data_1BT6
# 
_entry.id   1BT6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BT6         
WWPDB D_1000172062 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BT6 
_pdbx_database_status.recvd_initial_deposition_date   1998-09-02 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rety, S.'          1 
'Sopkova, J.'       2 
'Renouard, M.'      3 
'Osterloh, D.'      4 
'Gerke, V.'         5 
'Russo-Marie, F.'   6 
'Lewit-Bentley, A.' 7 
# 
_citation.id                        primary 
_citation.title                     'The crystal structure of a complex of p11 with the annexin II N-terminal peptide.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            6 
_citation.page_first                89 
_citation.page_last                 95 
_citation.year                      1999 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9886297 
_citation.pdbx_database_id_DOI      10.1038/4965 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rety, S.'          1 
primary 'Sopkova, J.'       2 
primary 'Renouard, M.'      3 
primary 'Osterloh, D.'      4 
primary 'Gerke, V.'         5 
primary 'Tabaries, S.'      6 
primary 'Russo-Marie, F.'   7 
primary 'Lewit-Bentley, A.' 8 
# 
_cell.entry_id           1BT6 
_cell.length_a           80.600 
_cell.length_b           56.400 
_cell.length_c           64.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         114.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BT6 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man S100A10      11088.940 2  ? ? ?          ? 
2 polymer man 'ANNEXIN II' 1483.706  2  ? ? N-TERMINAL ? 
3 water   nat water        18.015    22 ? ? ?          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'P11, CALPACTIN LIGHT CHAIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTI
ACNDYFVVHMKQKGKK
;
;PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTI
ACNDYFVVHMKQKGKK
;
A,B ? 
2 'polypeptide(L)' no yes '(ACE)STVHEILSKLSLE'                                                                                
XSTVHEILSKLSLE                                                                                      C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  SER n 
1 3  GLN n 
1 4  MET n 
1 5  GLU n 
1 6  HIS n 
1 7  ALA n 
1 8  MET n 
1 9  GLU n 
1 10 THR n 
1 11 MET n 
1 12 MET n 
1 13 PHE n 
1 14 THR n 
1 15 PHE n 
1 16 HIS n 
1 17 LYS n 
1 18 PHE n 
1 19 ALA n 
1 20 GLY n 
1 21 ASP n 
1 22 LYS n 
1 23 GLY n 
1 24 TYR n 
1 25 LEU n 
1 26 THR n 
1 27 LYS n 
1 28 GLU n 
1 29 ASP n 
1 30 LEU n 
1 31 ARG n 
1 32 VAL n 
1 33 LEU n 
1 34 MET n 
1 35 GLU n 
1 36 LYS n 
1 37 GLU n 
1 38 PHE n 
1 39 PRO n 
1 40 GLY n 
1 41 PHE n 
1 42 LEU n 
1 43 GLU n 
1 44 ASN n 
1 45 GLN n 
1 46 LYS n 
1 47 ASP n 
1 48 PRO n 
1 49 LEU n 
1 50 ALA n 
1 51 VAL n 
1 52 ASP n 
1 53 LYS n 
1 54 ILE n 
1 55 MET n 
1 56 LYS n 
1 57 ASP n 
1 58 LEU n 
1 59 ASP n 
1 60 GLN n 
1 61 CYS n 
1 62 ARG n 
1 63 ASP n 
1 64 GLY n 
1 65 LYS n 
1 66 VAL n 
1 67 GLY n 
1 68 PHE n 
1 69 GLN n 
1 70 SER n 
1 71 PHE n 
1 72 PHE n 
1 73 SER n 
1 74 LEU n 
1 75 ILE n 
1 76 ALA n 
1 77 GLY n 
1 78 LEU n 
1 79 THR n 
1 80 ILE n 
1 81 ALA n 
1 82 CYS n 
1 83 ASN n 
1 84 ASP n 
1 85 TYR n 
1 86 PHE n 
1 87 VAL n 
1 88 VAL n 
1 89 HIS n 
1 90 MET n 
1 91 LYS n 
1 92 GLN n 
1 93 LYS n 
1 94 GLY n 
1 95 LYS n 
1 96 LYS n 
2 1  ACE n 
2 2  SER n 
2 3  THR n 
2 4  VAL n 
2 5  HIS n 
2 6  GLU n 
2 7  ILE n 
2 8  LEU n 
2 9  SER n 
2 10 LYS n 
2 11 LEU n 
2 12 SER n 
2 13 LEU n 
2 14 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET23A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP S10AA_HUMAN 1 P60903 1 
;PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTI
ACNDYFVVHMKQKGKK
;
? 
2 UNP ANX2_CHICK  2 P17785 1 
;STVHEILSKLSLEGDHSLPPSAYATVKAYSNFDADRDAAALEAAIKTKGVDEVTIINILTNRSNEQRQDIAFAYQRRTKK
ELSAALKSALSGHLEAVILGLLKTPSQYDASELKAAMKGLGTDEDTLIEIICSRTNQELNEINRVYREMYKTELEKDIIS
DTSGDFRKLMVALAKGKRCEDTSVIDYELIDQDARELYDAGVKRKGTDVPKWINIMTERSVPHLQKVFERYKSYSPYDML
ESIKKEVKGDLENAFLNLVQCIQNKQLYFADRLYDSMKGKGTRDKVLIRIMVSRCEVDMLKIKSEFKRKYGKSLYYFIQQ
DTKGDYQRALLNLCGGED
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BT6 A 1 ? 96 ? P60903 1 ? 96 ? 1 96 
2 1 1BT6 B 1 ? 96 ? P60903 1 ? 96 ? 1 96 
3 2 1BT6 C 2 ? 14 ? P17785 1 ? 13 ? 1 13 
4 2 1BT6 D 2 ? 14 ? P17785 1 ? 13 ? 1 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BT6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   56. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           280 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-04-25 
_diffrn_detector.details                'FOCUSSING MONOCHROMATOR AND MONOLAYER' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GE(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE DW32' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   DW32 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BT6 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             62. 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   9774 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.8 
_reflns.pdbx_Rmerge_I_obs            0.0600000 
_reflns.pdbx_Rsym_value              0.0600000 
_reflns.pdbx_netI_over_sigmaI        20.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.25 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.6100000 
_reflns_shell.meanI_over_sigI_obs    1.96 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1BT6 
_refine.ls_number_reflns_obs                     8511 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    96.8 
_refine.ls_R_factor_obs                          0.2330000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2280000 
_refine.ls_R_factor_R_free                       0.3070000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               200.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1A4P 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               1666 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.019 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.039 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.079 0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord 0.05  ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.976 2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        3.176 3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         3.260 3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        4.635 4.0   ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.009 0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.226 0.15  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.243 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.352 0.30  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        3.7   2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     24.7  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    26.0  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       0.    15.0  ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.457998 -0.053155 -0.887363 -0.024374 -0.997085 0.072307 -0.888619 0.054745 0.455367 133.80363 54.89459 78.87959 
2 given ? -0.506522 0.042448  -0.861181 -0.119007 -0.992670 0.021068 -0.853975 0.113158 0.507861 133.22804 64.91576 72.08719 
# 
_struct.entry_id                  1BT6 
_struct.title                     'P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS' 
_struct.pdbx_descriptor           'S100A10, ANNEXIN II' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BT6 
_struct_keywords.pdbx_keywords   'COMPLEX (LIGAND/ANNEXIN)' 
_struct_keywords.text            
;S100 FAMILY, EF-HAND PROTEIN, COMPLEX (LIGAND-ANNEXIN), LIGAND OF ANNEXIN II, CALCIUM/PHOSPHOLIPID BINDING PROTEIN, COMPLEX (LIGAND-ANNEXIN) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  GLN A 3  ? LYS A 22 ? GLN A 3  LYS A 22 1 ? 20 
HELX_P HELX_P2  2AA LYS A 27 ? GLU A 37 ? LYS A 27 GLU A 37 1 ? 11 
HELX_P HELX_P3  2AB PRO A 39 ? ASN A 44 ? PRO A 39 ASN A 44 1 ? 6  
HELX_P HELX_P4  3A  ALA A 50 ? LEU A 58 ? ALA A 50 LEU A 58 1 ? 9  
HELX_P HELX_P5  4A  PHE A 68 ? HIS A 89 ? PHE A 68 HIS A 89 1 ? 22 
HELX_P HELX_P6  1B  GLN B 3  ? ALA B 19 ? GLN B 3  ALA B 19 1 ? 17 
HELX_P HELX_P7  2BA LYS B 27 ? GLU B 37 ? LYS B 27 GLU B 37 1 ? 11 
HELX_P HELX_P8  2BB PRO B 39 ? ASN B 44 ? PRO B 39 ASN B 44 1 ? 6  
HELX_P HELX_P9  3B  ALA B 50 ? LEU B 58 ? ALA B 50 LEU B 58 1 ? 9  
HELX_P HELX_P10 4B  PHE B 68 ? HIS B 89 ? PHE B 68 HIS B 89 1 ? 22 
HELX_P HELX_P11 1C  SER C 2  ? LYS C 10 ? SER C 1  LYS C 9  1 ? 9  
HELX_P HELX_P12 1D  SER D 2  ? LYS D 10 ? SER D 1  LYS D 9  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C ACE 1 C ? ? ? 1_555 C SER 2 N ? ? C ACE 0 C SER 1 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale ? ? D ACE 1 C ? ? ? 1_555 D SER 2 N ? ? D ACE 0 D SER 1 1_555 ? ? ? ? ? ? ? 1.346 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 2 ? 
S2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 LEU A 25 ? LEU A 25 ? LEU A 25 LEU A 25 
S1 2 VAL A 66 ? VAL A 66 ? VAL A 66 VAL A 66 
S2 1 LEU B 25 ? LEU B 25 ? LEU B 25 LEU B 25 
S2 2 VAL B 66 ? VAL B 66 ? VAL B 66 VAL B 66 
# 
_database_PDB_matrix.entry_id          1BT6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BT6 
_atom_sites.fract_transf_matrix[1][1]   0.012407 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005654 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017730 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017091 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1  ? 62.762 30.912 25.705 1.00 35.75  ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1  ? 61.994 31.230 26.998 1.00 34.42  ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1  ? 62.821 32.156 27.876 1.00 30.97  ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1  ? 63.982 32.454 27.470 1.00 28.54  ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1  ? 61.677 29.921 27.610 1.00 32.29  ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1  ? 62.007 28.891 26.546 1.00 33.00  ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1  ? 63.151 29.476 25.755 1.00 34.85  ? 1   PRO A CD  1 
ATOM   8    N N   . SER A 1 2  ? 62.240 32.667 28.956 1.00 28.54  ? 2   SER A N   1 
ATOM   9    C CA  . SER A 1 2  ? 63.171 33.546 29.763 1.00 34.26  ? 2   SER A CA  1 
ATOM   10   C C   . SER A 1 2  ? 64.130 32.693 30.604 1.00 32.59  ? 2   SER A C   1 
ATOM   11   O O   . SER A 1 2  ? 63.847 31.571 31.003 1.00 34.41  ? 2   SER A O   1 
ATOM   12   C CB  . SER A 1 2  ? 62.349 34.353 30.775 1.00 33.30  ? 2   SER A CB  1 
ATOM   13   O OG  . SER A 1 2  ? 61.781 33.356 31.641 1.00 39.34  ? 2   SER A OG  1 
ATOM   14   N N   . GLN A 1 3  ? 65.232 33.224 31.025 1.00 36.56  ? 3   GLN A N   1 
ATOM   15   C CA  . GLN A 1 3  ? 66.215 32.805 32.009 1.00 34.60  ? 3   GLN A CA  1 
ATOM   16   C C   . GLN A 1 3  ? 65.564 32.241 33.289 1.00 33.59  ? 3   GLN A C   1 
ATOM   17   O O   . GLN A 1 3  ? 65.926 31.129 33.702 1.00 33.09  ? 3   GLN A O   1 
ATOM   18   C CB  . GLN A 1 3  ? 67.091 34.004 32.301 1.00 33.13  ? 3   GLN A CB  1 
ATOM   19   C CG  . GLN A 1 3  ? 68.355 34.006 31.474 1.00 39.02  ? 3   GLN A CG  1 
ATOM   20   C CD  . GLN A 1 3  ? 69.097 35.301 31.674 1.00 46.07  ? 3   GLN A CD  1 
ATOM   21   O OE1 . GLN A 1 3  ? 70.260 35.361 32.082 1.00 54.42  ? 3   GLN A OE1 1 
ATOM   22   N NE2 . GLN A 1 3  ? 68.453 36.415 31.361 1.00 52.90  ? 3   GLN A NE2 1 
ATOM   23   N N   . MET A 1 4  ? 64.556 32.919 33.827 1.00 31.66  ? 4   MET A N   1 
ATOM   24   C CA  . MET A 1 4  ? 63.805 32.460 34.953 1.00 34.16  ? 4   MET A CA  1 
ATOM   25   C C   . MET A 1 4  ? 63.097 31.166 34.637 1.00 37.89  ? 4   MET A C   1 
ATOM   26   O O   . MET A 1 4  ? 63.171 30.153 35.358 1.00 42.34  ? 4   MET A O   1 
ATOM   27   C CB  . MET A 1 4  ? 62.812 33.514 35.466 1.00 33.34  ? 4   MET A CB  1 
ATOM   28   C CG  . MET A 1 4  ? 63.419 34.547 36.430 1.00 38.42  ? 4   MET A CG  1 
ATOM   29   S SD  . MET A 1 4  ? 64.325 33.852 37.849 1.00 41.17  ? 4   MET A SD  1 
ATOM   30   C CE  . MET A 1 4  ? 63.175 32.667 38.512 1.00 25.18  ? 4   MET A CE  1 
ATOM   31   N N   . GLU A 1 5  ? 62.341 31.113 33.511 1.00 38.79  ? 5   GLU A N   1 
ATOM   32   C CA  . GLU A 1 5  ? 61.712 29.827 33.135 1.00 35.73  ? 5   GLU A CA  1 
ATOM   33   C C   . GLU A 1 5  ? 62.784 28.740 32.944 1.00 29.20  ? 5   GLU A C   1 
ATOM   34   O O   . GLU A 1 5  ? 62.535 27.584 33.254 1.00 27.06  ? 5   GLU A O   1 
ATOM   35   C CB  . GLU A 1 5  ? 60.930 30.000 31.849 1.00 36.85  ? 5   GLU A CB  1 
ATOM   36   C CG  . GLU A 1 5  ? 59.509 30.479 31.931 1.00 38.36  ? 5   GLU A CG  1 
ATOM   37   C CD  . GLU A 1 5  ? 59.070 31.283 30.685 1.00 39.65  ? 5   GLU A CD  1 
ATOM   38   O OE1 . GLU A 1 5  ? 59.883 31.723 29.833 1.00 35.76  ? 5   GLU A OE1 1 
ATOM   39   O OE2 . GLU A 1 5  ? 57.845 31.489 30.593 1.00 41.15  ? 5   GLU A OE2 1 
ATOM   40   N N   . HIS A 1 6  ? 63.943 29.094 32.412 1.00 24.72  ? 6   HIS A N   1 
ATOM   41   C CA  . HIS A 1 6  ? 64.978 28.090 32.244 1.00 27.65  ? 6   HIS A CA  1 
ATOM   42   C C   . HIS A 1 6  ? 65.474 27.606 33.601 1.00 26.47  ? 6   HIS A C   1 
ATOM   43   O O   . HIS A 1 6  ? 65.320 26.500 33.990 1.00 26.77  ? 6   HIS A O   1 
ATOM   44   C CB  . HIS A 1 6  ? 66.102 28.615 31.386 1.00 35.80  ? 6   HIS A CB  1 
ATOM   45   C CG  . HIS A 1 6  ? 65.937 28.374 29.910 1.00 46.72  ? 6   HIS A CG  1 
ATOM   46   N ND1 . HIS A 1 6  ? 65.832 27.121 29.334 1.00 47.09  ? 6   HIS A ND1 1 
ATOM   47   C CD2 . HIS A 1 6  ? 65.905 29.299 28.877 1.00 46.92  ? 6   HIS A CD2 1 
ATOM   48   C CE1 . HIS A 1 6  ? 65.775 27.296 28.030 1.00 50.83  ? 6   HIS A CE1 1 
ATOM   49   N NE2 . HIS A 1 6  ? 65.864 28.584 27.743 1.00 48.65  ? 6   HIS A NE2 1 
ATOM   50   N N   . ALA A 1 7  ? 65.598 28.522 34.570 1.00 29.08  ? 7   ALA A N   1 
ATOM   51   C CA  . ALA A 1 7  ? 66.038 28.160 35.926 1.00 28.02  ? 7   ALA A CA  1 
ATOM   52   C C   . ALA A 1 7  ? 65.039 27.272 36.573 1.00 25.58  ? 7   ALA A C   1 
ATOM   53   O O   . ALA A 1 7  ? 65.478 26.253 37.203 1.00 27.22  ? 7   ALA A O   1 
ATOM   54   C CB  . ALA A 1 7  ? 66.448 29.433 36.682 1.00 21.52  ? 7   ALA A CB  1 
ATOM   55   N N   . MET A 1 8  ? 63.738 27.555 36.459 1.00 24.15  ? 8   MET A N   1 
ATOM   56   C CA  . MET A 1 8  ? 62.731 26.705 37.117 1.00 24.75  ? 8   MET A CA  1 
ATOM   57   C C   . MET A 1 8  ? 62.622 25.306 36.565 1.00 30.84  ? 8   MET A C   1 
ATOM   58   O O   . MET A 1 8  ? 62.353 24.285 37.209 1.00 33.15  ? 8   MET A O   1 
ATOM   59   C CB  . MET A 1 8  ? 61.368 27.384 36.978 1.00 32.25  ? 8   MET A CB  1 
ATOM   60   C CG  . MET A 1 8  ? 61.336 28.831 37.437 1.00 33.36  ? 8   MET A CG  1 
ATOM   61   S SD  . MET A 1 8  ? 59.786 29.738 37.345 1.00 39.39  ? 8   MET A SD  1 
ATOM   62   C CE  . MET A 1 8  ? 58.481 28.586 37.275 1.00 36.08  ? 8   MET A CE  1 
ATOM   63   N N   . GLU A 1 9  ? 62.866 25.211 35.212 1.00 31.00  ? 9   GLU A N   1 
ATOM   64   C CA  . GLU A 1 9  ? 62.743 23.931 34.587 1.00 29.66  ? 9   GLU A CA  1 
ATOM   65   C C   . GLU A 1 9  ? 63.924 23.097 35.098 1.00 24.68  ? 9   GLU A C   1 
ATOM   66   O O   . GLU A 1 9  ? 63.846 21.885 35.202 1.00 24.57  ? 9   GLU A O   1 
ATOM   67   C CB  . GLU A 1 9  ? 62.933 24.105 33.037 1.00 26.42  ? 9   GLU A CB  1 
ATOM   68   C CG  . GLU A 1 9  ? 62.648 22.763 32.323 1.00 33.09  ? 9   GLU A CG  1 
ATOM   69   C CD  . GLU A 1 9  ? 62.195 22.978 30.855 1.00 32.67  ? 9   GLU A CD  1 
ATOM   70   O OE1 . GLU A 1 9  ? 61.036 23.422 30.743 1.00 33.55  ? 9   GLU A OE1 1 
ATOM   71   O OE2 . GLU A 1 9  ? 63.024 22.728 29.952 1.00 27.08  ? 9   GLU A OE2 1 
ATOM   72   N N   . THR A 1 10 ? 65.109 23.745 35.033 1.00 22.73  ? 10  THR A N   1 
ATOM   73   C CA  . THR A 1 10 ? 66.269 23.029 35.477 1.00 31.34  ? 10  THR A CA  1 
ATOM   74   C C   . THR A 1 10 ? 66.155 22.497 36.915 1.00 32.48  ? 10  THR A C   1 
ATOM   75   O O   . THR A 1 10 ? 66.347 21.282 37.116 1.00 34.05  ? 10  THR A O   1 
ATOM   76   C CB  . THR A 1 10 ? 67.635 23.465 35.084 1.00 34.31  ? 10  THR A CB  1 
ATOM   77   O OG1 . THR A 1 10 ? 68.492 23.469 36.186 1.00 36.69  ? 10  THR A OG1 1 
ATOM   78   C CG2 . THR A 1 10 ? 67.760 24.598 34.123 1.00 31.23  ? 10  THR A CG2 1 
ATOM   79   N N   . MET A 1 11 ? 65.525 23.200 37.847 1.00 32.49  ? 11  MET A N   1 
ATOM   80   C CA  . MET A 1 11 ? 65.341 22.660 39.177 1.00 36.90  ? 11  MET A CA  1 
ATOM   81   C C   . MET A 1 11 ? 64.349 21.539 39.197 1.00 38.80  ? 11  MET A C   1 
ATOM   82   O O   . MET A 1 11 ? 64.483 20.647 40.040 1.00 43.40  ? 11  MET A O   1 
ATOM   83   C CB  . MET A 1 11 ? 64.900 23.736 40.194 1.00 32.88  ? 11  MET A CB  1 
ATOM   84   C CG  . MET A 1 11 ? 66.029 24.821 40.366 1.00 33.23  ? 11  MET A CG  1 
ATOM   85   S SD  . MET A 1 11 ? 65.477 25.868 41.740 1.00 41.48  ? 11  MET A SD  1 
ATOM   86   C CE  . MET A 1 11 ? 66.838 27.008 41.856 1.00 38.33  ? 11  MET A CE  1 
ATOM   87   N N   . MET A 1 12 ? 63.214 21.736 38.561 1.00 40.90  ? 12  MET A N   1 
ATOM   88   C CA  . MET A 1 12 ? 62.174 20.702 38.522 1.00 41.29  ? 12  MET A CA  1 
ATOM   89   C C   . MET A 1 12 ? 62.746 19.517 37.768 1.00 40.64  ? 12  MET A C   1 
ATOM   90   O O   . MET A 1 12 ? 62.605 18.388 38.242 1.00 41.13  ? 12  MET A O   1 
ATOM   91   C CB  . MET A 1 12 ? 60.887 21.269 37.953 1.00 46.05  ? 12  MET A CB  1 
ATOM   92   C CG  . MET A 1 12 ? 60.149 20.413 36.949 1.00 50.26  ? 12  MET A CG  1 
ATOM   93   S SD  . MET A 1 12 ? 58.484 20.931 36.513 1.00 51.73  ? 12  MET A SD  1 
ATOM   94   C CE  . MET A 1 12 ? 58.732 22.728 36.455 1.00 43.54  ? 12  MET A CE  1 
ATOM   95   N N   . PHE A 1 13 ? 63.446 19.652 36.646 1.00 39.68  ? 13  PHE A N   1 
ATOM   96   C CA  . PHE A 1 13 ? 63.966 18.416 36.044 1.00 41.04  ? 13  PHE A CA  1 
ATOM   97   C C   . PHE A 1 13 ? 65.036 17.792 36.883 1.00 44.09  ? 13  PHE A C   1 
ATOM   98   O O   . PHE A 1 13 ? 65.085 16.562 36.948 1.00 44.33  ? 13  PHE A O   1 
ATOM   99   C CB  . PHE A 1 13 ? 64.364 18.637 34.593 1.00 49.14  ? 13  PHE A CB  1 
ATOM   100  C CG  . PHE A 1 13 ? 63.169 18.801 33.653 1.00 54.10  ? 13  PHE A CG  1 
ATOM   101  C CD1 . PHE A 1 13 ? 61.862 18.581 34.052 1.00 49.67  ? 13  PHE A CD1 1 
ATOM   102  C CD2 . PHE A 1 13 ? 63.391 19.229 32.347 1.00 57.72  ? 13  PHE A CD2 1 
ATOM   103  C CE1 . PHE A 1 13 ? 60.824 18.764 33.188 1.00 52.74  ? 13  PHE A CE1 1 
ATOM   104  C CE2 . PHE A 1 13 ? 62.335 19.412 31.466 1.00 56.48  ? 13  PHE A CE2 1 
ATOM   105  C CZ  . PHE A 1 13 ? 61.043 19.166 31.884 1.00 54.16  ? 13  PHE A CZ  1 
ATOM   106  N N   . THR A 1 14 ? 65.907 18.578 37.616 1.00 44.30  ? 14  THR A N   1 
ATOM   107  C CA  . THR A 1 14 ? 66.877 18.063 38.561 1.00 34.30  ? 14  THR A CA  1 
ATOM   108  C C   . THR A 1 14 ? 66.157 17.220 39.597 1.00 33.00  ? 14  THR A C   1 
ATOM   109  O O   . THR A 1 14 ? 66.604 16.115 39.940 1.00 31.41  ? 14  THR A O   1 
ATOM   110  C CB  . THR A 1 14 ? 67.765 19.100 39.203 1.00 38.39  ? 14  THR A CB  1 
ATOM   111  O OG1 . THR A 1 14 ? 68.614 19.735 38.188 1.00 34.12  ? 14  THR A OG1 1 
ATOM   112  C CG2 . THR A 1 14 ? 68.743 18.504 40.256 1.00 28.07  ? 14  THR A CG2 1 
ATOM   113  N N   . PHE A 1 15 ? 65.018 17.603 40.117 1.00 32.08  ? 15  PHE A N   1 
ATOM   114  C CA  . PHE A 1 15 ? 64.364 16.722 41.101 1.00 35.66  ? 15  PHE A CA  1 
ATOM   115  C C   . PHE A 1 15 ? 64.081 15.330 40.522 1.00 40.09  ? 15  PHE A C   1 
ATOM   116  O O   . PHE A 1 15 ? 64.422 14.247 41.060 1.00 40.04  ? 15  PHE A O   1 
ATOM   117  C CB  . PHE A 1 15 ? 63.072 17.379 41.587 1.00 31.93  ? 15  PHE A CB  1 
ATOM   118  C CG  . PHE A 1 15 ? 62.369 16.523 42.626 1.00 39.24  ? 15  PHE A CG  1 
ATOM   119  C CD1 . PHE A 1 15 ? 62.819 16.534 43.971 1.00 33.03  ? 15  PHE A CD1 1 
ATOM   120  C CD2 . PHE A 1 15 ? 61.285 15.738 42.266 1.00 34.34  ? 15  PHE A CD2 1 
