00 91.65  ? 301 ARG B O   1 
ATOM   4854 C CB  . ARG B 1 301 ? 55.569 -8.728  48.619 1.00 89.87  ? 301 ARG B CB  1 
ATOM   4855 C CG  . ARG B 1 301 ? 55.198 -9.602  47.439 1.00 85.40  ? 301 ARG B CG  1 
ATOM   4856 C CD  . ARG B 1 301 ? 55.136 -8.795  46.154 1.00 89.13  ? 301 ARG B CD  1 
ATOM   4857 N NE  . ARG B 1 301 ? 54.977 -9.641  44.973 1.00 86.64  ? 301 ARG B NE  1 
ATOM   4858 C CZ  . ARG B 1 301 ? 55.809 -10.621 44.627 1.00 86.12  ? 301 ARG B CZ  1 
ATOM   4859 N NH1 . ARG B 1 301 ? 56.874 -10.900 45.369 1.00 86.53  ? 301 ARG B NH1 1 
ATOM   4860 N NH2 . ARG B 1 301 ? 55.584 -11.317 43.522 1.00 87.97  ? 301 ARG B NH2 1 
ATOM   4861 N N   . ALA B 1 302 ? 55.691 -7.950  51.765 1.00 87.74  ? 302 ALA B N   1 
ATOM   4862 C CA  . ALA B 1 302 ? 56.232 -7.086  52.806 1.00 88.91  ? 302 ALA B CA  1 
ATOM   4863 C C   . ALA B 1 302 ? 56.841 -7.944  53.908 1.00 87.65  ? 302 ALA B C   1 
ATOM   4864 O O   . ALA B 1 302 ? 57.678 -7.472  54.680 1.00 89.65  ? 302 ALA B O   1 
ATOM   4865 C CB  . ALA B 1 302 ? 55.136 -6.207  53.377 1.00 89.82  ? 302 ALA B CB  1 
ATOM   4866 N N   . GLU B 1 303 ? 56.374 -9.190  53.998 1.00 89.00  ? 303 GLU B N   1 
ATOM   4867 C CA  . GLU B 1 303 ? 56.847 -10.140 55.000 1.00 89.57  ? 303 GLU B CA  1 
ATOM   4868 C C   . GLU B 1 303 ? 58.005 -10.984 54.460 1.00 89.57  ? 303 GLU B C   1 
ATOM   4869 O O   . GLU B 1 303 ? 59.165 -10.706 54.841 1.00 89.18  ? 303 GLU B O   1 
ATOM   4870 C CB  . GLU B 1 303 ? 55.692 -11.041 55.461 1.00 86.94  ? 303 GLU B CB  1 
ATOM   4871 C CG  . GLU B 1 303 ? 54.558 -10.300 56.154 1.00 88.69  ? 303 GLU B CG  1 
ATOM   4872 C CD  . GLU B 1 303 ? 53.419 -11.218 56.555 1.00 86.97  ? 303 GLU B CD  1 
ATOM   4873 O OE1 . GLU B 1 303 ? 53.505 -11.839 57.636 1.00 85.89  ? 303 GLU B OE1 1 
ATOM   4874 O OE2 . GLU B 1 303 ? 52.436 -11.318 55.791 1.00 87.60  ? 303 GLU B OE2 1 
ATOM   4875 N N   . ASP B 1 343 ? 35.617 -7.794  49.476 1.00 48.96  ? 343 ASP B N   1 
ATOM   4876 C CA  . ASP B 1 343 ? 34.460 -8.376  50.218 1.00 45.02  ? 343 ASP B CA  1 
ATOM   4877 C C   . ASP B 1 343 ? 33.309 -7.402  50.469 1.00 40.82  ? 343 ASP B C   1 
ATOM   4878 O O   . ASP B 1 343 ? 32.154 -7.731  50.230 1.00 35.38  ? 343 ASP B O   1 
ATOM   4879 C CB  . ASP B 1 343 ? 34.888 -9.011  51.568 1.00 49.05  ? 343 ASP B CB  1 
ATOM   4880 C CG  . ASP B 1 343 ? 36.374 -8.791  51.915 1.00 55.49  ? 343 ASP B CG  1 
ATOM   4881 O OD1 . ASP B 1 343 ? 36.712 -7.835  52.659 1.00 50.02  ? 343 ASP B OD1 1 
ATOM   4882 O OD2 . ASP B 1 343 ? 37.205 -9.620  51.485 1.00 64.08  ? 343 ASP B OD2 1 
ATOM   4883 N N   . PRO B 1 344 ? 33.605 -6.185  50.949 1.00 46.09  ? 344 PRO B N   1 
ATOM   4884 C CA  . PRO B 1 344 ? 32.485 -5.289  51.189 1.00 48.37  ? 344 PRO B CA  1 
ATOM   4885 C C   . PRO B 1 344 ? 32.482 -4.003  50.389 1.00 46.42  ? 344 PRO B C   1 
ATOM   4886 O O   . PRO B 1 344 ? 33.456 -3.248  50.374 1.00 45.37  ? 344 PRO B O   1 
ATOM   4887 C CB  . PRO B 1 344 ? 32.662 -4.966  52.659 1.00 54.66  ? 344 PRO B CB  1 
ATOM   4888 C CG  . PRO B 1 344 ? 34.192 -4.756  52.744 1.00 59.45  ? 344 PRO B CG  1 
ATOM   4889 C CD  . PRO B 1 344 ? 34.801 -5.668  51.640 1.00 56.65  ? 344 PRO B CD  1 
ATOM   4890 N N   . SER B 1 345 ? 31.359 -3.763  49.731 1.00 48.80  ? 345 SER B N   1 
ATOM   4891 C CA  . SER B 1 345 ? 31.156 -2.545  48.984 1.00 42.20  ? 345 SER B CA  1 
ATOM   4892 C C   . SER B 1 345 ? 30.744 -1.569  50.085 1.00 47.92  ? 345 SER B C   1 
ATOM   4893 O O   . SER B 1 345 ? 30.963 -1.818  51.274 1.00 46.66  ? 345 SER B O   1 
ATOM   4894 C CB  . SER B 1 345 ? 30.012 -2.734  47.970 1.00 33.01  ? 345 SER B CB  1 
ATOM   4895 O OG  . SER B 1 345 ? 28.803 -3.183  48.577 1.00 23.33  ? 345 SER B OG  1 
ATOM   4896 N N   . VAL B 1 346 ? 30.194 -0.435  49.695 1.00 53.49  ? 346 VAL B N   1 
ATOM   4897 C CA  . VAL B 1 346 ? 29.715 0.528   50.667 1.00 51.51  ? 346 VAL B CA  1 
ATOM   4898 C C   . VAL B 1 346 ? 28.458 1.124   50.072 1.00 50.46  ? 346 VAL B C   1 
ATOM   4899 O O   . VAL B 1 346 ? 28.510 1.970   49.168 1.00 35.97  ? 346 VAL B O   1 
ATOM   4900 C CB  . VAL B 1 346 ? 30.754 1.591   50.992 1.00 57.33  ? 346 VAL B CB  1 
ATOM   4901 C CG1 . VAL B 1 346 ? 30.127 2.699   51.859 1.00 54.54  ? 346 VAL B CG1 1 
ATOM   4902 C CG2 . VAL B 1 346 ? 31.920 0.936   51.715 1.00 51.92  ? 346 VAL B CG2 1 
ATOM   4903 N N   . ASP B 1 347 ? 27.343 0.564   50.533 1.00 47.07  ? 347 ASP B N   1 
ATOM   4904 C CA  . ASP B 1 347 ? 25.999 0.921   50.121 1.00 57.69  ? 347 ASP B CA  1 
ATOM   4905 C C   . ASP B 1 347 ? 25.848 2.270   49.424 1.00 60.81  ? 347 ASP B C   1 
ATOM   4906 O O   . ASP B 1 347 ? 25.128 2.382   48.428 1.00 62.25  ? 347 ASP B O   1 
ATOM   4907 C CB  . ASP B 1 347 ? 25.063 0.858   51.332 1.00 63.74  ? 347 ASP B CB  1 
ATOM   4908 C CG  . ASP B 1 347 ? 24.829 -0.563  51.828 1.00 69.64  ? 347 ASP B CG  1 
ATOM   4909 O OD1 . ASP B 1 347 ? 25.800 -1.337  51.928 1.00 74.84  ? 347 ASP B OD1 1 
ATOM   4910 O OD2 . ASP B 1 347 ? 23.667 -0.900  52.152 1.00 78.72  ? 347 ASP B OD2 1 
ATOM   4911 N N   . VAL B 1 348 ? 26.547 3.280   49.934 1.00 62.36  ? 348 VAL B N   1 
ATOM   4912 C CA  . VAL B 1 348 ? 26.454 4.615   49.377 1.00 62.68  ? 348 VAL B CA  1 
ATOM   4913 C C   . VAL B 1 348 ? 27.699 5.146   48.685 1.00 64.40  ? 348 VAL B C   1 
ATOM   4914 O O   . VAL B 1 348 ? 27.640 5.574   47.532 1.00 69.70  ? 348 VAL B O   1 
ATOM   4915 C CB  . VAL B 1 348 ? 26.073 5.618   50.462 1.00 63.33  ? 348 VAL B CB  1 
ATOM   4916 C CG1 . VAL B 1 348 ? 25.801 6.981   49.841 1.00 69.42  ? 348 VAL B CG1 1 
ATOM   4917 C CG2 . VAL B 1 348 ? 24.859 5.121   51.222 1.00 71.22  ? 348 VAL B CG2 1 
ATOM   4918 N N   . TYR B 1 349 ? 28.832 5.087   49.375 1.00 62.74  ? 349 TYR B N   1 
ATOM   4919 C CA  . TYR B 1 349 ? 30.072 5.644   48.846 1.00 53.28  ? 349 TYR B CA  1 
ATOM   4920 C C   . TYR B 1 349 ? 30.814 4.908   47.757 1.00 40.64  ? 349 TYR B C   1 
ATOM   4921 O O   . TYR B 1 349 ? 31.946 5.251   47.455 1.00 35.27  ? 349 TYR B O   1 
ATOM   4922 C CB  . TYR B 1 349 ? 30.983 6.040   50.014 1.00 65.47  ? 349 TYR B CB  1 
ATOM   4923 C CG  . TYR B 1 349 ? 30.271 7.050   50.907 1.00 84.67  ? 349 TYR B CG  1 
ATOM   4924 C CD1 . TYR B 1 349 ? 29.949 6.751   52.235 1.00 84.91  ? 349 TYR B CD1 1 
ATOM   4925 C CD2 . TYR B 1 349 ? 29.813 8.271   50.379 1.00 90.05  ? 349 TYR B CD2 1 
ATOM   4926 C CE1 . TYR B 1 349 ? 29.182 7.634   53.005 1.00 83.90  ? 349 TYR B CE1 1 
ATOM   4927 C CE2 . TYR B 1 349 ? 29.047 9.156   51.141 1.00 84.23  ? 349 TYR B CE2 1 
ATOM   4928 C CZ  . TYR B 1 349 ? 28.734 8.831   52.448 1.00 86.29  ? 349 TYR B CZ  1 
ATOM   4929 O OH  . TYR B 1 349 ? 27.964 9.703   53.181 1.00 79.47  ? 349 TYR B OH  1 
ATOM   4930 N N   . ALA B 1 350 ? 30.133 3.961   47.118 1.00 42.69  ? 350 ALA B N   1 
ATOM   4931 C CA  . ALA B 1 350 ? 30.692 3.139   46.030 1.00 53.07  ? 350 ALA B CA  1 
ATOM   4932 C C   . ALA B 1 350 ? 29.688 2.060   45.648 1.00 50.27  ? 350 ALA B C   1 
ATOM   4933 O O   . ALA B 1 350 ? 30.038 0.877   45.541 1.00 39.22  ? 350 ALA B O   1 
ATOM   4934 C CB  . ALA B 1 350 ? 32.007 2.471   46.455 1.00 58.91  ? 350 ALA B CB  1 
ATOM   4935 N N   . MET B 1 351 ? 28.452 2.492   45.422 1.00 54.97  ? 351 MET B N   1 
ATOM   4936 C CA  . MET B 1 351 ? 27.365 1.591   45.080 1.00 60.16  ? 351 MET B CA  1 
ATOM   4937 C C   . MET B 1 351 ? 27.317 1.080   43.641 1.00 62.27  ? 351 MET B C   1 
ATOM   4938 O O   . MET B 1 351 ? 28.330 1.104   42.932 1.00 66.15  ? 351 MET B O   1 
ATOM   4939 C CB  . MET B 1 351 ? 26.007 2.147   45.548 1.00 60.28  ? 351 MET B CB  1 
ATOM   4940 C CG  . MET B 1 351 ? 25.671 3.544   45.086 1.00 56.82  ? 351 MET B CG  1 
ATOM   4941 S SD  . MET B 1 351 ? 25.499 3.538   43.351 1.00 58.93  ? 351 MET B SD  1 
ATOM   4942 C CE  . MET B 1 351 ? 23.921 2.678   43.173 1.00 60.54  ? 351 MET B CE  1 
ATOM   4943 N N   . LYS B 1 352 ? 26.123 0.640   43.235 1.00 56.10  ? 352 LYS B N   1 
ATOM   4944 C CA  . LYS B 1 352 ? 25.851 0.003   41.943 1.00 50.30  ? 352 LYS B CA  1 
ATOM   4945 C C   . LYS B 1 352 ? 26.212 -1.480  42.139 1.00 49.44  ? 352 LYS B C   1 
ATOM   4946 O O   . LYS B 1 352 ? 25.922 -2.328  41.294 1.00 46.11  ? 352 LYS B O   1 
ATOM   4947 C CB  . LYS B 1 352 ? 26.633 0.626   40.782 1.00 42.62  ? 352 LYS B CB  1 
ATOM   4948 C CG  . LYS B 1 352 ? 25.946 1.821   40.171 1.00 38.65  ? 352 LYS B CG  1 
ATOM   4949 C CD  . LYS B 1 352 ? 26.806 2.445   39.093 1.00 36.45  ? 352 LYS B CD  1 
ATOM   4950 C CE  . LYS B 1 352 ? 26.378 3.888   38.808 1.00 38.88  ? 352 LYS B CE  1 
ATOM   4951 N NZ  . LYS B 1 352 ? 24.954 4.012   38.395 1.00 40.52  ? 352 LYS B NZ  1 
ATOM   4952 N N   . SER B 1 353 ? 26.777 -1.771  43.311 1.00 43.38  ? 353 SER B N   1 
ATOM   4953 C CA  . SER B 1 353 ? 27.176 -3.102  43.712 1.00 42.41  ? 353 SER B CA  1 
ATOM   4954 C C   . SER B 1 353 ? 25.948 -3.894  44.092 1.00 42.52  ? 353 SER B C   1 
ATOM   4955 O O   . SER B 1 353 ? 24.917 -3.321  44.441 1.00 39.46  ? 353 SER B O   1 
ATOM   4956 C CB  . SER B 1 353 ? 28.089 -3.027  44.925 1.00 44.47  ? 353 SER B CB  1 
ATOM   4957 O OG  . SER B 1 353 ? 29.207 -2.206  44.657 1.00 52.48  ? 353 SER B OG  1 
ATOM   4958 N N   . HIS B 1 354 ? 26.085 -5.216  44.017 1.00 49.02  ? 354 HIS B N   1 
ATOM   4959 C CA  . HIS B 1 354 ? 25.025 -6.174  44.345 1.00 50.94  ? 354 HIS B CA  1 
ATOM   4960 C C   . HIS B 1 354 ? 25.710 -7.372  44.961 1.00 56.04  ? 354 HIS B C   1 
ATOM   4961 O O   . HIS B 1 354 ? 26.598 -7.959  44.343 1.00 56.02  ? 354 HIS B O   1 
ATOM   4962 C CB  . HIS B 1 354 ? 24.343 -6.678  43.076 1.00 45.41  ? 354 HIS B CB  1 
ATOM   4963 C CG  . HIS B 1 354 ? 22.998 -6.083  42.821 1.00 38.08  ? 354 HIS B CG  1 
ATOM   4964 N ND1 . HIS B 1 354 ? 22.252 -6.410  41.712 1.00 37.63  ? 354 HIS B ND1 1 
ATOM   4965 C CD2 . HIS B 1 354 ? 22.264 -5.190  43.520 1.00 40.66  ? 354 HIS B CD2 1 
ATOM   4966 C CE1 . HIS B 1 354 ? 21.114 -5.740  41.734 1.00 42.41  ? 354 HIS B CE1 1 
ATOM   4967 N NE2 . HIS B 1 354 ? 21.097 -4.993  42.822 1.00 48.71  ? 354 HIS B NE2 1 
ATOM   4968 N N   . GLU B 1 355 ? 25.328 -7.740  46.175 1.00 60.75  ? 355 GLU B N   1 
ATOM   4969 C CA  . GLU B 1 355 ? 25.945 -8.913  46.776 1.00 62.21  ? 355 GLU B CA  1 
ATOM   4970 C C   . GLU B 1 355 ? 25.232 -10.167 46.265 1.00 66.24  ? 355 GLU B C   1 
ATOM   4971 O O   . GLU B 1 355 ? 24.022 -10.148 45.985 1.00 67.67  ? 355 GLU B O   1 
ATOM   4972 C CB  . GLU B 1 355 ? 25.909 -8.852  48.302 1.00 51.60  ? 355 GLU B CB  1 
ATOM   4973 C CG  . GLU B 1 355 ? 26.848 -7.836  48.878 1.00 55.16  ? 355 GLU B CG  1 
ATOM   4974 C CD  . GLU B 1 355 ? 27.020 -7.975  50.375 1.00 65.81  ? 355 GLU B CD  1 
ATOM   4975 O OE1 . GLU B 1 355 ? 26.025 -7.813  51.118 1.00 64.85  ? 355 GLU B OE1 1 
ATOM   4976 O OE2 . GLU B 1 355 ? 28.163 -8.232  50.807 1.00 64.37  ? 355 GLU B OE2 1 
ATOM   4977 N N   . SER B 1 356 ? 26.009 -11.231 46.079 1.00 65.45  ? 356 SER B N   1 
ATOM   4978 C CA  . SER B 1 356 ? 25.494 -12.514 45.615 1.00 62.87  ? 356 SER B CA  1 
ATOM   4979 C C   . SER B 1 356 ? 24.729 -13.180 46.753 1.00 61.43  ? 356 SER B C   1 
ATOM   4980 O O   . SER B 1 356 ? 25.150 -13.113 47.908 1.00 58.46  ? 356 SER B O   1 
ATOM   4981 C CB  . SER B 1 356 ? 26.663 -13.402 45.206 1.00 61.21  ? 356 SER B CB  1 
ATOM   4982 O OG  . SER B 1 356 ? 27.613 -13.467 46.262 1.00 56.46  ? 356 SER B OG  1 
ATOM   4983 N N   . SER B 1 357 ? 23.629 -13.846 46.424 1.00 65.50  ? 357 SER B N   1 
ATOM   4984 C CA  . SER B 1 357 ? 22.816 -14.522 47.438 1.00 71.05  ? 357 SER B CA  1 
ATOM   4985 C C   . SER B 1 357 ? 23.659 -15.452 48.322 1.00 76.79  ? 357 SER B C   1 
ATOM   4986 O O   . SER B 1 357 ? 23.456 -15.503 49.539 1.00 76.11  ? 357 SER B O   1 
ATOM   4987 C CB  . SER B 1 357 ? 21.675 -15.303 46.775 1.00 64.83  ? 357 SER B CB  1 
ATOM   4988 O OG  . SER B 1 357 ? 20.596 -15.499 47.669 1.00 64.95  ? 357 SER B OG  1 
ATOM   4989 N N   . PRO B 1 358 ? 24.547 -16.263 47.710 1.00 83.03  ? 358 PRO B N   1 
ATOM   4990 C CA  . PRO B 1 358 ? 25.380 -17.175 48.486 1.00 88.01  ? 358 PRO B CA  1 
ATOM   4991 C C   . PRO B 1 358 ? 26.884 -16.942 48.255 1.00 90.97  ? 358 PRO B C   1 
ATOM   4992 O O   . PRO B 1 358 ? 27.449 -15.964 48.763 1.00 87.24  ? 358 PRO B O   1 
ATOM   4993 C CB  . PRO B 1 358 ? 24.930 -18.548 47.975 1.00 91.99  ? 358 PRO B CB  1 
ATOM   4994 C CG  . PRO B 1 358 ? 24.379 -18.264 46.538 1.00 88.38  ? 358 PRO B CG  1 
ATOM   4995 C CD  . PRO B 1 358 ? 24.505 -16.757 46.323 1.00 89.77  ? 358 PRO B CD  1 
ATOM   4996 N N   . LYS B 1 359 ? 27.496 -17.808 47.438 1.00 89.04  ? 359 LYS B N   1 
ATOM   4997 C CA  . LYS B 1 359 ? 28.928 -17.760 47.129 1.00 90.63  ? 359 LYS B CA  1 
ATOM   4998 C C   . LYS B 1 359 ? 29.497 -16.372 46.856 1.00 90.62  ? 359 LYS B C   1 
ATOM   4999 O O   . LYS B 1 359 ? 29.108 -15.693 45.911 1.00 89.75  ? 359 LYS B O   1 
ATOM   5000 C CB  . LYS B 1 359 ? 29.251 -18.722 45.987 1.00 93.12  ? 359 LYS B CB  1 
ATOM   5001 C CG  . LYS B 1 359 ? 29.170 -20.165 46.430 1.00 88.91  ? 359 LYS B CG  1 
ATOM   5002 C CD  . LYS B 1 359 ? 29.208 -21.128 45.266 1.00 88.08  ? 359 LYS B CD  1 
ATOM   5003 C CE  . LYS B 1 359 ? 29.192 -22.572 45.759 1.00 88.41  ? 359 LYS B CE  1 
ATOM   5004 N NZ  . LYS B 1 359 ? 29.166 -23.557 44.641 1.00 94.30  ? 359 LYS B NZ  1 
ATOM   5005 N N   . LYS B 1 360 ? 30.441 -15.998 47.709 1.00 86.56  ? 360 LYS B N   1 
ATOM   5006 C CA  . LYS B 1 360 ? 31.117 -14.707 47.687 1.00 86.95  ? 360 LYS B CA  1 
ATOM   5007 C C   . LYS B 1 360 ? 31.415 -13.975 46.385 1.00 82.15  ? 360 LYS B C   1 
ATOM   5008 O O   . LYS B 1 360 ? 32.484 -14.150 45.789 1.00 78.92  ? 360 LYS B O   1 
ATOM   5009 C CB  . LYS B 1 360 ? 32.401 -14.807 48.496 1.00 91.06  ? 360 LYS B CB  1 
ATOM   5010 C CG  . LYS B 1 360 ? 32.156 -15.278 49.901 1.00 90.98  ? 360 LYS B CG  1 
ATOM   5011 C CD  . LYS B 1 360 ? 33.435 -15.329 50.703 1.00 93.01  ? 360 LYS B CD  1 
ATOM   5012 C CE  . LYS B 1 360 ? 33.156 -15.903 52.080 1.00 91.50  ? 360 LYS B CE  1 
ATOM   5013 N NZ  . LYS B 1 360 ? 34.389 -15.964 52.893 1.00 93.47  ? 360 LYS B NZ  1 
ATOM   5014 N N   . GLU B 1 361 ? 30.463 -13.145 45.970 1.00 75.02  ? 361 GLU B N   1 
ATOM   5015 C CA  . GLU B 1 361 ? 30.615 -12.297 44.791 1.00 68.66  ? 361 GLU B CA  1 
ATOM   5016 C C   . GLU B 1 361 ? 29.808 -11.005 44.929 1.00 69.16  ? 361 GLU B C   1 
ATOM   5017 O O   . GLU B 1 361 ? 28.842 -10.928 45.704 1.00 62.99  ? 361 GLU B O   1 
ATOM   5018 C CB  . GLU B 1 361 ? 30.223 -13.007 43.494 1.00 60.92  ? 361 GLU B CB  1 
ATOM   5019 C CG  . GLU B 1 361 ? 31.299 -13.905 42.927 1.00 56.54  ? 361 GLU B CG  1 
ATOM   5020 C CD  . GLU B 1 361 ? 30.927 -14.492 41.583 1.00 58.66  ? 361 GLU B CD  1 
ATOM   5021 O OE1 . GLU B 1 361 ? 29.718 -14.716 41.338 1.00 60.03  ? 361 GLU B OE1 1 
ATOM   5022 O OE2 . GLU B 1 361 ? 31.852 -14.737 40.775 1.00 62.71  ? 361 GLU B OE2 1 
ATOM   5023 N N   . VAL B 1 362 ? 30.244 -9.989  44.186 1.00 68.27  ? 362 VAL B N   1 
ATOM   5024 C CA  . VAL B 1 362 ? 29.598 -8.679  44.160 1.00 60.46  ? 362 VAL B CA  1 
ATOM   5025 C C   . VAL B 1 362 ? 29.451 -8.307  42.692 1.00 60.15  ? 362 VAL B C   1 
ATOM   5026 O O   . VAL B 1 362 ? 30.430 -8.357  41.942 1.00 63.18  ? 362 VAL B O   1 
ATOM   5027 C CB  . VAL B 1 362 ? 30.464 -7.581  44.807 1.00 53.56  ? 362 VAL B CB  1 
ATOM   5028 C CG1 . VAL B 1 362 ? 29.615 -6.349  45.042 1.00 54.47  ? 362 VAL B CG1 1 
ATOM   5029 C CG2 . VAL B 1 362 ? 31.090 -8.061  46.095 1.00 52.54  ? 362 VAL B CG2 1 
ATOM   5030 N N   . TYR B 1 363 ? 28.243 -7.930  42.287 1.00 52.55  ? 363 TYR B N   1 
ATOM   5031 C CA  . TYR B 1 363 ? 27.985 -7.558  40.906 1.00 54.85  ? 363 TYR B CA  1 
ATOM   5032 C C   . TYR B 1 363 ? 27.834 -6.055  40.802 1.00 54.50  ? 363 TYR B C   1 
ATOM   5033 O O   . TYR B 1 363 ? 27.306 -5.428  41.718 1.00 55.22  ? 363 TYR B O   1 
ATOM   5034 C CB  . TYR B 1 363 ? 26.698 -8.214  40.414 1.00 59.34  ? 363 TYR B CB  1 
ATOM   5035 C CG  . TYR B 1 363 ? 26.612 -9.699  40.685 1.00 60.48  ? 363 TYR B CG  1 
ATOM   5036 C CD1 . TYR B 1 363 ? 25.718 -10.196 41.627 1.00 55.91  ? 363 TYR B CD1 1 
ATOM   5037 C CD2 . TYR B 1 363 ? 27.415 -10.604 39.993 1.00 63.59  ? 363 TYR B CD2 1 
ATOM   5038 C CE1 . TYR B 1 363 ? 25.622 -11.551 41.875 1.00 67.21  ? 363 TYR B CE1 1 
ATOM   5039 C CE2 . TYR B 1 363 ? 27.328 -11.967 40.234 1.00 64.21  ? 363 TYR B CE2 1 
ATOM   5040 C CZ  . TYR B 1 363 ? 26.427 -12.436 41.178 1.00 70.27  ? 363 TYR B CZ  1 
ATOM   5041 O OH  . TYR B 1 363 ? 26.324 -13.789 41.437 1.00 75.52  ? 363 TYR B OH  1 
ATOM   5042 N N   . PHE B 1 364 ? 28.299 -5.488  39.687 1.00 46.73  ? 364 PHE B N   1 
ATOM   5043 C CA  . PHE B 1 364 ? 28.210 -4.050  39.435 1.00 38.59  ? 364 PHE B CA  1 
ATOM   5044 C C   . PHE B 1 364 ? 27.457 -3.872  38.126 1.00 36.26  ? 364 PHE B C   1 
ATOM   5045 O O   . PHE B 1 364 ? 28.014 -4.134  37.064 1.00 36.24  ? 364 PHE B O   1 
ATOM   5046 C CB  . PHE B 1 364 ? 29.607 -3.448  39.298 1.00 30.36  ? 364 PHE B CB  1 
ATOM   5047 C CG  . PHE B 1 364 ? 30.494 -3.684  40.487 1.00 27.04  ? 364 PHE B CG  1 
ATOM   5048 C CD1 . PHE B 1 364 ? 31.643 -4.442  40.366 1.00 18.42  ? 364 PHE B CD1 1 
ATOM   5049 C CD2 . PHE B 1 364 ? 30.194 -3.117  41.727 1.00 36.72  ? 364 PHE B CD2 1 