ATOM   121  C CE1 . PHE A 1 15 ? 62.175 15.709 44.858 1.00 38.87  ? 15  PHE A CE1 1 
ATOM   122  C CE2 . PHE A 1 15 ? 60.636 14.924 43.160 1.00 33.30  ? 15  PHE A CE2 1 
ATOM   123  C CZ  . PHE A 1 15 ? 61.090 14.905 44.482 1.00 36.23  ? 15  PHE A CZ  1 
ATOM   124  N N   . HIS A 1 16 ? 63.453 15.320 39.351 1.00 40.10  ? 16  HIS A N   1 
ATOM   125  C CA  . HIS A 1 16 ? 62.878 14.176 38.661 1.00 38.87  ? 16  HIS A CA  1 
ATOM   126  C C   . HIS A 1 16 ? 63.989 13.239 38.273 1.00 41.42  ? 16  HIS A C   1 
ATOM   127  O O   . HIS A 1 16 ? 63.878 12.014 38.353 1.00 44.20  ? 16  HIS A O   1 
ATOM   128  C CB  . HIS A 1 16 ? 62.014 14.714 37.467 1.00 31.63  ? 16  HIS A CB  1 
ATOM   129  C CG  . HIS A 1 16 ? 60.756 15.210 38.092 1.00 27.06  ? 16  HIS A CG  1 
ATOM   130  N ND1 . HIS A 1 16 ? 59.913 14.360 38.758 1.00 33.74  ? 16  HIS A ND1 1 
ATOM   131  C CD2 . HIS A 1 16 ? 60.197 16.436 38.240 1.00 30.71  ? 16  HIS A CD2 1 
ATOM   132  C CE1 . HIS A 1 16 ? 58.873 15.010 39.275 1.00 28.64  ? 16  HIS A CE1 1 
ATOM   133  N NE2 . HIS A 1 16 ? 59.046 16.297 38.965 1.00 27.88  ? 16  HIS A NE2 1 
ATOM   134  N N   . LYS A 1 17 ? 65.137 13.791 37.915 1.00 40.54  ? 17  LYS A N   1 
ATOM   135  C CA  . LYS A 1 17 ? 66.289 13.002 37.567 1.00 41.88  ? 17  LYS A CA  1 
ATOM   136  C C   . LYS A 1 17 ? 66.830 12.246 38.752 1.00 45.24  ? 17  LYS A C   1 
ATOM   137  O O   . LYS A 1 17 ? 67.433 11.161 38.572 1.00 50.46  ? 17  LYS A O   1 
ATOM   138  C CB  . LYS A 1 17 ? 67.366 13.960 36.995 1.00 42.73  ? 17  LYS A CB  1 
ATOM   139  C CG  . LYS A 1 17 ? 68.788 13.495 37.236 1.00 48.21  ? 17  LYS A CG  1 
ATOM   140  C CD  . LYS A 1 17 ? 69.852 14.251 36.437 1.00 47.10  ? 17  LYS A CD  1 
ATOM   141  C CE  . LYS A 1 17 ? 71.140 13.384 36.526 1.00 49.54  ? 17  LYS A CE  1 
ATOM   142  N NZ  . LYS A 1 17 ? 72.273 14.056 35.790 1.00 55.15  ? 17  LYS A NZ  1 
ATOM   143  N N   . PHE A 1 18 ? 66.793 12.725 39.997 1.00 44.88  ? 18  PHE A N   1 
ATOM   144  C CA  . PHE A 1 18 ? 67.440 11.853 41.024 1.00 43.18  ? 18  PHE A CA  1 
ATOM   145  C C   . PHE A 1 18 ? 66.344 11.042 41.671 1.00 46.66  ? 18  PHE A C   1 
ATOM   146  O O   . PHE A 1 18 ? 66.557 9.948  42.189 1.00 52.83  ? 18  PHE A O   1 
ATOM   147  C CB  . PHE A 1 18 ? 68.296 12.687 41.927 1.00 34.26  ? 18  PHE A CB  1 
ATOM   148  C CG  . PHE A 1 18 ? 69.526 13.267 41.315 1.00 32.47  ? 18  PHE A CG  1 
ATOM   149  C CD1 . PHE A 1 18 ? 70.694 12.521 41.203 1.00 34.23  ? 18  PHE A CD1 1 
ATOM   150  C CD2 . PHE A 1 18 ? 69.556 14.574 40.855 1.00 28.28  ? 18  PHE A CD2 1 
ATOM   151  C CE1 . PHE A 1 18 ? 71.858 13.045 40.638 1.00 33.28  ? 18  PHE A CE1 1 
ATOM   152  C CE2 . PHE A 1 18 ? 70.689 15.095 40.295 1.00 29.22  ? 18  PHE A CE2 1 
ATOM   153  C CZ  . PHE A 1 18 ? 71.861 14.327 40.187 1.00 31.72  ? 18  PHE A CZ  1 
ATOM   154  N N   . ALA A 1 19 ? 65.095 11.462 41.628 1.00 47.27  ? 19  ALA A N   1 
ATOM   155  C CA  . ALA A 1 19 ? 63.986 10.762 42.197 1.00 48.51  ? 19  ALA A CA  1 
ATOM   156  C C   . ALA A 1 19 ? 63.415 9.621  41.369 1.00 51.01  ? 19  ALA A C   1 
ATOM   157  O O   . ALA A 1 19 ? 62.637 8.772  41.883 1.00 50.34  ? 19  ALA A O   1 
ATOM   158  C CB  . ALA A 1 19 ? 62.884 11.807 42.480 1.00 48.38  ? 19  ALA A CB  1 
ATOM   159  N N   . GLY A 1 20 ? 63.684 9.526  40.085 1.00 53.57  ? 20  GLY A N   1 
ATOM   160  C CA  . GLY A 1 20 ? 63.103 8.476  39.230 1.00 55.71  ? 20  GLY A CA  1 
ATOM   161  C C   . GLY A 1 20 ? 61.589 8.441  39.210 1.00 56.70  ? 20  GLY A C   1 
ATOM   162  O O   . GLY A 1 20 ? 60.884 9.386  39.610 1.00 57.27  ? 20  GLY A O   1 
ATOM   163  N N   . ASP A 1 21 ? 61.034 7.301  38.780 1.00 57.88  ? 21  ASP A N   1 
ATOM   164  C CA  . ASP A 1 21 ? 59.594 7.111  38.743 1.00 59.75  ? 21  ASP A CA  1 
ATOM   165  C C   . ASP A 1 21 ? 58.971 7.179  40.104 1.00 61.94  ? 21  ASP A C   1 
ATOM   166  O O   . ASP A 1 21 ? 57.872 7.747  40.191 1.00 63.55  ? 21  ASP A O   1 
ATOM   167  C CB  . ASP A 1 21 ? 59.204 5.792  38.047 1.00 63.65  ? 21  ASP A CB  1 
ATOM   168  C CG  . ASP A 1 21 ? 59.802 5.800  36.640 1.00 70.69  ? 21  ASP A CG  1 
ATOM   169  O OD1 . ASP A 1 21 ? 59.298 6.485  35.703 1.00 68.90  ? 21  ASP A OD1 1 
ATOM   170  O OD2 . ASP A 1 21 ? 60.854 5.131  36.519 1.00 75.28  ? 21  ASP A OD2 1 
ATOM   171  N N   . LYS A 1 22 ? 59.618 6.680  41.182 1.00 61.44  ? 22  LYS A N   1 
ATOM   172  C CA  . LYS A 1 22 ? 59.036 6.780  42.511 1.00 61.25  ? 22  LYS A CA  1 
ATOM   173  C C   . LYS A 1 22 ? 58.544 8.169  42.907 1.00 60.83  ? 22  LYS A C   1 
ATOM   174  O O   . LYS A 1 22 ? 57.636 8.297  43.745 1.00 59.01  ? 22  LYS A O   1 
ATOM   175  C CB  . LYS A 1 22 ? 59.955 6.219  43.585 1.00 62.95  ? 22  LYS A CB  1 
ATOM   176  C CG  . LYS A 1 22 ? 61.407 6.003  43.219 1.00 64.61  ? 22  LYS A CG  1 
ATOM   177  C CD  . LYS A 1 22 ? 62.196 5.570  44.457 1.00 64.95  ? 22  LYS A CD  1 
ATOM   178  C CE  . LYS A 1 22 ? 62.699 6.719  45.315 1.00 60.45  ? 22  LYS A CE  1 
ATOM   179  N NZ  . LYS A 1 22 ? 63.869 7.381  44.673 1.00 58.52  ? 22  LYS A NZ  1 
ATOM   180  N N   . GLY A 1 23 ? 59.102 9.267  42.380 1.00 60.87  ? 23  GLY A N   1 
ATOM   181  C CA  . GLY A 1 23 ? 58.647 10.609 42.688 1.00 59.12  ? 23  GLY A CA  1 
ATOM   182  C C   . GLY A 1 23 ? 59.127 11.245 43.957 1.00 57.27  ? 23  GLY A C   1 
ATOM   183  O O   . GLY A 1 23 ? 58.598 12.293 44.362 1.00 58.25  ? 23  GLY A O   1 
ATOM   184  N N   . TYR A 1 24 ? 60.061 10.607 44.670 1.00 55.19  ? 24  TYR A N   1 
ATOM   185  C CA  . TYR A 1 24 ? 60.548 11.221 45.911 1.00 53.55  ? 24  TYR A CA  1 
ATOM   186  C C   . TYR A 1 24 ? 62.037 10.895 46.052 1.00 51.13  ? 24  TYR A C   1 
ATOM   187  O O   . TYR A 1 24 ? 62.548 10.019 45.343 1.00 47.23  ? 24  TYR A O   1 
ATOM   188  C CB  . TYR A 1 24 ? 59.731 10.796 47.109 1.00 56.56  ? 24  TYR A CB  1 
ATOM   189  C CG  . TYR A 1 24 ? 59.737 9.299  47.362 1.00 63.47  ? 24  TYR A CG  1 
ATOM   190  C CD1 . TYR A 1 24 ? 60.872 8.700  47.913 1.00 65.14  ? 24  TYR A CD1 1 
ATOM   191  C CD2 . TYR A 1 24 ? 58.656 8.478  47.038 1.00 64.56  ? 24  TYR A CD2 1 
ATOM   192  C CE1 . TYR A 1 24 ? 60.929 7.348  48.166 1.00 65.91  ? 24  TYR A CE1 1 
ATOM   193  C CE2 . TYR A 1 24 ? 58.713 7.111  47.274 1.00 65.73  ? 24  TYR A CE2 1 
ATOM   194  C CZ  . TYR A 1 24 ? 59.842 6.562  47.838 1.00 66.87  ? 24  TYR A CZ  1 
ATOM   195  O OH  . TYR A 1 24 ? 59.937 5.215  48.067 1.00 68.48  ? 24  TYR A OH  1 
ATOM   196  N N   . LEU A 1 25 ? 62.719 11.684 46.891 1.00 47.91  ? 25  LEU A N   1 
ATOM   197  C CA  . LEU A 1 25 ? 64.118 11.330 47.141 1.00 48.59  ? 25  LEU A CA  1 
ATOM   198  C C   . LEU A 1 25 ? 64.189 10.619 48.514 1.00 48.01  ? 25  LEU A C   1 
ATOM   199  O O   . LEU A 1 25 ? 63.397 10.732 49.453 1.00 49.24  ? 25  LEU A O   1 
ATOM   200  C CB  . LEU A 1 25 ? 65.163 12.403 47.053 1.00 42.75  ? 25  LEU A CB  1 
ATOM   201  C CG  . LEU A 1 25 ? 65.025 13.507 45.991 1.00 45.30  ? 25  LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 25 ? 65.500 14.857 46.505 1.00 40.25  ? 25  LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 25 ? 65.805 13.151 44.730 1.00 43.60  ? 25  LEU A CD2 1 
ATOM   204  N N   . THR A 1 26 ? 65.211 9.807  48.587 1.00 47.61  ? 26  THR A N   1 
ATOM   205  C CA  . THR A 1 26 ? 65.544 9.081  49.809 1.00 45.57  ? 26  THR A CA  1 
ATOM   206  C C   . THR A 1 26 ? 66.834 9.773  50.238 1.00 46.41  ? 26  THR A C   1 
ATOM   207  O O   . THR A 1 26 ? 67.420 10.536 49.451 1.00 46.57  ? 26  THR A O   1 
ATOM   208  C CB  . THR A 1 26 ? 65.895 7.593  49.529 1.00 41.15  ? 26  THR A CB  1 
ATOM   209  O OG1 . THR A 1 26 ? 66.963 7.597  48.581 1.00 37.98  ? 26  THR A OG1 1 
ATOM   210  C CG2 . THR A 1 26 ? 64.716 6.801  48.985 1.00 35.83  ? 26  THR A CG2 1 
ATOM   211  N N   . LYS A 1 27 ? 67.370 9.334  51.351 1.00 48.71  ? 27  LYS A N   1 
ATOM   212  C CA  . LYS A 1 27 ? 68.639 9.863  51.833 1.00 48.38  ? 27  LYS A CA  1 
ATOM   213  C C   . LYS A 1 27 ? 69.741 9.669  50.823 1.00 48.25  ? 27  LYS A C   1 
ATOM   214  O O   . LYS A 1 27 ? 70.607 10.486 50.542 1.00 47.80  ? 27  LYS A O   1 
ATOM   215  C CB  . LYS A 1 27 ? 68.949 9.032  53.100 1.00 54.85  ? 27  LYS A CB  1 
ATOM   216  C CG  . LYS A 1 27 ? 69.153 9.840  54.364 1.00 58.48  ? 27  LYS A CG  1 
ATOM   217  C CD  . LYS A 1 27 ? 70.628 10.087 54.586 1.00 63.11  ? 27  LYS A CD  1 
ATOM   218  C CE  . LYS A 1 27 ? 71.409 8.785  54.668 1.00 70.27  ? 27  LYS A CE  1 
ATOM   219  N NZ  . LYS A 1 27 ? 71.139 8.020  55.927 1.00 70.78  ? 27  LYS A NZ  1 
ATOM   220  N N   . GLU A 1 28 ? 69.778 8.474  50.235 1.00 49.43  ? 28  GLU A N   1 
ATOM   221  C CA  . GLU A 1 28 ? 70.840 8.133  49.285 1.00 50.97  ? 28  GLU A CA  1 
ATOM   222  C C   . GLU A 1 28 ? 70.767 8.978  48.031 1.00 49.19  ? 28  GLU A C   1 
ATOM   223  O O   . GLU A 1 28 ? 71.774 9.496  47.502 1.00 43.96  ? 28  GLU A O   1 
ATOM   224  C CB  . GLU A 1 28 ? 70.790 6.611  49.096 1.00 56.00  ? 28  GLU A CB  1 
ATOM   225  C CG  . GLU A 1 28 ? 69.392 6.065  48.997 1.00 65.59  ? 28  GLU A CG  1 
ATOM   226  C CD  . GLU A 1 28 ? 68.599 5.677  50.225 1.00 70.41  ? 28  GLU A CD  1 
ATOM   227  O OE1 . GLU A 1 28 ? 68.412 6.475  51.193 1.00 71.98  ? 28  GLU A OE1 1 
ATOM   228  O OE2 . GLU A 1 28 ? 68.059 4.522  50.250 1.00 68.31  ? 28  GLU A OE2 1 
ATOM   229  N N   . ASP A 1 29 ? 69.493 9.151  47.553 1.00 48.29  ? 29  ASP A N   1 
ATOM   230  C CA  . ASP A 1 29 ? 69.322 10.007 46.384 1.00 47.28  ? 29  ASP A CA  1 
ATOM   231  C C   . ASP A 1 29 ? 69.728 11.443 46.756 1.00 45.05  ? 29  ASP A C   1 
ATOM   232  O O   . ASP A 1 29 ? 70.296 12.064 45.866 1.00 43.08  ? 29  ASP A O   1 
ATOM   233  C CB  . ASP A 1 29 ? 67.896 10.010 45.878 1.00 52.77  ? 29  ASP A CB  1 
ATOM   234  C CG  . ASP A 1 29 ? 67.374 8.644  45.481 1.00 51.89  ? 29  ASP A CG  1 
ATOM   235  O OD1 . ASP A 1 29 ? 68.185 7.794  45.089 1.00 58.99  ? 29  ASP A OD1 1 
ATOM   236  O OD2 . ASP A 1 29 ? 66.168 8.395  45.542 1.00 51.98  ? 29  ASP A OD2 1 
ATOM   237  N N   . LEU A 1 30 ? 69.478 11.877 48.004 1.00 42.98  ? 30  LEU A N   1 
ATOM   238  C CA  . LEU A 1 30 ? 69.784 13.229 48.453 1.00 42.98  ? 30  LEU A CA  1 
ATOM   239  C C   . LEU A 1 30 ? 71.267 13.516 48.456 1.00 42.34  ? 30  LEU A C   1 
ATOM   240  O O   . LEU A 1 30 ? 71.815 14.518 47.986 1.00 43.63  ? 30  LEU A O   1 
ATOM   241  C CB  . LEU A 1 30 ? 69.183 13.592 49.818 1.00 43.55  ? 30  LEU A CB  1 
ATOM   242  C CG  . LEU A 1 30 ? 69.515 15.000 50.336 1.00 48.26  ? 30  LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 30 ? 68.906 16.069 49.410 1.00 46.74  ? 30  LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 30 ? 69.081 15.269 51.787 1.00 40.67  ? 30  LEU A CD2 1 
ATOM   245  N N   . ARG A 1 31 ? 71.993 12.546 48.943 1.00 43.05  ? 31  ARG A N   1 
ATOM   246  C CA  . ARG A 1 31 ? 73.454 12.589 48.989 1.00 44.26  ? 31  ARG A CA  1 
ATOM   247  C C   . ARG A 1 31 ? 73.975 12.530 47.553 1.00 40.95  ? 31  ARG A C   1 
ATOM   248  O O   . ARG A 1 31 ? 74.991 13.234 47.319 1.00 43.66  ? 31  ARG A O   1 
ATOM   249  C CB  . ARG A 1 31 ? 74.011 11.452 49.866 1.00 41.69  ? 31  ARG A CB  1 
ATOM   250  C CG  . ARG A 1 31 ? 75.490 11.212 49.733 1.00 51.38  ? 31  ARG A CG  1 
ATOM   251  C CD  . ARG A 1 31 ? 75.988 9.937  50.410 1.00 59.04  ? 31  ARG A CD  1 
ATOM   252  N NE  . ARG A 1 31 ? 75.348 9.638  51.694 1.00 61.73  ? 31  ARG A NE  1 
ATOM   253  C CZ  . ARG A 1 31 ? 75.654 10.321 52.804 1.00 66.33  ? 31  ARG A CZ  1 
ATOM   254  N NH1 . ARG A 1 31 ? 76.571 11.273 52.748 1.00 66.12  ? 31  ARG A NH1 1 
ATOM   255  N NH2 . ARG A 1 31 ? 75.080 10.055 53.976 1.00 67.96  ? 31  ARG A NH2 1 
ATOM   256  N N   . VAL A 1 32 ? 73.417 11.725 46.638 1.00 35.93  ? 32  VAL A N   1 
ATOM   257  C CA  . VAL A 1 32 ? 74.026 11.756 45.308 1.00 38.69  ? 32  VAL A CA  1 
ATOM   258  C C   . VAL A 1 32 ? 73.722 13.113 44.651 1.00 37.88  ? 32  VAL A C   1 
ATOM   259  O O   . VAL A 1 32 ? 74.631 13.677 44.072 1.00 38.52  ? 32  VAL A O   1 
ATOM   260  C CB  . VAL A 1 32 ? 73.691 10.712 44.251 1.00 43.27  ? 32  VAL A CB  1 
ATOM   261  C CG1 . VAL A 1 32 ? 74.923 10.615 43.289 1.00 45.26  ? 32  VAL A CG1 1 
ATOM   262  C CG2 . VAL A 1 32 ? 73.328 9.379  44.803 1.00 39.07  ? 32  VAL A CG2 1 
ATOM   263  N N   . LEU A 1 33 ? 72.491 13.572 44.843 1.00 37.12  ? 33  LEU A N   1 
ATOM   264  C CA  . LEU A 1 33 ? 72.112 14.888 44.342 1.00 39.46  ? 33  LEU A CA  1 
ATOM   265  C C   . LEU A 1 33 ? 73.030 15.938 44.946 1.00 39.81  ? 33  LEU A C   1 
ATOM   266  O O   . LEU A 1 33 ? 73.598 16.780 44.182 1.00 41.93  ? 33  LEU A O   1 
ATOM   267  C CB  . LEU A 1 33 ? 70.635 15.078 44.643 1.00 40.33  ? 33  LEU A CB  1 
ATOM   268  C CG  . LEU A 1 33 ? 70.002 16.444 44.730 1.00 39.75  ? 33  LEU A CG  1 
ATOM   269  C CD1 . LEU A 1 33 ? 70.674 17.566 44.033 1.00 34.73  ? 33  LEU A CD1 1 
ATOM   270  C CD2 . LEU A 1 33 ? 68.559 16.359 44.203 1.00 42.77  ? 33  LEU A CD2 1 
ATOM   271  N N   . MET A 1 34 ? 73.366 15.926 46.226 1.00 37.52  ? 34  MET A N   1 
ATOM   272  C CA  . MET A 1 34 ? 74.350 16.944 46.668 1.00 37.90  ? 34  MET A CA  1 
ATOM   273  C C   . MET A 1 34 ? 75.715 16.649 46.148 1.00 35.76  ? 34  MET A C   1 
ATOM   274  O O   . MET A 1 34 ? 76.471 17.531 45.754 1.00 31.07  ? 34  MET A O   1 
ATOM   275  C CB  . MET A 1 34 ? 74.308 17.129 48.218 1.00 44.79  ? 34  MET A CB  1 
ATOM   276  C CG  . MET A 1 34 ? 72.883 17.582 48.607 1.00 47.37  ? 34  MET A CG  1 
ATOM   277  S SD  . MET A 1 34 ? 72.643 18.709 49.915 1.00 57.77  ? 34  MET A SD  1 
ATOM   278  C CE  . MET A 1 34 ? 73.871 19.977 49.737 1.00 48.08  ? 34  MET A CE  1 
ATOM   279  N N   . GLU A 1 35 ? 76.126 15.400 46.028 1.00 36.60  ? 35  GLU A N   1 
ATOM   280  C CA  . GLU A 1 35 ? 77.499 15.160 45.527 1.00 40.48  ? 35  GLU A CA  1 
ATOM   281  C C   . GLU A 1 35 ? 77.644 15.736 44.146 1.00 41.22  ? 35  GLU A C   1 
ATOM   282  O O   . GLU A 1 35 ? 78.630 16.365 43.804 1.00 43.18  ? 35  GLU A O   1 
ATOM   283  C CB  . GLU A 1 35 ? 77.743 13.675 45.610 1.00 48.18  ? 35  GLU A CB  1 
ATOM   284  C CG  . GLU A 1 35 ? 78.839 12.981 46.310 1.00 55.58  ? 35  GLU A CG  1 
ATOM   285  C CD  . GLU A 1 35 ? 78.424 11.755 47.106 1.00 62.58  ? 35  GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 35 ? 77.806 10.817 46.518 1.00 63.16  ? 35  GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 35 ? 78.664 11.733 48.351 1.00 66.07  ? 35  GLU A OE2 1 
ATOM   288  N N   . LYS A 1 36 ? 76.718 15.436 43.223 1.00 42.27  ? 36  LYS A N   1 
ATOM   289  C CA  . LYS A 1 36 ? 76.868 15.945 41.857 1.00 42.93  ? 36  LYS A CA  1 
ATOM   290  C C   . LYS A 1 36 ? 76.506 17.415 41.732 1.00 40.06  ? 36  LYS A C   1 
ATOM   291  O O   . LYS A 1 36 ? 77.131 18.106 40.984 1.00 40.14  ? 36  LYS A O   1 
ATOM   292  C CB  . LYS A 1 36 ? 76.021 15.096 40.916 1.00 45.13  ? 36  LYS A CB  1 
ATOM   293  C CG  . LYS A 1 36 ? 76.482 13.646 40.763 1.00 51.90  ? 36  LYS A CG  1 
ATOM   294  C CD  . LYS A 1 36 ? 77.715 13.660 39.862 1.00 61.46  ? 36  LYS A CD  1 
ATOM   295  C CE  . LYS A 1 36 ? 78.236 12.257 39.525 1.00 67.63  ? 36  LYS A CE  1 
ATOM   296  N NZ  . LYS A 1 36 ? 79.164 12.360 38.312 1.00 67.34  ? 36  LYS A NZ  1 
ATOM   297  N N   . GLU A 1 37 ? 75.498 17.939 42.399 1.00 39.11  ? 37  GLU A N   1 
ATOM   298  C CA  . GLU A 1 37 ? 75.153 19.384 42.254 1.00 40.60  ? 37  GLU A CA  1 
ATOM   299  C C   . GLU A 1 37 ? 75.824 20.035 43.397 1.00 44.57  ? 37  GLU A C   1 
ATOM   300  O O   . GLU A 1 37 ? 75.861 19.305 44.470 1.00 49.57  ? 37  GLU A O   1 
ATOM   301  C CB  . GLU A 1 37 ? 73.606 19.496 42.294 1.00 36.25  ? 37  GLU A CB  1 
ATOM   302  C CG  . GLU A 1 37 ? 72.906 18.780 41.158 1.00 31.45  ? 37  GLU A CG  1 
ATOM   303  C CD  . GLU A 1 37 ? 73.140 19.425 39.790 1.00 37.20  ? 37  GLU A CD  1 
ATOM   304  O OE1 . GLU A 1 37 ? 73.474 20.622 39.527 1.00 33.51  ? 37  GLU A OE1 1 
ATOM   305  O OE2 . GLU A 1 37 ? 72.967 18.668 38.816 1.00 34.89  ? 37  GLU A OE2 1 
ATOM   306  N N   . PHE A 1 38 ? 76.435 21.156 43.568 1.00 48.10  ? 38  PHE A N   1 
ATOM   307  C CA  . PHE A 1 38 ? 77.022 21.481 44.921 1.00 48.90  ? 38  PHE A CA  1 
ATOM   308  C C   . PHE A 1 38 ? 78.110 20.568 45.435 1.00 51.63  ? 38  PHE A C   1 
ATOM   309  O O   . PHE A 1 38 ? 78.245 20.245 46.658 1.00 50.04  ? 38  PHE A O   1 
ATOM   310  C CB  . PHE A 1 38 ? 75.989 21.657 46.032 1.00 38.84  ? 38  PHE A CB  1 
ATOM   311  C CG  . PHE A 1 38 ? 74.592 22.033 45.723 1.00 40.17  ? 38  PHE A CG  1 
ATOM   312  C CD1 . PHE A 1 38 ? 74.277 23.245 45.080 1.00 40.65  ? 38  PHE A CD1 1 
ATOM   313  C CD2 . PHE A 1 38 ? 73.548 21.151 45.961 1.00 37.74  ? 38  PHE A CD2 1 
ATOM   314  C CE1 . PHE A 1 38 ? 72.966 23.534 44.771 1.00 38.40  ? 38  PHE A CE1 1 
ATOM   315  C CE2 . PHE A 1 38 ? 72.246 21.441 45.648 1.00 36.80  ? 38  PHE A CE2 1 
ATOM   316  C CZ  . PHE A 1 38 ? 71.944 22.642 45.047 1.00 35.91  ? 38  PHE A CZ  1 
ATOM   317  N N   . PRO A 1 39 ? 79.084 20.192 44.624 1.00 53.90  ? 39  PRO A N   1 
ATOM   318  C CA  . PRO A 1 39 ? 80.206 19.398 45.179 1.00 57.81  ? 39  PRO A CA  1 
ATOM   319  C C   . PRO A 1 39 ? 81.232 20.235 45.934 1.00 57.00  ? 39  PRO A C   1 
ATOM   320  O O   . PRO A 1 39 ? 82.133 19.685 46.623 1.00 57.27  ? 39  PRO A O   1 
ATOM   321  C CB  . PRO A 1 39 ? 80.738 18.722 43.921 1.00 56.84  ? 39  PRO A CB  1 
ATOM   322  C CG  . PRO A 1 39 ? 80.612 19.817 42.903 1.00 57.09  ? 39  PRO A CG  1 
ATOM   323  C CD  . PRO A 1 39 ? 79.274 20.484 43.215 1.00 55.14  ? 39  PRO A CD  1 
ATOM   324  N N   . GLY A 1 40 ? 81.157 21.558 45.945 1.00 54.01  ? 40  GLY A N   1 
ATOM   325  C CA  . GLY A 1 40 ? 82.155 22.327 46.703 1.00 55.23  ? 40  GLY A CA  1 
ATOM   326  C C   . GLY A 1 40 ? 81.637 22.645 48.104 1.00 56.67  ? 40  GLY A C   1 
ATOM   327  O O   . GLY A 1 40 ? 82.313 23.116 49.046 1.00 57.40  ? 40  GLY A O   1 
ATOM   328  N N   . PHE A 1 41 ? 80.341 22.351 48.263 1.00 53.36  ? 41  PHE A N   1 
ATOM   329  C CA  . PHE A 1 41 ? 79.681 22.673 49.511 1.00 49.46  ? 41  PHE A CA  1 
ATOM   330  C C   . PHE A 1 41 ? 79.819 21.594 50.561 1.00 49.30  ? 41  PHE A C   1 
ATOM   331  O O   . PHE A 1 41 ? 80.167 21.947 51.709 1.00 47.46  ? 41  PHE A O   1 
ATOM   332  C CB  . PHE A 1 41 ? 78.240 23.014 49.219 1.00 40.74  ? 41  PHE A CB  1 
ATOM   333  C CG  . PHE A 1 41 ? 77.367 23.310 50.376 1.00 35.49  ? 41  PHE A CG  1 
ATOM   334  C CD1 . PHE A 1 41 ? 77.489 24.487 51.077 1.00 33.94  ? 41  PHE A CD1 1 
ATOM   335  C CD2 . PHE A 1 41 ? 76.418 22.368 50.747 1.00 35.91  ? 41  PHE A CD2 1 
ATOM   336  C CE1 . PHE A 1 41 ? 76.637 24.723 52.155 1.00 37.79  ? 41  PHE A CE1 1 
ATOM   337  C CE2 . PHE A 1 41 ? 75.577 22.615 51.835 1.00 38.39  ? 41  PHE A CE2 1 
ATOM   338  C CZ  . PHE A 1 41 ? 75.689 23.786 52.517 1.00 37.04  ? 41  PHE A CZ  1 
ATOM   339  N N   . LEU A 1 42 ? 79.342 20.414 50.289 1.00 50.78  ? 42  LEU A N   1 
ATOM   340  C CA  . LEU A 1 42 ? 79.371 19.347 51.297 1.00 57.33  ? 42  LEU A CA  1 
ATOM   341  C C   . LEU A 1 42 ? 80.763 19.148 51.909 1.00 60.22  ? 42  LEU A C   1 
ATOM   342  O O   . LEU A 1 42 ? 81.063 19.571 52.999 1.00 59.37  ? 42  LEU A O   1 
ATOM   343  C CB  . LEU A 1 42 ? 78.960 18.053 50.608 1.00 54.47  ? 42  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 42 ? 77.711 17.380 51.163 1.00 54.94  ? 42  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 42 ? 76.695 18.402 51.644 1.00 48.95  ? 42  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 42 ? 77.203 16.512 50.005 1.00 56.74  ? 42  LEU A CD2 1 
ATOM   347  N N   . GLU A 1 43 ? 81.663 18.540 51.160 1.00 63.76  ? 43  GLU A N   1 
ATOM   348  C CA  . GLU A 1 43 ? 83.030 18.273 51.484 1.00 68.59  ? 43  GLU A CA  1 
ATOM   349  C C   . GLU A 1 43 ? 83.713 19.431 52.213 1.00 71.21  ? 43  GLU A C   1 
ATOM   350  O O   . GLU A 1 43 ? 84.511 19.164 53.139 1.00 73.02  ? 43  GLU A O   1 
ATOM   351  C CB  . GLU A 1 43 ? 83.801 17.878 50.223 1.00 69.73  ? 43  GLU A CB  1 