ATOM   5050 C CE1 . PHE B 1 364 ? 32.489 -4.632  41.463 1.00 29.85  ? 364 PHE B CE1 1 
ATOM   5051 C CE2 . PHE B 1 364 ? 31.044 -3.305  42.842 1.00 35.79  ? 364 PHE B CE2 1 
ATOM   5052 C CZ  . PHE B 1 364 ? 32.189 -4.060  42.707 1.00 26.84  ? 364 PHE B CZ  1 
ATOM   5053 N N   . MET B 1 365 ? 26.199 -3.438  38.192 1.00 30.93  ? 365 MET B N   1 
ATOM   5054 C CA  . MET B 1 365 ? 25.409 -3.268  36.978 1.00 30.34  ? 365 MET B CA  1 
ATOM   5055 C C   . MET B 1 365 ? 24.664 -1.933  36.847 1.00 33.34  ? 365 MET B C   1 
ATOM   5056 O O   . MET B 1 365 ? 23.923 -1.522  37.746 1.00 30.40  ? 365 MET B O   1 
ATOM   5057 C CB  . MET B 1 365 ? 24.403 -4.407  36.866 1.00 36.04  ? 365 MET B CB  1 
ATOM   5058 C CG  . MET B 1 365 ? 24.988 -5.790  37.047 1.00 42.87  ? 365 MET B CG  1 
ATOM   5059 S SD  . MET B 1 365 ? 23.658 -6.938  37.385 1.00 58.65  ? 365 MET B SD  1 
ATOM   5060 C CE  . MET B 1 365 ? 23.311 -6.497  39.054 1.00 47.59  ? 365 MET B CE  1 
ATOM   5061 N N   . ALA B 1 366 ? 24.811 -1.310  35.679 1.00 32.49  ? 366 ALA B N   1 
ATOM   5062 C CA  . ALA B 1 366 ? 24.167 -0.034  35.370 1.00 31.26  ? 366 ALA B CA  1 
ATOM   5063 C C   . ALA B 1 366 ? 24.139 0.193   33.848 1.00 35.06  ? 366 ALA B C   1 
ATOM   5064 O O   . ALA B 1 366 ? 25.033 -0.278  33.136 1.00 41.88  ? 366 ALA B O   1 
ATOM   5065 C CB  . ALA B 1 366 ? 24.929 1.087   36.039 1.00 35.49  ? 366 ALA B CB  1 
ATOM   5066 N N   . ILE B 1 367 ? 23.098 0.866   33.351 1.00 29.00  ? 367 ILE B N   1 
ATOM   5067 C CA  . ILE B 1 367 ? 22.956 1.187   31.922 1.00 27.36  ? 367 ILE B CA  1 
ATOM   5068 C C   . ILE B 1 367 ? 24.130 2.099   31.520 1.00 37.13  ? 367 ILE B C   1 
ATOM   5069 O O   . ILE B 1 367 ? 24.551 2.929   32.320 1.00 38.55  ? 367 ILE B O   1 
ATOM   5070 C CB  . ILE B 1 367 ? 21.631 1.879   31.679 1.00 20.05  ? 367 ILE B CB  1 
ATOM   5071 C CG1 . ILE B 1 367 ? 20.496 0.915   32.035 1.00 18.34  ? 367 ILE B CG1 1 
ATOM   5072 C CG2 . ILE B 1 367 ? 21.533 2.346   30.257 1.00 14.19  ? 367 ILE B CG2 1 
ATOM   5073 C CD1 . ILE B 1 367 ? 19.115 1.567   32.082 1.00 27.32  ? 367 ILE B CD1 1 
ATOM   5074 N N   . ILE B 1 368 ? 24.617 2.022   30.279 1.00 40.38  ? 368 ILE B N   1 
ATOM   5075 C CA  . ILE B 1 368 ? 25.797 2.814   29.967 1.00 40.10  ? 368 ILE B CA  1 
ATOM   5076 C C   . ILE B 1 368 ? 25.966 3.855   28.844 1.00 49.47  ? 368 ILE B C   1 
ATOM   5077 O O   . ILE B 1 368 ? 26.226 5.009   29.168 1.00 60.67  ? 368 ILE B O   1 
ATOM   5078 C CB  . ILE B 1 368 ? 27.063 1.934   30.144 1.00 38.77  ? 368 ILE B CB  1 
ATOM   5079 C CG1 . ILE B 1 368 ? 28.108 2.694   30.946 1.00 42.57  ? 368 ILE B CG1 1 
ATOM   5080 C CG2 . ILE B 1 368 ? 27.633 1.498   28.831 1.00 38.25  ? 368 ILE B CG2 1 
ATOM   5081 C CD1 . ILE B 1 368 ? 27.564 3.285   32.246 1.00 45.66  ? 368 ILE B CD1 1 
ATOM   5082 N N   . ASP B 1 369 ? 25.882 3.540   27.556 1.00 54.10  ? 369 ASP B N   1 
ATOM   5083 C CA  . ASP B 1 369 ? 26.083 4.647   26.611 1.00 57.72  ? 369 ASP B CA  1 
ATOM   5084 C C   . ASP B 1 369 ? 24.822 5.366   26.147 1.00 58.49  ? 369 ASP B C   1 
ATOM   5085 O O   . ASP B 1 369 ? 24.493 5.397   24.963 1.00 60.27  ? 369 ASP B O   1 
ATOM   5086 C CB  . ASP B 1 369 ? 26.976 4.259   25.436 1.00 67.92  ? 369 ASP B CB  1 
ATOM   5087 C CG  . ASP B 1 369 ? 27.997 5.350   25.105 1.00 84.03  ? 369 ASP B CG  1 
ATOM   5088 O OD1 . ASP B 1 369 ? 27.582 6.458   24.689 1.00 86.00  ? 369 ASP B OD1 1 
ATOM   5089 O OD2 . ASP B 1 369 ? 29.215 5.109   25.288 1.00 89.62  ? 369 ASP B OD2 1 
ATOM   5090 N N   . ILE B 1 370 ? 24.171 6.011   27.109 1.00 57.48  ? 370 ILE B N   1 
ATOM   5091 C CA  . ILE B 1 370 ? 22.934 6.753   26.901 1.00 56.41  ? 370 ILE B CA  1 
ATOM   5092 C C   . ILE B 1 370 ? 23.054 7.842   25.814 1.00 53.37  ? 370 ILE B C   1 
ATOM   5093 O O   . ILE B 1 370 ? 22.070 8.200   25.168 1.00 49.12  ? 370 ILE B O   1 
ATOM   5094 C CB  . ILE B 1 370 ? 22.414 7.317   28.281 1.00 57.56  ? 370 ILE B CB  1 
ATOM   5095 C CG1 . ILE B 1 370 ? 21.228 8.271   28.096 1.00 63.54  ? 370 ILE B CG1 1 
ATOM   5096 C CG2 . ILE B 1 370 ? 23.551 7.954   29.064 1.00 58.16  ? 370 ILE B CG2 1 
ATOM   5097 C CD1 . ILE B 1 370 ? 20.941 9.165   29.301 1.00 54.64  ? 370 ILE B CD1 1 
ATOM   5098 N N   . LEU B 1 371 ? 24.258 8.351   25.589 1.00 54.45  ? 371 LEU B N   1 
ATOM   5099 C CA  . LEU B 1 371 ? 24.447 9.367   24.559 1.00 59.60  ? 371 LEU B CA  1 
ATOM   5100 C C   . LEU B 1 371 ? 24.642 8.683   23.201 1.00 69.69  ? 371 LEU B C   1 
ATOM   5101 O O   . LEU B 1 371 ? 23.667 8.277   22.571 1.00 74.64  ? 371 LEU B O   1 
ATOM   5102 C CB  . LEU B 1 371 ? 25.631 10.285  24.886 1.00 48.62  ? 371 LEU B CB  1 
ATOM   5103 C CG  . LEU B 1 371 ? 25.513 11.256  26.061 1.00 31.90  ? 371 LEU B CG  1 
ATOM   5104 C CD1 . LEU B 1 371 ? 26.803 12.050  26.198 1.00 28.85  ? 371 LEU B CD1 1 
ATOM   5105 C CD2 . LEU B 1 371 ? 24.337 12.190  25.845 1.00 28.30  ? 371 LEU B CD2 1 
ATOM   5106 N N   . THR B 1 372 ? 25.887 8.586   22.738 1.00 80.18  ? 372 THR B N   1 
ATOM   5107 C CA  . THR B 1 372 ? 26.199 7.940   21.462 1.00 84.43  ? 372 THR B CA  1 
ATOM   5108 C C   . THR B 1 372 ? 27.677 7.537   21.417 1.00 88.67  ? 372 THR B C   1 
ATOM   5109 O O   . THR B 1 372 ? 28.540 8.439   21.489 1.00 90.08  ? 372 THR B O   1 
ATOM   5110 C CB  . THR B 1 372 ? 25.883 8.863   20.258 1.00 87.08  ? 372 THR B CB  1 
ATOM   5111 O OG1 . THR B 1 372 ? 24.506 9.255   20.297 1.00 87.80  ? 372 THR B OG1 1 
ATOM   5112 C CG2 . THR B 1 372 ? 26.148 8.136   18.944 1.00 88.20  ? 372 THR B CG2 1 
ATOM   5113 N N   . THR B 1 397 ? 20.182 -5.047  12.455 1.00 89.17  ? 397 THR B N   1 
ATOM   5114 C CA  . THR B 1 397 ? 20.197 -3.706  13.111 1.00 90.17  ? 397 THR B CA  1 
ATOM   5115 C C   . THR B 1 397 ? 18.834 -3.017  12.961 1.00 89.65  ? 397 THR B C   1 
ATOM   5116 O O   . THR B 1 397 ? 18.508 -2.477  11.894 1.00 92.80  ? 397 THR B O   1 
ATOM   5117 C CB  . THR B 1 397 ? 21.313 -2.811  12.513 1.00 89.34  ? 397 THR B CB  1 
ATOM   5118 O OG1 . THR B 1 397 ? 22.569 -3.490  12.611 1.00 85.41  ? 397 THR B OG1 1 
ATOM   5119 C CG2 . THR B 1 397 ? 21.412 -1.494  13.264 1.00 87.57  ? 397 THR B CG2 1 
ATOM   5120 N N   . VAL B 1 398 ? 18.049 -3.038  14.038 1.00 89.41  ? 398 VAL B N   1 
ATOM   5121 C CA  . VAL B 1 398 ? 16.714 -2.436  14.052 1.00 89.46  ? 398 VAL B CA  1 
ATOM   5122 C C   . VAL B 1 398 ? 16.670 -1.104  14.815 1.00 91.59  ? 398 VAL B C   1 
ATOM   5123 O O   . VAL B 1 398 ? 17.560 -0.816  15.622 1.00 92.34  ? 398 VAL B O   1 
ATOM   5124 C CB  . VAL B 1 398 ? 15.688 -3.411  14.663 1.00 88.20  ? 398 VAL B CB  1 
ATOM   5125 C CG1 . VAL B 1 398 ? 15.888 -4.812  14.075 1.00 87.68  ? 398 VAL B CG1 1 
ATOM   5126 C CG2 . VAL B 1 398 ? 15.810 -3.434  16.180 1.00 85.98  ? 398 VAL B CG2 1 
ATOM   5127 N N   . ASN B 1 399 ? 15.633 -0.302  14.573 1.00 87.76  ? 399 ASN B N   1 
ATOM   5128 C CA  . ASN B 1 399 ? 15.503 0.991   15.247 1.00 86.77  ? 399 ASN B CA  1 
ATOM   5129 C C   . ASN B 1 399 ? 15.158 0.879   16.741 1.00 84.62  ? 399 ASN B C   1 
ATOM   5130 O O   . ASN B 1 399 ? 14.138 0.291   17.111 1.00 80.78  ? 399 ASN B O   1 
ATOM   5131 C CB  . ASN B 1 399 ? 14.501 1.898   14.518 1.00 88.89  ? 399 ASN B CB  1 
ATOM   5132 C CG  . ASN B 1 399 ? 15.185 2.999   13.697 1.00 86.86  ? 399 ASN B CG  1 
ATOM   5133 O OD1 . ASN B 1 399 ? 15.207 4.168   14.094 1.00 87.24  ? 399 ASN B OD1 1 
ATOM   5134 N ND2 . ASN B 1 399 ? 15.732 2.626   12.545 1.00 91.60  ? 399 ASN B ND2 1 
ATOM   5135 N N   . PRO B 1 400 ? 16.017 1.464   17.608 1.00 83.67  ? 400 PRO B N   1 
ATOM   5136 C CA  . PRO B 1 400 ? 16.047 1.576   19.071 1.00 84.13  ? 400 PRO B CA  1 
ATOM   5137 C C   . PRO B 1 400 ? 14.788 1.658   19.958 1.00 87.84  ? 400 PRO B C   1 
ATOM   5138 O O   . PRO B 1 400 ? 14.870 1.335   21.147 1.00 89.31  ? 400 PRO B O   1 
ATOM   5139 C CB  . PRO B 1 400 ? 16.982 2.757   19.283 1.00 80.27  ? 400 PRO B CB  1 
ATOM   5140 C CG  . PRO B 1 400 ? 18.025 2.481   18.280 1.00 77.01  ? 400 PRO B CG  1 
ATOM   5141 C CD  . PRO B 1 400 ? 17.210 2.130   17.046 1.00 83.82  ? 400 PRO B CD  1 
ATOM   5142 N N   . GLU B 1 401 ? 13.647 2.118   19.448 1.00 87.17  ? 401 GLU B N   1 
ATOM   5143 C CA  . GLU B 1 401 ? 12.449 2.142   20.301 1.00 89.31  ? 401 GLU B CA  1 
ATOM   5144 C C   . GLU B 1 401 ? 12.132 0.692   20.736 1.00 90.07  ? 401 GLU B C   1 
ATOM   5145 O O   . GLU B 1 401 ? 11.689 0.439   21.862 1.00 89.77  ? 401 GLU B O   1 
ATOM   5146 C CB  . GLU B 1 401 ? 11.257 2.776   19.564 1.00 88.68  ? 401 GLU B CB  1 
ATOM   5147 C CG  . GLU B 1 401 ? 9.858  2.467   20.153 1.00 87.34  ? 401 GLU B CG  1 
ATOM   5148 C CD  . GLU B 1 401 ? 9.684  2.858   21.628 1.00 91.79  ? 401 GLU B CD  1 
ATOM   5149 O OE1 . GLU B 1 401 ? 9.279  1.984   22.431 1.00 82.33  ? 401 GLU B OE1 1 
ATOM   5150 O OE2 . GLU B 1 401 ? 9.926  4.036   21.980 1.00 88.58  ? 401 GLU B OE2 1 
ATOM   5151 N N   . GLN B 1 402 ? 12.419 -0.252  19.841 1.00 89.14  ? 402 GLN B N   1 
ATOM   5152 C CA  . GLN B 1 402 ? 12.200 -1.676  20.085 1.00 86.93  ? 402 GLN B CA  1 
ATOM   5153 C C   . GLN B 1 402 ? 13.368 -2.261  20.881 1.00 87.08  ? 402 GLN B C   1 
ATOM   5154 O O   . GLN B 1 402 ? 13.296 -3.392  21.367 1.00 90.31  ? 402 GLN B O   1 
ATOM   5155 C CB  . GLN B 1 402 ? 12.053 -2.422  18.750 1.00 88.13  ? 402 GLN B CB  1 
ATOM   5156 C CG  . GLN B 1 402 ? 10.891 -1.933  17.878 1.00 90.05  ? 402 GLN B CG  1 
ATOM   5157 C CD  . GLN B 1 402 ? 10.889 -2.559  16.490 1.00 89.54  ? 402 GLN B CD  1 
ATOM   5158 O OE1 . GLN B 1 402 ? 11.925 -2.629  15.823 1.00 89.17  ? 402 GLN B OE1 1 
ATOM   5159 N NE2 . GLN B 1 402 ? 9.721  -3.013  16.048 1.00 89.24  ? 402 GLN B NE2 1 
ATOM   5160 N N   . TYR B 1 403 ? 14.448 -1.487  20.977 1.00 78.91  ? 403 TYR B N   1 
ATOM   5161 C CA  . TYR B 1 403 ? 15.659 -1.864  21.704 1.00 74.42  ? 403 TYR B CA  1 
ATOM   5162 C C   . TYR B 1 403 ? 15.355 -1.947  23.200 1.00 70.52  ? 403 TYR B C   1 
ATOM   5163 O O   . TYR B 1 403 ? 15.975 -2.721  23.930 1.00 64.69  ? 403 TYR B O   1 
ATOM   5164 C CB  . TYR B 1 403 ? 16.740 -0.811  21.447 1.00 71.90  ? 403 TYR B CB  1 
ATOM   5165 C CG  . TYR B 1 403 ? 18.150 -1.180  21.846 1.00 67.74  ? 403 TYR B CG  1 
ATOM   5166 C CD1 . TYR B 1 403 ? 18.556 -2.505  21.923 1.00 72.54  ? 403 TYR B CD1 1 
ATOM   5167 C CD2 . TYR B 1 403 ? 19.093 -0.190  22.111 1.00 71.44  ? 403 TYR B CD2 1 
ATOM   5168 C CE1 . TYR B 1 403 ? 19.869 -2.835  22.251 1.00 74.46  ? 403 TYR B CE1 1 
ATOM   5169 C CE2 . TYR B 1 403 ? 20.402 -0.508  22.439 1.00 66.82  ? 403 TYR B CE2 1 
ATOM   5170 C CZ  . TYR B 1 403 ? 20.785 -1.830  22.507 1.00 70.65  ? 403 TYR B CZ  1 
ATOM   5171 O OH  . TYR B 1 403 ? 22.085 -2.150  22.824 1.00 72.64  ? 403 TYR B OH  1 
ATOM   5172 N N   . SER B 1 404 ? 14.376 -1.162  23.637 1.00 68.09  ? 404 SER B N   1 
ATOM   5173 C CA  . SER B 1 404 ? 13.962 -1.129  25.037 1.00 67.67  ? 404 SER B CA  1 
ATOM   5174 C C   . SER B 1 404 ? 13.535 -2.489  25.557 1.00 69.42  ? 404 SER B C   1 
ATOM   5175 O O   . SER B 1 404 ? 14.176 -3.052  26.443 1.00 68.12  ? 404 SER B O   1 
ATOM   5176 C CB  . SER B 1 404 ? 12.806 -0.146  25.225 1.00 70.18  ? 404 SER B CB  1 
ATOM   5177 O OG  . SER B 1 404 ? 13.155 1.138   24.749 1.00 76.12  ? 404 SER B OG  1 
ATOM   5178 N N   . LYS B 1 405 ? 12.438 -2.999  24.998 1.00 71.84  ? 405 LYS B N   1 
ATOM   5179 C CA  . LYS B 1 405 ? 11.877 -4.294  25.381 1.00 71.39  ? 405 LYS B CA  1 
ATOM   5180 C C   . LYS B 1 405 ? 12.883 -5.431  25.259 1.00 66.44  ? 405 LYS B C   1 
ATOM   5181 O O   . LYS B 1 405 ? 12.855 -6.370  26.045 1.00 61.41  ? 405 LYS B O   1 
ATOM   5182 C CB  . LYS B 1 405 ? 10.637 -4.608  24.539 1.00 68.34  ? 405 LYS B CB  1 
ATOM   5183 C CG  . LYS B 1 405 ? 9.326  -4.541  25.300 1.00 70.22  ? 405 LYS B CG  1 
ATOM   5184 C CD  . LYS B 1 405 ? 8.161  -4.930  24.405 1.00 74.63  ? 405 LYS B CD  1 
ATOM   5185 C CE  . LYS B 1 405 ? 6.855  -4.970  25.179 1.00 72.88  ? 405 LYS B CE  1 
ATOM   5186 N NZ  . LYS B 1 405 ? 5.709  -5.338  24.303 1.00 72.67  ? 405 LYS B NZ  1 
ATOM   5187 N N   . ARG B 1 406 ? 13.766 -5.333  24.272 1.00 65.28  ? 406 ARG B N   1 
ATOM   5188 C CA  . ARG B 1 406 ? 14.786 -6.347  24.051 1.00 68.60  ? 406 ARG B CA  1 
ATOM   5189 C C   . ARG B 1 406 ? 15.833 -6.289  25.150 1.00 70.72  ? 406 ARG B C   1 
ATOM   5190 O O   . ARG B 1 406 ? 16.181 -7.319  25.729 1.00 69.03  ? 406 ARG B O   1 
ATOM   5191 C CB  . ARG B 1 406 ? 15.458 -6.150  22.690 1.00 72.28  ? 406 ARG B CB  1 
ATOM   5192 C CG  . ARG B 1 406 ? 16.433 -7.266  22.329 1.00 70.79  ? 406 ARG B CG  1 
ATOM   5193 C CD  . ARG B 1 406 ? 16.897 -7.173  20.887 1.00 71.85  ? 406 ARG B CD  1 
ATOM   5194 N NE  . ARG B 1 406 ? 17.679 -5.968  20.621 1.00 73.16  ? 406 ARG B NE  1 
ATOM   5195 C CZ  . ARG B 1 406 ? 18.212 -5.673  19.440 1.00 74.33  ? 406 ARG B CZ  1 
ATOM   5196 N NH1 . ARG B 1 406 ? 18.041 -6.490  18.412 1.00 79.21  ? 406 ARG B NH1 1 
ATOM   5197 N NH2 . ARG B 1 406 ? 18.972 -4.596  19.298 1.00 80.30  ? 406 ARG B NH2 1 
ATOM   5198 N N   . PHE B 1 407 ? 16.323 -5.079  25.430 1.00 73.71  ? 407 PHE B N   1 
ATOM   5199 C CA  . PHE B 1 407 ? 17.337 -4.848  26.462 1.00 71.87  ? 407 PHE B CA  1 
ATOM   5200 C C   . PHE B 1 407 ? 16.853 -5.354  27.812 1.00 68.99  ? 407 PHE B C   1 
ATOM   5201 O O   . PHE B 1 407 ? 17.607 -5.999  28.538 1.00 69.59  ? 407 PHE B O   1 
ATOM   5202 C CB  . PHE B 1 407 ? 17.673 -3.353  26.567 1.00 76.52  ? 407 PHE B CB  1 
ATOM   5203 C CG  . PHE B 1 407 ? 18.777 -3.036  27.550 1.00 72.38  ? 407 PHE B CG  1 
ATOM   5204 C CD1 . PHE B 1 407 ? 20.102 -2.965  27.128 1.00 75.46  ? 407 PHE B CD1 1 
ATOM   5205 C CD2 . PHE B 1 407 ? 18.495 -2.812  28.887 1.00 64.75  ? 407 PHE B CD2 1 
ATOM   5206 C CE1 . PHE B 1 407 ? 21.131 -2.679  28.025 1.00 61.65  ? 407 PHE B CE1 1 
ATOM   5207 C CE2 . PHE B 1 407 ? 19.513 -2.528  29.781 1.00 66.35  ? 407 PHE B CE2 1 
ATOM   5208 C CZ  . PHE B 1 407 ? 20.835 -2.462  29.348 1.00 62.55  ? 407 PHE B CZ  1 
ATOM   5209 N N   . ASN B 1 408 ? 15.596 -5.061  28.141 1.00 65.80  ? 408 ASN B N   1 
ATOM   5210 C CA  . ASN B 1 408 ? 15.031 -5.499  29.408 1.00 66.58  ? 408 ASN B CA  1 
ATOM   5211 C C   . ASN B 1 408 ? 14.776 -7.009  29.448 1.00 71.45  ? 408 ASN B C   1 
ATOM   5212 O O   . ASN B 1 408 ? 14.954 -7.643  30.490 1.00 65.85  ? 408 ASN B O   1 
ATOM   5213 C CB  . ASN B 1 408 ? 13.746 -4.743  29.723 1.00 64.40  ? 408 ASN B CB  1 
ATOM   5214 C CG  . ASN B 1 408 ? 13.296 -4.957  31.150 1.00 75.72  ? 408 ASN B CG  1 
ATOM   5215 O OD1 . ASN B 1 408 ? 13.020 -6.082  31.560 1.00 84.31  ? 408 ASN B OD1 1 
ATOM   5216 N ND2 . ASN B 1 408 ? 13.254 -3.884  31.928 1.00 76.44  ? 408 ASN B ND2 1 
ATOM   5217 N N   . GLU B 1 409 ? 14.366 -7.580  28.316 1.00 76.62  ? 409 GLU B N   1 
ATOM   5218 C CA  . GLU B 1 409 ? 14.095 -9.018  28.223 1.00 76.03  ? 409 GLU B CA  1 
ATOM   5219 C C   . GLU B 1 409 ? 15.384 -9.835  28.287 1.00 71.87  ? 409 GLU B C   1 
ATOM   5220 O O   . GLU B 1 409 ? 15.376 -10.967 28.771 1.00 74.62  ? 409 GLU B O   1 
ATOM   5221 C CB  . GLU B 1 409 ? 13.334 -9.345  26.933 1.00 81.21  ? 409 GLU B CB  1 
ATOM   5222 C CG  . GLU B 1 409 ? 12.821 -10.775 26.840 1.00 80.82  ? 409 GLU B CG  1 
ATOM   5223 C CD  . GLU B 1 409 ? 11.305 -10.859 26.857 1.00 79.62  ? 409 GLU B CD  1 
ATOM   5224 O OE1 . GLU B 1 409 ? 10.679 -10.287 27.775 1.00 79.97  ? 409 GLU B OE1 1 
ATOM   5225 O OE2 . GLU B 1 409 ? 10.737 -11.501 25.948 1.00 76.81  ? 409 GLU B OE2 1 
ATOM   5226 N N   . PHE B 1 410 ? 16.481 -9.285  27.767 1.00 65.88  ? 410 PHE B N   1 
ATOM   5227 C CA  . PHE B 1 410 ? 17.752 -9.993  27.823 1.00 64.79  ? 410 PHE B CA  1 
ATOM   5228 C C   . PHE B 1 410 ? 18.191 -9.999  29.276 1.00 64.01  ? 410 PHE B C   1 
ATOM   5229 O O   . PHE B 1 410 ? 18.443 -11.055 29.852 1.00 68.36  ? 410 PHE B O   1 
ATOM   5230 C CB  . PHE B 1 410 ? 18.824 -9.303  26.979 1.00 65.02  ? 410 PHE B CB  1 
ATOM   5231 C CG  . PHE B 1 410 ? 20.123 -10.062 26.914 1.00 60.73  ? 410 PHE B CG  1 
ATOM   5232 C CD1 . PHE B 1 410 ? 20.517 -10.682 25.739 1.00 59.69  ? 410 PHE B CD1 1 
ATOM   5233 C CD2 . PHE B 1 410 ? 20.952 -10.155 28.026 1.00 61.47  ? 410 PHE B CD2 1 
ATOM   5234 C CE1 . PHE B 1 410 ? 21.714 -11.382 25.674 1.00 65.34  ? 410 PHE B CE1 1 
ATOM   5235 C CE2 . PHE B 1 410 ? 22.153 -10.854 27.968 1.00 63.59  ? 410 PHE B CE2 1 
ATOM   5236 C CZ  . PHE B 1 410 ? 22.535 -11.468 26.793 1.00 62.78  ? 410 PHE B CZ  1 
ATOM   5237 N N   . MET B 1 411 ? 18.253 -8.809  29.867 1.00 65.30  ? 411 MET B N   1 
ATOM   5238 C CA  . MET B 1 411 ? 18.663 -8.658  31.258 1.00 60.32  ? 411 MET B CA  1 
ATOM   5239 C C   . MET B 1 411 ? 17.665 -9.312  32.203 1.00 59.79  ? 411 MET B C   1 
ATOM   5240 O O   . MET B 1 411 ? 18.034 -9.744  33.286 1.00 61.77  ? 411 MET B O   1 
ATOM   5241 C CB  . MET B 1 411 ? 18.827 -7.179  31.627 1.00 56.07  ? 411 MET B CB  1 
ATOM   5242 C CG  . MET B 1 411 ? 19.600 -6.338  30.617 1.00 51.15  ? 411 MET B CG  1 
ATOM   5243 S SD  . MET B 1 411 ? 21.075 -7.136  29.961 1.00 51.16  ? 411 MET B SD  1 
ATOM   5244 C CE  . MET B 1 411 ? 21.174 -6.376  28.351 1.00 46.11  ? 411 MET B CE  1 
ATOM   5245 N N   . SER B 1 412 ? 16.412 -9.423  31.776 1.00 57.77  ? 412 SER B N   1 
ATOM   5246 C CA  . SER B 1 412 ? 15.380 -10.029 32.614 1.00 66.90  ? 412 SER B CA  1 