ATOM   352  C CG  . GLU A 1 43 ? 83.225 16.703 49.459 1.00 75.09  ? 43  GLU A CG  1 
ATOM   353  C CD  . GLU A 1 43 ? 82.175 17.029 48.414 1.00 75.54  ? 43  GLU A CD  1 
ATOM   354  O OE1 . GLU A 1 43 ? 81.538 18.102 48.483 1.00 76.07  ? 43  GLU A OE1 1 
ATOM   355  O OE2 . GLU A 1 43 ? 81.919 16.208 47.499 1.00 76.28  ? 43  GLU A OE2 1 
ATOM   356  N N   . ASN A 1 44 ? 83.394 20.690 51.976 1.00 70.91  ? 44  ASN A N   1 
ATOM   357  C CA  . ASN A 1 44 ? 83.962 21.800 52.711 1.00 70.93  ? 44  ASN A CA  1 
ATOM   358  C C   . ASN A 1 44 ? 83.289 22.014 54.041 1.00 71.68  ? 44  ASN A C   1 
ATOM   359  O O   . ASN A 1 44 ? 83.720 22.807 54.896 1.00 73.74  ? 44  ASN A O   1 
ATOM   360  C CB  . ASN A 1 44 ? 84.099 23.028 51.857 1.00 73.70  ? 44  ASN A CB  1 
ATOM   361  C CG  . ASN A 1 44 ? 85.309 22.874 50.960 1.00 79.36  ? 44  ASN A CG  1 
ATOM   362  O OD1 . ASN A 1 44 ? 85.150 22.588 49.767 1.00 86.83  ? 44  ASN A OD1 1 
ATOM   363  N ND2 . ASN A 1 44 ? 86.509 23.012 51.495 1.00 81.91  ? 44  ASN A ND2 1 
ATOM   364  N N   . GLN A 1 45 ? 82.187 21.324 54.279 1.00 70.77  ? 45  GLN A N   1 
ATOM   365  C CA  . GLN A 1 45 ? 81.557 21.332 55.615 1.00 69.99  ? 45  GLN A CA  1 
ATOM   366  C C   . GLN A 1 45 ? 82.550 20.369 56.296 1.00 69.43  ? 45  GLN A C   1 
ATOM   367  O O   . GLN A 1 45 ? 83.164 19.597 55.487 1.00 69.92  ? 45  GLN A O   1 
ATOM   368  C CB  . GLN A 1 45 ? 80.182 20.723 55.599 1.00 71.21  ? 45  GLN A CB  1 
ATOM   369  C CG  . GLN A 1 45 ? 79.015 21.488 55.089 1.00 74.62  ? 45  GLN A CG  1 
ATOM   370  C CD  . GLN A 1 45 ? 78.526 22.628 55.949 1.00 77.71  ? 45  GLN A CD  1 
ATOM   371  O OE1 . GLN A 1 45 ? 79.056 23.740 55.891 1.00 77.82  ? 45  GLN A OE1 1 
ATOM   372  N NE2 . GLN A 1 45 ? 77.491 22.390 56.768 1.00 78.83  ? 45  GLN A NE2 1 
ATOM   373  N N   . LYS A 1 46 ? 82.877 20.311 57.554 1.00 69.35  ? 46  LYS A N   1 
ATOM   374  C CA  . LYS A 1 46 ? 83.913 19.226 57.783 1.00 71.73  ? 46  LYS A CA  1 
ATOM   375  C C   . LYS A 1 46 ? 83.259 17.966 58.290 1.00 71.45  ? 46  LYS A C   1 
ATOM   376  O O   . LYS A 1 46 ? 83.802 16.861 58.407 1.00 73.83  ? 46  LYS A O   1 
ATOM   377  C CB  . LYS A 1 46 ? 85.100 19.807 58.481 1.00 74.97  ? 46  LYS A CB  1 
ATOM   378  C CG  . LYS A 1 46 ? 85.975 20.643 57.509 1.00 77.59  ? 46  LYS A CG  1 
ATOM   379  C CD  . LYS A 1 46 ? 85.872 22.113 57.857 1.00 80.93  ? 46  LYS A CD  1 
ATOM   380  C CE  . LYS A 1 46 ? 86.418 23.023 56.758 1.00 82.82  ? 46  LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 46 ? 86.960 24.301 57.357 1.00 83.90  ? 46  LYS A NZ  1 
ATOM   382  N N   . ASP A 1 47 ? 81.973 18.068 58.542 1.00 68.53  ? 47  ASP A N   1 
ATOM   383  C CA  . ASP A 1 47 ? 81.043 17.126 59.036 1.00 63.97  ? 47  ASP A CA  1 
ATOM   384  C C   . ASP A 1 47 ? 80.606 16.036 58.109 1.00 62.81  ? 47  ASP A C   1 
ATOM   385  O O   . ASP A 1 47 ? 79.693 16.184 57.285 1.00 63.41  ? 47  ASP A O   1 
ATOM   386  C CB  . ASP A 1 47 ? 79.841 18.007 59.439 1.00 61.33  ? 47  ASP A CB  1 
ATOM   387  C CG  . ASP A 1 47 ? 78.741 17.233 60.095 1.00 61.01  ? 47  ASP A CG  1 
ATOM   388  O OD1 . ASP A 1 47 ? 78.751 15.993 60.068 1.00 62.57  ? 47  ASP A OD1 1 
ATOM   389  O OD2 . ASP A 1 47 ? 77.845 17.900 60.657 1.00 62.66  ? 47  ASP A OD2 1 
ATOM   390  N N   . PRO A 1 48 ? 81.008 14.790 58.398 1.00 61.52  ? 48  PRO A N   1 
ATOM   391  C CA  . PRO A 1 48 ? 80.601 13.618 57.643 1.00 57.63  ? 48  PRO A CA  1 
ATOM   392  C C   . PRO A 1 48 ? 79.171 13.208 57.898 1.00 52.17  ? 48  PRO A C   1 
ATOM   393  O O   . PRO A 1 48 ? 78.739 12.220 57.301 1.00 53.55  ? 48  PRO A O   1 
ATOM   394  C CB  . PRO A 1 48 ? 81.547 12.504 58.109 1.00 59.66  ? 48  PRO A CB  1 
ATOM   395  C CG  . PRO A 1 48 ? 81.884 12.932 59.497 1.00 60.56  ? 48  PRO A CG  1 
ATOM   396  C CD  . PRO A 1 48 ? 82.063 14.448 59.381 1.00 61.43  ? 48  PRO A CD  1 
ATOM   397  N N   . LEU A 1 49 ? 78.451 13.862 58.772 1.00 46.84  ? 49  LEU A N   1 
ATOM   398  C CA  . LEU A 1 49 ? 77.067 13.637 59.066 1.00 44.36  ? 49  LEU A CA  1 
ATOM   399  C C   . LEU A 1 49 ? 76.152 14.697 58.356 1.00 43.07  ? 49  LEU A C   1 
ATOM   400  O O   . LEU A 1 49 ? 74.910 14.540 58.428 1.00 42.64  ? 49  LEU A O   1 
ATOM   401  C CB  . LEU A 1 49 ? 76.751 13.647 60.550 1.00 43.19  ? 49  LEU A CB  1 
ATOM   402  C CG  . LEU A 1 49 ? 77.607 12.776 61.508 1.00 46.67  ? 49  LEU A CG  1 
ATOM   403  C CD1 . LEU A 1 49 ? 77.162 13.028 62.932 1.00 44.46  ? 49  LEU A CD1 1 
ATOM   404  C CD2 . LEU A 1 49 ? 77.496 11.298 61.202 1.00 46.03  ? 49  LEU A CD2 1 
ATOM   405  N N   . ALA A 1 50 ? 76.685 15.719 57.699 1.00 38.13  ? 50  ALA A N   1 
ATOM   406  C CA  . ALA A 1 50 ? 75.972 16.808 57.034 1.00 38.31  ? 50  ALA A CA  1 
ATOM   407  C C   . ALA A 1 50 ? 74.722 16.423 56.259 1.00 35.61  ? 50  ALA A C   1 
ATOM   408  O O   . ALA A 1 50 ? 73.580 16.796 56.511 1.00 35.48  ? 50  ALA A O   1 
ATOM   409  C CB  . ALA A 1 50 ? 76.983 17.522 56.131 1.00 45.58  ? 50  ALA A CB  1 
ATOM   410  N N   . VAL A 1 51 ? 74.853 15.461 55.366 1.00 33.46  ? 51  VAL A N   1 
ATOM   411  C CA  . VAL A 1 51 ? 73.716 14.929 54.692 1.00 38.87  ? 51  VAL A CA  1 
ATOM   412  C C   . VAL A 1 51 ? 72.668 14.497 55.668 1.00 40.14  ? 51  VAL A C   1 
ATOM   413  O O   . VAL A 1 51 ? 71.469 14.873 55.517 1.00 43.00  ? 51  VAL A O   1 
ATOM   414  C CB  . VAL A 1 51 ? 74.089 13.813 53.680 1.00 41.14  ? 51  VAL A CB  1 
ATOM   415  C CG1 . VAL A 1 51 ? 72.840 13.223 53.060 1.00 43.26  ? 51  VAL A CG1 1 
ATOM   416  C CG2 . VAL A 1 51 ? 74.967 14.410 52.579 1.00 44.62  ? 51  VAL A CG2 1 
ATOM   417  N N   . ASP A 1 52 ? 72.996 13.680 56.647 1.00 42.90  ? 52  ASP A N   1 
ATOM   418  C CA  . ASP A 1 52 ? 72.037 13.133 57.614 1.00 40.23  ? 52  ASP A CA  1 
ATOM   419  C C   . ASP A 1 52 ? 71.260 14.183 58.355 1.00 37.92  ? 52  ASP A C   1 
ATOM   420  O O   . ASP A 1 52 ? 70.054 14.016 58.619 1.00 37.12  ? 52  ASP A O   1 
ATOM   421  C CB  . ASP A 1 52 ? 72.815 12.245 58.640 1.00 48.39  ? 52  ASP A CB  1 
ATOM   422  C CG  . ASP A 1 52 ? 73.303 11.020 57.861 1.00 51.09  ? 52  ASP A CG  1 
ATOM   423  O OD1 . ASP A 1 52 ? 74.412 11.136 57.310 1.00 53.34  ? 52  ASP A OD1 1 
ATOM   424  O OD2 . ASP A 1 52 ? 72.518 10.049 57.849 1.00 52.31  ? 52  ASP A OD2 1 
ATOM   425  N N   . LYS A 1 53 ? 71.933 15.263 58.712 1.00 37.93  ? 53  LYS A N   1 
ATOM   426  C CA  . LYS A 1 53 ? 71.289 16.378 59.398 1.00 42.73  ? 53  LYS A CA  1 
ATOM   427  C C   . LYS A 1 53 ? 70.385 17.172 58.416 1.00 42.41  ? 53  LYS A C   1 
ATOM   428  O O   . LYS A 1 53 ? 69.365 17.730 58.808 1.00 38.73  ? 53  LYS A O   1 
ATOM   429  C CB  . LYS A 1 53 ? 72.304 17.325 60.058 1.00 43.97  ? 53  LYS A CB  1 
ATOM   430  C CG  . LYS A 1 53 ? 73.570 16.722 60.568 1.00 46.41  ? 53  LYS A CG  1 
ATOM   431  C CD  . LYS A 1 53 ? 73.960 17.149 61.960 1.00 47.88  ? 53  LYS A CD  1 
ATOM   432  C CE  . LYS A 1 53 ? 75.353 16.709 62.333 1.00 48.43  ? 53  LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 53 ? 76.330 17.794 62.543 1.00 48.69  ? 53  LYS A NZ  1 
ATOM   434  N N   . ILE A 1 54 ? 70.788 17.241 57.129 1.00 43.42  ? 54  ILE A N   1 
ATOM   435  C CA  . ILE A 1 54 ? 69.904 17.949 56.179 1.00 44.01  ? 54  ILE A CA  1 
ATOM   436  C C   . ILE A 1 54 ? 68.634 17.117 56.097 1.00 42.66  ? 54  ILE A C   1 
ATOM   437  O O   . ILE A 1 54 ? 67.526 17.565 56.365 1.00 42.64  ? 54  ILE A O   1 
ATOM   438  C CB  . ILE A 1 54 ? 70.552 18.135 54.788 1.00 43.97  ? 54  ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 54 ? 71.610 19.254 54.843 1.00 36.81  ? 54  ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 54 ? 69.492 18.489 53.739 1.00 39.88  ? 54  ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 54 ? 72.852 18.875 54.082 1.00 35.88  ? 54  ILE A CD1 1 
ATOM   442  N N   . MET A 1 55 ? 68.814 15.827 55.794 1.00 42.19  ? 55  MET A N   1 
ATOM   443  C CA  . MET A 1 55 ? 67.680 14.906 55.733 1.00 46.69  ? 55  MET A CA  1 
ATOM   444  C C   . MET A 1 55 ? 66.734 14.986 56.914 1.00 49.57  ? 55  MET A C   1 
ATOM   445  O O   . MET A 1 55 ? 65.512 14.792 56.947 1.00 50.72  ? 55  MET A O   1 
ATOM   446  C CB  . MET A 1 55 ? 68.246 13.468 55.636 1.00 43.71  ? 55  MET A CB  1 
ATOM   447  C CG  . MET A 1 55 ? 67.123 12.473 55.389 1.00 48.18  ? 55  MET A CG  1 
ATOM   448  S SD  . MET A 1 55 ? 66.464 12.687 53.658 1.00 51.42  ? 55  MET A SD  1 
ATOM   449  C CE  . MET A 1 55 ? 65.016 11.665 53.888 1.00 45.41  ? 55  MET A CE  1 
ATOM   450  N N   . LYS A 1 56 ? 67.303 15.234 58.097 1.00 51.97  ? 56  LYS A N   1 
ATOM   451  C CA  . LYS A 1 56 ? 66.564 15.338 59.337 1.00 51.72  ? 56  LYS A CA  1 
ATOM   452  C C   . LYS A 1 56 ? 65.640 16.535 59.367 1.00 50.87  ? 56  LYS A C   1 
ATOM   453  O O   . LYS A 1 56 ? 64.486 16.430 59.799 1.00 50.66  ? 56  LYS A O   1 
ATOM   454  C CB  . LYS A 1 56 ? 67.629 15.346 60.453 1.00 53.46  ? 56  LYS A CB  1 
ATOM   455  C CG  . LYS A 1 56 ? 67.121 14.748 61.732 1.00 49.25  ? 56  LYS A CG  1 
ATOM   456  C CD  . LYS A 1 56 ? 66.411 15.810 62.519 1.00 51.64  ? 56  LYS A CD  1 
ATOM   457  C CE  . LYS A 1 56 ? 67.381 16.646 63.321 1.00 58.93  ? 56  LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 56 ? 66.995 16.575 64.771 1.00 63.78  ? 56  LYS A NZ  1 
ATOM   459  N N   . ASP A 1 57 ? 66.064 17.721 58.927 1.00 51.87  ? 57  ASP A N   1 
ATOM   460  C CA  . ASP A 1 57 ? 65.131 18.847 58.950 1.00 53.28  ? 57  ASP A CA  1 
ATOM   461  C C   . ASP A 1 57 ? 64.064 18.728 57.847 1.00 50.61  ? 57  ASP A C   1 
ATOM   462  O O   . ASP A 1 57 ? 62.992 19.260 58.022 1.00 50.44  ? 57  ASP A O   1 
ATOM   463  C CB  . ASP A 1 57 ? 65.844 20.186 58.791 1.00 57.72  ? 57  ASP A CB  1 
ATOM   464  C CG  . ASP A 1 57 ? 67.003 20.245 59.764 1.00 59.69  ? 57  ASP A CG  1 
ATOM   465  O OD1 . ASP A 1 57 ? 66.731 20.339 60.974 1.00 61.45  ? 57  ASP A OD1 1 
ATOM   466  O OD2 . ASP A 1 57 ? 68.132 20.175 59.248 1.00 65.90  ? 57  ASP A OD2 1 
ATOM   467  N N   . LEU A 1 58 ? 64.372 18.040 56.770 1.00 50.31  ? 58  LEU A N   1 
ATOM   468  C CA  . LEU A 1 58 ? 63.525 17.832 55.647 1.00 51.91  ? 58  LEU A CA  1 
ATOM   469  C C   . LEU A 1 58 ? 62.464 16.764 55.811 1.00 55.78  ? 58  LEU A C   1 
ATOM   470  O O   . LEU A 1 58 ? 61.492 16.763 55.017 1.00 57.60  ? 58  LEU A O   1 
ATOM   471  C CB  . LEU A 1 58 ? 64.353 17.499 54.415 1.00 46.89  ? 58  LEU A CB  1 
ATOM   472  C CG  . LEU A 1 58 ? 65.365 18.519 53.924 1.00 43.16  ? 58  LEU A CG  1 
ATOM   473  C CD1 . LEU A 1 58 ? 66.182 17.952 52.765 1.00 36.60  ? 58  LEU A CD1 1 
ATOM   474  C CD2 . LEU A 1 58 ? 64.654 19.815 53.591 1.00 44.25  ? 58  LEU A CD2 1 
ATOM   475  N N   . ASP A 1 59 ? 62.660 15.821 56.709 1.00 60.32  ? 59  ASP A N   1 
ATOM   476  C CA  . ASP A 1 59 ? 61.732 14.725 56.958 1.00 62.90  ? 59  ASP A CA  1 
ATOM   477  C C   . ASP A 1 59 ? 60.810 15.072 58.115 1.00 65.55  ? 59  ASP A C   1 
ATOM   478  O O   . ASP A 1 59 ? 60.851 14.537 59.203 1.00 67.75  ? 59  ASP A O   1 
ATOM   479  C CB  . ASP A 1 59 ? 62.438 13.425 57.191 1.00 66.46  ? 59  ASP A CB  1 
ATOM   480  C CG  . ASP A 1 59 ? 61.806 12.135 56.759 1.00 68.48  ? 59  ASP A CG  1 
ATOM   481  O OD1 . ASP A 1 59 ? 60.603 12.042 56.470 1.00 69.72  ? 59  ASP A OD1 1 
ATOM   482  O OD2 . ASP A 1 59 ? 62.538 11.105 56.674 1.00 69.47  ? 59  ASP A OD2 1 
ATOM   483  N N   . GLN A 1 60 ? 59.868 15.990 57.862 1.00 68.72  ? 60  GLN A N   1 
ATOM   484  C CA  . GLN A 1 60 ? 58.878 16.377 58.858 1.00 70.46  ? 60  GLN A CA  1 
ATOM   485  C C   . GLN A 1 60 ? 58.235 15.114 59.434 1.00 70.21  ? 60  GLN A C   1 
ATOM   486  O O   . GLN A 1 60 ? 58.286 14.801 60.600 1.00 69.75  ? 60  GLN A O   1 
ATOM   487  C CB  . GLN A 1 60 ? 57.810 17.240 58.183 1.00 74.82  ? 60  GLN A CB  1 
ATOM   488  C CG  . GLN A 1 60 ? 57.874 18.716 58.569 1.00 79.66  ? 60  GLN A CG  1 
ATOM   489  C CD  . GLN A 1 60 ? 58.698 19.524 57.586 1.00 82.93  ? 60  GLN A CD  1 
ATOM   490  O OE1 . GLN A 1 60 ? 59.933 19.505 57.634 1.00 87.78  ? 60  GLN A OE1 1 
ATOM   491  N NE2 . GLN A 1 60 ? 58.065 20.229 56.668 1.00 84.52  ? 60  GLN A NE2 1 
ATOM   492  N N   . CYS A 1 61 ? 57.690 14.295 58.527 1.00 69.58  ? 61  CYS A N   1 
ATOM   493  C CA  . CYS A 1 61 ? 57.055 13.053 58.908 1.00 68.53  ? 61  CYS A CA  1 
ATOM   494  C C   . CYS A 1 61 ? 57.982 11.920 59.180 1.00 68.85  ? 61  CYS A C   1 
ATOM   495  O O   . CYS A 1 61 ? 57.514 10.770 59.340 1.00 70.99  ? 61  CYS A O   1 
ATOM   496  C CB  . CYS A 1 61 ? 56.020 12.708 57.821 1.00 68.41  ? 61  CYS A CB  1 
ATOM   497  S SG  . CYS A 1 61 ? 54.906 14.150 57.593 1.00 70.72  ? 61  CYS A SG  1 
ATOM   498  N N   . ARG A 1 62 ? 59.298 12.058 59.263 1.00 68.40  ? 62  ARG A N   1 
ATOM   499  C CA  . ARG A 1 62 ? 60.102 10.864 59.552 1.00 69.98  ? 62  ARG A CA  1 
ATOM   500  C C   . ARG A 1 62 ? 59.724 9.650  58.718 1.00 68.52  ? 62  ARG A C   1 
ATOM   501  O O   . ARG A 1 62 ? 59.902 8.510  59.172 1.00 69.00  ? 62  ARG A O   1 
ATOM   502  C CB  . ARG A 1 62 ? 59.929 10.498 61.034 1.00 72.68  ? 62  ARG A CB  1 
ATOM   503  C CG  . ARG A 1 62 ? 60.445 11.567 61.993 1.00 77.99  ? 62  ARG A CG  1 
ATOM   504  C CD  . ARG A 1 62 ? 61.755 11.099 62.608 1.00 84.40  ? 62  ARG A CD  1 
ATOM   505  N NE  . ARG A 1 62 ? 62.696 10.593 61.601 1.00 88.62  ? 62  ARG A NE  1 
ATOM   506  C CZ  . ARG A 1 62 ? 63.732 9.818  61.896 1.00 91.04  ? 62  ARG A CZ  1 
ATOM   507  N NH1 . ARG A 1 62 ? 63.958 9.446  63.164 1.00 92.36  ? 62  ARG A NH1 1 
ATOM   508  N NH2 . ARG A 1 62 ? 64.538 9.400  60.929 1.00 92.34  ? 62  ARG A NH2 1 
ATOM   509  N N   . ASP A 1 63 ? 59.366 9.798  57.441 1.00 65.07  ? 63  ASP A N   1 
ATOM   510  C CA  . ASP A 1 63 ? 59.081 8.577  56.668 1.00 61.73  ? 63  ASP A CA  1 
ATOM   511  C C   . ASP A 1 63 ? 60.200 8.265  55.700 1.00 58.23  ? 63  ASP A C   1 
ATOM   512  O O   . ASP A 1 63 ? 60.193 7.384  54.842 1.00 56.75  ? 63  ASP A O   1 
ATOM   513  C CB  . ASP A 1 63 ? 57.691 8.723  56.085 1.00 63.95  ? 63  ASP A CB  1 
ATOM   514  C CG  . ASP A 1 63 ? 57.494 9.999  55.295 1.00 65.82  ? 63  ASP A CG  1 
ATOM   515  O OD1 . ASP A 1 63 ? 58.475 10.526 54.722 1.00 67.33  ? 63  ASP A OD1 1 
ATOM   516  O OD2 . ASP A 1 63 ? 56.350 10.486 55.233 1.00 66.59  ? 63  ASP A OD2 1 
ATOM   517  N N   . GLY A 1 64 ? 61.307 8.993  55.791 1.00 56.03  ? 64  GLY A N   1 
ATOM   518  C CA  . GLY A 1 64 ? 62.432 8.780  54.940 1.00 55.95  ? 64  GLY A CA  1 
ATOM   519  C C   . GLY A 1 64 ? 62.266 9.213  53.509 1.00 56.61  ? 64  GLY A C   1 
ATOM   520  O O   . GLY A 1 64 ? 63.034 8.774  52.636 1.00 57.92  ? 64  GLY A O   1 
ATOM   521  N N   . LYS A 1 65 ? 61.301 10.071 53.198 1.00 55.57  ? 65  LYS A N   1 
ATOM   522  C CA  . LYS A 1 65 ? 61.151 10.479 51.812 1.00 56.40  ? 65  LYS A CA  1 
ATOM   523  C C   . LYS A 1 65 ? 61.050 12.011 51.696 1.00 53.00  ? 65  LYS A C   1 
ATOM   524  O O   . LYS A 1 65 ? 60.368 12.663 52.464 1.00 50.90  ? 65  LYS A O   1 
ATOM   525  C CB  . LYS A 1 65 ? 60.024 9.800  51.071 1.00 58.99  ? 65  LYS A CB  1 
ATOM   526  C CG  . LYS A 1 65 ? 59.359 8.597  51.650 1.00 60.61  ? 65  LYS A CG  1 
ATOM   527  C CD  . LYS A 1 65 ? 57.948 8.415  51.124 1.00 64.01  ? 65  LYS A CD  1 
ATOM   528  C CE  . LYS A 1 65 ? 57.251 7.235  51.779 1.00 65.28  ? 65  LYS A CE  1 
ATOM   529  N NZ  . LYS A 1 65 ? 57.531 5.957  51.077 1.00 65.41  ? 65  LYS A NZ  1 
ATOM   530  N N   . VAL A 1 66 ? 61.780 12.486 50.693 1.00 49.28  ? 66  VAL A N   1 
ATOM   531  C CA  . VAL A 1 66 ? 61.791 13.929 50.394 1.00 46.09  ? 66  VAL A CA  1 
ATOM   532  C C   . VAL A 1 66 ? 61.054 14.240 49.085 1.00 41.88  ? 66  VAL A C   1 
ATOM   533  O O   . VAL A 1 66 ? 61.539 13.941 47.984 1.00 41.96  ? 66  VAL A O   1 
ATOM   534  C CB  . VAL A 1 66 ? 63.217 14.496 50.340 1.00 42.45  ? 66  VAL A CB  1 
ATOM   535  C CG1 . VAL A 1 66 ? 63.228 15.922 49.848 1.00 35.28  ? 66  VAL A CG1 1 
ATOM   536  C CG2 . VAL A 1 66 ? 63.778 14.461 51.783 1.00 43.16  ? 66  VAL A CG2 1 
ATOM   537  N N   . GLY A 1 67 ? 59.903 14.857 49.226 1.00 38.09  ? 67  GLY A N   1 
ATOM   538  C CA  . GLY A 1 67 ? 59.110 15.267 48.078 1.00 38.41  ? 67  GLY A CA  1 
ATOM   539  C C   . GLY A 1 67 ? 59.638 16.549 47.416 1.00 38.01  ? 67  GLY A C   1 
ATOM   540  O O   . GLY A 1 67 ? 60.666 17.076 47.789 1.00 38.02  ? 67  GLY A O   1 
ATOM   541  N N   . PHE A 1 68 ? 58.878 17.114 46.458 1.00 38.79  ? 68  PHE A N   1 
ATOM   542  C CA  . PHE A 1 68 ? 59.280 18.254 45.661 1.00 36.05  ? 68  PHE A CA  1 
ATOM   543  C C   . PHE A 1 68 ? 59.345 19.531 46.468 1.00 34.39  ? 68  PHE A C   1 
ATOM   544  O O   . PHE A 1 68 ? 60.304 20.289 46.404 1.00 37.76  ? 68  PHE A O   1 
ATOM   545  C CB  . PHE A 1 68 ? 58.422 18.386 44.362 1.00 32.01  ? 68  PHE A CB  1 
ATOM   546  C CG  . PHE A 1 68 ? 59.068 19.437 43.491 1.00 28.52  ? 68  PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 68 ? 60.238 19.160 42.836 1.00 28.43  ? 68  PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 68 ? 58.510 20.678 43.377 1.00 30.91  ? 68  PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 68 ? 60.856 20.111 42.072 1.00 30.10  ? 68  PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 68 ? 59.126 21.668 42.608 1.00 31.02  ? 68  PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 68 ? 60.305 21.368 41.957 1.00 34.72  ? 68  PHE A CZ  1 
ATOM   552  N N   . GLN A 1 69 ? 58.409 19.807 47.288 1.00 36.38  ? 69  GLN A N   1 
ATOM   553  C CA  . GLN A 1 69 ? 58.273 20.935 48.190 1.00 39.85  ? 69  GLN A CA  1 
ATOM   554  C C   . GLN A 1 69 ? 59.344 20.910 49.272 1.00 41.20  ? 69  GLN A C   1 
ATOM   555  O O   . GLN A 1 69 ? 60.119 21.906 49.269 1.00 46.69  ? 69  GLN A O   1 
ATOM   556  C CB  . GLN A 1 69 ? 56.849 21.027 48.651 1.00 42.20  ? 69  GLN A CB  1 
ATOM   557  C CG  . GLN A 1 69 ? 56.307 22.228 49.360 1.00 55.72  ? 69  GLN A CG  1 
ATOM   558  C CD  . GLN A 1 69 ? 54.815 22.089 49.662 1.00 63.84  ? 69  GLN A CD  1 
ATOM   559  O OE1 . GLN A 1 69 ? 54.351 22.440 50.763 1.00 68.17  ? 69  GLN A OE1 1 
ATOM   560  N NE2 . GLN A 1 69 ? 54.032 21.564 48.700 1.00 65.89  ? 69  GLN A NE2 1 
ATOM   561  N N   . SER A 1 70 ? 59.692 19.862 49.977 1.00 40.03  ? 70  SER A N   1 
ATOM   562  C CA  . SER A 1 70 ? 60.904 19.835 50.833 1.00 37.21  ? 70  SER A CA  1 
ATOM   563  C C   . SER A 1 70 ? 62.161 20.004 50.019 1.00 34.69  ? 70  SER A C   1 
ATOM   564  O O   . SER A 1 70 ? 63.027 20.834 50.344 1.00 36.73  ? 70  SER A O   1 
ATOM   565  C CB  . SER A 1 70 ? 61.013 18.503 51.598 1.00 32.49  ? 70  SER A CB  1 
ATOM   566  O OG  . SER A 1 70 ? 59.697 18.356 52.129 1.00 38.98  ? 70  SER A OG  1 
ATOM   567  N N   . PHE A 1 71 ? 62.301 19.307 48.883 1.00 32.43  ? 71  PHE A N   1 
ATOM   568  C CA  . PHE A 1 71 ? 63.523 19.615 48.118 1.00 34.26  ? 71  PHE A CA  1 
ATOM   569  C C   . PHE A 1 71 ? 63.614 21.135 47.873 1.00 35.48  ? 71  PHE A C   1 
ATOM   570  O O   . PHE A 1 71 ? 64.652 21.772 47.883 1.00 34.70  ? 71  PHE A O   1 
ATOM   571  C CB  . PHE A 1 71 ? 63.423 18.844 46.815 1.00 35.77  ? 71  PHE A CB  1 
ATOM   572  C CG  . PHE A 1 71 ? 64.372 19.298 45.714 1.00 33.02  ? 71  PHE A CG  1 
ATOM   573  C CD1 . PHE A 1 71 ? 65.686 18.933 45.720 1.00 32.01  ? 71  PHE A CD1 1 
ATOM   574  C CD2 . PHE A 1 71 ? 63.905 20.074 44.676 1.00 33.55  ? 71  PHE A CD2 1 
ATOM   575  C CE1 . PHE A 1 71 ? 66.522 19.371 44.697 1.00 34.76  ? 71  PHE A CE1 1 
ATOM   576  C CE2 . PHE A 1 71 ? 64.685 20.497 43.640 1.00 32.00  ? 71  PHE A CE2 1 
ATOM   577  C CZ  . PHE A 1 71 ? 66.010 20.141 43.672 1.00 34.77  ? 71  PHE A CZ  1 
ATOM   578  N N   . PHE A 1 72 ? 62.465 21.801 47.596 1.00 35.15  ? 72  PHE A N   1 
ATOM   579  C CA  . PHE A 1 72 ? 62.428 23.187 47.328 1.00 34.80  ? 72  PHE A CA  1 
ATOM   580  C C   . PHE A 1 72 ? 62.752 24.065 48.510 1.00 34.12  ? 72  PHE A C   1 