ATOM   5247 C C   . SER B 1 412 ? 15.693 -11.491 32.965 1.00 70.67  ? 412 SER B C   1 
ATOM   5248 O O   . SER B 1 412 ? 15.275 -11.993 34.012 1.00 67.57  ? 412 SER B O   1 
ATOM   5249 C CB  . SER B 1 412 ? 14.013 -9.927  31.926 1.00 69.98  ? 412 SER B CB  1 
ATOM   5250 O OG  . SER B 1 412 ? 12.958 -10.316 32.793 1.00 72.32  ? 412 SER B OG  1 
ATOM   5251 N N   . ASN B 1 413 ? 16.450 -12.154 32.096 1.00 74.86  ? 413 ASN B N   1 
ATOM   5252 C CA  . ASN B 1 413 ? 16.819 -13.551 32.296 1.00 79.41  ? 413 ASN B CA  1 
ATOM   5253 C C   . ASN B 1 413 ? 18.161 -13.780 32.994 1.00 83.07  ? 413 ASN B C   1 
ATOM   5254 O O   . ASN B 1 413 ? 18.415 -14.877 33.497 1.00 86.23  ? 413 ASN B O   1 
ATOM   5255 C CB  . ASN B 1 413 ? 16.813 -14.295 30.961 1.00 85.33  ? 413 ASN B CB  1 
ATOM   5256 C CG  . ASN B 1 413 ? 15.425 -14.702 30.531 1.00 86.41  ? 413 ASN B CG  1 
ATOM   5257 O OD1 . ASN B 1 413 ? 14.997 -15.834 30.772 1.00 87.59  ? 413 ASN B OD1 1 
ATOM   5258 N ND2 . ASN B 1 413 ? 14.710 -13.786 29.886 1.00 91.23  ? 413 ASN B ND2 1 
ATOM   5259 N N   . ILE B 1 414 ? 19.022 -12.765 33.005 1.00 77.68  ? 414 ILE B N   1 
ATOM   5260 C CA  . ILE B 1 414 ? 20.331 -12.880 33.644 1.00 77.84  ? 414 ILE B CA  1 
ATOM   5261 C C   . ILE B 1 414 ? 20.198 -13.303 35.107 1.00 79.94  ? 414 ILE B C   1 
ATOM   5262 O O   . ILE B 1 414 ? 20.705 -14.345 35.528 1.00 83.31  ? 414 ILE B O   1 
ATOM   5263 C CB  . ILE B 1 414 ? 21.065 -11.532 33.652 1.00 70.92  ? 414 ILE B CB  1 
ATOM   5264 C CG1 . ILE B 1 414 ? 21.273 -11.013 32.239 1.00 76.02  ? 414 ILE B CG1 1 
ATOM   5265 C CG2 . ILE B 1 414 ? 22.397 -11.667 34.345 1.00 70.28  ? 414 ILE B CG2 1 
ATOM   5266 C CD1 . ILE B 1 414 ? 21.892 -9.626  32.215 1.00 84.90  ? 414 ILE B CD1 1 
ATOM   5267 N N   . LEU B 1 415 ? 19.472 -12.487 35.861 1.00 84.52  ? 415 LEU B N   1 
ATOM   5268 C CA  . LEU B 1 415 ? 19.274 -12.685 37.292 1.00 82.53  ? 415 LEU B CA  1 
ATOM   5269 C C   . LEU B 1 415 ? 18.444 -13.892 37.718 1.00 80.70  ? 415 LEU B C   1 
ATOM   5270 O O   . LEU B 1 415 ? 17.608 -14.393 36.964 1.00 73.07  ? 415 LEU B O   1 
ATOM   5271 C CB  . LEU B 1 415 ? 18.682 -11.413 37.901 1.00 80.37  ? 415 LEU B CB  1 
ATOM   5272 C CG  . LEU B 1 415 ? 19.238 -10.074 37.411 1.00 65.72  ? 415 LEU B CG  1 
ATOM   5273 C CD1 . LEU B 1 415 ? 18.339 -8.995  37.924 1.00 60.14  ? 415 LEU B CD1 1 
ATOM   5274 C CD2 . LEU B 1 415 ? 20.680 -9.871  37.851 1.00 62.26  ? 415 LEU B CD2 1 
ATOM   5275 N N   . THR B 1 416 ? 18.674 -14.309 38.964 1.00 83.68  ? 416 THR B N   1 
ATOM   5276 C CA  . THR B 1 416 ? 18.001 -15.447 39.595 1.00 87.59  ? 416 THR B CA  1 
ATOM   5277 C C   . THR B 1 416 ? 18.003 -15.297 41.123 1.00 88.29  ? 416 THR B C   1 
ATOM   5278 O O   . THR B 1 416 ? 18.990 -14.753 41.670 1.00 84.68  ? 416 THR B O   1 
ATOM   5279 C CB  . THR B 1 416 ? 18.694 -16.789 39.250 1.00 88.36  ? 416 THR B CB  1 
ATOM   5280 O OG1 . THR B 1 416 ? 20.114 -16.660 39.429 1.00 88.53  ? 416 THR B OG1 1 
ATOM   5281 C CG2 . THR B 1 416 ? 18.380 -17.218 37.815 1.00 89.63  ? 416 THR B CG2 1 
ATOM   5282 O OXT . THR B 1 416 ? 17.021 -15.741 41.757 1.00 88.89  ? 416 THR B OXT 1 
HETATM 5283 O O   . HOH C 2 .   ? 25.045 41.567  49.075 1.00 71.92  ? 417 HOH A O   1 
HETATM 5284 O O   . HOH C 2 .   ? 60.285 56.665  63.012 1.00 48.48  ? 418 HOH A O   1 
HETATM 5285 O O   . HOH C 2 .   ? 69.701 55.561  66.545 1.00 100.00 ? 419 HOH A O   1 
HETATM 5286 O O   . HOH C 2 .   ? 68.841 52.278  62.987 1.00 92.48  ? 420 HOH A O   1 
HETATM 5287 O O   . HOH C 2 .   ? 32.031 55.729  53.676 1.00 76.40  ? 421 HOH A O   1 
HETATM 5288 O O   . HOH C 2 .   ? 70.359 46.693  46.704 1.00 52.42  ? 422 HOH A O   1 
HETATM 5289 O O   . HOH C 2 .   ? 57.559 44.773  58.308 1.00 48.78  ? 423 HOH A O   1 
HETATM 5290 O O   . HOH C 2 .   ? 38.935 78.602  43.279 1.00 88.05  ? 424 HOH A O   1 
HETATM 5291 O O   . HOH C 2 .   ? 26.326 47.702  32.940 1.00 70.32  ? 425 HOH A O   1 
HETATM 5292 O O   . HOH C 2 .   ? 60.210 36.454  52.076 1.00 64.39  ? 426 HOH A O   1 
HETATM 5293 O O   . HOH C 2 .   ? 31.473 32.608  37.645 1.00 26.65  ? 427 HOH A O   1 
HETATM 5294 O O   . HOH C 2 .   ? 17.584 39.034  38.268 1.00 62.88  ? 428 HOH A O   1 
HETATM 5295 O O   . HOH C 2 .   ? 46.040 66.607  77.960 1.00 77.65  ? 429 HOH A O   1 
HETATM 5296 O O   . HOH D 2 .   ? 20.198 -17.803 42.099 1.00 64.61  ? 417 HOH B O   1 
HETATM 5297 O O   . HOH D 2 .   ? 56.995 23.503  34.109 1.00 46.03  ? 418 HOH B O   1 
HETATM 5298 O O   . HOH D 2 .   ? 45.589 27.704  23.651 1.00 57.07  ? 419 HOH B O   1 
HETATM 5299 O O   . HOH D 2 .   ? 51.006 31.206  24.394 1.00 49.29  ? 420 HOH B O   1 
HETATM 5300 O O   . HOH D 2 .   ? 30.768 -16.100 36.918 1.00 38.98  ? 421 HOH B O   1 
HETATM 5301 O O   . HOH D 2 .   ? 57.069 18.944  40.670 1.00 68.40  ? 422 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   ASN 4   4   ?   ?   ?   A . n 
A 1 5   CYS 5   5   ?   ?   ?   A . n 
A 1 6   THR 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   THR 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  VAL 11  11  ?   ?   ?   A . n 
A 1 12  ALA 12  12  ?   ?   ?   A . n 
A 1 13  VAL 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  PRO 15  15  ?   ?   ?   A . n 
A 1 16  LEU 16  16  ?   ?   ?   A . n 
A 1 17  SER 17  17  ?   ?   ?   A . n 
A 1 18  ALA 18  18  ?   ?   ?   A . n 
A 1 19  SER 19  19  ?   ?   ?   A . n 
A 1 20  LYS 20  20  ?   ?   ?   A . n 
A 1 21  THR 21  21  ?   ?   ?   A . n 
A 1 22  LYS 22  22  ?   ?   ?   A . n 
A 1 23  THR 23  23  ?   ?   ?   A . n 
A 1 24  LYS 24  24  ?   ?   ?   A . n 
A 1 25  LYS 25  25  ?   ?   ?   A . n 
A 1 26  LYS 26  26  ?   ?   ?   A . n 
A 1 27  HIS 27  27  ?   ?   ?   A . n 
A 1 28  PHE 28  28  ?   ?   ?   A . n 
A 1 29  VAL 29  29  ?   ?   ?   A . n 
A 1 30  CYS 30  30  ?   ?   ?   A . n 
A 1 31  GLN 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  VAL 33  33  ?   ?   ?   A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  MET 47  47  47  MET MET A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ASN 51  51  51  ASN ASN A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  MET 67  67  67  MET MET A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  CYS 99  99  99  CYS CYS A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 MET 101 101 101 MET MET A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ASN 128 128 128 ASN ASN A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 GLY 133 133 ?   ?   ?   A . n 
A 1 134 ARG 134 134 ?   ?   ?   A . n 
A 1 135 CYS 135 135 ?   ?   ?   A . n 
A 1 136 GLY 136 136 ?   ?   ?   A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 HIS 161 161 161 HIS HIS A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 HIS 168 168 168 HIS HIS A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 CYS 174 174 174 CYS CYS A . n 
A 1 175 HIS 175 175 175 HIS HIS A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 MET 186 186 186 MET MET A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 MET 198 198 198 MET MET A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ARG 213 213 213 ARG ARG A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 LYS 218 218 218 LYS LYS A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 GLU 225 225 225 GLU GLU A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 THR 237 237 237 THR THR A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 HIS 251 251 251 HIS HIS A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 SER 256 256 256 SER SER A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ASN 259 259 259 ASN ASN A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 GLU 269 269 269 GLU GLU A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 GLN 273 273 273 GLN GLN A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 ILE 276 276 276 ILE ILE A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 VAL 298 298 298 VAL VAL A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 CYS 307 307 ?   ?   ?   A . n 
A 1 308 GLU 308 308 ?   ?   ?   A . n 
A 1 309 ASN 309 309 ?   ?   ?   A . n 
A 1 310 ASP 310 310 ?   ?   ?   A . n 
A 1 311 GLY 311 311 ?   ?   ?   A . n 
A 1 312 VAL 312 312 ?   ?   ?   A . n 
A 1 313 GLY 313 313 ?   ?   ?   A . n 
A 1 314 GLY 314 314 ?   ?   ?   A . n 
A 1 315 ASN 315 315 ?   ?   ?   A . n 
A 1 316 LEU 316 316 ?   ?   ?   A . n 
A 1 317 LEU 317 317 ?   ?   ?   A . n 
A 1 318 CYS 318 318 ?   ?   ?   A . n 
A 1 319 SER 319 319 ?   ?   ?   A . n 
A 1 320 TYR 320 320 ?   ?   ?   A . n 
A 1 321 GLY 321 321 ?   ?   ?   A . n 
A 1 322 THR 322 322 ?   ?   ?   A . n 