ATOM   581  O O   . PHE A 1 72 ? 63.359 25.153 48.331 1.00 33.91  ? 72  PHE A O   1 
ATOM   582  C CB  . PHE A 1 72 ? 61.094 23.569 46.604 1.00 35.70  ? 72  PHE A CB  1 
ATOM   583  C CG  . PHE A 1 72 ? 61.418 24.644 45.587 1.00 30.82  ? 72  PHE A CG  1 
ATOM   584  C CD1 . PHE A 1 72 ? 61.783 24.320 44.311 1.00 33.52  ? 72  PHE A CD1 1 
ATOM   585  C CD2 . PHE A 1 72 ? 61.364 25.965 45.939 1.00 32.44  ? 72  PHE A CD2 1 
ATOM   586  C CE1 . PHE A 1 72 ? 62.061 25.305 43.387 1.00 34.68  ? 72  PHE A CE1 1 
ATOM   587  C CE2 . PHE A 1 72 ? 61.724 26.942 45.035 1.00 32.33  ? 72  PHE A CE2 1 
ATOM   588  C CZ  . PHE A 1 72 ? 62.055 26.637 43.763 1.00 29.13  ? 72  PHE A CZ  1 
ATOM   589  N N   . SER A 1 73 ? 62.411 23.583 49.695 1.00 33.20  ? 73  SER A N   1 
ATOM   590  C CA  . SER A 1 73 ? 62.773 24.341 50.919 1.00 36.08  ? 73  SER A CA  1 
ATOM   591  C C   . SER A 1 73 ? 64.291 24.231 51.116 1.00 34.03  ? 73  SER A C   1 
ATOM   592  O O   . SER A 1 73 ? 65.012 25.190 51.410 1.00 37.01  ? 73  SER A O   1 
ATOM   593  C CB  . SER A 1 73 ? 61.958 23.867 52.103 1.00 40.42  ? 73  SER A CB  1 
ATOM   594  O OG  . SER A 1 73 ? 62.642 22.932 52.885 1.00 50.15  ? 73  SER A OG  1 
ATOM   595  N N   . LEU A 1 74 ? 64.892 23.112 50.737 1.00 28.85  ? 74  LEU A N   1 
ATOM   596  C CA  . LEU A 1 74 ? 66.294 22.981 50.776 1.00 27.34  ? 74  LEU A CA  1 
ATOM   597  C C   . LEU A 1 74 ? 66.902 23.938 49.816 1.00 27.74  ? 74  LEU A C   1 
ATOM   598  O O   . LEU A 1 74 ? 67.911 24.560 50.230 1.00 32.29  ? 74  LEU A O   1 
ATOM   599  C CB  . LEU A 1 74 ? 66.789 21.503 50.624 1.00 24.62  ? 74  LEU A CB  1 
ATOM   600  C CG  . LEU A 1 74 ? 68.299 21.441 50.341 1.00 26.12  ? 74  LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 74 ? 69.089 21.877 51.577 1.00 29.37  ? 74  LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 74 ? 68.714 20.106 49.861 1.00 29.01  ? 74  LEU A CD2 1 
ATOM   603  N N   . ILE A 1 75 ? 66.452 24.115 48.569 1.00 29.58  ? 75  ILE A N   1 
ATOM   604  C CA  . ILE A 1 75 ? 67.092 25.058 47.610 1.00 25.92  ? 75  ILE A CA  1 
ATOM   605  C C   . ILE A 1 75 ? 66.890 26.505 48.019 1.00 26.56  ? 75  ILE A C   1 
ATOM   606  O O   . ILE A 1 75 ? 67.749 27.353 47.781 1.00 25.78  ? 75  ILE A O   1 
ATOM   607  C CB  . ILE A 1 75 ? 66.456 24.857 46.190 1.00 30.61  ? 75  ILE A CB  1 
ATOM   608  C CG1 . ILE A 1 75 ? 66.562 23.448 45.643 1.00 29.83  ? 75  ILE A CG1 1 
ATOM   609  C CG2 . ILE A 1 75 ? 67.010 25.881 45.210 1.00 18.68  ? 75  ILE A CG2 1 
ATOM   610  C CD1 . ILE A 1 75 ? 67.844 22.676 45.814 1.00 33.53  ? 75  ILE A CD1 1 
ATOM   611  N N   . ALA A 1 76 ? 65.751 26.866 48.588 1.00 25.66  ? 76  ALA A N   1 
ATOM   612  C CA  . ALA A 1 76 ? 65.484 28.219 49.056 1.00 32.16  ? 76  ALA A CA  1 
ATOM   613  C C   . ALA A 1 76 ? 66.514 28.542 50.179 1.00 30.92  ? 76  ALA A C   1 
ATOM   614  O O   . ALA A 1 76 ? 67.388 29.397 50.052 1.00 32.74  ? 76  ALA A O   1 
ATOM   615  C CB  . ALA A 1 76 ? 64.064 28.319 49.676 1.00 32.58  ? 76  ALA A CB  1 
ATOM   616  N N   . GLY A 1 77 ? 66.511 27.746 51.193 1.00 32.26  ? 77  GLY A N   1 
ATOM   617  C CA  . GLY A 1 77 ? 67.570 27.704 52.267 1.00 28.99  ? 77  GLY A CA  1 
ATOM   618  C C   . GLY A 1 77 ? 68.915 27.916 51.685 1.00 25.54  ? 77  GLY A C   1 
ATOM   619  O O   . GLY A 1 77 ? 69.571 28.864 52.105 1.00 28.04  ? 77  GLY A O   1 
ATOM   620  N N   . LEU A 1 78 ? 69.461 27.208 50.706 1.00 24.08  ? 78  LEU A N   1 
ATOM   621  C CA  . LEU A 1 78 ? 70.750 27.623 50.226 1.00 26.70  ? 78  LEU A CA  1 
ATOM   622  C C   . LEU A 1 78 ? 70.715 28.933 49.440 1.00 31.70  ? 78  LEU A C   1 
ATOM   623  O O   . LEU A 1 78 ? 71.789 29.653 49.448 1.00 36.13  ? 78  LEU A O   1 
ATOM   624  C CB  . LEU A 1 78 ? 71.307 26.531 49.296 1.00 26.54  ? 78  LEU A CB  1 
ATOM   625  C CG  . LEU A 1 78 ? 71.391 25.123 49.871 1.00 33.34  ? 78  LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 78 ? 71.816 24.161 48.783 1.00 29.15  ? 78  LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 78 ? 72.445 25.090 51.037 1.00 33.21  ? 78  LEU A CD2 1 
ATOM   628  N N   . THR A 1 79 ? 69.641 29.240 48.708 1.00 26.37  ? 79  THR A N   1 
ATOM   629  C CA  . THR A 1 79 ? 69.700 30.416 47.825 1.00 29.34  ? 79  THR A CA  1 
ATOM   630  C C   . THR A 1 79 ? 69.691 31.688 48.640 1.00 26.27  ? 79  THR A C   1 
ATOM   631  O O   . THR A 1 79 ? 70.458 32.612 48.417 1.00 25.16  ? 79  THR A O   1 
ATOM   632  C CB  . THR A 1 79 ? 68.584 30.523 46.705 1.00 26.24  ? 79  THR A CB  1 
ATOM   633  O OG1 . THR A 1 79 ? 68.635 29.241 45.948 1.00 26.59  ? 79  THR A OG1 1 
ATOM   634  C CG2 . THR A 1 79 ? 69.145 31.451 45.655 1.00 17.43  ? 79  THR A CG2 1 
ATOM   635  N N   . ILE A 1 80 ? 68.821 31.674 49.618 1.00 28.17  ? 80  ILE A N   1 
ATOM   636  C CA  . ILE A 1 80 ? 68.702 32.832 50.535 1.00 31.44  ? 80  ILE A CA  1 
ATOM   637  C C   . ILE A 1 80 ? 70.024 32.976 51.296 1.00 36.79  ? 80  ILE A C   1 
ATOM   638  O O   . ILE A 1 80 ? 70.665 34.058 51.217 1.00 37.58  ? 80  ILE A O   1 
ATOM   639  C CB  . ILE A 1 80 ? 67.480 32.539 51.402 1.00 31.94  ? 80  ILE A CB  1 
ATOM   640  C CG1 . ILE A 1 80 ? 66.175 32.558 50.604 1.00 30.48  ? 80  ILE A CG1 1 
ATOM   641  C CG2 . ILE A 1 80 ? 67.428 33.528 52.548 1.00 37.63  ? 80  ILE A CG2 1 
ATOM   642  C CD1 . ILE A 1 80 ? 64.945 32.206 51.386 1.00 28.67  ? 80  ILE A CD1 1 
ATOM   643  N N   . ALA A 1 81 ? 70.731 31.853 51.695 1.00 32.67  ? 81  ALA A N   1 
ATOM   644  C CA  . ALA A 1 81 ? 71.985 32.083 52.401 1.00 34.57  ? 81  ALA A CA  1 
ATOM   645  C C   . ALA A 1 81 ? 72.967 32.674 51.441 1.00 37.62  ? 81  ALA A C   1 
ATOM   646  O O   . ALA A 1 81 ? 73.778 33.512 51.824 1.00 40.66  ? 81  ALA A O   1 
ATOM   647  C CB  . ALA A 1 81 ? 72.642 30.826 53.011 1.00 33.21  ? 81  ALA A CB  1 
ATOM   648  N N   . CYS A 1 82 ? 72.945 32.178 50.193 1.00 37.33  ? 82  CYS A N   1 
ATOM   649  C CA  . CYS A 1 82 ? 73.905 32.702 49.219 1.00 33.14  ? 82  CYS A CA  1 
ATOM   650  C C   . CYS A 1 82 ? 73.721 34.170 48.958 1.00 30.61  ? 82  CYS A C   1 
ATOM   651  O O   . CYS A 1 82 ? 74.701 34.865 48.757 1.00 31.90  ? 82  CYS A O   1 
ATOM   652  C CB  . CYS A 1 82 ? 73.712 31.954 47.864 1.00 29.00  ? 82  CYS A CB  1 
ATOM   653  S SG  . CYS A 1 82 ? 74.652 30.402 47.975 1.00 36.02  ? 82  CYS A SG  1 
ATOM   654  N N   . ASN A 1 83 ? 72.505 34.635 48.924 1.00 31.90  ? 83  ASN A N   1 
ATOM   655  C CA  . ASN A 1 83 ? 72.183 36.032 48.694 1.00 34.62  ? 83  ASN A CA  1 
ATOM   656  C C   . ASN A 1 83 ? 72.524 36.901 49.906 1.00 35.07  ? 83  ASN A C   1 
ATOM   657  O O   . ASN A 1 83 ? 72.798 38.114 49.740 1.00 38.86  ? 83  ASN A O   1 
ATOM   658  C CB  . ASN A 1 83 ? 70.632 36.151 48.427 1.00 27.56  ? 83  ASN A CB  1 
ATOM   659  C CG  . ASN A 1 83 ? 70.339 37.607 48.152 1.00 29.44  ? 83  ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 83 ? 69.515 38.175 48.830 1.00 33.51  ? 83  ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 83 ? 70.990 38.227 47.188 1.00 27.46  ? 83  ASN A ND2 1 
ATOM   662  N N   . ASP A 1 84 ? 72.298 36.423 51.124 1.00 35.41  ? 84  ASP A N   1 
ATOM   663  C CA  . ASP A 1 84 ? 72.703 37.276 52.334 1.00 34.87  ? 84  ASP A CA  1 
ATOM   664  C C   . ASP A 1 84 ? 74.228 37.411 52.230 1.00 33.07  ? 84  ASP A C   1 
ATOM   665  O O   . ASP A 1 84 ? 74.748 38.523 52.219 1.00 34.07  ? 84  ASP A O   1 
ATOM   666  C CB  . ASP A 1 84 ? 72.286 36.622 53.602 1.00 30.98  ? 84  ASP A CB  1 
ATOM   667  C CG  . ASP A 1 84 ? 70.869 36.723 53.979 1.00 32.77  ? 84  ASP A CG  1 
ATOM   668  O OD1 . ASP A 1 84 ? 70.064 37.643 53.680 1.00 41.35  ? 84  ASP A OD1 1 
ATOM   669  O OD2 . ASP A 1 84 ? 70.396 35.834 54.697 1.00 43.74  ? 84  ASP A OD2 1 
ATOM   670  N N   . TYR A 1 85 ? 74.973 36.343 51.968 1.00 31.67  ? 85  TYR A N   1 
ATOM   671  C CA  . TYR A 1 85 ? 76.405 36.561 51.833 1.00 38.82  ? 85  TYR A CA  1 
ATOM   672  C C   . TYR A 1 85 ? 76.783 37.521 50.735 1.00 44.82  ? 85  TYR A C   1 
ATOM   673  O O   . TYR A 1 85 ? 77.647 38.392 50.798 1.00 49.60  ? 85  TYR A O   1 
ATOM   674  C CB  . TYR A 1 85 ? 77.080 35.230 51.589 1.00 41.72  ? 85  TYR A CB  1 
ATOM   675  C CG  . TYR A 1 85 ? 78.572 35.300 51.519 1.00 46.81  ? 85  TYR A CG  1 
ATOM   676  C CD1 . TYR A 1 85 ? 79.270 35.794 50.436 1.00 47.23  ? 85  TYR A CD1 1 
ATOM   677  C CD2 . TYR A 1 85 ? 79.287 34.802 52.637 1.00 49.12  ? 85  TYR A CD2 1 
ATOM   678  C CE1 . TYR A 1 85 ? 80.652 35.823 50.400 1.00 48.08  ? 85  TYR A CE1 1 
ATOM   679  C CE2 . TYR A 1 85 ? 80.675 34.819 52.616 1.00 48.84  ? 85  TYR A CE2 1 
ATOM   680  C CZ  . TYR A 1 85 ? 81.322 35.338 51.523 1.00 50.34  ? 85  TYR A CZ  1 
ATOM   681  O OH  . TYR A 1 85 ? 82.696 35.328 51.559 1.00 55.97  ? 85  TYR A OH  1 
ATOM   682  N N   . PHE A 1 86 ? 76.202 37.370 49.549 1.00 47.82  ? 86  PHE A N   1 
ATOM   683  C CA  . PHE A 1 86 ? 76.491 38.199 48.397 1.00 44.40  ? 86  PHE A CA  1 
ATOM   684  C C   . PHE A 1 86 ? 76.136 39.632 48.683 1.00 41.29  ? 86  PHE A C   1 
ATOM   685  O O   . PHE A 1 86 ? 76.944 40.468 48.319 1.00 42.38  ? 86  PHE A O   1 
ATOM   686  C CB  . PHE A 1 86 ? 75.716 37.668 47.138 1.00 41.78  ? 86  PHE A CB  1 
ATOM   687  C CG  . PHE A 1 86 ? 75.503 38.629 46.017 1.00 36.00  ? 86  PHE A CG  1 
ATOM   688  C CD1 . PHE A 1 86 ? 76.434 38.760 45.019 1.00 40.56  ? 86  PHE A CD1 1 
ATOM   689  C CD2 . PHE A 1 86 ? 74.355 39.409 45.971 1.00 38.58  ? 86  PHE A CD2 1 
ATOM   690  C CE1 . PHE A 1 86 ? 76.265 39.653 43.955 1.00 43.14  ? 86  PHE A CE1 1 
ATOM   691  C CE2 . PHE A 1 86 ? 74.179 40.312 44.919 1.00 45.23  ? 86  PHE A CE2 1 
ATOM   692  C CZ  . PHE A 1 86 ? 75.135 40.437 43.908 1.00 42.36  ? 86  PHE A CZ  1 
ATOM   693  N N   . VAL A 1 87 ? 74.978 39.918 49.258 1.00 41.46  ? 87  VAL A N   1 
ATOM   694  C CA  . VAL A 1 87 ? 74.683 41.376 49.480 1.00 44.30  ? 87  VAL A CA  1 
ATOM   695  C C   . VAL A 1 87 ? 75.727 42.082 50.345 1.00 47.26  ? 87  VAL A C   1 
ATOM   696  O O   . VAL A 1 87 ? 76.190 43.178 50.064 1.00 48.11  ? 87  VAL A O   1 
ATOM   697  C CB  . VAL A 1 87 ? 73.304 41.483 50.146 1.00 43.83  ? 87  VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 87 ? 73.136 42.814 50.834 1.00 42.90  ? 87  VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 87 ? 72.179 41.240 49.151 1.00 42.07  ? 87  VAL A CG2 1 
ATOM   700  N N   . VAL A 1 88 ? 76.174 41.474 51.428 1.00 48.44  ? 88  VAL A N   1 
ATOM   701  C CA  . VAL A 1 88 ? 77.119 41.916 52.374 1.00 53.80  ? 88  VAL A CA  1 
ATOM   702  C C   . VAL A 1 88 ? 78.557 42.011 51.900 1.00 54.73  ? 88  VAL A C   1 
ATOM   703  O O   . VAL A 1 88 ? 79.192 43.003 52.240 1.00 57.04  ? 88  VAL A O   1 
ATOM   704  C CB  . VAL A 1 88 ? 77.118 40.978 53.644 1.00 55.74  ? 88  VAL A CB  1 
ATOM   705  C CG1 . VAL A 1 88 ? 78.271 41.263 54.570 1.00 53.49  ? 88  VAL A CG1 1 
ATOM   706  C CG2 . VAL A 1 88 ? 75.802 41.122 54.388 1.00 56.13  ? 88  VAL A CG2 1 
ATOM   707  N N   . HIS A 1 89 ? 79.101 41.032 51.226 1.00 56.49  ? 89  HIS A N   1 
ATOM   708  C CA  . HIS A 1 89 ? 80.455 40.943 50.771 1.00 56.90  ? 89  HIS A CA  1 
ATOM   709  C C   . HIS A 1 89 ? 80.753 41.103 49.292 1.00 58.82  ? 89  HIS A C   1 
ATOM   710  O O   . HIS A 1 89 ? 81.832 41.610 48.941 1.00 57.77  ? 89  HIS A O   1 
ATOM   711  C CB  . HIS A 1 89 ? 81.033 39.556 51.107 1.00 54.71  ? 89  HIS A CB  1 
ATOM   712  C CG  . HIS A 1 89 ? 80.970 39.252 52.565 1.00 59.65  ? 89  HIS A CG  1 
ATOM   713  N ND1 . HIS A 1 89 ? 80.016 38.411 53.122 1.00 58.88  ? 89  HIS A ND1 1 
ATOM   714  C CD2 . HIS A 1 89 ? 81.772 39.664 53.583 1.00 59.61  ? 89  HIS A CD2 1 
ATOM   715  C CE1 . HIS A 1 89 ? 80.246 38.311 54.421 1.00 61.10  ? 89  HIS A CE1 1 
ATOM   716  N NE2 . HIS A 1 89 ? 81.294 39.065 54.728 1.00 60.02  ? 89  HIS A NE2 1 
ATOM   717  N N   . MET A 1 90 ? 79.864 40.624 48.413 1.00 60.56  ? 90  MET A N   1 
ATOM   718  C CA  . MET A 1 90 ? 80.178 40.706 46.998 1.00 61.59  ? 90  MET A CA  1 
ATOM   719  C C   . MET A 1 90 ? 79.592 41.822 46.186 1.00 63.66  ? 90  MET A C   1 
ATOM   720  O O   . MET A 1 90 ? 80.389 42.237 45.323 1.00 64.16  ? 90  MET A O   1 
ATOM   721  C CB  . MET A 1 90 ? 79.989 39.344 46.346 1.00 54.75  ? 90  MET A CB  1 
ATOM   722  C CG  . MET A 1 90 ? 81.069 38.386 46.762 1.00 54.77  ? 90  MET A CG  1 
ATOM   723  S SD  . MET A 1 90 ? 80.725 36.696 46.254 1.00 59.13  ? 90  MET A SD  1 
ATOM   724  C CE  . MET A 1 90 ? 81.813 36.574 44.828 1.00 61.07  ? 90  MET A CE  1 
ATOM   725  N N   . LYS A 1 91 ? 78.404 42.371 46.305 1.00 65.91  ? 91  LYS A N   1 
ATOM   726  C CA  . LYS A 1 91 ? 77.974 43.433 45.400 1.00 70.30  ? 91  LYS A CA  1 
ATOM   727  C C   . LYS A 1 91 ? 78.917 44.631 45.338 1.00 73.62  ? 91  LYS A C   1 
ATOM   728  O O   . LYS A 1 91 ? 78.338 45.785 45.315 1.00 76.78  ? 91  LYS A O   1 
ATOM   729  C CB  . LYS A 1 91 ? 76.526 43.844 45.539 1.00 71.29  ? 91  LYS A CB  1 
ATOM   730  C CG  . LYS A 1 91 ? 75.942 44.338 46.803 1.00 74.95  ? 91  LYS A CG  1 
ATOM   731  C CD  . LYS A 1 91 ? 76.952 44.875 47.803 1.00 77.36  ? 91  LYS A CD  1 
ATOM   732  C CE  . LYS A 1 91 ? 76.330 45.944 48.677 1.00 83.27  ? 91  LYS A CE  1 
ATOM   733  N NZ  . LYS A 1 91 ? 75.330 45.400 49.641 1.00 85.08  ? 91  LYS A NZ  1 
ATOM   734  N N   . PRO B 1 1  ? 80.664 24.773 37.466 1.00 33.68  ? 1   PRO B N   1 
ATOM   735  C CA  . PRO B 1 1  ? 79.431 24.934 38.312 1.00 32.89  ? 1   PRO B CA  1 
ATOM   736  C C   . PRO B 1 1  ? 78.404 23.937 37.878 1.00 33.92  ? 1   PRO B C   1 
ATOM   737  O O   . PRO B 1 1  ? 78.561 23.391 36.811 1.00 40.60  ? 1   PRO B O   1 
ATOM   738  C CB  . PRO B 1 1  ? 79.041 26.351 38.245 1.00 32.15  ? 1   PRO B CB  1 
ATOM   739  C CG  . PRO B 1 1  ? 80.195 27.074 37.745 1.00 34.82  ? 1   PRO B CG  1 
ATOM   740  C CD  . PRO B 1 1  ? 81.328 26.119 37.425 1.00 36.05  ? 1   PRO B CD  1 
ATOM   741  N N   . SER B 1 2  ? 77.447 23.526 38.679 1.00 32.21  ? 2   SER B N   1 
ATOM   742  C CA  . SER B 1 2  ? 76.529 22.532 38.195 1.00 33.73  ? 2   SER B CA  1 
ATOM   743  C C   . SER B 1 2  ? 75.360 23.264 37.523 1.00 34.56  ? 2   SER B C   1 
ATOM   744  O O   . SER B 1 2  ? 75.168 24.481 37.645 1.00 36.52  ? 2   SER B O   1 
ATOM   745  C CB  . SER B 1 2  ? 76.042 21.705 39.405 1.00 26.59  ? 2   SER B CB  1 
ATOM   746  O OG  . SER B 1 2  ? 75.282 22.578 40.195 1.00 34.51  ? 2   SER B OG  1 
ATOM   747  N N   . GLN B 1 3  ? 74.421 22.462 37.004 1.00 33.04  ? 3   GLN B N   1 
ATOM   748  C CA  . GLN B 1 3  ? 73.181 23.145 36.549 1.00 33.60  ? 3   GLN B CA  1 
ATOM   749  C C   . GLN B 1 3  ? 72.468 23.811 37.703 1.00 30.88  ? 3   GLN B C   1 
ATOM   750  O O   . GLN B 1 3  ? 71.909 24.887 37.622 1.00 36.43  ? 3   GLN B O   1 
ATOM   751  C CB  . GLN B 1 3  ? 72.302 22.055 35.942 1.00 37.95  ? 3   GLN B CB  1 
ATOM   752  C CG  . GLN B 1 3  ? 72.548 21.893 34.431 1.00 43.25  ? 3   GLN B CG  1 
ATOM   753  C CD  . GLN B 1 3  ? 71.482 20.891 33.928 1.00 50.41  ? 3   GLN B CD  1 
ATOM   754  O OE1 . GLN B 1 3  ? 71.521 19.714 34.290 1.00 54.26  ? 3   GLN B OE1 1 
ATOM   755  N NE2 . GLN B 1 3  ? 70.510 21.384 33.186 1.00 51.26  ? 3   GLN B NE2 1 
ATOM   756  N N   . MET B 1 4  ? 72.371 23.181 38.856 1.00 33.85  ? 4   MET B N   1 
ATOM   757  C CA  . MET B 1 4  ? 71.686 23.695 40.065 1.00 30.21  ? 4   MET B CA  1 
ATOM   758  C C   . MET B 1 4  ? 72.299 25.017 40.473 1.00 25.64  ? 4   MET B C   1 
ATOM   759  O O   . MET B 1 4  ? 71.601 25.975 40.692 1.00 26.20  ? 4   MET B O   1 
ATOM   760  C CB  . MET B 1 4  ? 71.723 22.672 41.148 1.00 32.88  ? 4   MET B CB  1 
ATOM   761  C CG  . MET B 1 4  ? 70.530 21.737 41.267 1.00 37.23  ? 4   MET B CG  1 
ATOM   762  S SD  . MET B 1 4  ? 68.938 22.323 40.976 1.00 39.11  ? 4   MET B SD  1 
ATOM   763  C CE  . MET B 1 4  ? 68.060 22.854 42.361 1.00 34.94  ? 4   MET B CE  1 
ATOM   764  N N   . GLU B 1 5  ? 73.613 25.128 40.450 1.00 24.46  ? 5   GLU B N   1 
ATOM   765  C CA  . GLU B 1 5  ? 74.289 26.350 40.775 1.00 28.90  ? 5   GLU B CA  1 
ATOM   766  C C   . GLU B 1 5  ? 74.026 27.453 39.766 1.00 31.31  ? 5   GLU B C   1 
ATOM   767  O O   . GLU B 1 5  ? 73.749 28.554 40.245 1.00 33.34  ? 5   GLU B O   1 
ATOM   768  C CB  . GLU B 1 5  ? 75.827 26.161 40.859 1.00 30.99  ? 5   GLU B CB  1 
ATOM   769  C CG  . GLU B 1 5  ? 76.184 25.260 42.043 1.00 32.68  ? 5   GLU B CG  1 
ATOM   770  C CD  . GLU B 1 5  ? 77.682 24.963 42.054 1.00 38.37  ? 5   GLU B CD  1 
ATOM   771  O OE1 . GLU B 1 5  ? 78.334 24.801 41.007 1.00 38.93  ? 5   GLU B OE1 1 
ATOM   772  O OE2 . GLU B 1 5  ? 78.263 24.870 43.146 1.00 40.20  ? 5   GLU B OE2 1 
ATOM   773  N N   . HIS B 1 6  ? 73.954 27.096 38.437 1.00 30.78  ? 6   HIS B N   1 
ATOM   774  C CA  . HIS B 1 6  ? 73.598 28.122 37.442 1.00 24.58  ? 6   HIS B CA  1 
ATOM   775  C C   . HIS B 1 6  ? 72.183 28.529 37.666 1.00 23.49  ? 6   HIS B C   1 
ATOM   776  O O   . HIS B 1 6  ? 71.903 29.709 37.587 1.00 26.38  ? 6   HIS B O   1 
ATOM   777  C CB  . HIS B 1 6  ? 73.692 27.625 36.002 1.00 28.50  ? 6   HIS B CB  1 
ATOM   778  C CG  . HIS B 1 6  ? 75.105 27.719 35.504 1.00 17.28  ? 6   HIS B CG  1 
ATOM   779  N ND1 . HIS B 1 6  ? 75.562 28.927 35.015 1.00 19.11  ? 6   HIS B ND1 1 
ATOM   780  C CD2 . HIS B 1 6  ? 76.066 26.811 35.494 1.00 16.03  ? 6   HIS B CD2 1 
ATOM   781  C CE1 . HIS B 1 6  ? 76.868 28.746 34.689 1.00 19.74  ? 6   HIS B CE1 1 
ATOM   782  N NE2 . HIS B 1 6  ? 77.184 27.484 34.962 1.00 24.92  ? 6   HIS B NE2 1 
ATOM   783  N N   . ALA B 1 7  ? 71.330 27.566 37.975 1.00 20.24  ? 7   ALA B N   1 
ATOM   784  C CA  . ALA B 1 7  ? 69.962 28.010 38.213 1.00 24.18  ? 7   ALA B CA  1 
ATOM   785  C C   . ALA B 1 7  ? 69.819 28.922 39.384 1.00 27.31  ? 7   ALA B C   1 
ATOM   786  O O   . ALA B 1 7  ? 68.883 29.776 39.398 1.00 33.08  ? 7   ALA B O   1 
ATOM   787  C CB  . ALA B 1 7  ? 69.018 26.802 38.341 1.00 20.78  ? 7   ALA B CB  1 
ATOM   788  N N   . MET B 1 8  ? 70.556 28.686 40.448 1.00 29.07  ? 8   MET B N   1 
ATOM   789  C CA  . MET B 1 8  ? 70.382 29.462 41.748 1.00 28.19  ? 8   MET B CA  1 
ATOM   790  C C   . MET B 1 8  ? 70.935 30.846 41.483 1.00 25.15  ? 8   MET B C   1 
ATOM   791  O O   . MET B 1 8  ? 70.395 31.840 41.870 1.00 27.53  ? 8   MET B O   1 
ATOM   792  C CB  . MET B 1 8  ? 71.251 28.760 42.841 1.00 25.67  ? 8   MET B CB  1 
ATOM   793  C CG  . MET B 1 8  ? 70.529 27.580 43.445 1.00 27.31  ? 8   MET B CG  1 
ATOM   794  S SD  . MET B 1 8  ? 71.591 26.461 44.424 1.00 35.98  ? 8   MET B SD  1 
ATOM   795  C CE  . MET B 1 8  ? 72.052 27.682 45.735 1.00 21.92  ? 8   MET B CE  1 
ATOM   796  N N   . GLU B 1 9  ? 72.070 30.900 40.793 1.00 25.11  ? 9   GLU B N   1 
ATOM   797  C CA  . GLU B 1 9  ? 72.632 32.169 40.433 1.00 29.77  ? 9   GLU B CA  1 
ATOM   798  C C   . GLU B 1 9  ? 71.645 32.957 39.547 1.00 31.50  ? 9   GLU B C   1 
ATOM   799  O O   . GLU B 1 9  ? 71.402 34.100 39.895 1.00 34.41  ? 9   GLU B O   1 
ATOM   800  C CB  . GLU B 1 9  ? 73.926 32.008 39.610 1.00 29.67  ? 9   GLU B CB  1 
ATOM   801  C CG  . GLU B 1 9  ? 74.590 33.357 39.314 1.00 34.43  ? 9   GLU B CG  1 
ATOM   802  C CD  . GLU B 1 9  ? 76.052 33.203 38.981 1.00 43.47  ? 9   GLU B CD  1 
ATOM   803  O OE1 . GLU B 1 9  ? 76.784 32.454 39.697 1.00 45.89  ? 9   GLU B OE1 1 
ATOM   804  O OE2 . GLU B 1 9  ? 76.591 33.795 37.989 1.00 47.84  ? 9   GLU B OE2 1 
ATOM   805  N N   . THR B 1 10 ? 70.997 32.327 38.526 1.00 29.84  ? 10  THR B N   1 
ATOM   806  C CA  . THR B 1 10 ? 70.145 33.078 37.670 1.00 29.14  ? 10  THR B CA  1 
ATOM   807  C C   . THR B 1 10 ? 69.027 33.677 38.485 1.00 29.57  ? 10  THR B C   1 
ATOM   808  O O   . THR B 1 10 ? 68.833 34.835 38.208 1.00 29.11  ? 10  THR B O   1 
ATOM   809  C CB  . THR B 1 10 ? 69.692 32.622 36.257 1.00 28.10  ? 10  THR B CB  1 
ATOM   810  O OG1 . THR B 1 10 ? 68.327 32.287 36.157 1.00 29.26  ? 10  THR B OG1 1 
ATOM   811  C CG2 . THR B 1 10 ? 70.521 31.548 35.662 1.00 19.89  ? 10  THR B CG2 1 
ATOM   812  N N   . MET B 1 11 ? 68.409 33.001 39.421 1.00 32.42  ? 11  MET B N   1 
ATOM   813  C CA  . MET B 1 11 ? 67.363 33.517 40.255 1.00 32.99  ? 11  MET B CA  1 
ATOM   814  C C   . MET B 1 11 ? 67.860 34.617 41.182 1.00 39.35  ? 11  MET B C   1 
ATOM   815  O O   . MET B 1 11 ? 67.039 35.477 41.543 1.00 43.02  ? 11  MET B O   1 
ATOM   816  C CB  . MET B 1 11 ? 66.599 32.478 41.059 1.00 31.87  ? 11  MET B CB  1 
ATOM   817  C CG  . MET B 1 11 ? 66.341 31.116 40.387 1.00 30.29  ? 11  MET B CG  1 
ATOM   818  S SD  . MET B 1 11 ? 65.120 30.207 41.360 1.00 39.23  ? 11  MET B SD  1 
ATOM   819  C CE  . MET B 1 11 ? 64.421 29.010 40.247 1.00 44.74  ? 11  MET B CE  1 
ATOM   820  N N   . MET B 1 12 ? 69.107 34.605 41.629 1.00 40.44  ? 12  MET B N   1 
ATOM   821  C CA  . MET B 1 12 ? 69.664 35.609 42.498 1.00 39.82  ? 12  MET B CA  1 
ATOM   822  C C   . MET B 1 12 ? 69.908 36.897 41.695 1.00 39.09  ? 12  MET B C   1 
ATOM   823  O O   . MET B 1 12 ? 69.608 38.008 42.124 1.00 37.22  ? 12  MET B O   1 
ATOM   824  C CB  . MET B 1 12 ? 71.098 35.183 42.977 1.00 41.61  ? 12  MET B CB  1 
ATOM   825  C CG  . MET B 1 12 ? 71.467 35.699 44.359 1.00 44.68  ? 12  MET B CG  1 
ATOM   826  S SD  . MET B 1 12 ? 72.939 34.906 45.045 1.00 47.64  ? 12  MET B SD  1 
ATOM   827  C CE  . MET B 1 12 ? 74.226 35.849 44.304 1.00 38.57  ? 12  MET B CE  1 
ATOM   828  N N   . PHE B 1 13 ? 70.552 36.703 40.541 1.00 37.50  ? 13  PHE B N   1 
ATOM   829  C CA  . PHE B 1 13 ? 70.876 37.828 39.671 1.00 39.35  ? 13  PHE B CA  1 
ATOM   830  C C   . PHE B 1 13 ? 69.625 38.495 39.076 1.00 40.95  ? 13  PHE B C   1 
ATOM   831  O O   . PHE B 1 13 ? 69.697 39.722 38.942 1.00 42.28  ? 13  PHE B O   1 
ATOM   832  C CB  . PHE B 1 13 ? 71.881 37.437 38.639 1.00 41.15  ? 13  PHE B CB  1 
ATOM   833  C CG  . PHE B 1 13 ? 73.300 37.241 38.983 1.00 46.49  ? 13  PHE B CG  1 
ATOM   834  C CD1 . PHE B 1 13 ? 73.796 37.528 40.269 1.00 53.35  ? 13  PHE B CD1 1 
ATOM   835  C CD2 . PHE B 1 13 ? 74.217 36.800 38.049 1.00 50.50  ? 13  PHE B CD2 1 
ATOM   836  C CE1 . PHE B 1 13 ? 75.114 37.368 40.612 1.00 53.53  ? 13  PHE B CE1 1 
ATOM   837  C CE2 . PHE B 1 13 ? 75.562 36.635 38.357 1.00 56.53  ? 13  PHE B CE2 1 
ATOM   838  C CZ  . PHE B 1 13 ? 76.023 36.923 39.648 1.00 56.88  ? 13  PHE B CZ  1 
ATOM   839  N N   . THR B 1 14 ? 68.528 37.800 38.880 1.00 40.60  ? 14  THR B N   1 
ATOM   840  C CA  . THR B 1 14 ? 67.262 38.225 38.378 1.00 43.22  ? 14  THR B CA  1 
ATOM   841  C C   . THR B 1 14 ? 66.669 39.256 39.332 1.00 42.91  ? 14  THR B C   1 
ATOM   842  O O   . THR B 1 14 ? 66.335 40.375 38.952 1.00 42.84  ? 14  THR B O   1 
ATOM   843  C CB  . THR B 1 14 ? 66.157 37.140 38.204 1.00 42.80  ? 14  THR B CB  1 
ATOM   844  O OG1 . THR B 1 14 ? 66.536 36.179 37.229 1.00 48.71  ? 14  THR B OG1 1 
ATOM   845  C CG2 . THR B 1 14 ? 64.854 37.689 37.621 1.00 40.89  ? 14  THR B CG2 1 
ATOM   846  N N   . PHE B 1 15 ? 66.438 38.773 40.553 1.00 42.60  ? 15  PHE B N   1 
ATOM   847  C CA  . PHE B 1 15 ? 65.959 39.667 41.607 1.00 43.36  ? 15  PHE B CA  1 
ATOM   848  C C   . PHE B 1 15 ? 66.848 40.944 41.667 1.00 43.32  ? 15  PHE B C   1 
ATOM   849  O O   . PHE B 1 15 ? 66.307 42.015 41.710 1.00 40.18  ? 15  PHE B O   1 
ATOM   850  C CB  . PHE B 1 15 ? 66.115 39.004 42.990 1.00 41.48  ? 15  PHE B CB  1 
ATOM   851  C CG  . PHE B 1 15 ? 65.819 39.935 44.156 1.00 37.88  ? 15  PHE B CG  1 
ATOM   852  C CD1 . PHE B 1 15 ? 66.837 40.693 44.731 1.00 32.05  ? 15  PHE B CD1 1 
ATOM   853  C CD2 . PHE B 1 15 ? 64.541 40.010 44.669 1.00 32.73  ? 15  PHE B CD2 1 
ATOM   854  C CE1 . PHE B 1 15 ? 66.528 41.505 45.805 1.00 31.45  ? 15  PHE B CE1 1 
ATOM   855  C CE2 . PHE B 1 15 ? 64.243 40.850 45.732 1.00 34.38  ? 15  PHE B CE2 1 
ATOM   856  C CZ  . PHE B 1 15 ? 65.265 41.599 46.305 1.00 27.96  ? 15  PHE B CZ  1 
ATOM   857  N N   . HIS B 1 16 ? 68.186 40.816 41.665 1.00 43.26  ? 16  HIS B N   1 
ATOM   858  C CA  . HIS B 1 16 ? 68.961 42.023 41.800 1.00 49.12  ? 16  HIS B CA  1 
ATOM   859  C C   . HIS B 1 16 ? 68.766 43.010 40.674 1.00 53.43  ? 16  HIS B C   1 
ATOM   860  O O   . HIS B 1 16 ? 68.715 44.231 40.883 1.00 54.52  ? 16  HIS B O   1 
ATOM   861  C CB  . HIS B 1 16 ? 70.441 41.761 42.089 1.00 46.31  ? 16  HIS B CB  1 
ATOM   862  C CG  . HIS B 1 16 ? 70.582 41.269 43.508 1.00 52.34  ? 16  HIS B CG  1 
ATOM   863  N ND1 . HIS B 1 16 ? 70.359 42.085 44.590 1.00 57.19  ? 16  HIS B ND1 1 
ATOM   864  C CD2 . HIS B 1 16 ? 70.886 40.061 44.032 1.00 53.68  ? 16  HIS B CD2 1 
ATOM   865  C CE1 . HIS B 1 16 ? 70.512 41.433 45.724 1.00 53.90  ? 16  HIS B CE1 1 
ATOM   866  N NE2 . HIS B 1 16 ? 70.825 40.198 45.396 1.00 56.70  ? 16  HIS B NE2 1 
ATOM   867  N N   . LYS B 1 17 ? 68.614 42.476 39.475 1.00 56.54  ? 17  LYS B N   1 
ATOM   868  C CA  . LYS B 1 17 ? 68.495 43.133 38.210 1.00 55.68  ? 17  LYS B CA  1 
ATOM   869  C C   . LYS B 1 17 ? 67.279 44.069 38.243 1.00 54.56  ? 17  LYS B C   1 
ATOM   870  O O   . LYS B 1 17 ? 67.363 45.153 37.705 1.00 55.13  ? 17  LYS B O   1 
ATOM   871  C CB  . LYS B 1 17 ? 68.166 42.086 37.134 1.00 60.22  ? 17  LYS B CB  1 
ATOM   872  C CG  . LYS B 1 17 ? 69.078 41.837 35.967 1.00 62.17  ? 17  LYS B CG  1 
ATOM   873  C CD  . LYS B 1 17 ? 68.881 40.373 35.487 1.00 63.56  ? 17  LYS B CD  1 
ATOM   874  C CE  . LYS B 1 17 ? 70.203 39.642 35.338 1.00 66.80  ? 17  LYS B CE  1 
ATOM   875  N NZ  . LYS B 1 17 ? 70.001 38.210 34.940 1.00 73.27  ? 17  LYS B NZ  1 
ATOM   876  N N   . PHE B 1 18 ? 66.211 43.587 38.832 1.00 51.72  ? 18  PHE B N   1 
ATOM   877  C CA  . PHE B 1 18 ? 64.995 44.372 38.877 1.00 56.91  ? 18  PHE B CA  1 
ATOM   878  C C   . PHE B 1 18 ? 64.872 45.192 40.148 1.00 61.53  ? 18  PHE B C   1 
ATOM   879  O O   . PHE B 1 18 ? 63.933 45.998 40.314 1.00 61.89  ? 18  PHE B O   1 
ATOM   880  C CB  . PHE B 1 18 ? 63.780 43.424 38.659 1.00 51.93  ? 18  PHE B CB  1 
ATOM   881  C CG  . PHE B 1 18 ? 63.780 42.815 37.268 1.00 57.61  ? 18  PHE B CG  1 
ATOM   882  C CD1 . PHE B 1 18 ? 63.404 43.583 36.151 1.00 56.43  ? 18  PHE B CD1 1 
ATOM   883  C CD2 . PHE B 1 18 ? 64.181 41.510 37.030 1.00 55.84  ? 18  PHE B CD2 1 
ATOM   884  C CE1 . PHE B 1 18 ? 63.414 43.029 34.887 1.00 55.62  ? 18  PHE B CE1 1 
ATOM   885  C CE2 . PHE B 1 18 ? 64.243 40.940 35.768 1.00 51.88  ? 18  PHE B CE2 1 
ATOM   886  C CZ  . PHE B 1 18 ? 63.840 41.717 34.688 1.00 55.75  ? 18  PHE B CZ  1 
ATOM   887  N N   . ALA B 1 19 ? 65.785 44.936 41.116 1.00 63.00  ? 19  ALA B N   1 
ATOM   888  C CA  . ALA B 1 19 ? 65.613 45.565 42.415 1.00 64.83  ? 19  ALA B CA  1 
ATOM   889  C C   . ALA B 1 19 ? 66.428 46.838 42.484 1.00 66.82  ? 19  ALA B C   1 
ATOM   890  O O   . ALA B 1 19 ? 65.999 47.809 43.109 1.00 66.49  ? 19  ALA B O   1 
ATOM   891  C CB  . ALA B 1 19 ? 65.805 44.584 43.544 1.00 62.99  ? 19  ALA B CB  1 
ATOM   892  N N   . GLY B 1 20 ? 67.579 46.868 41.825 1.00 68.48  ? 20  GLY B N   1 
ATOM   893  C CA  . GLY B 1 20 ? 68.362 48.108 41.867 1.00 70.69  ? 20  GLY B CA  1 
ATOM   894  C C   . GLY B 1 20 ? 69.264 48.171 43.067 1.00 72.23  ? 20  GLY B C   1 
ATOM   895  O O   . GLY B 1 20 ? 69.508 47.149 43.702 1.00 72.47  ? 20  GLY B O   1 
ATOM   896  N N   . ASP B 1 21 ? 69.860 49.339 43.319 1.00 73.85  ? 21  ASP B N   1 
ATOM   897  C CA  . ASP B 1 21 ? 70.783 49.474 44.470 1.00 72.96  ? 21  ASP B CA  1 
ATOM   898  C C   . ASP B 1 21 ? 69.956 49.418 45.736 1.00 71.47  ? 21  ASP B C   1 
ATOM   899  O O   . ASP B 1 21 ? 70.345 48.837 46.745 1.00 70.65  ? 21  ASP B O   1 
ATOM   900  C CB  . ASP B 1 21 ? 71.587 50.744 44.343 1.00 78.59  ? 21  ASP B CB  1 
ATOM   901  C CG  . ASP B 1 21 ? 73.086 50.573 44.303 1.00 83.56  ? 21  ASP B CG  1 
ATOM   902  O OD1 . ASP B 1 21 ? 73.644 50.111 43.280 1.00 84.21  ? 21  ASP B OD1 1 
ATOM   903  O OD2 . ASP B 1 21 ? 73.738 50.919 45.328 1.00 87.10  ? 21  ASP B OD2 1 
ATOM   904  N N   . LYS B 1 22 ? 68.700 49.894 45.703 1.00 69.90  ? 22  LYS B N   1 
ATOM   905  C CA  . LYS B 1 22 ? 67.805 49.839 46.837 1.00 68.20  ? 22  LYS B CA  1 
ATOM   906  C C   . LYS B 1 22 ? 67.668 48.441 47.437 1.00 67.50  ? 22  LYS B C   1 
ATOM   907  O O   . LYS B 1 22 ? 67.050 48.356 48.523 1.00 67.97  ? 22  LYS B O   1 
ATOM   908  C CB  . LYS B 1 22 ? 66.393 50.363 46.593 1.00 64.78  ? 22  LYS B CB  1 
ATOM   909  C CG  . LYS B 1 22 ? 65.828 50.444 45.211 1.00 64.48  ? 22  LYS B CG  1 
ATOM   910  C CD  . LYS B 1 22 ? 64.301 50.395 45.208 1.00 64.34  ? 22  LYS B CD  1 
ATOM   911  C CE  . LYS B 1 22 ? 63.785 49.728 43.931 1.00 66.32  ? 22  LYS B CE  1 
ATOM   912  N NZ  . LYS B 1 22 ? 62.338 49.372 44.070 1.00 67.34  ? 22  LYS B NZ  1 
ATOM   913  N N   . GLY B 1 23 ? 68.084 47.370 46.799 1.00 66.59  ? 23  GLY B N   1 
ATOM   914  C CA  . GLY B 1 23 ? 68.014 46.016 47.267 1.00 65.06  ? 23  GLY B CA  1 
ATOM   915  C C   . GLY B 1 23 ? 66.659 45.377 47.449 1.00 63.15  ? 23  GLY B C   1 
ATOM   916  O O   . GLY B 1 23 ? 66.575 44.289 48.047 1.00 63.66  ? 23  GLY B O   1 
ATOM   917  N N   . TYR B 1 24 ? 65.562 45.953 46.999 1.00 60.56  ? 24  TYR B N   1 
ATOM   918  C CA  . TYR B 1 24 ? 64.253 45.302 47.145 1.00 58.87  ? 24  TYR B CA  1 
ATOM   919  C C   . TYR B 1 24 ? 63.417 45.711 45.909 1.00 58.61  ? 24  TYR B C   1 
ATOM   920  O O   . TYR B 1 24 ? 63.908 46.531 45.107 1.00 57.23  ? 24  TYR B O   1 
ATOM   921  C CB  . TYR B 1 24 ? 63.516 45.726 48.387 1.00 58.30  ? 24  TYR B CB  1 
ATOM   922  C CG  . TYR B 1 24 ? 63.294 47.231 48.388 1.00 62.19  ? 24  TYR B CG  1 
ATOM   923  C CD1 . TYR B 1 24 ? 64.268 48.086 48.887 1.00 63.14  ? 24  TYR B CD1 1 
ATOM   924  C CD2 . TYR B 1 24 ? 62.124 47.776 47.864 1.00 63.99  ? 24  TYR B CD2 1 
ATOM   925  C CE1 . TYR B 1 24 ? 64.080 49.449 48.877 1.00 67.44  ? 24  TYR B CE1 1 
ATOM   926  C CE2 . TYR B 1 24 ? 61.934 49.138 47.839 1.00 67.26  ? 24  TYR B CE2 1 
ATOM   927  C CZ  . TYR B 1 24 ? 62.906 49.972 48.366 1.00 69.33  ? 24  TYR B CZ  1 
ATOM   928  O OH  . TYR B 1 24 ? 62.701 51.339 48.350 1.00 71.96  ? 24  TYR B OH  1 
ATOM   929  N N   . LEU B 1 25 ? 62.198 45.223 45.804 1.00 56.03  ? 25  LEU B N   1 
ATOM   930  C CA  . LEU B 1 25 ? 61.448 45.668 44.640 1.00 58.32  ? 25  LEU B CA  1 
ATOM   931  C C   . LEU B 1 25 ? 60.100 46.236 44.998 1.00 60.74  ? 25  LEU B C   1 
ATOM   932  O O   . LEU B 1 25 ? 59.384 45.809 45.909 1.00 60.43  ? 25  LEU B O   1 
ATOM   933  C CB  . LEU B 1 25 ? 61.466 44.558 43.579 1.00 58.51  ? 25  LEU B CB  1 
ATOM   934  C CG  . LEU B 1 25 ? 60.743 43.269 43.845 1.00 61.02  ? 25  LEU B CG  1 
ATOM   935  C CD1 . LEU B 1 25 ? 59.268 43.387 43.506 1.00 64.04  ? 25  LEU B CD1 1 
ATOM   936  C CD2 . LEU B 1 25 ? 61.348 42.069 43.143 1.00 61.29  ? 25  LEU B CD2 1 
ATOM   937  N N   . THR B 1 26 ? 59.681 47.278 44.261 1.00 63.53  ? 26  THR B N   1 
ATOM   938  C CA  . THR B 1 26 ? 58.354 47.863 44.540 1.00 66.71  ? 26  THR B CA  1 
ATOM   939  C C   . THR B 1 26 ? 57.360 47.125 43.649 1.00 67.49  ? 26  THR B C   1 
ATOM   940  O O   . THR B 1 26 ? 57.821 46.267 42.862 1.00 66.92  ? 26  THR B O   1 
ATOM   941  C CB  . THR B 1 26 ? 58.321 49.371 44.298 1.00 69.66  ? 26  THR B CB  1 
ATOM   942  O OG1 . THR B 1 26 ? 59.574 49.969 44.706 1.00 69.05  ? 26  THR B OG1 1 
ATOM   943  C CG2 . THR B 1 26 ? 57.191 50.030 45.117 1.00 69.90  ? 26  THR B CG2 1 
ATOM   944  N N   . LYS B 1 27 ? 56.072 47.442 43.703 1.00 67.13  ? 27  LYS B N   1 
ATOM   945  C CA  . LYS B 1 27 ? 55.113 46.755 42.831 1.00 69.00  ? 27  LYS B CA  1 
ATOM   946  C C   . LYS B 1 27 ? 55.411 47.080 41.364 1.00 69.83  ? 27  LYS B C   1 
ATOM   947  O O   . LYS B 1 27 ? 55.273 46.276 40.448 1.00 69.42  ? 27  LYS B O   1 
ATOM   948  C CB  . LYS B 1 27 ? 53.683 47.031 43.248 1.00 70.37  ? 27  LYS B CB  1 
ATOM   949  C CG  . LYS B 1 27 ? 52.901 47.976 42.370 1.00 76.33  ? 27  LYS B CG  1 
ATOM   950  C CD  . LYS B 1 27 ? 51.448 48.178 42.753 1.00 79.81  ? 27  LYS B CD  1 
ATOM   951  C CE  . LYS B 1 27 ? 51.250 48.933 44.059 1.00 80.37  ? 27  LYS B CE  1 
ATOM   952  N NZ  . LYS B 1 27 ? 51.171 50.405 43.910 1.00 78.27  ? 27  LYS B NZ  1 
ATOM   953  N N   . GLU B 1 28 ? 55.996 48.232 41.093 1.00 69.34  ? 28  GLU B N   1 
ATOM   954  C CA  . GLU B 1 28 ? 56.385 48.718 39.797 1.00 70.63  ? 28  GLU B CA  1 
ATOM   955  C C   . GLU B 1 28 ? 57.488 47.841 39.209 1.00 69.97  ? 28  GLU B C   1 
ATOM   956  O O   . GLU B 1 28 ? 57.747 47.739 37.996 1.00 71.66  ? 28  GLU B O   1 
ATOM   957  C CB  . GLU B 1 28 ? 56.858 50.176 39.923 1.00 75.29  ? 28  GLU B CB  1 
ATOM   958  C CG  . GLU B 1 28 ? 56.339 50.889 41.194 1.00 78.54  ? 28  GLU B CG  1 
ATOM   959  C CD  . GLU B 1 28 ? 54.814 50.812 41.291 1.00 80.96  ? 28  GLU B CD  1 
ATOM   960  O OE1 . GLU B 1 28 ? 54.160 50.665 40.223 1.00 80.41  ? 28  GLU B OE1 1 
ATOM   961  O OE2 . GLU B 1 28 ? 54.294 50.861 42.432 1.00 79.64  ? 28  GLU B OE2 1 
ATOM   962  N N   . ASP B 1 29 ? 58.192 47.193 40.118 1.00 66.08  ? 29  ASP B N   1 
ATOM   963  C CA  . ASP B 1 29 ? 59.276 46.302 39.808 1.00 61.98  ? 29  ASP B CA  1 
ATOM   964  C C   . ASP B 1 29 ? 58.790 44.877 39.617 1.00 58.29  ? 29  ASP B C   1 
ATOM   965  O O   . ASP B 1 29 ? 59.305 44.155 38.791 1.00 57.11  ? 29  ASP B O   1 
ATOM   966  C CB  . ASP B 1 29 ? 60.264 46.383 40.971 1.00 65.12  ? 29  ASP B CB  1 
ATOM   967  C CG  . ASP B 1 29 ? 60.835 47.787 40.977 1.00 67.85  ? 29  ASP B CG  1 
ATOM   968  O OD1 . ASP B 1 29 ? 60.036 48.722 41.176 1.00 74.99  ? 29  ASP B OD1 1 
ATOM   969  O OD2 . ASP B 1 29 ? 62.031 47.929 40.765 1.00 70.82  ? 29  ASP B OD2 1 
ATOM   970  N N   . LEU B 1 30 ? 57.799 44.486 40.387 1.00 56.39  ? 30  LEU B N   1 
ATOM   971  C CA  . LEU B 1 30 ? 57.273 43.128 40.291 1.00 56.27  ? 30  LEU B CA  1 
ATOM   972  C C   . LEU B 1 30 ? 56.674 42.943 38.903 1.00 57.11  ? 30  LEU B C   1 
ATOM   973  O O   . LEU B 1 30 ? 57.173 42.063 38.172 1.00 57.84  ? 30  LEU B O   1 
ATOM   974  C CB  . LEU B 1 30 ? 56.390 42.776 41.452 1.00 50.13  ? 30  LEU B CB  1 
ATOM   975  C CG  . LEU B 1 30 ? 55.889 41.361 41.583 1.00 48.68  ? 30  LEU B CG  1 
ATOM   976  C CD1 . LEU B 1 30 ? 57.018 40.365 41.772 1.00 43.01  ? 30  LEU B CD1 1 
ATOM   977  C CD2 . LEU B 1 30 ? 54.833 41.266 42.682 1.00 51.00  ? 30  LEU B CD2 1 
ATOM   978  N N   . ARG B 1 31 ? 55.761 43.798 38.496 1.00 57.44  ? 31  ARG B N   1 
ATOM   979  C CA  . ARG B 1 31 ? 55.151 43.833 37.188 1.00 59.18  ? 31  ARG B CA  1 
ATOM   980  C C   . ARG B 1 31 ? 56.148 43.695 36.031 1.00 57.17  ? 31  ARG B C   1 
ATOM   981  O O   . ARG B 1 31 ? 56.024 42.850 35.137 1.00 58.34  ? 31  ARG B O   1 
ATOM   982  C CB  . ARG B 1 31 ? 54.506 45.215 36.952 1.00 66.44  ? 31  ARG B CB  1 
ATOM   983  C CG  . ARG B 1 31 ? 53.002 45.286 37.208 1.00 73.85  ? 31  ARG B CG  1 
ATOM   984  C CD  . ARG B 1 31 ? 52.432 46.546 36.522 1.00 78.58  ? 31  ARG B CD  1 
ATOM   985  N NE  . ARG B 1 31 ? 52.865 46.566 35.121 1.00 81.86  ? 31  ARG B NE  1 
ATOM   986  C CZ  . ARG B 1 31 ? 53.820 47.373 34.651 1.00 82.50  ? 31  ARG B CZ  1 
ATOM   987  N NH1 . ARG B 1 31 ? 54.425 48.212 35.493 1.00 83.07  ? 31  ARG B NH1 1 
ATOM   988  N NH2 . ARG B 1 31 ? 54.147 47.303 33.376 1.00 80.58  ? 31  ARG B NH2 1 
ATOM   989  N N   . VAL B 1 32 ? 57.154 44.549 36.028 1.00 53.46  ? 32  VAL B N   1 
ATOM   990  C CA  . VAL B 1 32 ? 58.118 44.491 34.959 1.00 53.90  ? 32  VAL B CA  1 
ATOM   991  C C   . VAL B 1 32 ? 58.823 43.161 34.929 1.00 55.71  ? 32  VAL B C   1 
ATOM   992  O O   . VAL B 1 32 ? 58.920 42.480 33.878 1.00 56.05  ? 32  VAL B O   1 
ATOM   993  C CB  . VAL B 1 32 ? 59.046 45.695 35.002 1.00 55.19  ? 32  VAL B CB  1 
ATOM   994  C CG1 . VAL B 1 32 ? 60.200 45.580 34.032 1.00 57.99  ? 32  VAL B CG1 1 
ATOM   995  C CG2 . VAL B 1 32 ? 58.196 46.917 34.646 1.00 59.80  ? 32  VAL B CG2 1 
ATOM   996  N N   . LEU B 1 33 ? 59.251 42.716 36.110 1.00 54.61  ? 33  LEU B N   1 
ATOM   997  C CA  . LEU B 1 33 ? 59.966 41.488 36.354 1.00 50.05  ? 33  LEU B CA  1 
ATOM   998  C C   . LEU B 1 33 ? 59.154 40.358 35.707 1.00 50.33  ? 33  LEU B C   1 
ATOM   999  O O   . LEU B 1 33 ? 59.623 39.534 34.937 1.00 50.39  ? 33  LEU B O   1 
ATOM   1000 C CB  . LEU B 1 33 ? 60.003 41.295 37.863 1.00 51.48  ? 33  LEU B CB  1 
ATOM   1001 C CG  . LEU B 1 33 ? 60.497 40.077 38.611 1.00 48.80  ? 33  LEU B CG  1 
ATOM   1002 C CD1 . LEU B 1 33 ? 60.288 38.758 37.937 1.00 31.80  ? 33  LEU B CD1 1 
ATOM   1003 C CD2 . LEU B 1 33 ? 61.982 40.258 38.983 1.00 50.12  ? 33  LEU B CD2 1 
ATOM   1004 N N   . MET B 1 34 ? 57.902 40.352 36.089 1.00 49.99  ? 34  MET B N   1 
ATOM   1005 C CA  . MET B 1 34 ? 56.914 39.402 35.687 1.00 55.13  ? 34  MET B CA  1 
ATOM   1006 C C   . MET B 1 34 ? 56.598 39.478 34.197 1.00 57.74  ? 34  MET B C   1 
ATOM   1007 O O   . MET B 1 34 ? 56.167 38.500 33.598 1.00 58.06  ? 34  MET B O   1 
ATOM   1008 C CB  . MET B 1 34 ? 55.629 39.683 36.494 1.00 59.11  ? 34  MET B CB  1 
ATOM   1009 C CG  . MET B 1 34 ? 55.886 39.366 38.006 1.00 58.45  ? 34  MET B CG  1 
ATOM   1010 S SD  . MET B 1 34 ? 55.059 37.811 38.341 1.00 59.98  ? 34  MET B SD  1 
ATOM   1011 C CE  . MET B 1 34 ? 53.452 38.431 38.814 1.00 63.89  ? 34  MET B CE  1 
ATOM   1012 N N   . GLU B 1 35 ? 56.795 40.672 33.654 1.00 58.23  ? 35  GLU B N   1 
ATOM   1013 C CA  . GLU B 1 35 ? 56.520 40.891 32.248 1.00 59.62  ? 35  GLU B CA  1 
ATOM   1014 C C   . GLU B 1 35 ? 57.666 40.313 31.443 1.00 57.19  ? 35  GLU B C   1 
ATOM   1015 O O   . GLU B 1 35 ? 57.444 39.444 30.609 1.00 60.07  ? 35  GLU B O   1 
ATOM   1016 C CB  . GLU B 1 35 ? 56.324 42.397 32.015 1.00 63.79  ? 35  GLU B CB  1 
ATOM   1017 C CG  . GLU B 1 35 ? 54.863 42.789 32.245 1.00 65.57  ? 35  GLU B CG  1 
ATOM   1018 C CD  . GLU B 1 35 ? 54.686 44.292 32.234 1.00 65.93  ? 35  GLU B CD  1 
ATOM   1019 O OE1 . GLU B 1 35 ? 55.706 45.014 32.208 1.00 69.54  ? 35  GLU B OE1 1 
ATOM   1020 O OE2 . GLU B 1 35 ? 53.524 44.728 32.253 1.00 66.63  ? 35  GLU B OE2 1 
ATOM   1021 N N   . LYS B 1 36 ? 58.880 40.765 31.725 1.00 52.83  ? 36  LYS B N   1 
ATOM   1022 C CA  . LYS B 1 36 ? 60.022 40.260 31.022 1.00 49.67  ? 36  LYS B CA  1 
ATOM   1023 C C   . LYS B 1 36 ? 60.454 38.854 31.376 1.00 50.22  ? 36  LYS B C   1 
ATOM   1024 O O   . LYS B 1 36 ? 61.147 38.283 30.520 1.00 48.68  ? 36  LYS B O   1 
ATOM   1025 C CB  . LYS B 1 36 ? 61.155 41.260 31.164 1.00 53.76  ? 36  LYS B CB  1 
ATOM   1026 C CG  . LYS B 1 36 ? 60.811 42.643 30.596 1.00 59.82  ? 36  LYS B CG  1 
ATOM   1027 C CD  . LYS B 1 36 ? 62.085 43.307 30.091 1.00 64.96  ? 36  LYS B CD  1 
ATOM   1028 C CE  . LYS B 1 36 ? 61.995 44.831 30.153 1.00 70.20  ? 36  LYS B CE  1 
ATOM   1029 N NZ  . LYS B 1 36 ? 62.549 45.473 28.907 1.00 70.46  ? 36  LYS B NZ  1 
ATOM   1030 N N   . GLU B 1 37 ? 60.082 38.242 32.523 1.00 49.14  ? 37  GLU B N   1 
ATOM   1031 C CA  . GLU B 1 37 ? 60.571 36.911 32.828 1.00 50.69  ? 37  GLU B CA  1 
ATOM   1032 C C   . GLU B 1 37 ? 59.583 35.775 32.714 1.00 50.56  ? 37  GLU B C   1 
ATOM   1033 O O   . GLU B 1 37 ? 59.972 34.615 32.598 1.00 48.94  ? 37  GLU B O   1 
ATOM   1034 C CB  . GLU B 1 37 ? 61.239 36.855 34.227 1.00 48.11  ? 37  GLU B CB  1 
ATOM   1035 C CG  . GLU B 1 37 ? 62.493 37.735 34.226 1.00 47.29  ? 37  GLU B CG  1 
ATOM   1036 C CD  . GLU B 1 37 ? 63.621 37.016 33.519 1.00 45.70  ? 37  GLU B CD  1 
ATOM   1037 O OE1 . GLU B 1 37 ? 63.486 35.785 33.372 1.00 53.79  ? 37  GLU B OE1 1 
ATOM   1038 O OE2 . GLU B 1 37 ? 64.635 37.580 33.111 1.00 48.98  ? 37  GLU B OE2 1 
ATOM   1039 N N   . PHE B 1 38 ? 58.316 36.123 32.715 1.00 51.07  ? 38  PHE B N   1 
ATOM   1040 C CA  . PHE B 1 38 ? 57.210 35.207 32.573 1.00 54.91  ? 38  PHE B CA  1 
ATOM   1041 C C   . PHE B 1 38 ? 56.156 35.768 31.594 1.00 56.70  ? 38  PHE B C   1 
ATOM   1042 O O   . PHE B 1 38 ? 54.951 35.864 31.892 1.00 55.18  ? 38  PHE B O   1 
ATOM   1043 C CB  . PHE B 1 38 ? 56.616 34.970 33.951 1.00 58.52  ? 38  PHE B CB  1 