A 1 323 PRO 323 323 ?   ?   ?   A . n 
A 1 324 PRO 324 324 ?   ?   ?   A . n 
A 1 325 ASP 325 325 ?   ?   ?   A . n 
A 1 326 SER 326 326 ?   ?   ?   A . n 
A 1 327 PRO 327 327 ?   ?   ?   A . n 
A 1 328 GLY 328 328 ?   ?   ?   A . n 
A 1 329 ASN 329 329 ?   ?   ?   A . n 
A 1 330 LEU 330 330 ?   ?   ?   A . n 
A 1 331 LEU 331 331 ?   ?   ?   A . n 
A 1 332 SER 332 332 ?   ?   ?   A . n 
A 1 333 PHE 333 333 ?   ?   ?   A . n 
A 1 334 PRO 334 334 ?   ?   ?   A . n 
A 1 335 ARG 335 335 ?   ?   ?   A . n 
A 1 336 PHE 336 336 ?   ?   ?   A . n 
A 1 337 PHE 337 337 ?   ?   ?   A . n 
A 1 338 GLY 338 338 ?   ?   ?   A . n 
A 1 339 PRO 339 339 ?   ?   ?   A . n 
A 1 340 GLY 340 340 ?   ?   ?   A . n 
A 1 341 GLU 341 341 ?   ?   ?   A . n 
A 1 342 PHE 342 342 342 PHE PHE A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 TYR 349 349 349 TYR TYR A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 MET 351 351 351 MET MET A . n 
A 1 352 LYS 352 352 352 LYS LYS A . n 
A 1 353 SER 353 353 353 SER SER A . n 
A 1 354 HIS 354 354 354 HIS HIS A . n 
A 1 355 GLU 355 355 355 GLU GLU A . n 
A 1 356 SER 356 356 356 SER SER A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 LYS 359 359 359 LYS LYS A . n 
A 1 360 LYS 360 360 360 LYS LYS A . n 
A 1 361 GLU 361 361 361 GLU GLU A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 TYR 363 363 363 TYR TYR A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 MET 365 365 365 MET MET A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 LEU 371 371 371 LEU LEU A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 PRO 373 373 ?   ?   ?   A . n 
A 1 374 TYR 374 374 ?   ?   ?   A . n 
A 1 375 ASP 375 375 ?   ?   ?   A . n 
A 1 376 THR 376 376 ?   ?   ?   A . n 
A 1 377 LYS 377 377 ?   ?   ?   A . n 
A 1 378 LYS 378 378 ?   ?   ?   A . n 
A 1 379 LYS 379 379 ?   ?   ?   A . n 
A 1 380 ALA 380 380 ?   ?   ?   A . n 
A 1 381 ALA 381 381 ?   ?   ?   A . n 
A 1 382 HIS 382 382 ?   ?   ?   A . n 
A 1 383 ALA 383 383 ?   ?   ?   A . n 
A 1 384 ALA 384 384 ?   ?   ?   A . n 
A 1 385 LYS 385 385 ?   ?   ?   A . n 
A 1 386 THR 386 386 ?   ?   ?   A . n 
A 1 387 VAL 387 387 ?   ?   ?   A . n 
A 1 388 LYS 388 388 ?   ?   ?   A . n 
A 1 389 HIS 389 389 ?   ?   ?   A . n 
A 1 390 GLY 390 390 ?   ?   ?   A . n 
A 1 391 ALA 391 391 391 ALA ALA A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 ILE 395 395 395 ILE ILE A . n 
A 1 396 SER 396 396 396 SER SER A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 VAL 398 398 398 VAL VAL A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 PRO 400 400 400 PRO PRO A . n 
A 1 401 GLU 401 401 401 GLU GLU A . n 
A 1 402 GLN 402 402 402 GLN GLN A . n 
A 1 403 TYR 403 403 403 TYR TYR A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 ARG 406 406 406 ARG ARG A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 ASN 408 408 408 ASN ASN A . n 
A 1 409 GLU 409 409 409 GLU GLU A . n 
A 1 410 PHE 410 410 410 PHE PHE A . n 
A 1 411 MET 411 411 411 MET MET A . n 
A 1 412 SER 412 412 412 SER SER A . n 
A 1 413 ASN 413 413 413 ASN ASN A . n 
A 1 414 ILE 414 414 414 ILE ILE A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 THR 416 416 416 THR THR A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   ?   ?   ?   B . n 
B 1 4   ASN 4   4   ?   ?   ?   B . n 
B 1 5   CYS 5   5   ?   ?   ?   B . n 
B 1 6   THR 6   6   ?   ?   ?   B . n 
B 1 7   SER 7   7   ?   ?   ?   B . n 
B 1 8   THR 8   8   ?   ?   ?   B . n 
B 1 9   THR 9   9   ?   ?   ?   B . n 
B 1 10  ALA 10  10  ?   ?   ?   B . n 
B 1 11  VAL 11  11  ?   ?   ?   B . n 
B 1 12  ALA 12  12  ?   ?   ?   B . n 
B 1 13  VAL 13  13  ?   ?   ?   B . n 
B 1 14  ALA 14  14  ?   ?   ?   B . n 
B 1 15  PRO 15  15  ?   ?   ?   B . n 
B 1 16  LEU 16  16  ?   ?   ?   B . n 
B 1 17  SER 17  17  ?   ?   ?   B . n 
B 1 18  ALA 18  18  ?   ?   ?   B . n 
B 1 19  SER 19  19  ?   ?   ?   B . n 
B 1 20  LYS 20  20  ?   ?   ?   B . n 
B 1 21  THR 21  21  ?   ?   ?   B . n 
B 1 22  LYS 22  22  ?   ?   ?   B . n 
B 1 23  THR 23  23  ?   ?   ?   B . n 
B 1 24  LYS 24  24  ?   ?   ?   B . n 
B 1 25  LYS 25  25  ?   ?   ?   B . n 
B 1 26  LYS 26  26  ?   ?   ?   B . n 
B 1 27  HIS 27  27  ?   ?   ?   B . n 
B 1 28  PHE 28  28  ?   ?   ?   B . n 
B 1 29  VAL 29  29  ?   ?   ?   B . n 
B 1 30  CYS 30  30  ?   ?   ?   B . n 
B 1 31  GLN 31  31  ?   ?   ?   B . n 
B 1 32  LYS 32  32  ?   ?   ?   B . n 
B 1 33  VAL 33  33  ?   ?   ?   B . n 
B 1 34  LYS 34  34  ?   ?   ?   B . n 
B 1 35  LEU 35  35  ?   ?   ?   B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  SER 39  39  39  SER SER B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  MET 47  47  47  MET MET B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  VAL 50  50  50  VAL VAL B . n 
B 1 51  ASN 51  51  51  ASN ASN B . n 
B 1 52  HIS 52  52  52  HIS HIS B . n 
B 1 53  THR 53  53  53  THR THR B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  SER 58  58  58  SER SER B . n 
B 1 59  ASN 59  59  59  ASN ASN B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  PRO 61  61  61  PRO PRO B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  MET 65  65  65  MET MET B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  MET 67  67  67  MET MET B . n 
B 1 68  PRO 68  68  68  PRO PRO B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  TYR 74  74  74  TYR TYR B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  ASP 80  80  80  ASP ASP B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  HIS 82  82  82  HIS HIS B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASN 88  88  88  ASN ASN B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  PHE 95  95  95  PHE PHE B . n 
B 1 96  LYS 96  96  96  LYS LYS B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  CYS 99  99  99  CYS CYS B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 MET 101 101 101 MET MET B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 PHE 103 103 103 PHE PHE B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 ARG 109 109 109 ARG ARG B . n 
B 1 110 PHE 110 110 110 PHE PHE B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 ASP 114 114 114 ASP ASP B . n 
B 1 115 GLN 115 115 115 GLN GLN B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 TYR 117 117 117 TYR TYR B . n 
B 1 118 GLN 118 118 118 GLN GLN B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 PRO 126 126 126 PRO PRO B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 ASN 128 128 128 ASN ASN B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 SER 131 131 131 SER SER B . n 
B 1 132 GLN 132 132 132 GLN GLN B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 CYS 135 135 135 CYS CYS B . n 
B 1 136 GLY 136 136 136 GLY GLY B . n 
B 1 137 THR 137 137 137 THR THR B . n 
B 1 138 ARG 138 138 138 ARG ARG B . n 
B 1 139 PHE 139 139 139 PHE PHE B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 THR 142 142 142 THR THR B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 ARG 146 146 146 ARG ARG B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 THR 151 151 151 THR THR B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 SER 153 153 153 SER SER B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 MET 160 160 160 MET MET B . n 
B 1 161 HIS 161 161 161 HIS HIS B . n 
B 1 162 ASN 162 162 162 ASN ASN B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 LYS 165 165 165 LYS LYS B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 TYR 167 167 167 TYR TYR B . n 
B 1 168 HIS 168 168 168 HIS HIS B . n 
B 1 169 GLN 169 169 169 GLN GLN B . n 
B 1 170 PHE 170 170 170 PHE PHE B . n 
B 1 171 ILE 171 171 171 ILE ILE B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 CYS 174 174 174 CYS CYS B . n 
B 1 175 HIS 175 175 175 HIS HIS B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 THR 178 178 178 THR THR B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 GLN 182 182 182 GLN GLN B . n 
B 1 183 PHE 183 183 183 PHE PHE B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 MET 186 186 186 MET MET B . n 
B 1 187 TYR 187 187 187 TYR TYR B . n 
B 1 188 ARG 188 188 188 ARG ARG B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 THR 190 190 190 THR THR B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 GLU 195 195 195 GLU GLU B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 MET 198 198 198 MET MET B . n 
B 1 199 VAL 199 199 199 VAL VAL B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 ARG 202 202 202 ARG ARG B . n 
B 1 203 ASN 203 203 203 ASN ASN B . n 
B 1 204 VAL 204 204 204 VAL VAL B . n 
B 1 205 PHE 205 205 205 PHE PHE B . n 
B 1 206 SER 206 206 206 SER SER B . n 