ATOM   1044 C CG  . PHE B 1 38 ? 57.477 34.463 35.069 1.00 60.60  ? 38  PHE B CG  1 
ATOM   1045 C CD1 . PHE B 1 38 ? 57.952 33.147 35.066 1.00 62.11  ? 38  PHE B CD1 1 
ATOM   1046 C CD2 . PHE B 1 38 ? 57.831 35.282 36.121 1.00 57.39  ? 38  PHE B CD2 1 
ATOM   1047 C CE1 . PHE B 1 38 ? 58.735 32.669 36.098 1.00 61.42  ? 38  PHE B CE1 1 
ATOM   1048 C CE2 . PHE B 1 38 ? 58.601 34.810 37.166 1.00 59.66  ? 38  PHE B CE2 1 
ATOM   1049 C CZ  . PHE B 1 38 ? 59.048 33.501 37.157 1.00 60.17  ? 38  PHE B CZ  1 
ATOM   1050 N N   . PRO B 1 39 ? 56.553 36.096 30.375 1.00 59.70  ? 39  PRO B N   1 
ATOM   1051 C CA  . PRO B 1 39 ? 55.690 36.687 29.363 1.00 62.65  ? 39  PRO B CA  1 
ATOM   1052 C C   . PRO B 1 39 ? 54.370 36.032 29.129 1.00 63.26  ? 39  PRO B C   1 
ATOM   1053 O O   . PRO B 1 39 ? 53.325 36.698 29.142 1.00 61.38  ? 39  PRO B O   1 
ATOM   1054 C CB  . PRO B 1 39 ? 56.511 36.751 28.097 1.00 63.58  ? 39  PRO B CB  1 
ATOM   1055 C CG  . PRO B 1 39 ? 57.822 36.135 28.369 1.00 63.63  ? 39  PRO B CG  1 
ATOM   1056 C CD  . PRO B 1 39 ? 57.938 35.991 29.855 1.00 62.06  ? 39  PRO B CD  1 
ATOM   1057 N N   . GLY B 1 40 ? 54.337 34.703 28.981 1.00 66.75  ? 40  GLY B N   1 
ATOM   1058 C CA  . GLY B 1 40 ? 53.008 34.095 28.735 1.00 70.93  ? 40  GLY B CA  1 
ATOM   1059 C C   . GLY B 1 40 ? 52.146 33.909 29.954 1.00 72.08  ? 40  GLY B C   1 
ATOM   1060 O O   . GLY B 1 40 ? 51.229 33.058 29.898 1.00 74.65  ? 40  GLY B O   1 
ATOM   1061 N N   . PHE B 1 41 ? 52.302 34.713 31.029 1.00 70.36  ? 41  PHE B N   1 
ATOM   1062 C CA  . PHE B 1 41 ? 51.477 34.428 32.214 1.00 67.77  ? 41  PHE B CA  1 
ATOM   1063 C C   . PHE B 1 41 ? 50.584 35.514 32.725 1.00 67.15  ? 41  PHE B C   1 
ATOM   1064 O O   . PHE B 1 41 ? 49.434 35.232 33.140 1.00 64.91  ? 41  PHE B O   1 
ATOM   1065 C CB  . PHE B 1 41 ? 52.467 33.916 33.291 1.00 61.15  ? 41  PHE B CB  1 
ATOM   1066 C CG  . PHE B 1 41 ? 51.922 33.742 34.662 1.00 54.12  ? 41  PHE B CG  1 
ATOM   1067 C CD1 . PHE B 1 41 ? 51.366 32.543 35.055 1.00 54.89  ? 41  PHE B CD1 1 
ATOM   1068 C CD2 . PHE B 1 41 ? 51.964 34.783 35.570 1.00 54.17  ? 41  PHE B CD2 1 
ATOM   1069 C CE1 . PHE B 1 41 ? 50.849 32.371 36.334 1.00 53.31  ? 41  PHE B CE1 1 
ATOM   1070 C CE2 . PHE B 1 41 ? 51.442 34.616 36.845 1.00 55.30  ? 41  PHE B CE2 1 
ATOM   1071 C CZ  . PHE B 1 41 ? 50.887 33.408 37.206 1.00 52.86  ? 41  PHE B CZ  1 
ATOM   1072 N N   . LEU B 1 42 ? 50.995 36.766 32.783 1.00 69.22  ? 42  LEU B N   1 
ATOM   1073 C CA  . LEU B 1 42 ? 50.069 37.761 33.315 1.00 74.23  ? 42  LEU B CA  1 
ATOM   1074 C C   . LEU B 1 42 ? 48.993 38.114 32.290 1.00 76.81  ? 42  LEU B C   1 
ATOM   1075 O O   . LEU B 1 42 ? 47.798 38.187 32.608 1.00 74.42  ? 42  LEU B O   1 
ATOM   1076 C CB  . LEU B 1 42 ? 50.795 38.948 33.913 1.00 75.36  ? 42  LEU B CB  1 
ATOM   1077 C CG  . LEU B 1 42 ? 50.636 39.080 35.444 1.00 77.65  ? 42  LEU B CG  1 
ATOM   1078 C CD1 . LEU B 1 42 ? 50.295 37.752 36.105 1.00 77.30  ? 42  LEU B CD1 1 
ATOM   1079 C CD2 . LEU B 1 42 ? 51.915 39.664 36.025 1.00 77.03  ? 42  LEU B CD2 1 
ATOM   1080 N N   . GLU B 1 43 ? 49.460 38.246 31.053 1.00 79.48  ? 43  GLU B N   1 
ATOM   1081 C CA  . GLU B 1 43 ? 48.651 38.545 29.880 1.00 81.74  ? 43  GLU B CA  1 
ATOM   1082 C C   . GLU B 1 43 ? 47.676 37.399 29.640 1.00 83.20  ? 43  GLU B C   1 
ATOM   1083 O O   . GLU B 1 43 ? 46.482 37.678 29.476 1.00 83.38  ? 43  GLU B O   1 
ATOM   1084 C CB  . GLU B 1 43 ? 49.529 38.815 28.667 1.00 80.98  ? 43  GLU B CB  1 
ATOM   1085 C CG  . GLU B 1 43 ? 50.555 39.916 28.886 1.00 80.80  ? 43  GLU B CG  1 
ATOM   1086 C CD  . GLU B 1 43 ? 51.840 39.520 29.578 1.00 77.97  ? 43  GLU B CD  1 
ATOM   1087 O OE1 . GLU B 1 43 ? 51.873 38.600 30.407 1.00 74.39  ? 43  GLU B OE1 1 
ATOM   1088 O OE2 . GLU B 1 43 ? 52.886 40.161 29.303 1.00 77.52  ? 43  GLU B OE2 1 
ATOM   1089 N N   . ASN B 1 44 ? 48.130 36.148 29.797 1.00 83.81  ? 44  ASN B N   1 
ATOM   1090 C CA  . ASN B 1 44 ? 47.196 35.031 29.678 1.00 86.00  ? 44  ASN B CA  1 
ATOM   1091 C C   . ASN B 1 44 ? 46.352 34.957 30.921 1.00 89.44  ? 44  ASN B C   1 
ATOM   1092 O O   . ASN B 1 44 ? 45.283 34.364 30.910 1.00 90.52  ? 44  ASN B O   1 
ATOM   1093 C CB  . ASN B 1 44 ? 47.833 33.726 29.283 1.00 87.02  ? 44  ASN B CB  1 
ATOM   1094 C CG  . ASN B 1 44 ? 47.991 33.607 27.774 1.00 88.15  ? 44  ASN B CG  1 
ATOM   1095 O OD1 . ASN B 1 44 ? 49.058 33.818 27.199 1.00 87.34  ? 44  ASN B OD1 1 
ATOM   1096 N ND2 . ASN B 1 44 ? 46.889 33.283 27.094 1.00 90.90  ? 44  ASN B ND2 1 
ATOM   1097 N N   . GLN B 1 45 ? 46.789 35.540 32.048 1.00 93.84  ? 45  GLN B N   1 
ATOM   1098 C CA  . GLN B 1 45 ? 45.839 35.528 33.207 1.00 97.08  ? 45  GLN B CA  1 
ATOM   1099 C C   . GLN B 1 45 ? 44.829 36.544 32.653 1.00 99.39  ? 45  GLN B C   1 
ATOM   1100 O O   . GLN B 1 45 ? 45.283 37.511 31.983 1.00 100.31 ? 45  GLN B O   1 
ATOM   1101 C CB  . GLN B 1 45 ? 46.470 35.855 34.519 1.00 98.86  ? 45  GLN B CB  1 
ATOM   1102 C CG  . GLN B 1 45 ? 47.276 34.769 35.208 1.00 99.64  ? 45  GLN B CG  1 
ATOM   1103 C CD  . GLN B 1 45 ? 46.492 33.629 35.809 1.00 101.32 ? 45  GLN B CD  1 
ATOM   1104 O OE1 . GLN B 1 45 ? 46.351 32.539 35.238 1.00 100.12 ? 45  GLN B OE1 1 
ATOM   1105 N NE2 . GLN B 1 45 ? 45.946 33.801 37.018 1.00 100.64 ? 45  GLN B NE2 1 
ATOM   1106 N N   . LYS B 1 46 ? 43.528 36.340 32.757 1.00 100.30 ? 46  LYS B N   1 
ATOM   1107 C CA  . LYS B 1 46 ? 42.662 37.311 32.069 1.00 100.94 ? 46  LYS B CA  1 
ATOM   1108 C C   . LYS B 1 46 ? 42.541 38.649 32.727 1.00 100.85 ? 46  LYS B C   1 
ATOM   1109 O O   . LYS B 1 46 ? 42.480 39.701 32.059 1.00 102.48 ? 46  LYS B O   1 
ATOM   1110 C CB  . LYS B 1 46 ? 41.342 36.606 31.753 1.00 103.57 ? 46  LYS B CB  1 
ATOM   1111 C CG  . LYS B 1 46 ? 41.337 35.985 30.351 1.00 104.73 ? 46  LYS B CG  1 
ATOM   1112 C CD  . LYS B 1 46 ? 42.437 34.958 30.168 1.00 105.69 ? 46  LYS B CD  1 
ATOM   1113 C CE  . LYS B 1 46 ? 43.216 35.152 28.871 1.00 106.25 ? 46  LYS B CE  1 
ATOM   1114 N NZ  . LYS B 1 46 ? 43.545 33.827 28.246 1.00 105.85 ? 46  LYS B NZ  1 
ATOM   1115 N N   . ASP B 1 47 ? 42.540 38.675 34.033 1.00 99.49  ? 47  ASP B N   1 
ATOM   1116 C CA  . ASP B 1 47 ? 42.360 39.774 34.968 1.00 95.78  ? 47  ASP B CA  1 
ATOM   1117 C C   . ASP B 1 47 ? 43.370 40.890 34.935 1.00 92.95  ? 47  ASP B C   1 
ATOM   1118 O O   . ASP B 1 47 ? 44.570 40.706 34.753 1.00 94.04  ? 47  ASP B O   1 
ATOM   1119 C CB  . ASP B 1 47 ? 42.300 39.060 36.332 1.00 92.89  ? 47  ASP B CB  1 
ATOM   1120 C CG  . ASP B 1 47 ? 42.481 39.856 37.575 1.00 91.72  ? 47  ASP B CG  1 
ATOM   1121 O OD1 . ASP B 1 47 ? 42.645 41.084 37.501 1.00 89.73  ? 47  ASP B OD1 1 
ATOM   1122 O OD2 . ASP B 1 47 ? 42.455 39.245 38.684 1.00 89.46  ? 47  ASP B OD2 1 
ATOM   1123 N N   . PRO B 1 48 ? 42.934 42.124 35.157 1.00 91.19  ? 48  PRO B N   1 
ATOM   1124 C CA  . PRO B 1 48 ? 43.798 43.301 35.158 1.00 90.03  ? 48  PRO B CA  1 
ATOM   1125 C C   . PRO B 1 48 ? 44.440 43.616 36.508 1.00 87.60  ? 48  PRO B C   1 
ATOM   1126 O O   . PRO B 1 48 ? 45.347 44.443 36.642 1.00 86.85  ? 48  PRO B O   1 
ATOM   1127 C CB  . PRO B 1 48 ? 42.813 44.423 34.804 1.00 89.38  ? 48  PRO B CB  1 
ATOM   1128 C CG  . PRO B 1 48 ? 41.555 44.003 35.490 1.00 89.60  ? 48  PRO B CG  1 
ATOM   1129 C CD  . PRO B 1 48 ? 41.510 42.500 35.374 1.00 90.54  ? 48  PRO B CD  1 
ATOM   1130 N N   . LEU B 1 49 ? 43.946 42.961 37.546 1.00 84.75  ? 49  LEU B N   1 
ATOM   1131 C CA  . LEU B 1 49 ? 44.421 43.107 38.906 1.00 83.14  ? 49  LEU B CA  1 
ATOM   1132 C C   . LEU B 1 49 ? 45.443 42.025 39.288 1.00 79.91  ? 49  LEU B C   1 
ATOM   1133 O O   . LEU B 1 49 ? 45.714 41.788 40.457 1.00 79.42  ? 49  LEU B O   1 
ATOM   1134 C CB  . LEU B 1 49 ? 43.231 43.035 39.882 1.00 83.67  ? 49  LEU B CB  1 
ATOM   1135 C CG  . LEU B 1 49 ? 42.509 44.360 40.148 1.00 84.21  ? 49  LEU B CG  1 
ATOM   1136 C CD1 . LEU B 1 49 ? 41.661 44.242 41.405 1.00 80.51  ? 49  LEU B CD1 1 
ATOM   1137 C CD2 . LEU B 1 49 ? 43.494 45.529 40.252 1.00 82.93  ? 49  LEU B CD2 1 
ATOM   1138 N N   . ALA B 1 50 ? 45.994 41.380 38.282 1.00 76.72  ? 50  ALA B N   1 
ATOM   1139 C CA  . ALA B 1 50 ? 46.963 40.323 38.327 1.00 73.10  ? 50  ALA B CA  1 
ATOM   1140 C C   . ALA B 1 50 ? 48.079 40.544 39.353 1.00 69.00  ? 50  ALA B C   1 
ATOM   1141 O O   . ALA B 1 50 ? 48.160 39.836 40.329 1.00 63.92  ? 50  ALA B O   1 
ATOM   1142 C CB  . ALA B 1 50 ? 47.591 40.202 36.925 1.00 74.82  ? 50  ALA B CB  1 
ATOM   1143 N N   . VAL B 1 51 ? 48.909 41.536 39.114 1.00 69.02  ? 51  VAL B N   1 
ATOM   1144 C CA  . VAL B 1 51 ? 50.041 41.858 39.944 1.00 71.71  ? 51  VAL B CA  1 
ATOM   1145 C C   . VAL B 1 51 ? 49.639 42.250 41.346 1.00 74.57  ? 51  VAL B C   1 
ATOM   1146 O O   . VAL B 1 51 ? 50.096 41.614 42.308 1.00 74.94  ? 51  VAL B O   1 
ATOM   1147 C CB  . VAL B 1 51 ? 50.930 42.938 39.327 1.00 70.78  ? 51  VAL B CB  1 
ATOM   1148 C CG1 . VAL B 1 51 ? 52.294 42.895 40.022 1.00 74.78  ? 51  VAL B CG1 1 
ATOM   1149 C CG2 . VAL B 1 51 ? 51.115 42.621 37.857 1.00 71.95  ? 51  VAL B CG2 1 
ATOM   1150 N N   . ASP B 1 52 ? 48.710 43.199 41.493 1.00 75.58  ? 52  ASP B N   1 
ATOM   1151 C CA  . ASP B 1 52 ? 48.216 43.587 42.801 1.00 76.23  ? 52  ASP B CA  1 
ATOM   1152 C C   . ASP B 1 52 ? 47.920 42.350 43.657 1.00 75.49  ? 52  ASP B C   1 
ATOM   1153 O O   . ASP B 1 52 ? 48.364 42.352 44.819 1.00 76.57  ? 52  ASP B O   1 
ATOM   1154 C CB  . ASP B 1 52 ? 46.918 44.420 42.723 1.00 76.69  ? 52  ASP B CB  1 
ATOM   1155 C CG  . ASP B 1 52 ? 47.045 45.423 41.590 1.00 81.80  ? 52  ASP B CG  1 
ATOM   1156 O OD1 . ASP B 1 52 ? 46.725 44.989 40.452 1.00 84.11  ? 52  ASP B OD1 1 
ATOM   1157 O OD2 . ASP B 1 52 ? 47.532 46.549 41.846 1.00 81.76  ? 52  ASP B OD2 1 
ATOM   1158 N N   . LYS B 1 53 ? 47.199 41.379 43.112 1.00 72.71  ? 53  LYS B N   1 
ATOM   1159 C CA  . LYS B 1 53 ? 46.857 40.199 43.894 1.00 73.53  ? 53  LYS B CA  1 
ATOM   1160 C C   . LYS B 1 53 ? 48.088 39.350 44.232 1.00 72.46  ? 53  LYS B C   1 
ATOM   1161 O O   . LYS B 1 53 ? 48.187 38.673 45.271 1.00 71.17  ? 53  LYS B O   1 
ATOM   1162 C CB  . LYS B 1 53 ? 45.796 39.362 43.172 1.00 76.98  ? 53  LYS B CB  1 
ATOM   1163 C CG  . LYS B 1 53 ? 44.558 40.152 42.745 1.00 79.88  ? 53  LYS B CG  1 
ATOM   1164 C CD  . LYS B 1 53 ? 43.291 39.388 43.120 1.00 82.61  ? 53  LYS B CD  1 
ATOM   1165 C CE  . LYS B 1 53 ? 42.038 39.878 42.431 1.00 83.07  ? 53  LYS B CE  1 
ATOM   1166 N NZ  . LYS B 1 53 ? 42.225 40.263 41.003 1.00 82.49  ? 53  LYS B NZ  1 
ATOM   1167 N N   . ILE B 1 54 ? 49.096 39.365 43.341 1.00 69.52  ? 54  ILE B N   1 
ATOM   1168 C CA  . ILE B 1 54 ? 50.291 38.569 43.681 1.00 68.17  ? 54  ILE B CA  1 
ATOM   1169 C C   . ILE B 1 54 ? 50.883 39.147 44.978 1.00 68.74  ? 54  ILE B C   1 
ATOM   1170 O O   . ILE B 1 54 ? 50.891 38.551 46.049 1.00 67.26  ? 54  ILE B O   1 
ATOM   1171 C CB  . ILE B 1 54 ? 51.215 38.499 42.473 1.00 62.32  ? 54  ILE B CB  1 
ATOM   1172 C CG1 . ILE B 1 54 ? 50.951 37.126 41.793 1.00 60.55  ? 54  ILE B CG1 1 
ATOM   1173 C CG2 . ILE B 1 54 ? 52.686 38.703 42.767 1.00 54.98  ? 54  ILE B CG2 1 
ATOM   1174 C CD1 . ILE B 1 54 ? 50.964 37.231 40.286 1.00 59.62  ? 54  ILE B CD1 1 
ATOM   1175 N N   . MET B 1 55 ? 51.210 40.419 44.928 1.00 67.43  ? 55  MET B N   1 
ATOM   1176 C CA  . MET B 1 55 ? 51.735 41.287 45.918 1.00 68.23  ? 55  MET B CA  1 
ATOM   1177 C C   . MET B 1 55 ? 50.928 41.320 47.211 1.00 71.48  ? 55  MET B C   1 
ATOM   1178 O O   . MET B 1 55 ? 51.395 41.556 48.326 1.00 71.02  ? 55  MET B O   1 
ATOM   1179 C CB  . MET B 1 55 ? 51.671 42.710 45.336 1.00 61.67  ? 55  MET B CB  1 
ATOM   1180 C CG  . MET B 1 55 ? 52.314 43.723 46.221 1.00 57.55  ? 55  MET B CG  1 
ATOM   1181 S SD  . MET B 1 55 ? 54.024 43.963 45.776 1.00 63.61  ? 55  MET B SD  1 
ATOM   1182 C CE  . MET B 1 55 ? 54.505 45.052 47.142 1.00 66.02  ? 55  MET B CE  1 
ATOM   1183 N N   . LYS B 1 56 ? 49.611 41.123 47.062 1.00 73.65  ? 56  LYS B N   1 
ATOM   1184 C CA  . LYS B 1 56 ? 48.811 41.115 48.297 1.00 74.82  ? 56  LYS B CA  1 
ATOM   1185 C C   . LYS B 1 56 ? 49.533 40.112 49.203 1.00 75.01  ? 56  LYS B C   1 
ATOM   1186 O O   . LYS B 1 56 ? 50.111 40.477 50.207 1.00 75.58  ? 56  LYS B O   1 
ATOM   1187 C CB  . LYS B 1 56 ? 47.389 40.678 47.978 1.00 75.27  ? 56  LYS B CB  1 
ATOM   1188 C CG  . LYS B 1 56 ? 46.317 41.211 48.901 1.00 74.90  ? 56  LYS B CG  1 
ATOM   1189 C CD  . LYS B 1 56 ? 45.043 40.401 48.723 1.00 78.45  ? 56  LYS B CD  1 
ATOM   1190 C CE  . LYS B 1 56 ? 45.092 39.066 49.444 1.00 79.15  ? 56  LYS B CE  1 
ATOM   1191 N NZ  . LYS B 1 56 ? 44.727 39.205 50.894 1.00 79.43  ? 56  LYS B NZ  1 
ATOM   1192 N N   . ASP B 1 57 ? 49.628 38.870 48.738 1.00 75.67  ? 57  ASP B N   1 
ATOM   1193 C CA  . ASP B 1 57 ? 50.235 37.774 49.491 1.00 75.90  ? 57  ASP B CA  1 
ATOM   1194 C C   . ASP B 1 57 ? 51.705 37.893 49.762 1.00 73.65  ? 57  ASP B C   1 
ATOM   1195 O O   . ASP B 1 57 ? 52.245 37.375 50.741 1.00 74.22  ? 57  ASP B O   1 
ATOM   1196 C CB  . ASP B 1 57 ? 49.857 36.472 48.734 1.00 78.86  ? 57  ASP B CB  1 
ATOM   1197 C CG  . ASP B 1 57 ? 48.325 36.469 48.687 1.00 83.47  ? 57  ASP B CG  1 
ATOM   1198 O OD1 . ASP B 1 57 ? 47.680 36.485 49.759 1.00 85.87  ? 57  ASP B OD1 1 
ATOM   1199 O OD2 . ASP B 1 57 ? 47.775 36.499 47.582 1.00 87.88  ? 57  ASP B OD2 1 
ATOM   1200 N N   . LEU B 1 58 ? 52.441 38.626 48.950 1.00 72.12  ? 58  LEU B N   1 
ATOM   1201 C CA  . LEU B 1 58 ? 53.853 38.846 49.151 1.00 72.16  ? 58  LEU B CA  1 
ATOM   1202 C C   . LEU B 1 58 ? 54.140 39.874 50.243 1.00 74.24  ? 58  LEU B C   1 
ATOM   1203 O O   . LEU B 1 58 ? 55.265 39.935 50.747 1.00 74.59  ? 58  LEU B O   1 
ATOM   1204 C CB  . LEU B 1 58 ? 54.452 39.353 47.831 1.00 64.49  ? 58  LEU B CB  1 
ATOM   1205 C CG  . LEU B 1 58 ? 54.422 38.441 46.606 1.00 59.20  ? 58  LEU B CG  1 
ATOM   1206 C CD1 . LEU B 1 58 ? 55.465 38.976 45.610 1.00 55.12  ? 58  LEU B CD1 1 
ATOM   1207 C CD2 . LEU B 1 58 ? 54.638 36.980 46.932 1.00 52.96  ? 58  LEU B CD2 1 
ATOM   1208 N N   . ASP B 1 59 ? 53.192 40.774 50.505 1.00 76.14  ? 59  ASP B N   1 
ATOM   1209 C CA  . ASP B 1 59 ? 53.416 41.881 51.403 1.00 78.59  ? 59  ASP B CA  1 
ATOM   1210 C C   . ASP B 1 59 ? 52.551 41.923 52.640 1.00 80.53  ? 59  ASP B C   1 
ATOM   1211 O O   . ASP B 1 59 ? 51.631 42.730 52.703 1.00 81.47  ? 59  ASP B O   1 
ATOM   1212 C CB  . ASP B 1 59 ? 53.195 43.202 50.626 1.00 80.08  ? 59  ASP B CB  1 
ATOM   1213 C CG  . ASP B 1 59 ? 53.980 44.348 51.244 1.00 77.98  ? 59  ASP B CG  1 
ATOM   1214 O OD1 . ASP B 1 59 ? 54.845 43.994 52.069 1.00 79.41  ? 59  ASP B OD1 1 
ATOM   1215 O OD2 . ASP B 1 59 ? 53.764 45.520 50.869 1.00 76.07  ? 59  ASP B OD2 1 
ATOM   1216 N N   . GLN B 1 60 ? 52.837 41.099 53.619 1.00 83.39  ? 60  GLN B N   1 
ATOM   1217 C CA  . GLN B 1 60 ? 52.189 41.022 54.918 1.00 85.14  ? 60  GLN B CA  1 
ATOM   1218 C C   . GLN B 1 60 ? 52.007 42.438 55.484 1.00 85.40  ? 60  GLN B C   1 
ATOM   1219 O O   . GLN B 1 60 ? 50.948 43.066 55.488 1.00 85.15  ? 60  GLN B O   1 
ATOM   1220 C CB  . GLN B 1 60 ? 53.175 40.297 55.849 1.00 89.25  ? 60  GLN B CB  1 
ATOM   1221 C CG  . GLN B 1 60 ? 53.030 38.837 56.095 1.00 93.47  ? 60  GLN B CG  1 
ATOM   1222 C CD  . GLN B 1 60 ? 53.976 37.936 55.333 1.00 95.14  ? 60  GLN B CD  1 
ATOM   1223 O OE1 . GLN B 1 60 ? 53.584 37.401 54.276 1.00 98.91  ? 60  GLN B OE1 1 
ATOM   1224 N NE2 . GLN B 1 60 ? 55.182 37.710 55.826 1.00 94.15  ? 60  GLN B NE2 1 
ATOM   1225 N N   . CYS B 1 61 ? 53.134 43.041 55.855 1.00 85.67  ? 61  CYS B N   1 
ATOM   1226 C CA  . CYS B 1 61 ? 53.247 44.364 56.404 1.00 87.02  ? 61  CYS B CA  1 
ATOM   1227 C C   . CYS B 1 61 ? 52.744 45.507 55.549 1.00 87.55  ? 61  CYS B C   1 
ATOM   1228 O O   . CYS B 1 61 ? 52.941 46.700 55.896 1.00 87.71  ? 61  CYS B O   1 
ATOM   1229 C CB  . CYS B 1 61 ? 54.731 44.645 56.747 1.00 89.18  ? 61  CYS B CB  1 
ATOM   1230 S SG  . CYS B 1 61 ? 55.568 43.376 57.724 1.00 92.43  ? 61  CYS B SG  1 
ATOM   1231 N N   . ARG B 1 62 ? 52.190 45.288 54.363 1.00 86.60  ? 62  ARG B N   1 
ATOM   1232 C CA  . ARG B 1 62 ? 51.750 46.336 53.481 1.00 85.05  ? 62  ARG B CA  1 
ATOM   1233 C C   . ARG B 1 62 ? 52.716 47.500 53.383 1.00 82.13  ? 62  ARG B C   1 
ATOM   1234 O O   . ARG B 1 62 ? 52.231 48.622 53.203 1.00 82.80  ? 62  ARG B O   1 
ATOM   1235 C CB  . ARG B 1 62 ? 50.346 46.868 53.820 1.00 89.40  ? 62  ARG B CB  1 
ATOM   1236 C CG  . ARG B 1 62 ? 49.196 46.066 53.229 1.00 92.92  ? 62  ARG B CG  1 
ATOM   1237 C CD  . ARG B 1 62 ? 48.148 46.938 52.552 1.00 96.47  ? 62  ARG B CD  1 
ATOM   1238 N NE  . ARG B 1 62 ? 48.586 47.369 51.241 1.00 100.45 ? 62  ARG B NE  1 
ATOM   1239 C CZ  . ARG B 1 62 ? 48.049 48.158 50.330 1.00 101.37 ? 62  ARG B CZ  1 
ATOM   1240 N NH1 . ARG B 1 62 ? 46.872 48.756 50.494 1.00 100.21 ? 62  ARG B NH1 1 
ATOM   1241 N NH2 . ARG B 1 62 ? 48.741 48.355 49.196 1.00 100.70 ? 62  ARG B NH2 1 
ATOM   1242 N N   . ASP B 1 63 ? 54.033 47.302 53.394 1.00 79.77  ? 63  ASP B N   1 
ATOM   1243 C CA  . ASP B 1 63 ? 54.943 48.422 53.243 1.00 77.21  ? 63  ASP B CA  1 
ATOM   1244 C C   . ASP B 1 63 ? 55.299 48.654 51.783 1.00 74.71  ? 63  ASP B C   1 
ATOM   1245 O O   . ASP B 1 63 ? 56.096 49.550 51.487 1.00 73.96  ? 63  ASP B O   1 
ATOM   1246 C CB  . ASP B 1 63 ? 56.202 48.345 54.063 1.00 82.57  ? 63  ASP B CB  1 
ATOM   1247 C CG  . ASP B 1 63 ? 56.964 47.055 54.054 1.00 86.09  ? 63  ASP B CG  1 
ATOM   1248 O OD1 . ASP B 1 63 ? 56.726 46.207 53.163 1.00 88.23  ? 63  ASP B OD1 1 
ATOM   1249 O OD2 . ASP B 1 63 ? 57.835 46.906 54.956 1.00 88.14  ? 63  ASP B OD2 1 
ATOM   1250 N N   . GLY B 1 64 ? 54.769 47.817 50.895 1.00 72.62  ? 64  GLY B N   1 
ATOM   1251 C CA  . GLY B 1 64 ? 55.042 48.000 49.466 1.00 69.99  ? 64  GLY B CA  1 
ATOM   1252 C C   . GLY B 1 64 ? 56.474 47.634 49.128 1.00 66.39  ? 64  GLY B C   1 
ATOM   1253 O O   . GLY B 1 64 ? 57.173 48.243 48.317 1.00 66.36  ? 64  GLY B O   1 
ATOM   1254 N N   . LYS B 1 65 ? 56.959 46.606 49.810 1.00 62.81  ? 65  LYS B N   1 
ATOM   1255 C CA  . LYS B 1 65 ? 58.322 46.183 49.510 1.00 62.00  ? 65  LYS B CA  1 
ATOM   1256 C C   . LYS B 1 65 ? 58.346 44.669 49.452 1.00 57.21  ? 65  LYS B C   1 
ATOM   1257 O O   . LYS B 1 65 ? 57.766 43.966 50.257 1.00 58.70  ? 65  LYS B O   1 
ATOM   1258 C CB  . LYS B 1 65 ? 59.368 46.755 50.426 1.00 66.95  ? 65  LYS B CB  1 
ATOM   1259 C CG  . LYS B 1 65 ? 59.835 48.140 50.069 1.00 73.79  ? 65  LYS B CG  1 
ATOM   1260 C CD  . LYS B 1 65 ? 60.901 48.672 51.029 1.00 78.42  ? 65  LYS B CD  1 
ATOM   1261 C CE  . LYS B 1 65 ? 60.482 50.064 51.509 1.00 79.65  ? 65  LYS B CE  1 
ATOM   1262 N NZ  . LYS B 1 65 ? 61.396 51.078 50.896 1.00 85.40  ? 65  LYS B NZ  1 
ATOM   1263 N N   . VAL B 1 66 ? 59.001 44.183 48.452 1.00 55.99  ? 66  VAL B N   1 
ATOM   1264 C CA  . VAL B 1 66 ? 59.135 42.707 48.292 1.00 53.79  ? 66  VAL B CA  1 
ATOM   1265 C C   . VAL B 1 66 ? 60.627 42.442 48.383 1.00 50.64  ? 66  VAL B C   1 
ATOM   1266 O O   . VAL B 1 66 ? 61.373 43.001 47.576 1.00 50.55  ? 66  VAL B O   1 
ATOM   1267 C CB  . VAL B 1 66 ? 58.520 42.261 46.970 1.00 56.07  ? 66  VAL B CB  1 
ATOM   1268 C CG1 . VAL B 1 66 ? 59.181 41.027 46.411 1.00 56.33  ? 66  VAL B CG1 1 
ATOM   1269 C CG2 . VAL B 1 66 ? 57.007 42.065 47.155 1.00 50.61  ? 66  VAL B CG2 1 
ATOM   1270 N N   . GLY B 1 67 ? 61.038 41.693 49.405 1.00 46.94  ? 67  GLY B N   1 
ATOM   1271 C CA  . GLY B 1 67 ? 62.465 41.399 49.508 1.00 43.27  ? 67  GLY B CA  1 
ATOM   1272 C C   . GLY B 1 67 ? 62.717 39.987 48.915 1.00 42.92  ? 67  GLY B C   1 
ATOM   1273 O O   . GLY B 1 67 ? 61.807 39.198 48.596 1.00 39.04  ? 67  GLY B O   1 
ATOM   1274 N N   . PHE B 1 68 ? 64.007 39.658 48.869 1.00 40.13  ? 68  PHE B N   1 