B 1 207 HIS 207 207 207 HIS HIS B . n 
B 1 208 ARG 208 208 208 ARG ARG B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 THR 210 210 210 THR THR B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ARG 213 213 213 ARG ARG B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 TYR 215 215 215 TYR TYR B . n 
B 1 216 ASP 216 216 216 ASP ASP B . n 
B 1 217 LEU 217 217 217 LEU LEU B . n 
B 1 218 LYS 218 218 218 LYS LYS B . n 
B 1 219 GLY 219 219 219 GLY GLY B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 THR 221 221 221 THR THR B . n 
B 1 222 VAL 222 222 222 VAL VAL B . n 
B 1 223 ALA 223 223 223 ALA ALA B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 GLU 225 225 225 GLU GLU B . n 
B 1 226 ALA 226 226 226 ALA ALA B . n 
B 1 227 SER 227 227 227 SER SER B . n 
B 1 228 ASP 228 228 228 ASP ASP B . n 
B 1 229 LYS 229 229 229 LYS LYS B . n 
B 1 230 GLU 230 230 230 GLU GLU B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 PRO 236 236 236 PRO PRO B . n 
B 1 237 THR 237 237 237 THR THR B . n 
B 1 238 PHE 238 238 238 PHE PHE B . n 
B 1 239 LYS 239 239 239 LYS LYS B . n 
B 1 240 ASP 240 240 240 ASP ASP B . n 
B 1 241 ASN 241 241 241 ASN ASN B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 PHE 243 243 243 PHE PHE B . n 
B 1 244 LEU 244 244 244 LEU LEU B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
B 1 246 GLU 246 246 246 GLU GLU B . n 
B 1 247 GLY 247 247 247 GLY GLY B . n 
B 1 248 GLN 248 248 248 GLN GLN B . n 
B 1 249 LYS 249 249 249 LYS LYS B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 HIS 251 251 251 HIS HIS B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 SER 256 256 256 SER SER B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 LYS 258 258 258 LYS LYS B . n 
B 1 259 ASN 259 259 259 ASN ASN B . n 
B 1 260 PHE 260 260 260 PHE PHE B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 LYS 263 263 263 LYS LYS B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 LYS 265 265 265 LYS LYS B . n 
B 1 266 ARG 266 266 266 ARG ARG B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 VAL 268 268 268 VAL VAL B . n 
B 1 269 GLU 269 269 269 GLU GLU B . n 
B 1 270 PHE 270 270 270 PHE PHE B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 ALA 272 272 272 ALA ALA B . n 
B 1 273 GLN 273 273 273 GLN GLN B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 LYS 275 275 275 LYS LYS B . n 
B 1 276 ILE 276 276 276 ILE ILE B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 ASP 278 278 278 ASP ASP B . n 
B 1 279 TYR 279 279 279 TYR TYR B . n 
B 1 280 SER 280 280 280 SER SER B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 VAL 283 283 283 VAL VAL B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 HIS 286 286 286 HIS HIS B . n 
B 1 287 ASP 287 287 287 ASP ASP B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 ASP 289 289 289 ASP ASP B . n 
B 1 290 ARG 290 290 290 ARG ARG B . n 
B 1 291 ALA 291 291 291 ALA ALA B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 GLN 293 293 293 GLN GLN B . n 
B 1 294 GLU 294 294 294 GLU GLU B . n 
B 1 295 GLU 295 295 295 GLU GLU B . n 
B 1 296 MET 296 296 296 MET MET B . n 
B 1 297 GLU 297 297 297 GLU GLU B . n 
B 1 298 VAL 298 298 298 VAL VAL B . n 
B 1 299 GLU 299 299 299 GLU GLU B . n 
B 1 300 GLU 300 300 300 GLU GLU B . n 
B 1 301 ARG 301 301 301 ARG ARG B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 GLU 303 303 303 GLU GLU B . n 
B 1 304 ASP 304 304 ?   ?   ?   B . n 
B 1 305 GLU 305 305 ?   ?   ?   B . n 
B 1 306 GLU 306 306 ?   ?   ?   B . n 
B 1 307 CYS 307 307 ?   ?   ?   B . n 
B 1 308 GLU 308 308 ?   ?   ?   B . n 
B 1 309 ASN 309 309 ?   ?   ?   B . n 
B 1 310 ASP 310 310 ?   ?   ?   B . n 
B 1 311 GLY 311 311 ?   ?   ?   B . n 
B 1 312 VAL 312 312 ?   ?   ?   B . n 
B 1 313 GLY 313 313 ?   ?   ?   B . n 
B 1 314 GLY 314 314 ?   ?   ?   B . n 
B 1 315 ASN 315 315 ?   ?   ?   B . n 
B 1 316 LEU 316 316 ?   ?   ?   B . n 
B 1 317 LEU 317 317 ?   ?   ?   B . n 
B 1 318 CYS 318 318 ?   ?   ?   B . n 
B 1 319 SER 319 319 ?   ?   ?   B . n 
B 1 320 TYR 320 320 ?   ?   ?   B . n 
B 1 321 GLY 321 321 ?   ?   ?   B . n 
B 1 322 THR 322 322 ?   ?   ?   B . n 
B 1 323 PRO 323 323 ?   ?   ?   B . n 
B 1 324 PRO 324 324 ?   ?   ?   B . n 
B 1 325 ASP 325 325 ?   ?   ?   B . n 
B 1 326 SER 326 326 ?   ?   ?   B . n 
B 1 327 PRO 327 327 ?   ?   ?   B . n 
B 1 328 GLY 328 328 ?   ?   ?   B . n 
B 1 329 ASN 329 329 ?   ?   ?   B . n 
B 1 330 LEU 330 330 ?   ?   ?   B . n 
B 1 331 LEU 331 331 ?   ?   ?   B . n 
B 1 332 SER 332 332 ?   ?   ?   B . n 
B 1 333 PHE 333 333 ?   ?   ?   B . n 
B 1 334 PRO 334 334 ?   ?   ?   B . n 
B 1 335 ARG 335 335 ?   ?   ?   B . n 
B 1 336 PHE 336 336 ?   ?   ?   B . n 
B 1 337 PHE 337 337 ?   ?   ?   B . n 
B 1 338 GLY 338 338 ?   ?   ?   B . n 
B 1 339 PRO 339 339 ?   ?   ?   B . n 
B 1 340 GLY 340 340 ?   ?   ?   B . n 
B 1 341 GLU 341 341 ?   ?   ?   B . n 
B 1 342 PHE 342 342 ?   ?   ?   B . n 
B 1 343 ASP 343 343 343 ASP ASP B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 VAL 346 346 346 VAL VAL B . n 
B 1 347 ASP 347 347 347 ASP ASP B . n 
B 1 348 VAL 348 348 348 VAL VAL B . n 
B 1 349 TYR 349 349 349 TYR TYR B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 MET 351 351 351 MET MET B . n 
B 1 352 LYS 352 352 352 LYS LYS B . n 
B 1 353 SER 353 353 353 SER SER B . n 
B 1 354 HIS 354 354 354 HIS HIS B . n 
B 1 355 GLU 355 355 355 GLU GLU B . n 
B 1 356 SER 356 356 356 SER SER B . n 
B 1 357 SER 357 357 357 SER SER B . n 
B 1 358 PRO 358 358 358 PRO PRO B . n 
B 1 359 LYS 359 359 359 LYS LYS B . n 
B 1 360 LYS 360 360 360 LYS LYS B . n 
B 1 361 GLU 361 361 361 GLU GLU B . n 
B 1 362 VAL 362 362 362 VAL VAL B . n 
B 1 363 TYR 363 363 363 TYR TYR B . n 
B 1 364 PHE 364 364 364 PHE PHE B . n 
B 1 365 MET 365 365 365 MET MET B . n 
B 1 366 ALA 366 366 366 ALA ALA B . n 
B 1 367 ILE 367 367 367 ILE ILE B . n 
B 1 368 ILE 368 368 368 ILE ILE B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 ILE 370 370 370 ILE ILE B . n 
B 1 371 LEU 371 371 371 LEU LEU B . n 
B 1 372 THR 372 372 372 THR THR B . n 
B 1 373 PRO 373 373 ?   ?   ?   B . n 
B 1 374 TYR 374 374 ?   ?   ?   B . n 
B 1 375 ASP 375 375 ?   ?   ?   B . n 
B 1 376 THR 376 376 ?   ?   ?   B . n 
B 1 377 LYS 377 377 ?   ?   ?   B . n 
B 1 378 LYS 378 378 ?   ?   ?   B . n 
B 1 379 LYS 379 379 ?   ?   ?   B . n 
B 1 380 ALA 380 380 ?   ?   ?   B . n 
B 1 381 ALA 381 381 ?   ?   ?   B . n 
B 1 382 HIS 382 382 ?   ?   ?   B . n 
B 1 383 ALA 383 383 ?   ?   ?   B . n 
B 1 384 ALA 384 384 ?   ?   ?   B . n 
B 1 385 LYS 385 385 ?   ?   ?   B . n 
B 1 386 THR 386 386 ?   ?   ?   B . n 
B 1 387 VAL 387 387 ?   ?   ?   B . n 
B 1 388 LYS 388 388 ?   ?   ?   B . n 
B 1 389 HIS 389 389 ?   ?   ?   B . n 
B 1 390 GLY 390 390 ?   ?   ?   B . n 
B 1 391 ALA 391 391 ?   ?   ?   B . n 
B 1 392 GLY 392 392 ?   ?   ?   B . n 
B 1 393 ALA 393 393 ?   ?   ?   B . n 
B 1 394 GLU 394 394 ?   ?   ?   B . n 
B 1 395 ILE 395 395 ?   ?   ?   B . n 
B 1 396 SER 396 396 ?   ?   ?   B . n 
B 1 397 THR 397 397 397 THR THR B . n 
B 1 398 VAL 398 398 398 VAL VAL B . n 
B 1 399 ASN 399 399 399 ASN ASN B . n 
B 1 400 PRO 400 400 400 PRO PRO B . n 
B 1 401 GLU 401 401 401 GLU GLU B . n 
B 1 402 GLN 402 402 402 GLN GLN B . n 
B 1 403 TYR 403 403 403 TYR TYR B . n 
B 1 404 SER 404 404 404 SER SER B . n 
B 1 405 LYS 405 405 405 LYS LYS B . n 
B 1 406 ARG 406 406 406 ARG ARG B . n 
B 1 407 PHE 407 407 407 PHE PHE B . n 
B 1 408 ASN 408 408 408 ASN ASN B . n 
B 1 409 GLU 409 409 409 GLU GLU B . n 
B 1 410 PHE 410 410 410 PHE PHE B . n 
B 1 411 MET 411 411 411 MET MET B . n 
B 1 412 SER 412 412 412 SER SER B . n 
B 1 413 ASN 413 413 413 ASN ASN B . n 
B 1 414 ILE 414 414 414 ILE ILE B . n 
B 1 415 LEU 415 415 415 LEU LEU B . n 
B 1 416 THR 416 416 416 THR THR B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-07 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
SHARP     phasing          .   ? 3 
X-PLOR    refinement       3.8 ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N B ILE 368 ? ? CA B ILE 368 ? ? C  B ILE 368 ? ? 127.81 111.00 16.81 2.70 N 
2 1 C B ASN 399 ? ? N  B PRO 400 ? ? CA B PRO 400 ? ? 133.20 119.30 13.90 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 37  ? ? -121.58 -163.08 
2  1 SER A 39  ? ? -82.60  -71.52  
3  1 ASN A 88  ? ? -148.23 -26.44  
4  1 SER A 129 ? ? -113.44 -111.39 
5  1 ARG A 145 ? ? 58.69   0.01    
6  1 CYS A 174 ? ? -141.78 -8.90   
7  1 ASN A 177 ? ? -105.84 78.58   
8  1 ARG A 208 ? ? -96.16  -63.86  
9  1 VAL A 222 ? ? -10.77  120.68  
10 1 ALA A 223 ? ? -163.91 -120.91 
11 1 GLU A 225 ? ? -91.05  35.88   