ATOM   1275 C CA  . PHE B 1 68 ? 64.474 38.413 48.363 1.00 42.54  ? 68  PHE B CA  1 
ATOM   1276 C C   . PHE B 1 68 ? 63.676 37.195 48.773 1.00 45.41  ? 68  PHE B C   1 
ATOM   1277 O O   . PHE B 1 68 ? 63.442 36.339 47.871 1.00 46.28  ? 68  PHE B O   1 
ATOM   1278 C CB  . PHE B 1 68 ? 65.958 38.133 48.665 1.00 34.73  ? 68  PHE B CB  1 
ATOM   1279 C CG  . PHE B 1 68 ? 66.517 37.046 47.833 1.00 39.99  ? 68  PHE B CG  1 
ATOM   1280 C CD1 . PHE B 1 68 ? 66.801 37.302 46.459 1.00 41.43  ? 68  PHE B CD1 1 
ATOM   1281 C CD2 . PHE B 1 68 ? 66.804 35.792 48.353 1.00 36.12  ? 68  PHE B CD2 1 
ATOM   1282 C CE1 . PHE B 1 68 ? 67.307 36.293 45.656 1.00 38.85  ? 68  PHE B CE1 1 
ATOM   1283 C CE2 . PHE B 1 68 ? 67.331 34.776 47.554 1.00 37.90  ? 68  PHE B CE2 1 
ATOM   1284 C CZ  . PHE B 1 68 ? 67.561 35.004 46.184 1.00 40.70  ? 68  PHE B CZ  1 
ATOM   1285 N N   . GLN B 1 69 ? 63.374 37.055 50.050 1.00 43.22  ? 69  GLN B N   1 
ATOM   1286 C CA  . GLN B 1 69 ? 62.821 35.786 50.485 1.00 45.89  ? 69  GLN B CA  1 
ATOM   1287 C C   . GLN B 1 69 ? 61.397 35.611 50.027 1.00 45.23  ? 69  GLN B C   1 
ATOM   1288 O O   . GLN B 1 69 ? 60.872 34.507 49.846 1.00 45.66  ? 69  GLN B O   1 
ATOM   1289 C CB  . GLN B 1 69 ? 63.044 35.606 52.004 1.00 49.78  ? 69  GLN B CB  1 
ATOM   1290 C CG  . GLN B 1 69 ? 61.943 34.855 52.721 1.00 58.76  ? 69  GLN B CG  1 
ATOM   1291 C CD  . GLN B 1 69 ? 62.297 34.205 54.034 1.00 66.87  ? 69  GLN B CD  1 
ATOM   1292 O OE1 . GLN B 1 69 ? 61.400 33.570 54.636 1.00 70.11  ? 69  GLN B OE1 1 
ATOM   1293 N NE2 . GLN B 1 69 ? 63.541 34.310 54.524 1.00 65.17  ? 69  GLN B NE2 1 
ATOM   1294 N N   . SER B 1 70 ? 60.686 36.716 49.963 1.00 43.21  ? 70  SER B N   1 
ATOM   1295 C CA  . SER B 1 70 ? 59.292 36.731 49.547 1.00 40.51  ? 70  SER B CA  1 
ATOM   1296 C C   . SER B 1 70 ? 59.273 36.506 48.010 1.00 39.80  ? 70  SER B C   1 
ATOM   1297 O O   . SER B 1 70 ? 58.495 35.777 47.453 1.00 37.14  ? 70  SER B O   1 
ATOM   1298 C CB  . SER B 1 70 ? 58.738 38.071 50.015 1.00 41.75  ? 70  SER B CB  1 
ATOM   1299 O OG  . SER B 1 70 ? 57.608 37.783 50.842 1.00 49.70  ? 70  SER B OG  1 
ATOM   1300 N N   . PHE B 1 71 ? 60.240 37.047 47.303 1.00 35.99  ? 71  PHE B N   1 
ATOM   1301 C CA  . PHE B 1 71 ? 60.525 36.849 45.946 1.00 39.65  ? 71  PHE B CA  1 
ATOM   1302 C C   . PHE B 1 71 ? 60.691 35.343 45.656 1.00 40.73  ? 71  PHE B C   1 
ATOM   1303 O O   . PHE B 1 71 ? 59.890 34.755 44.881 1.00 39.11  ? 71  PHE B O   1 
ATOM   1304 C CB  . PHE B 1 71 ? 61.756 37.640 45.517 1.00 39.10  ? 71  PHE B CB  1 
ATOM   1305 C CG  . PHE B 1 71 ? 62.266 37.152 44.207 1.00 41.91  ? 71  PHE B CG  1 
ATOM   1306 C CD1 . PHE B 1 71 ? 61.483 37.333 43.073 1.00 44.72  ? 71  PHE B CD1 1 
ATOM   1307 C CD2 . PHE B 1 71 ? 63.470 36.487 44.119 1.00 41.02  ? 71  PHE B CD2 1 
ATOM   1308 C CE1 . PHE B 1 71 ? 61.934 36.854 41.844 1.00 41.68  ? 71  PHE B CE1 1 
ATOM   1309 C CE2 . PHE B 1 71 ? 63.935 36.028 42.919 1.00 43.84  ? 71  PHE B CE2 1 
ATOM   1310 C CZ  . PHE B 1 71 ? 63.150 36.235 41.770 1.00 45.24  ? 71  PHE B CZ  1 
ATOM   1311 N N   . PHE B 1 72 ? 61.520 34.684 46.470 1.00 41.30  ? 72  PHE B N   1 
ATOM   1312 C CA  . PHE B 1 72 ? 61.690 33.250 46.487 1.00 37.45  ? 72  PHE B CA  1 
ATOM   1313 C C   . PHE B 1 72 ? 60.398 32.509 46.761 1.00 35.45  ? 72  PHE B C   1 
ATOM   1314 O O   . PHE B 1 72 ? 60.129 31.428 46.279 1.00 39.71  ? 72  PHE B O   1 
ATOM   1315 C CB  . PHE B 1 72 ? 62.586 32.707 47.676 1.00 35.44  ? 72  PHE B CB  1 
ATOM   1316 C CG  . PHE B 1 72 ? 63.309 31.569 47.001 1.00 30.99  ? 72  PHE B CG  1 
ATOM   1317 C CD1 . PHE B 1 72 ? 64.331 31.860 46.150 1.00 27.81  ? 72  PHE B CD1 1 
ATOM   1318 C CD2 . PHE B 1 72 ? 62.908 30.269 47.214 1.00 34.62  ? 72  PHE B CD2 1 
ATOM   1319 C CE1 . PHE B 1 72 ? 64.998 30.842 45.486 1.00 26.62  ? 72  PHE B CE1 1 
ATOM   1320 C CE2 . PHE B 1 72 ? 63.587 29.255 46.564 1.00 34.32  ? 72  PHE B CE2 1 
ATOM   1321 C CZ  . PHE B 1 72 ? 64.625 29.571 45.702 1.00 27.93  ? 72  PHE B CZ  1 
ATOM   1322 N N   . SER B 1 73 ? 59.572 33.095 47.604 1.00 34.48  ? 73  SER B N   1 
ATOM   1323 C CA  . SER B 1 73 ? 58.310 32.455 47.878 1.00 38.24  ? 73  SER B CA  1 
ATOM   1324 C C   . SER B 1 73 ? 57.412 32.528 46.609 1.00 38.35  ? 73  SER B C   1 
ATOM   1325 O O   . SER B 1 73 ? 56.546 31.691 46.334 1.00 40.07  ? 73  SER B O   1 
ATOM   1326 C CB  . SER B 1 73 ? 57.610 33.100 49.093 1.00 33.68  ? 73  SER B CB  1 
ATOM   1327 O OG  . SER B 1 73 ? 56.999 31.890 49.712 1.00 46.44  ? 73  SER B OG  1 
ATOM   1328 N N   . LEU B 1 74 ? 57.592 33.576 45.778 1.00 38.95  ? 74  LEU B N   1 
ATOM   1329 C CA  . LEU B 1 74 ? 56.841 33.651 44.564 1.00 39.68  ? 74  LEU B CA  1 
ATOM   1330 C C   . LEU B 1 74 ? 57.294 32.476 43.693 1.00 38.69  ? 74  LEU B C   1 
ATOM   1331 O O   . LEU B 1 74 ? 56.532 31.589 43.355 1.00 40.88  ? 74  LEU B O   1 
ATOM   1332 C CB  . LEU B 1 74 ? 57.022 34.994 43.833 1.00 43.51  ? 74  LEU B CB  1 
ATOM   1333 C CG  . LEU B 1 74 ? 56.129 35.175 42.585 1.00 41.36  ? 74  LEU B CG  1 
ATOM   1334 C CD1 . LEU B 1 74 ? 54.730 34.568 42.775 1.00 36.48  ? 74  LEU B CD1 1 
ATOM   1335 C CD2 . LEU B 1 74 ? 56.022 36.617 42.214 1.00 41.23  ? 74  LEU B CD2 1 
ATOM   1336 N N   . ILE B 1 75 ? 58.577 32.456 43.381 1.00 37.37  ? 75  ILE B N   1 
ATOM   1337 C CA  . ILE B 1 75 ? 59.125 31.421 42.545 1.00 39.22  ? 75  ILE B CA  1 
ATOM   1338 C C   . ILE B 1 75 ? 58.768 30.052 43.058 1.00 42.00  ? 75  ILE B C   1 
ATOM   1339 O O   . ILE B 1 75 ? 58.265 29.194 42.292 1.00 46.17  ? 75  ILE B O   1 
ATOM   1340 C CB  . ILE B 1 75 ? 60.621 31.656 42.353 1.00 38.52  ? 75  ILE B CB  1 
ATOM   1341 C CG1 . ILE B 1 75 ? 60.941 33.060 41.915 1.00 41.42  ? 75  ILE B CG1 1 
ATOM   1342 C CG2 . ILE B 1 75 ? 61.163 30.647 41.361 1.00 44.40  ? 75  ILE B CG2 1 
ATOM   1343 C CD1 . ILE B 1 75 ? 59.924 33.639 40.883 1.00 41.23  ? 75  ILE B CD1 1 
ATOM   1344 N N   . ALA B 1 76 ? 58.919 29.802 44.370 1.00 39.45  ? 76  ALA B N   1 
ATOM   1345 C CA  . ALA B 1 76 ? 58.550 28.501 44.913 1.00 37.04  ? 76  ALA B CA  1 
ATOM   1346 C C   . ALA B 1 76 ? 57.121 28.143 44.533 1.00 37.10  ? 76  ALA B C   1 
ATOM   1347 O O   . ALA B 1 76 ? 56.806 27.082 44.046 1.00 36.19  ? 76  ALA B O   1 
ATOM   1348 C CB  . ALA B 1 76 ? 58.727 28.550 46.428 1.00 28.28  ? 76  ALA B CB  1 
ATOM   1349 N N   . GLY B 1 77 ? 56.146 29.037 44.844 1.00 39.29  ? 77  GLY B N   1 
ATOM   1350 C CA  . GLY B 1 77 ? 54.763 28.745 44.457 1.00 40.45  ? 77  GLY B CA  1 
ATOM   1351 C C   . GLY B 1 77 ? 54.625 28.510 42.960 1.00 40.37  ? 77  GLY B C   1 
ATOM   1352 O O   . GLY B 1 77 ? 53.981 27.488 42.596 1.00 42.78  ? 77  GLY B O   1 
ATOM   1353 N N   . LEU B 1 78 ? 55.256 29.303 42.089 1.00 38.36  ? 78  LEU B N   1 
ATOM   1354 C CA  . LEU B 1 78 ? 55.046 28.991 40.649 1.00 39.99  ? 78  LEU B CA  1 
ATOM   1355 C C   . LEU B 1 78 ? 55.615 27.658 40.205 1.00 41.02  ? 78  LEU B C   1 
ATOM   1356 O O   . LEU B 1 78 ? 55.019 26.928 39.410 1.00 42.34  ? 78  LEU B O   1 
ATOM   1357 C CB  . LEU B 1 78 ? 55.615 30.068 39.739 1.00 37.32  ? 78  LEU B CB  1 
ATOM   1358 C CG  . LEU B 1 78 ? 54.920 31.429 39.843 1.00 34.29  ? 78  LEU B CG  1 
ATOM   1359 C CD1 . LEU B 1 78 ? 55.646 32.454 39.001 1.00 37.56  ? 78  LEU B CD1 1 
ATOM   1360 C CD2 . LEU B 1 78 ? 53.464 31.253 39.484 1.00 41.00  ? 78  LEU B CD2 1 
ATOM   1361 N N   . THR B 1 79 ? 56.827 27.367 40.707 1.00 41.55  ? 79  THR B N   1 
ATOM   1362 C CA  . THR B 1 79 ? 57.530 26.131 40.444 1.00 36.79  ? 79  THR B CA  1 
ATOM   1363 C C   . THR B 1 79 ? 56.842 24.907 40.963 1.00 36.15  ? 79  THR B C   1 
ATOM   1364 O O   . THR B 1 79 ? 56.825 23.829 40.328 1.00 38.49  ? 79  THR B O   1 
ATOM   1365 C CB  . THR B 1 79 ? 58.950 26.191 41.027 1.00 31.89  ? 79  THR B CB  1 
ATOM   1366 O OG1 . THR B 1 79 ? 59.577 27.409 40.581 1.00 39.82  ? 79  THR B OG1 1 
ATOM   1367 C CG2 . THR B 1 79 ? 59.745 25.046 40.426 1.00 30.07  ? 79  THR B CG2 1 
ATOM   1368 N N   . ILE B 1 80 ? 56.279 25.005 42.147 1.00 35.30  ? 80  ILE B N   1 
ATOM   1369 C CA  . ILE B 1 80 ? 55.588 23.823 42.688 1.00 37.58  ? 80  ILE B CA  1 
ATOM   1370 C C   . ILE B 1 80 ? 54.273 23.634 41.891 1.00 39.20  ? 80  ILE B C   1 
ATOM   1371 O O   . ILE B 1 80 ? 53.880 22.493 41.760 1.00 37.75  ? 80  ILE B O   1 
ATOM   1372 C CB  . ILE B 1 80 ? 55.345 24.018 44.191 1.00 37.79  ? 80  ILE B CB  1 
ATOM   1373 C CG1 . ILE B 1 80 ? 56.703 23.940 44.902 1.00 44.88  ? 80  ILE B CG1 1 
ATOM   1374 C CG2 . ILE B 1 80 ? 54.375 22.978 44.749 1.00 28.35  ? 80  ILE B CG2 1 
ATOM   1375 C CD1 . ILE B 1 80 ? 56.759 24.814 46.155 1.00 48.41  ? 80  ILE B CD1 1 
ATOM   1376 N N   . ALA B 1 81 ? 53.598 24.719 41.452 1.00 38.81  ? 81  ALA B N   1 
ATOM   1377 C CA  . ALA B 1 81 ? 52.368 24.563 40.638 1.00 38.48  ? 81  ALA B CA  1 
ATOM   1378 C C   . ALA B 1 81 ? 52.729 23.884 39.321 1.00 39.59  ? 81  ALA B C   1 
ATOM   1379 O O   . ALA B 1 81 ? 52.188 22.841 38.989 1.00 41.59  ? 81  ALA B O   1 
ATOM   1380 C CB  . ALA B 1 81 ? 51.736 25.920 40.379 1.00 34.79  ? 81  ALA B CB  1 
ATOM   1381 N N   . CYS B 1 82 ? 53.744 24.382 38.599 1.00 39.71  ? 82  CYS B N   1 
ATOM   1382 C CA  . CYS B 1 82 ? 54.200 23.743 37.406 1.00 40.13  ? 82  CYS B CA  1 
ATOM   1383 C C   . CYS B 1 82 ? 54.577 22.311 37.670 1.00 43.31  ? 82  CYS B C   1 
ATOM   1384 O O   . CYS B 1 82 ? 54.413 21.477 36.775 1.00 45.29  ? 82  CYS B O   1 
ATOM   1385 C CB  . CYS B 1 82 ? 55.411 24.450 36.761 1.00 39.31  ? 82  CYS B CB  1 
ATOM   1386 S SG  . CYS B 1 82 ? 55.019 26.176 36.279 1.00 44.99  ? 82  CYS B SG  1 
ATOM   1387 N N   . ASN B 1 83 ? 55.186 22.019 38.854 1.00 45.39  ? 83  ASN B N   1 
ATOM   1388 C CA  . ASN B 1 83 ? 55.650 20.622 39.024 1.00 42.44  ? 83  ASN B CA  1 
ATOM   1389 C C   . ASN B 1 83 ? 54.436 19.730 39.161 1.00 42.54  ? 83  ASN B C   1 
ATOM   1390 O O   . ASN B 1 83 ? 54.364 18.641 38.603 1.00 39.35  ? 83  ASN B O   1 
ATOM   1391 C CB  . ASN B 1 83 ? 56.633 20.468 40.163 1.00 38.78  ? 83  ASN B CB  1 
ATOM   1392 C CG  . ASN B 1 83 ? 56.788 19.022 40.583 1.00 39.02  ? 83  ASN B CG  1 
ATOM   1393 O OD1 . ASN B 1 83 ? 56.137 18.621 41.549 1.00 37.79  ? 83  ASN B OD1 1 
ATOM   1394 N ND2 . ASN B 1 83 ? 57.618 18.269 39.861 1.00 35.93  ? 83  ASN B ND2 1 
ATOM   1395 N N   . ASP B 1 84 ? 53.464 20.241 39.922 1.00 46.21  ? 84  ASP B N   1 
ATOM   1396 C CA  . ASP B 1 84 ? 52.233 19.477 40.125 1.00 52.83  ? 84  ASP B CA  1 
ATOM   1397 C C   . ASP B 1 84 ? 51.605 19.061 38.792 1.00 54.44  ? 84  ASP B C   1 
ATOM   1398 O O   . ASP B 1 84 ? 51.359 17.910 38.540 1.00 53.90  ? 84  ASP B O   1 
ATOM   1399 C CB  . ASP B 1 84 ? 51.225 20.277 40.941 1.00 55.92  ? 84  ASP B CB  1 
ATOM   1400 C CG  . ASP B 1 84 ? 51.428 20.000 42.415 1.00 60.42  ? 84  ASP B CG  1 
ATOM   1401 O OD1 . ASP B 1 84 ? 52.162 19.051 42.757 1.00 63.71  ? 84  ASP B OD1 1 
ATOM   1402 O OD2 . ASP B 1 84 ? 50.853 20.730 43.243 1.00 68.57  ? 84  ASP B OD2 1 
ATOM   1403 N N   . TYR B 1 85 ? 51.480 20.054 37.919 1.00 57.28  ? 85  TYR B N   1 
ATOM   1404 C CA  . TYR B 1 85 ? 50.924 19.959 36.608 1.00 58.89  ? 85  TYR B CA  1 
ATOM   1405 C C   . TYR B 1 85 ? 51.717 19.065 35.690 1.00 60.02  ? 85  TYR B C   1 
ATOM   1406 O O   . TYR B 1 85 ? 51.186 18.335 34.849 1.00 59.65  ? 85  TYR B O   1 
ATOM   1407 C CB  . TYR B 1 85 ? 50.779 21.387 36.023 1.00 62.60  ? 85  TYR B CB  1 
ATOM   1408 C CG  . TYR B 1 85 ? 49.974 21.256 34.738 1.00 67.39  ? 85  TYR B CG  1 
ATOM   1409 C CD1 . TYR B 1 85 ? 50.633 20.932 33.556 1.00 69.24  ? 85  TYR B CD1 1 
ATOM   1410 C CD2 . TYR B 1 85 ? 48.610 21.427 34.732 1.00 69.44  ? 85  TYR B CD2 1 
ATOM   1411 C CE1 . TYR B 1 85 ? 49.940 20.771 32.382 1.00 72.25  ? 85  TYR B CE1 1 
ATOM   1412 C CE2 . TYR B 1 85 ? 47.899 21.266 33.547 1.00 71.94  ? 85  TYR B CE2 1 
ATOM   1413 C CZ  . TYR B 1 85 ? 48.568 20.938 32.396 1.00 73.19  ? 85  TYR B CZ  1 
ATOM   1414 O OH  . TYR B 1 85 ? 47.892 20.790 31.220 1.00 77.90  ? 85  TYR B OH  1 
ATOM   1415 N N   . PHE B 1 86 ? 53.043 19.123 35.814 1.00 60.40  ? 86  PHE B N   1 
ATOM   1416 C CA  . PHE B 1 86 ? 53.921 18.268 35.027 1.00 60.04  ? 86  PHE B CA  1 
ATOM   1417 C C   . PHE B 1 86 ? 53.772 16.798 35.411 1.00 61.18  ? 86  PHE B C   1 
ATOM   1418 O O   . PHE B 1 86 ? 53.784 15.927 34.549 1.00 60.77  ? 86  PHE B O   1 
ATOM   1419 C CB  . PHE B 1 86 ? 55.381 18.683 35.266 1.00 54.24  ? 86  PHE B CB  1 
ATOM   1420 C CG  . PHE B 1 86 ? 56.428 17.773 34.703 1.00 52.50  ? 86  PHE B CG  1 
ATOM   1421 C CD1 . PHE B 1 86 ? 56.790 17.867 33.347 1.00 50.35  ? 86  PHE B CD1 1 
ATOM   1422 C CD2 . PHE B 1 86 ? 57.082 16.849 35.505 1.00 49.45  ? 86  PHE B CD2 1 
ATOM   1423 C CE1 . PHE B 1 86 ? 57.780 17.069 32.812 1.00 48.92  ? 86  PHE B CE1 1 
ATOM   1424 C CE2 . PHE B 1 86 ? 58.066 16.027 34.960 1.00 48.70  ? 86  PHE B CE2 1 
ATOM   1425 C CZ  . PHE B 1 86 ? 58.413 16.131 33.619 1.00 49.83  ? 86  PHE B CZ  1 
ATOM   1426 N N   . VAL B 1 87 ? 53.672 16.511 36.715 1.00 62.29  ? 87  VAL B N   1 
ATOM   1427 C CA  . VAL B 1 87 ? 53.690 15.107 37.150 1.00 63.62  ? 87  VAL B CA  1 
ATOM   1428 C C   . VAL B 1 87 ? 52.437 14.358 36.757 1.00 65.70  ? 87  VAL B C   1 
ATOM   1429 O O   . VAL B 1 87 ? 52.452 13.155 36.513 1.00 65.23  ? 87  VAL B O   1 
ATOM   1430 C CB  . VAL B 1 87 ? 53.987 15.053 38.670 1.00 62.05  ? 87  VAL B CB  1 
ATOM   1431 C CG1 . VAL B 1 87 ? 53.553 13.782 39.359 1.00 60.81  ? 87  VAL B CG1 1 
ATOM   1432 C CG2 . VAL B 1 87 ? 55.486 15.323 38.884 1.00 60.26  ? 87  VAL B CG2 1 
ATOM   1433 N N   . VAL B 1 88 ? 51.309 15.047 36.765 1.00 67.56  ? 88  VAL B N   1 
ATOM   1434 C CA  . VAL B 1 88 ? 50.012 14.498 36.464 1.00 68.66  ? 88  VAL B CA  1 
ATOM   1435 C C   . VAL B 1 88 ? 49.747 14.355 34.976 1.00 69.05  ? 88  VAL B C   1 
ATOM   1436 O O   . VAL B 1 88 ? 49.339 13.288 34.522 1.00 71.06  ? 88  VAL B O   1 
ATOM   1437 C CB  . VAL B 1 88 ? 48.908 15.410 37.066 1.00 70.40  ? 88  VAL B CB  1 
ATOM   1438 C CG1 . VAL B 1 88 ? 47.580 15.186 36.372 1.00 70.91  ? 88  VAL B CG1 1 
ATOM   1439 C CG2 . VAL B 1 88 ? 48.813 15.121 38.570 1.00 70.66  ? 88  VAL B CG2 1 
ATOM   1440 N N   . HIS B 1 89 ? 49.955 15.413 34.223 1.00 68.32  ? 89  HIS B N   1 
ATOM   1441 C CA  . HIS B 1 89 ? 49.654 15.495 32.830 1.00 67.39  ? 89  HIS B CA  1 
ATOM   1442 C C   . HIS B 1 89 ? 50.797 15.149 31.918 1.00 67.47  ? 89  HIS B C   1 
ATOM   1443 O O   . HIS B 1 89 ? 50.535 14.734 30.787 1.00 66.26  ? 89  HIS B O   1 
ATOM   1444 C CB  . HIS B 1 89 ? 49.152 16.899 32.479 1.00 68.32  ? 89  HIS B CB  1 
ATOM   1445 C CG  . HIS B 1 89 ? 47.875 17.276 33.167 1.00 72.97  ? 89  HIS B CG  1 
ATOM   1446 N ND1 . HIS B 1 89 ? 47.806 18.267 34.141 1.00 73.78  ? 89  HIS B ND1 1 
ATOM   1447 C CD2 . HIS B 1 89 ? 46.611 16.823 33.030 1.00 73.43  ? 89  HIS B CD2 1 
ATOM   1448 C CE1 . HIS B 1 89 ? 46.566 18.399 34.569 1.00 73.30  ? 89  HIS B CE1 1 
ATOM   1449 N NE2 . HIS B 1 89 ? 45.819 17.546 33.905 1.00 75.49  ? 89  HIS B NE2 1 
ATOM   1450 N N   . MET B 1 90 ? 52.047 15.343 32.315 1.00 69.38  ? 90  MET B N   1 
ATOM   1451 C CA  . MET B 1 90 ? 53.160 15.092 31.411 1.00 71.42  ? 90  MET B CA  1 
ATOM   1452 C C   . MET B 1 90 ? 54.188 14.071 31.830 1.00 74.23  ? 90  MET B C   1 
ATOM   1453 O O   . MET B 1 90 ? 54.695 13.364 30.928 1.00 74.97  ? 90  MET B O   1 
ATOM   1454 C CB  . MET B 1 90 ? 53.903 16.420 31.079 1.00 68.59  ? 90  MET B CB  1 
ATOM   1455 C CG  . MET B 1 90 ? 53.027 17.455 30.484 1.00 69.69  ? 90  MET B CG  1 
ATOM   1456 S SD  . MET B 1 90 ? 53.737 19.092 30.320 1.00 75.95  ? 90  MET B SD  1 
ATOM   1457 C CE  . MET B 1 90 ? 54.835 18.771 28.930 1.00 75.71  ? 90  MET B CE  1 
ATOM   1458 N N   . LYS B 1 91 ? 54.610 13.992 33.083 1.00 76.26  ? 91  LYS B N   1 
ATOM   1459 C CA  . LYS B 1 91 ? 55.683 13.053 33.440 1.00 79.64  ? 91  LYS B CA  1 
ATOM   1460 C C   . LYS B 1 91 ? 55.524 11.756 32.657 1.00 82.10  ? 91  LYS B C   1 
ATOM   1461 O O   . LYS B 1 91 ? 54.406 11.186 32.716 1.00 83.14  ? 91  LYS B O   1 
ATOM   1462 C CB  . LYS B 1 91 ? 55.737 12.825 34.921 1.00 83.23  ? 91  LYS B CB  1 
ATOM   1463 C CG  . LYS B 1 91 ? 56.806 11.993 35.562 1.00 83.33  ? 91  LYS B CG  1 
ATOM   1464 C CD  . LYS B 1 91 ? 56.200 10.942 36.478 1.00 89.71  ? 91  LYS B CD  1 
ATOM   1465 C CE  . LYS B 1 91 ? 55.124 11.453 37.410 1.00 92.43  ? 91  LYS B CE  1 
ATOM   1466 N NZ  . LYS B 1 91 ? 53.744 11.018 37.043 1.00 93.86  ? 91  LYS B NZ  1 
HETATM 1467 C C   . ACE C 2 1  ? 60.815 26.529 29.078 1.00 40.28  ? 0   ACE C C   1 
HETATM 1468 O O   . ACE C 2 1  ? 59.844 27.111 29.555 1.00 43.84  ? 0   ACE C O   1 
HETATM 1469 C CH3 . ACE C 2 1  ? 62.169 26.607 29.741 1.00 38.13  ? 0   ACE C CH3 1 
ATOM   1470 N N   . SER C 2 2  ? 61.010 25.717 28.048 1.00 35.97  ? 1   SER C N   1 
ATOM   1471 C CA  . SER C 2 2  ? 60.141 25.559 26.958 1.00 38.70  ? 1   SER C CA  1 
ATOM   1472 C C   . SER C 2 2  ? 58.952 24.779 27.550 1.00 34.44  ? 1   SER C C   1 
ATOM   1473 O O   . SER C 2 2  ? 57.760 25.095 27.403 1.00 33.34  ? 1   SER C O   1 
ATOM   1474 C CB  . SER C 2 2  ? 60.713 24.987 25.672 1.00 39.12  ? 1   SER C CB  1 
ATOM   1475 O OG  . SER C 2 2  ? 60.454 23.584 25.725 1.00 49.71  ? 1   SER C OG  1 
ATOM   1476 N N   . THR C 2 3  ? 59.298 23.865 28.473 1.00 33.25  ? 2   THR C N   1 
ATOM   1477 C CA  . THR C 2 3  ? 58.177 23.196 29.193 1.00 31.47  ? 2   THR C CA  1 
ATOM   1478 C C   . THR C 2 3  ? 57.614 24.011 30.331 1.00 37.39  ? 2   THR C C   1 
ATOM   1479 O O   . THR C 2 3  ? 56.365 24.016 31.000 1.00 38.54  ? 2   THR C O   1 
ATOM   1480 C CB  . THR C 2 3  ? 58.409 21.752 29.385 1.00 29.74  ? 2   THR C CB  1 
ATOM   1481 O OG1 . THR C 2 3  ? 58.060 21.153 30.576 1.00 39.54  ? 2   THR C OG1 1 
ATOM   1482 C CG2 . THR C 2 3  ? 59.645 21.191 28.767 1.00 27.53  ? 2   THR C CG2 1 
ATOM   1483 N N   . VAL C 2 4  ? 58.387 24.842 31.074 1.00 34.56  ? 3   VAL C N   1 
ATOM   1484 C CA  . VAL C 2 4  ? 57.783 25.652 32.149 1.00 32.84  ? 3   VAL C CA  1 
ATOM   1485 C C   . VAL C 2 4  ? 56.958 26.748 31.527 1.00 31.73  ? 3   VAL C C   1 
ATOM   1486 O O   . VAL C 2 4  ? 55.905 27.122 32.045 1.00 30.96  ? 3   VAL C O   1 
ATOM   1487 C CB  . VAL C 2 4  ? 58.856 26.250 33.146 1.00 28.67  ? 3   VAL C CB  1 
ATOM   1488 C CG1 . VAL C 2 4  ? 58.417 27.462 33.909 1.00 27.21  ? 3   VAL C CG1 1 
ATOM   1489 C CG2 . VAL C 2 4  ? 59.214 25.161 34.155 1.00 30.40  ? 3   VAL C CG2 1 
ATOM   1490 N N   . HIS C 2 5  ? 57.445 27.257 30.397 1.00 35.75  ? 4   HIS C N   1 
ATOM   1491 C CA  . HIS C 2 5  ? 56.721 28.313 29.669 1.00 38.73  ? 4   HIS C CA  1 
ATOM   1492 C C   . HIS C 2 5  ? 55.329 27.830 29.298 1.00 39.73  ? 4   HIS C C   1 
ATOM   1493 O O   . HIS C 2 5  ? 54.356 28.499 29.625 1.00 42.15  ? 4   HIS C O   1 
ATOM   1494 C CB  . HIS C 2 5  ? 57.529 28.790 28.477 1.00 39.07  ? 4   HIS C CB  1 
ATOM   1495 C CG  . HIS C 2 5  ? 56.746 29.786 27.676 1.00 45.63  ? 4   HIS C CG  1 
ATOM   1496 N ND1 . HIS C 2 5  ? 56.895 31.134 27.765 1.00 45.78  ? 4   HIS C ND1 1 
ATOM   1497 C CD2 . HIS C 2 5  ? 55.748 29.593 26.764 1.00 48.06  ? 4   HIS C CD2 1 
ATOM   1498 C CE1 . HIS C 2 5  ? 56.029 31.765 27.028 1.00 44.49  ? 4   HIS C CE1 1 
ATOM   1499 N NE2 . HIS C 2 5  ? 55.345 30.843 26.384 1.00 49.48  ? 4   HIS C NE2 1 
ATOM   1500 N N   . GLU C 2 6  ? 55.157 26.650 28.739 1.00 42.49  ? 5   GLU C N   1 
ATOM   1501 C CA  . GLU C 2 6  ? 53.884 26.085 28.360 1.00 44.00  ? 5   GLU C CA  1 
ATOM   1502 C C   . GLU C 2 6  ? 53.056 25.750 29.572 1.00 46.51  ? 5   GLU C C   1 
ATOM   1503 O O   . GLU C 2 6  ? 51.839 25.993 29.528 1.00 50.94  ? 5   GLU C O   1 
ATOM   1504 C CB  . GLU C 2 6  ? 54.017 24.825 27.514 1.00 45.70  ? 5   GLU C CB  1 
ATOM   1505 C CG  . GLU C 2 6  ? 55.016 24.979 26.352 1.00 56.05  ? 5   GLU C CG  1 
ATOM   1506 C CD  . GLU C 2 6  ? 54.324 25.363 25.039 1.00 60.36  ? 5   GLU C CD  1 