12 1 ASP A 228 ? ? -72.11  -101.78 
13 1 LYS A 231 ? ? -57.03  -8.22   
14 1 ALA A 232 ? ? -26.04  -87.46  
15 1 LYS A 233 ? ? -164.23 -30.90  
16 1 ASP A 234 ? ? -66.37  -150.93 
17 1 LEU A 274 ? ? -76.67  -94.18  
18 1 LYS A 275 ? ? -174.89 -7.85   
19 1 ASP A 304 ? ? -90.30  -70.08  
20 1 ASP A 343 ? ? -150.09 -54.51  
21 1 LYS A 352 ? ? -163.29 -4.69   
22 1 LYS A 359 ? ? -69.89  95.11   
23 1 LYS A 360 ? ? -160.45 -22.14  
24 1 ILE A 368 ? ? -127.42 -53.88  
25 1 ASP A 369 ? ? -83.33  43.66   
26 1 ILE A 370 ? ? -48.45  -15.56  
27 1 LEU A 371 ? ? -111.58 -92.58  
28 1 ALA A 393 ? ? -162.11 114.14  
29 1 SER A 396 ? ? 153.25  69.44   
30 1 THR A 397 ? ? -113.13 -154.78 
31 1 ARG B 37  ? ? -115.93 -158.92 
32 1 SER B 39  ? ? -82.70  -71.22  
33 1 ASN B 88  ? ? -149.74 -26.43  
34 1 SER B 129 ? ? -114.84 -77.05  
35 1 ASP B 130 ? ? 178.92  87.43   
36 1 GLN B 132 ? ? -37.53  145.67  
37 1 ARG B 134 ? ? -148.51 -136.23 
38 1 THR B 137 ? ? -144.62 -57.94  
39 1 ARG B 145 ? ? 59.12   0.34    
40 1 GLU B 173 ? ? -99.42  35.07   
41 1 CYS B 174 ? ? -141.49 -9.29   
42 1 ARG B 208 ? ? -103.42 -73.51  
43 1 VAL B 222 ? ? -5.01   106.65  
44 1 ALA B 223 ? ? -146.31 -116.02 
45 1 GLU B 225 ? ? -176.01 64.74   
46 1 ALA B 226 ? ? -171.69 -151.14 
47 1 ALA B 232 ? ? -107.16 47.48   
48 1 GLN B 248 ? ? -23.21  122.18  
49 1 LYS B 275 ? ? -5.16   79.74   
50 1 ASP B 278 ? ? 12.78   86.04   
51 1 ASP B 347 ? ? -17.85  -41.37  
52 1 ALA B 350 ? ? 173.57  49.98   
53 1 MET B 351 ? ? -77.64  -158.78 
54 1 LYS B 352 ? ? 83.98   -6.34   
55 1 PRO B 358 ? ? -122.30 -101.97 
56 1 LYS B 360 ? ? -34.12  89.98   
57 1 ILE B 368 ? ? -124.28 -62.88  
58 1 LEU B 371 ? ? -84.89  -101.26 
59 1 PRO B 400 ? ? -32.24  -24.83  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A SER 3   ? A SER 3   
4   1 Y 1 A ASN 4   ? A ASN 4   
5   1 Y 1 A CYS 5   ? A CYS 5   
6   1 Y 1 A THR 6   ? A THR 6   
7   1 Y 1 A SER 7   ? A SER 7   
8   1 Y 1 A THR 8   ? A THR 8   
9   1 Y 1 A THR 9   ? A THR 9   
10  1 Y 1 A ALA 10  ? A ALA 10  
11  1 Y 1 A VAL 11  ? A VAL 11  
12  1 Y 1 A ALA 12  ? A ALA 12  
13  1 Y 1 A VAL 13  ? A VAL 13  
14  1 Y 1 A ALA 14  ? A ALA 14  
15  1 Y 1 A PRO 15  ? A PRO 15  
16  1 Y 1 A LEU 16  ? A LEU 16  
17  1 Y 1 A SER 17  ? A SER 17  
18  1 Y 1 A ALA 18  ? A ALA 18  
19  1 Y 1 A SER 19  ? A SER 19  
20  1 Y 1 A LYS 20  ? A LYS 20  
21  1 Y 1 A THR 21  ? A THR 21  
22  1 Y 1 A LYS 22  ? A LYS 22  
23  1 Y 1 A THR 23  ? A THR 23  
24  1 Y 1 A LYS 24  ? A LYS 24  
25  1 Y 1 A LYS 25  ? A LYS 25  
26  1 Y 1 A LYS 26  ? A LYS 26  
27  1 Y 1 A HIS 27  ? A HIS 27  
28  1 Y 1 A PHE 28  ? A PHE 28  
29  1 Y 1 A VAL 29  ? A VAL 29  
30  1 Y 1 A CYS 30  ? A CYS 30  
31  1 Y 1 A GLN 31  ? A GLN 31  
32  1 Y 1 A LYS 32  ? A LYS 32  
33  1 Y 1 A VAL 33  ? A VAL 33  
34  1 Y 1 A GLY 133 ? A GLY 133 
35  1 Y 1 A ARG 134 ? A ARG 134 
36  1 Y 1 A CYS 135 ? A CYS 135 
37  1 Y 1 A GLY 136 ? A GLY 136 
38  1 Y 1 A CYS 307 ? A CYS 307 
39  1 Y 1 A GLU 308 ? A GLU 308 
40  1 Y 1 A ASN 309 ? A ASN 309 
41  1 Y 1 A ASP 310 ? A ASP 310 
42  1 Y 1 A GLY 311 ? A GLY 311 
43  1 Y 1 A VAL 312 ? A VAL 312 
44  1 Y 1 A GLY 313 ? A GLY 313 
45  1 Y 1 A GLY 314 ? A GLY 314 
46  1 Y 1 A ASN 315 ? A ASN 315 
47  1 Y 1 A LEU 316 ? A LEU 316 
48  1 Y 1 A LEU 317 ? A LEU 317 
49  1 Y 1 A CYS 318 ? A CYS 318 
50  1 Y 1 A SER 319 ? A SER 319 
51  1 Y 1 A TYR 320 ? A TYR 320 
52  1 Y 1 A GLY 321 ? A GLY 321 
53  1 Y 1 A THR 322 ? A THR 322 
54  1 Y 1 A PRO 323 ? A PRO 323 
55  1 Y 1 A PRO 324 ? A PRO 324 
56  1 Y 1 A ASP 325 ? A ASP 325 
57  1 Y 1 A SER 326 ? A SER 326 
58  1 Y 1 A PRO 327 ? A PRO 327 
59  1 Y 1 A GLY 328 ? A GLY 328 
60  1 Y 1 A ASN 329 ? A ASN 329 
61  1 Y 1 A LEU 330 ? A LEU 330 
62  1 Y 1 A LEU 331 ? A LEU 331 
63  1 Y 1 A SER 332 ? A SER 332 
64  1 Y 1 A PHE 333 ? A PHE 333 
65  1 Y 1 A PRO 334 ? A PRO 334 
66  1 Y 1 A ARG 335 ? A ARG 335 
67  1 Y 1 A PHE 336 ? A PHE 336 
68  1 Y 1 A PHE 337 ? A PHE 337 
69  1 Y 1 A GLY 338 ? A GLY 338 
70  1 Y 1 A PRO 339 ? A PRO 339 
71  1 Y 1 A GLY 340 ? A GLY 340 
72  1 Y 1 A GLU 341 ? A GLU 341 
73  1 Y 1 A PRO 373 ? A PRO 373 
74  1 Y 1 A TYR 374 ? A TYR 374 
75  1 Y 1 A ASP 375 ? A ASP 375 
76  1 Y 1 A THR 376 ? A THR 376 
77  1 Y 1 A LYS 377 ? A LYS 377 
78  1 Y 1 A LYS 378 ? A LYS 378 
79  1 Y 1 A LYS 379 ? A LYS 379 
80  1 Y 1 A ALA 380 ? A ALA 380 
81  1 Y 1 A ALA 381 ? A ALA 381 
82  1 Y 1 A HIS 382 ? A HIS 382 
83  1 Y 1 A ALA 383 ? A ALA 383 
84  1 Y 1 A ALA 384 ? A ALA 384 
85  1 Y 1 A LYS 385 ? A LYS 385 
86  1 Y 1 A THR 386 ? A THR 386 
87  1 Y 1 A VAL 387 ? A VAL 387 
88  1 Y 1 A LYS 388 ? A LYS 388 
89  1 Y 1 A HIS 389 ? A HIS 389 
90  1 Y 1 A GLY 390 ? A GLY 390 
91  1 Y 1 B MET 1   ? B MET 1   
92  1 Y 1 B SER 2   ? B SER 2   
93  1 Y 1 B SER 3   ? B SER 3   
94  1 Y 1 B ASN 4   ? B ASN 4   
95  1 Y 1 B CYS 5   ? B CYS 5   
96  1 Y 1 B THR 6   ? B THR 6   
97  1 Y 1 B SER 7   ? B SER 7   
98  1 Y 1 B THR 8   ? B THR 8   
99  1 Y 1 B THR 9   ? B THR 9   
100 1 Y 1 B ALA 10  ? B ALA 10  
101 1 Y 1 B VAL 11  ? B VAL 11  
102 1 Y 1 B ALA 12  ? B ALA 12  
103 1 Y 1 B VAL 13  ? B VAL 13  
104 1 Y 1 B ALA 14  ? B ALA 14  
105 1 Y 1 B PRO 15  ? B PRO 15  
106 1 Y 1 B LEU 16  ? B LEU 16  
107 1 Y 1 B SER 17  ? B SER 17  
108 1 Y 1 B ALA 18  ? B ALA 18  
109 1 Y 1 B SER 19  ? B SER 19  
110 1 Y 1 B LYS 20  ? B LYS 20  
111 1 Y 1 B THR 21  ? B THR 21  
112 1 Y 1 B LYS 22  ? B LYS 22  
113 1 Y 1 B THR 23  ? B THR 23  
114 1 Y 1 B LYS 24  ? B LYS 24  
115 1 Y 1 B LYS 25  ? B LYS 25  
116 1 Y 1 B LYS 26  ? B LYS 26  
117 1 Y 1 B HIS 27  ? B HIS 27  
118 1 Y 1 B PHE 28  ? B PHE 28  
119 1 Y 1 B VAL 29  ? B VAL 29  
120 1 Y 1 B CYS 30  ? B CYS 30  
121 1 Y 1 B GLN 31  ? B GLN 31  
122 1 Y 1 B LYS 32  ? B LYS 32  
123 1 Y 1 B VAL 33  ? B VAL 33  
124 1 Y 1 B LYS 34  ? B LYS 34  
125 1 Y 1 B LEU 35  ? B LEU 35  
126 1 Y 1 B ASP 304 ? B ASP 304 
127 1 Y 1 B GLU 305 ? B GLU 305 
128 1 Y 1 B GLU 306 ? B GLU 306 
129 1 Y 1 B CYS 307 ? B CYS 307 
130 1 Y 1 B GLU 308 ? B GLU 308 
131 1 Y 1 B ASN 309 ? B ASN 309 
132 1 Y 1 B ASP 310 ? B ASP 310 
133 1 Y 1 B GLY 311 ? B GLY 311 
134 1 Y 1 B VAL 312 ? B VAL 312 
135 1 Y 1 B GLY 313 ? B GLY 313 
136 1 Y 1 B GLY 314 ? B GLY 314 
137 1 Y 1 B ASN 315 ? B ASN 315 
138 1 Y 1 B LEU 316 ? B LEU 316 
139 1 Y 1 B LEU 317 ? B LEU 317 
140 1 Y 1 B CYS 318 ? B CYS 318 
141 1 Y 1 B SER 319 ? B SER 319 
142 1 Y 1 B TYR 320 ? B TYR 320 
143 1 Y 1 B GLY 321 ? B GLY 321 
144 1 Y 1 B THR 322 ? B THR 322 
145 1 Y 1 B PRO 323 ? B PRO 323 
146 1 Y 1 B PRO 324 ? B PRO 324 
147 1 Y 1 B ASP 325 ? B ASP 325 
148 1 Y 1 B SER 326 ? B SER 326 
149 1 Y 1 B PRO 327 ? B PRO 327 
150 1 Y 1 B GLY 328 ? B GLY 328 
151 1 Y 1 B ASN 329 ? B ASN 329 
152 1 Y 1 B LEU 330 ? B LEU 330 
153 1 Y 1 B LEU 331 ? B LEU 331 
154 1 Y 1 B SER 332 ? B SER 332 
155 1 Y 1 B PHE 333 ? B PHE 333 
156 1 Y 1 B PRO 334 ? B PRO 334 
157 1 Y 1 B ARG 335 ? B ARG 335 
158 1 Y 1 B PHE 336 ? B PHE 336 
159 1 Y 1 B PHE 337 ? B PHE 337 
160 1 Y 1 B GLY 338 ? B GLY 338 
161 1 Y 1 B PRO 339 ? B PRO 339 
162 1 Y 1 B GLY 340 ? B GLY 340 
163 1 Y 1 B GLU 341 ? B GLU 341 
164 1 Y 1 B PHE 342 ? B PHE 342 
165 1 Y 1 B PRO 373 ? B PRO 373 
166 1 Y 1 B TYR 374 ? B TYR 374 
167 1 Y 1 B ASP 375 ? B ASP 375 
168 1 Y 1 B THR 376 ? B THR 376 
169 1 Y 1 B LYS 377 ? B LYS 377 
170 1 Y 1 B LYS 378 ? B LYS 378 
171 1 Y 1 B LYS 379 ? B LYS 379 
172 1 Y 1 B ALA 380 ? B ALA 380 
173 1 Y 1 B ALA 381 ? B ALA 381 
174 1 Y 1 B HIS 382 ? B HIS 382 
175 1 Y 1 B ALA 383 ? B ALA 383 
176 1 Y 1 B ALA 384 ? B ALA 384 
177 1 Y 1 B LYS 385 ? B LYS 385 
178 1 Y 1 B THR 386 ? B THR 386 
179 1 Y 1 B VAL 387 ? B VAL 387 
180 1 Y 1 B LYS 388 ? B LYS 388 
181 1 Y 1 B HIS 389 ? B HIS 389 
182 1 Y 1 B GLY 390 ? B GLY 390 
183 1 Y 1 B ALA 391 ? B ALA 391 
184 1 Y 1 B GLY 392 ? B GLY 392 
185 1 Y 1 B ALA 393 ? B ALA 393 
186 1 Y 1 B GLU 394 ? B GLU 394 
187 1 Y 1 B ILE 395 ? B ILE 395 
188 1 Y 1 B SER 396 ? B SER 396 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  417 1  HOH HOH A . 
C 2 HOH 2  418 2  HOH HOH A . 
C 2 HOH 3  419 3  HOH HOH A . 
C 2 HOH 4  420 4  HOH HOH A . 
C 2 HOH 5  421 5  HOH HOH A . 
C 2 HOH 6  422 6  HOH HOH A . 
C 2 HOH 7  423 7  HOH HOH A . 
C 2 HOH 8  424 8  HOH HOH A . 
C 2 HOH 9  425 10 HOH HOH A . 
C 2 HOH 10 426 12 HOH HOH A . 
C 2 HOH 11 427 14 HOH HOH A . 
C 2 HOH 12 428 15 HOH HOH A . 
C 2 HOH 13 429 17 HOH HOH A . 
D 2 HOH 1  417 9  HOH HOH B . 
D 2 HOH 2  418 11 HOH HOH B . 
D 2 HOH 3  419 13 HOH HOH B . 
D 2 HOH 4  420 18 HOH HOH B . 
D 2 HOH 5  421 19 HOH HOH B . 
D 2 HOH 6  422 21 HOH HOH B . 
#