ATOM   1507 O OE1 . GLU C 2 6  ? 53.251 24.762 24.785 1.00 61.73  ? 5   GLU C OE1 1 
ATOM   1508 O OE2 . GLU C 2 6  ? 54.832 26.243 24.304 1.00 59.61  ? 5   GLU C OE2 1 
ATOM   1509 N N   . ILE C 2 7  ? 53.674 25.215 30.638 1.00 44.56  ? 6   ILE C N   1 
ATOM   1510 C CA  . ILE C 2 7  ? 52.793 24.969 31.810 1.00 42.44  ? 6   ILE C CA  1 
ATOM   1511 C C   . ILE C 2 7  ? 52.361 26.311 32.358 1.00 42.92  ? 6   ILE C C   1 
ATOM   1512 O O   . ILE C 2 7  ? 51.184 26.453 32.694 1.00 42.96  ? 6   ILE C O   1 
ATOM   1513 C CB  . ILE C 2 7  ? 53.448 24.090 32.880 1.00 36.83  ? 6   ILE C CB  1 
ATOM   1514 C CG1 . ILE C 2 7  ? 53.850 22.780 32.263 1.00 30.34  ? 6   ILE C CG1 1 
ATOM   1515 C CG2 . ILE C 2 7  ? 52.584 23.934 34.116 1.00 34.73  ? 6   ILE C CG2 1 
ATOM   1516 C CD1 . ILE C 2 7  ? 54.294 21.634 33.102 1.00 33.01  ? 6   ILE C CD1 1 
ATOM   1517 N N   . LEU C 2 8  ? 53.228 27.342 32.450 1.00 43.50  ? 7   LEU C N   1 
ATOM   1518 C CA  . LEU C 2 8  ? 52.698 28.594 33.022 1.00 48.57  ? 7   LEU C CA  1 
ATOM   1519 C C   . LEU C 2 8  ? 51.450 29.078 32.318 1.00 52.52  ? 7   LEU C C   1 
ATOM   1520 O O   . LEU C 2 8  ? 50.511 29.570 32.926 1.00 47.59  ? 7   LEU C O   1 
ATOM   1521 C CB  . LEU C 2 8  ? 53.743 29.673 33.248 1.00 48.67  ? 7   LEU C CB  1 
ATOM   1522 C CG  . LEU C 2 8  ? 54.874 29.178 34.217 1.00 50.83  ? 7   LEU C CG  1 
ATOM   1523 C CD1 . LEU C 2 8  ? 56.013 30.164 34.226 1.00 49.19  ? 7   LEU C CD1 1 
ATOM   1524 C CD2 . LEU C 2 8  ? 54.301 28.894 35.574 1.00 48.74  ? 7   LEU C CD2 1 
ATOM   1525 N N   . SER C 2 9  ? 51.459 28.889 30.995 1.00 60.30  ? 8   SER C N   1 
ATOM   1526 C CA  . SER C 2 9  ? 50.336 29.166 30.103 1.00 65.81  ? 8   SER C CA  1 
ATOM   1527 C C   . SER C 2 9  ? 49.115 28.335 30.428 1.00 67.97  ? 8   SER C C   1 
ATOM   1528 O O   . SER C 2 9  ? 48.026 28.880 30.309 1.00 67.94  ? 8   SER C O   1 
ATOM   1529 C CB  . SER C 2 9  ? 50.774 29.042 28.642 1.00 65.60  ? 8   SER C CB  1 
ATOM   1530 O OG  . SER C 2 9  ? 51.236 30.383 28.303 1.00 65.60  ? 8   SER C OG  1 
ATOM   1531 N N   . LYS C 2 10 ? 49.213 27.120 30.923 1.00 73.02  ? 9   LYS C N   1 
ATOM   1532 C CA  . LYS C 2 10 ? 48.093 26.302 31.363 1.00 77.92  ? 9   LYS C CA  1 
ATOM   1533 C C   . LYS C 2 10 ? 47.627 26.687 32.778 1.00 80.74  ? 9   LYS C C   1 
ATOM   1534 O O   . LYS C 2 10 ? 46.677 26.140 33.351 1.00 81.92  ? 9   LYS C O   1 
ATOM   1535 C CB  . LYS C 2 10 ? 48.440 24.809 31.407 1.00 76.04  ? 9   LYS C CB  1 
ATOM   1536 C CG  . LYS C 2 10 ? 48.009 24.009 30.201 1.00 79.58  ? 9   LYS C CG  1 
ATOM   1537 C CD  . LYS C 2 10 ? 48.408 24.724 28.916 1.00 81.41  ? 9   LYS C CD  1 
ATOM   1538 C CE  . LYS C 2 10 ? 48.438 23.751 27.743 1.00 85.71  ? 9   LYS C CE  1 
ATOM   1539 N NZ  . LYS C 2 10 ? 49.122 24.358 26.556 1.00 86.73  ? 9   LYS C NZ  1 
ATOM   1540 N N   . LEU C 2 11 ? 48.346 27.601 33.418 1.00 83.96  ? 10  LEU C N   1 
ATOM   1541 C CA  . LEU C 2 11 ? 47.971 28.052 34.764 1.00 85.43  ? 10  LEU C CA  1 
ATOM   1542 C C   . LEU C 2 11 ? 47.369 29.448 34.558 1.00 86.84  ? 10  LEU C C   1 
ATOM   1543 O O   . LEU C 2 11 ? 46.764 29.991 35.452 1.00 86.32  ? 10  LEU C O   1 
ATOM   1544 C CB  . LEU C 2 11 ? 49.114 28.090 35.733 1.00 85.97  ? 10  LEU C CB  1 
ATOM   1545 C CG  . LEU C 2 11 ? 49.917 26.844 36.054 1.00 85.07  ? 10  LEU C CG  1 
ATOM   1546 C CD1 . LEU C 2 11 ? 50.675 27.027 37.364 1.00 84.08  ? 10  LEU C CD1 1 
ATOM   1547 C CD2 . LEU C 2 11 ? 49.064 25.594 36.072 1.00 83.60  ? 10  LEU C CD2 1 
ATOM   1548 N N   . SER C 2 12 ? 47.557 29.925 33.328 1.00 89.66  ? 11  SER C N   1 
ATOM   1549 C CA  . SER C 2 12 ? 47.076 31.182 32.807 1.00 91.88  ? 11  SER C CA  1 
ATOM   1550 C C   . SER C 2 12 ? 46.027 31.042 31.703 1.00 93.92  ? 11  SER C C   1 
ATOM   1551 O O   . SER C 2 12 ? 45.186 30.093 31.780 1.00 95.07  ? 11  SER C O   1 
ATOM   1552 C CB  . SER C 2 12 ? 48.276 32.000 32.280 1.00 92.85  ? 11  SER C CB  1 
ATOM   1553 O OG  . SER C 2 12 ? 48.558 33.045 33.196 1.00 93.64  ? 11  SER C OG  1 
HETATM 1554 C C   . ACE D 2 1  ? 77.925 29.814 39.323 1.00 47.76  ? 0   ACE D C   1 
HETATM 1555 O O   . ACE D 2 1  ? 77.709 29.396 40.445 1.00 52.57  ? 0   ACE D O   1 
HETATM 1556 C CH3 . ACE D 2 1  ? 77.481 29.229 38.041 1.00 49.78  ? 0   ACE D CH3 1 
ATOM   1557 N N   . SER D 2 2  ? 78.609 30.945 39.069 1.00 51.32  ? 1   SER D N   1 
ATOM   1558 C CA  . SER D 2 2  ? 80.056 30.845 39.061 1.00 48.60  ? 1   SER D CA  1 
ATOM   1559 C C   . SER D 2 2  ? 80.388 31.549 40.445 1.00 47.87  ? 1   SER D C   1 
ATOM   1560 O O   . SER D 2 2  ? 81.294 31.143 41.164 1.00 47.09  ? 1   SER D O   1 
ATOM   1561 C CB  . SER D 2 2  ? 80.774 31.548 37.987 1.00 49.50  ? 1   SER D CB  1 
ATOM   1562 O OG  . SER D 2 2  ? 82.116 31.099 37.985 1.00 60.04  ? 1   SER D OG  1 
ATOM   1563 N N   . THR D 2 3  ? 79.519 32.512 40.745 1.00 43.05  ? 2   THR D N   1 
ATOM   1564 C CA  . THR D 2 3  ? 79.587 33.232 41.949 1.00 44.39  ? 2   THR D CA  1 
ATOM   1565 C C   . THR D 2 3  ? 78.763 32.487 43.001 1.00 45.96  ? 2   THR D C   1 
ATOM   1566 O O   . THR D 2 3  ? 78.949 32.672 44.191 1.00 47.52  ? 2   THR D O   1 
ATOM   1567 C CB  . THR D 2 3  ? 79.312 34.720 41.952 1.00 44.74  ? 2   THR D CB  1 
ATOM   1568 O OG1 . THR D 2 3  ? 77.997 35.049 42.364 1.00 53.38  ? 2   THR D OG1 1 
ATOM   1569 C CG2 . THR D 2 3  ? 79.587 35.422 40.653 1.00 47.56  ? 2   THR D CG2 1 
ATOM   1570 N N   . VAL D 2 4  ? 77.884 31.567 42.553 1.00 43.97  ? 3   VAL D N   1 
ATOM   1571 C CA  . VAL D 2 4  ? 77.105 30.831 43.496 1.00 38.24  ? 3   VAL D CA  1 
ATOM   1572 C C   . VAL D 2 4  ? 78.043 29.713 43.959 1.00 40.00  ? 3   VAL D C   1 
ATOM   1573 O O   . VAL D 2 4  ? 77.975 29.256 45.110 1.00 40.04  ? 3   VAL D O   1 
ATOM   1574 C CB  . VAL D 2 4  ? 75.763 30.299 43.048 1.00 34.13  ? 3   VAL D CB  1 
ATOM   1575 C CG1 . VAL D 2 4  ? 75.402 28.952 43.714 1.00 24.06  ? 3   VAL D CG1 1 
ATOM   1576 C CG2 . VAL D 2 4  ? 74.621 31.253 43.382 1.00 27.97  ? 3   VAL D CG2 1 
ATOM   1577 N N   . HIS D 2 5  ? 78.915 29.300 43.060 1.00 39.47  ? 4   HIS D N   1 
ATOM   1578 C CA  . HIS D 2 5  ? 79.799 28.181 43.435 1.00 42.04  ? 4   HIS D CA  1 
ATOM   1579 C C   . HIS D 2 5  ? 80.806 28.621 44.512 1.00 43.70  ? 4   HIS D C   1 
ATOM   1580 O O   . HIS D 2 5  ? 81.040 27.808 45.405 1.00 43.71  ? 4   HIS D O   1 
ATOM   1581 C CB  . HIS D 2 5  ? 80.483 27.584 42.213 1.00 43.20  ? 4   HIS D CB  1 
ATOM   1582 C CG  . HIS D 2 5  ? 81.252 26.326 42.443 1.00 41.31  ? 4   HIS D CG  1 
ATOM   1583 N ND1 . HIS D 2 5  ? 80.630 25.140 42.662 1.00 46.00  ? 4   HIS D ND1 1 
ATOM   1584 C CD2 . HIS D 2 5  ? 82.584 26.053 42.534 1.00 40.71  ? 4   HIS D CD2 1 
ATOM   1585 C CE1 . HIS D 2 5  ? 81.541 24.183 42.849 1.00 44.55  ? 4   HIS D CE1 1 
ATOM   1586 N NE2 . HIS D 2 5  ? 82.732 24.711 42.780 1.00 39.19  ? 4   HIS D NE2 1 
ATOM   1587 N N   . GLU D 2 6  ? 81.326 29.808 44.362 1.00 42.88  ? 5   GLU D N   1 
ATOM   1588 C CA  . GLU D 2 6  ? 82.243 31.004 45.213 1.00 46.51  ? 5   GLU D CA  1 
ATOM   1589 C C   . GLU D 2 6  ? 81.562 30.798 46.552 1.00 45.85  ? 5   GLU D C   1 
ATOM   1590 O O   . GLU D 2 6  ? 82.077 30.252 47.535 1.00 49.21  ? 5   GLU D O   1 
ATOM   1591 C CB  . GLU D 2 6  ? 82.860 31.715 44.564 1.00 54.86  ? 5   GLU D CB  1 
ATOM   1592 C CG  . GLU D 2 6  ? 83.844 32.583 45.323 1.00 63.77  ? 5   GLU D CG  1 
ATOM   1593 C CD  . GLU D 2 6  ? 85.220 31.995 45.542 1.00 70.91  ? 5   GLU D CD  1 
ATOM   1594 O OE1 . GLU D 2 6  ? 85.601 30.953 44.932 1.00 72.16  ? 5   GLU D OE1 1 
ATOM   1595 O OE2 . GLU D 2 6  ? 86.002 32.577 46.361 1.00 74.15  ? 5   GLU D OE2 1 
ATOM   1596 N N   . ILE D 2 7  ? 80.423 31.447 46.627 1.00 41.75  ? 6   ILE D N   1 
ATOM   1597 C CA  . ILE D 2 7  ? 79.705 31.667 47.832 1.00 36.93  ? 6   ILE D CA  1 
ATOM   1598 C C   . ILE D 2 7  ? 79.536 30.349 48.597 1.00 43.27  ? 6   ILE D C   1 
ATOM   1599 O O   . ILE D 2 7  ? 79.832 30.204 49.800 1.00 46.05  ? 6   ILE D O   1 
ATOM   1600 C CB  . ILE D 2 7  ? 78.366 32.312 47.688 1.00 31.98  ? 6   ILE D CB  1 
ATOM   1601 C CG1 . ILE D 2 7  ? 78.134 33.627 46.922 1.00 31.88  ? 6   ILE D CG1 1 
ATOM   1602 C CG2 . ILE D 2 7  ? 77.611 32.431 49.025 1.00 25.76  ? 6   ILE D CG2 1 
ATOM   1603 C CD1 . ILE D 2 7  ? 79.290 34.470 46.609 1.00 39.03  ? 6   ILE D CD1 1 
ATOM   1604 N N   . LEU D 2 8  ? 79.045 29.269 47.973 1.00 45.39  ? 7   LEU D N   1 
ATOM   1605 C CA  . LEU D 2 8  ? 78.646 28.066 48.623 1.00 43.44  ? 7   LEU D CA  1 
ATOM   1606 C C   . LEU D 2 8  ? 79.791 27.394 49.395 1.00 45.97  ? 7   LEU D C   1 
ATOM   1607 O O   . LEU D 2 8  ? 79.543 26.554 50.277 1.00 48.21  ? 7   LEU D O   1 
ATOM   1608 C CB  . LEU D 2 8  ? 77.998 27.079 47.671 1.00 42.05  ? 7   LEU D CB  1 
ATOM   1609 C CG  . LEU D 2 8  ? 76.517 27.242 47.334 1.00 45.11  ? 7   LEU D CG  1 
ATOM   1610 C CD1 . LEU D 2 8  ? 76.097 26.213 46.279 1.00 39.34  ? 7   LEU D CD1 1 
ATOM   1611 C CD2 . LEU D 2 8  ? 75.600 27.255 48.512 1.00 38.46  ? 7   LEU D CD2 1 
ATOM   1612 N N   . SER D 2 9  ? 80.981 27.651 49.023 1.00 46.73  ? 8   SER D N   1 
ATOM   1613 C CA  . SER D 2 9  ? 82.245 27.220 49.510 1.00 53.18  ? 8   SER D CA  1 
ATOM   1614 C C   . SER D 2 9  ? 82.667 27.957 50.805 1.00 54.51  ? 8   SER D C   1 
ATOM   1615 O O   . SER D 2 9  ? 83.241 27.313 51.654 1.00 55.50  ? 8   SER D O   1 
ATOM   1616 C CB  . SER D 2 9  ? 83.292 27.531 48.404 1.00 50.53  ? 8   SER D CB  1 
ATOM   1617 O OG  . SER D 2 9  ? 83.427 26.302 47.713 1.00 55.75  ? 8   SER D OG  1 
ATOM   1618 N N   . LYS D 2 10 ? 82.285 29.207 50.966 1.00 53.47  ? 9   LYS D N   1 
ATOM   1619 C CA  . LYS D 2 10 ? 82.428 30.014 52.135 1.00 53.49  ? 9   LYS D CA  1 
ATOM   1620 C C   . LYS D 2 10 ? 81.238 29.804 53.083 1.00 54.52  ? 9   LYS D C   1 
ATOM   1621 O O   . LYS D 2 10 ? 81.138 30.562 54.055 1.00 56.02  ? 9   LYS D O   1 
ATOM   1622 C CB  . LYS D 2 10 ? 82.296 31.529 51.865 1.00 54.82  ? 9   LYS D CB  1 
ATOM   1623 C CG  . LYS D 2 10 ? 82.850 32.105 50.617 1.00 55.96  ? 9   LYS D CG  1 
ATOM   1624 C CD  . LYS D 2 10 ? 84.328 31.724 50.472 1.00 57.23  ? 9   LYS D CD  1 
ATOM   1625 C CE  . LYS D 2 10 ? 84.953 32.596 49.393 1.00 61.83  ? 9   LYS D CE  1 
ATOM   1626 N NZ  . LYS D 2 10 ? 86.238 32.069 48.885 1.00 66.23  ? 9   LYS D NZ  1 
ATOM   1627 N N   . LEU D 2 11 ? 80.273 28.952 52.762 1.00 55.78  ? 10  LEU D N   1 
ATOM   1628 C CA  . LEU D 2 11 ? 79.147 28.801 53.713 1.00 57.61  ? 10  LEU D CA  1 
ATOM   1629 C C   . LEU D 2 11 ? 79.446 27.434 54.409 1.00 59.02  ? 10  LEU D C   1 
ATOM   1630 O O   . LEU D 2 11 ? 78.900 27.086 55.410 1.00 57.36  ? 10  LEU D O   1 
ATOM   1631 C CB  . LEU D 2 11 ? 77.750 28.853 53.186 1.00 53.74  ? 10  LEU D CB  1 
ATOM   1632 C CG  . LEU D 2 11 ? 77.132 30.046 52.502 1.00 55.21  ? 10  LEU D CG  1 
ATOM   1633 C CD1 . LEU D 2 11 ? 75.779 29.665 51.853 1.00 54.90  ? 10  LEU D CD1 1 
ATOM   1634 C CD2 . LEU D 2 11 ? 76.929 31.247 53.380 1.00 50.71  ? 10  LEU D CD2 1 
ATOM   1635 N N   . SER D 2 12 ? 80.353 26.743 53.759 1.00 63.13  ? 11  SER D N   1 
ATOM   1636 C CA  . SER D 2 12 ? 80.968 25.505 54.006 1.00 67.35  ? 11  SER D CA  1 
ATOM   1637 C C   . SER D 2 12 ? 82.488 25.682 54.208 1.00 69.29  ? 11  SER D C   1 
ATOM   1638 O O   . SER D 2 12 ? 82.923 26.621 54.931 1.00 71.25  ? 11  SER D O   1 
ATOM   1639 C CB  . SER D 2 12 ? 80.732 24.532 52.825 1.00 67.73  ? 11  SER D CB  1 
ATOM   1640 O OG  . SER D 2 12 ? 79.717 23.599 53.267 1.00 70.36  ? 11  SER D OG  1 
HETATM 1641 O O   . HOH E 3 .  ? 74.604 33.505 54.876 1.00 50.80  ? 97  HOH A O   1 
HETATM 1642 O O   . HOH E 3 .  ? 66.233 30.115 25.299 1.00 43.75  ? 98  HOH A O   1 
HETATM 1643 O O   . HOH E 3 .  ? 65.637 36.405 30.647 1.00 54.84  ? 99  HOH A O   1 
HETATM 1644 O O   . HOH E 3 .  ? 61.905 21.306 27.714 1.00 41.42  ? 100 HOH A O   1 
HETATM 1645 O O   . HOH E 3 .  ? 78.495 25.638 57.735 1.00 69.93  ? 101 HOH A O   1 
HETATM 1646 O O   . HOH E 3 .  ? 65.705 7.657  52.962 1.00 53.42  ? 102 HOH A O   1 
HETATM 1647 O O   . HOH E 3 .  ? 53.835 18.191 57.561 1.00 87.82  ? 103 HOH A O   1 
HETATM 1648 O O   . HOH E 3 .  ? 58.357 15.073 56.168 1.00 78.16  ? 104 HOH A O   1 
HETATM 1649 O O   . HOH E 3 .  ? 71.783 33.925 34.560 1.00 81.59  ? 105 HOH A O   1 
HETATM 1650 O O   . HOH E 3 .  ? 77.224 13.871 54.475 1.00 59.19  ? 106 HOH A O   1 
HETATM 1651 O O   . HOH E 3 .  ? 68.774 29.683 55.088 1.00 62.05  ? 107 HOH A O   1 
HETATM 1652 O O   . HOH E 3 .  ? 68.649 27.250 33.901 1.00 76.84  ? 108 HOH A O   1 
HETATM 1653 O O   . HOH F 3 .  ? 79.045 23.603 45.591 1.00 52.05  ? 97  HOH B O   1 
HETATM 1654 O O   . HOH F 3 .  ? 74.868 19.867 36.716 1.00 48.86  ? 98  HOH B O   1 
HETATM 1655 O O   . HOH F 3 .  ? 67.505 41.309 49.739 1.00 60.90  ? 99  HOH B O   1 
HETATM 1656 O O   . HOH F 3 .  ? 51.117 36.547 29.593 1.00 65.33  ? 100 HOH B O   1 
HETATM 1657 O O   . HOH F 3 .  ? 45.568 39.378 26.398 1.00 82.10  ? 101 HOH B O   1 
HETATM 1658 O O   . HOH F 3 .  ? 54.541 19.883 43.107 1.00 60.59  ? 102 HOH B O   1 
HETATM 1659 O O   . HOH F 3 .  ? 80.122 22.830 40.858 1.00 55.44  ? 103 HOH B O   1 
HETATM 1660 O O   . HOH F 3 .  ? 65.692 36.388 54.584 1.00 61.20  ? 104 HOH B O   1 
HETATM 1661 O O   . HOH F 3 .  ? 57.593 40.903 51.112 1.00 77.62  ? 105 HOH B O   1 
HETATM 1662 O O   . HOH G 3 .  ? 81.051 25.658 45.990 1.00 56.98  ? 14  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  GLN 3  3  3  GLN GLN A . n 
A 1 4  MET 4  4  4  MET MET A . n 
A 1 5  GLU 5  5  5  GLU GLU A . n 
A 1 6  HIS 6  6  6  HIS HIS A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  MET 8  8  8  MET MET A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 THR 10 10 10 THR THR A . n 
A 1 11 MET 11 11 11 MET MET A . n 
A 1 12 MET 12 12 12 MET MET A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 THR 14 14 14 THR THR A . n 
A 1 15 PHE 15 15 15 PHE PHE A . n 
A 1 16 HIS 16 16 16 HIS HIS A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 PHE 18 18 18 PHE PHE A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 TYR 24 24 24 TYR TYR A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 MET 34 34 34 MET MET A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 PHE 41 41 41 PHE PHE A . n 
A 1 42 LEU 42 42 42 LEU LEU A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 ASN 44 44 44 ASN ASN A . n 
A 1 45 GLN 45 45 45 GLN GLN A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 ASP 47 47 47 ASP ASP A . n 
A 1 48 PRO 48 48 48 PRO PRO A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 ALA 50 50 50 ALA ALA A . n 
A 1 51 VAL 51 51 51 VAL VAL A . n 
A 1 52 ASP 52 52 52 ASP ASP A . n 
A 1 53 LYS 53 53 53 LYS LYS A . n 
A 1 54 ILE 54 54 54 ILE ILE A . n 
A 1 55 MET 55 55 55 MET MET A . n 
A 1 56 LYS 56 56 56 LYS LYS A . n 
A 1 57 ASP 57 57 57 ASP ASP A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 ASP 59 59 59 ASP ASP A . n 
A 1 60 GLN 60 60 60 GLN GLN A . n 
A 1 61 CYS 61 61 61 CYS CYS A . n 
A 1 62 ARG 62 62 62 ARG ARG A . n 
A 1 63 ASP 63 63 63 ASP ASP A . n 
A 1 64 GLY 64 64 64 GLY GLY A . n 
A 1 65 LYS 65 65 65 LYS LYS A . n 
A 1 66 VAL 66 66 66 VAL VAL A . n 
A 1 67 GLY 67 67 67 GLY GLY A . n 
A 1 68 PHE 68 68 68 PHE PHE A . n 
A 1 69 GLN 69 69 69 GLN GLN A . n 
A 1 70 SER 70 70 70 SER SER A . n 
A 1 71 PHE 71 71 71 PHE PHE A . n 
A 1 72 PHE 72 72 72 PHE PHE A . n 
A 1 73 SER 73 73 73 SER SER A . n 
A 1 74 LEU 74 74 74 LEU LEU A . n 
A 1 75 ILE 75 75 75 ILE ILE A . n 
A 1 76 ALA 76 76 76 ALA ALA A . n 
A 1 77 GLY 77 77 77 GLY GLY A . n 
A 1 78 LEU 78 78 78 LEU LEU A . n 
A 1 79 THR 79 79 79 THR THR A . n 
A 1 80 ILE 80 80 80 ILE ILE A . n 
A 1 81 ALA 81 81 81 ALA ALA A . n 
A 1 82 CYS 82 82 82 CYS CYS A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 ASP 84 84 84 ASP ASP A . n 
A 1 85 TYR 85 85 85 TYR TYR A . n 
A 1 86 PHE 86 86 86 PHE PHE A . n 
A 1 87 VAL 87 87 87 VAL VAL A . n 
A 1 88 VAL 88 88 88 VAL VAL A . n 
A 1 89 HIS 89 89 89 HIS HIS A . n 
A 1 90 MET 90 90 90 MET MET A . n 
A 1 91 LYS 91 91 91 LYS LYS A . n 
A 1 92 GLN 92 92 ?  ?   ?   A . n 
A 1 93 LYS 93 93 ?  ?   ?   A . n 
A 1 94 GLY 94 94 ?  ?   ?   A . n 
A 1 95 LYS 95 95 ?  ?   ?   A . n 
A 1 96 LYS 96 96 ?  ?   ?   A . n 
B 1 1  PRO 1  1  1  PRO PRO B . n 
B 1 2  SER 2  2  2  SER SER B . n 
B 1 3  GLN 3  3  3  GLN GLN B . n 
B 1 4  MET 4  4  4  MET MET B . n 
B 1 5  GLU 5  5  5  GLU GLU B . n 
B 1 6  HIS 6  6  6  HIS HIS B . n 
B 1 7  ALA 7  7  7  ALA ALA B . n 
B 1 8  MET 8  8  8  MET MET B . n 
B 1 9  GLU 9  9  9  GLU GLU B . n 
B 1 10 THR 10 10 10 THR THR B . n 
B 1 11 MET 11 11 11 MET MET B . n 
B 1 12 MET 12 12 12 MET MET B . n 
B 1 13 PHE 13 13 13 PHE PHE B . n 
B 1 14 THR 14 14 14 THR THR B . n 
B 1 15 PHE 15 15 15 PHE PHE B . n 
B 1 16 HIS 16 16 16 HIS HIS B . n 
B 1 17 LYS 17 17 17 LYS LYS B . n 
B 1 18 PHE 18 18 18 PHE PHE B . n 
B 1 19 ALA 19 19 19 ALA ALA B . n 
B 1 20 GLY 20 20 20 GLY GLY B . n 
B 1 21 ASP 21 21 21 ASP ASP B . n 
B 1 22 LYS 22 22 22 LYS LYS B . n 
B 1 23 GLY 23 23 23 GLY GLY B . n 
B 1 24 TYR 24 24 24 TYR TYR B . n 
B 1 25 LEU 25 25 25 LEU LEU B . n 
B 1 26 THR 26 26 26 THR THR B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 GLU 28 28 28 GLU GLU B . n 
B 1 29 ASP 29 29 29 ASP ASP B . n 
B 1 30 LEU 30 30 30 LEU LEU B . n 
B 1 31 ARG 31 31 31 ARG ARG B . n 
B 1 32 VAL 32 32 32 VAL VAL B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 MET 34 34 34 MET MET B . n 
B 1 35 GLU 35 35 35 GLU GLU B . n 
B 1 36 LYS 36 36 36 LYS LYS B . n 
B 1 37 GLU 37 37 37 GLU GLU B . n 
B 1 38 PHE 38 38 38 PHE PHE B . n 
B 1 39 PRO 39 39 39 PRO PRO B . n 
B 1 40 GLY 40 40 40 GLY GLY B . n 
B 1 41 PHE 41 41 41 PHE PHE B . n 
B 1 42 LEU 42 42 42 LEU LEU B . n 
B 1 43 GLU 43 43 43 GLU GLU B . n 
B 1 44 ASN 44 44 44 ASN ASN B . n 
B 1 45 GLN 45 45 45 GLN GLN B . n 
B 1 46 LYS 46 46 46 LYS LYS B . n 
B 1 47 ASP 47 47 47 ASP ASP B . n 
B 1 48 PRO 48 48 48 PRO PRO B . n 
B 1 49 LEU 49 49 49 LEU LEU B . n 
B 1 50 ALA 50 50 50 ALA ALA B . n 
B 1 51 VAL 51 51 51 VAL VAL B . n 
B 1 52 ASP 52 52 52 ASP ASP B . n 
B 1 53 LYS 53 53 53 LYS LYS B . n 
B 1 54 ILE 54 54 54 ILE ILE B . n 
B 1 55 MET 55 55 55 MET MET B . n 
B 1 56 LYS 56 56 56 LYS LYS B . n 
B 1 57 ASP 57 57 57 ASP ASP B . n 
B 1 58 LEU 58 58 58 LEU LEU B . n 
B 1 59 ASP 59 59 59 ASP ASP B . n 
B 1 60 GLN 60 60 60 GLN GLN B . n 
B 1 61 CYS 61 61 61 CYS CYS B . n 
B 1 62 ARG 62 62 62 ARG ARG B . n 
B 1 63 ASP 63 63 63 ASP ASP B . n 
B 1 64 GLY 64 64 64 GLY GLY B . n 
B 1 65 LYS 65 65 65 LYS LYS B . n 
B 1 66 VAL 66 66 66 VAL VAL B . n 
B 1 67 GLY 67 67 67 GLY GLY B . n 
B 1 68 PHE 68 68 68 PHE PHE B . n 
B 1 69 GLN 69 69 69 GLN GLN B . n 
B 1 70 SER 70 70 70 SER SER B . n 
B 1 71 PHE 71 71 71 PHE PHE B . n 
B 1 72 PHE 72 72 72 PHE PHE B . n 
B 1 73 SER 73 73 73 SER SER B . n 
B 1 74 LEU 74 74 74 LEU LEU B . n 
B 1 75 ILE 75 75 75 ILE ILE B . n 
B 1 76 ALA 76 76 76 ALA ALA B . n 
B 1 77 GLY 77 77 77 GLY GLY B . n 
B 1 78 LEU 78 78 78 LEU LEU B . n 
B 1 79 THR 79 79 79 THR THR B . n 
B 1 80 ILE 80 80 80 ILE ILE B . n 
B 1 81 ALA 81 81 81 ALA ALA B . n 
B 1 82 CYS 82 82 82 CYS CYS B . n 
B 1 83 ASN 83 83 83 ASN ASN B . n 
B 1 84 ASP 84 84 84 ASP ASP B . n 
B 1 85 TYR 85 85 85 TYR TYR B . n 
B 1 86 PHE 86 86 86 PHE PHE B . n 
B 1 87 VAL 87 87 87 VAL VAL B . n 
B 1 88 VAL 88 88 88 VAL VAL B . n 
B 1 89 HIS 89 89 89 HIS HIS B . n 
B 1 90 MET 90 90 90 MET MET B . n 
B 1 91 LYS 91 91 91 LYS LYS B . n 
B 1 92 GLN 92 92 ?  ?   ?   B . n 
B 1 93 LYS 93 93 ?  ?   ?   B . n 
B 1 94 GLY 94 94 ?  ?   ?   B . n 
B 1 95 LYS 95 95 ?  ?   ?   B . n 
B 1 96 LYS 96 96 ?  ?   ?   B . n 
C 2 1  ACE 1  0  1  ACE ACE C . n 
C 2 2  SER 2  1  1  SER SER C . n 
C 2 3  THR 3  2  2  THR THR C . n 
C 2 4  VAL 4  3  3  VAL VAL C . n 
C 2 5  HIS 5  4  4  HIS HIS C . n 
C 2 6  GLU 6  5  5  GLU GLU C . n 
C 2 7  ILE 7  6  6  ILE ILE C . n 
C 2 8  LEU 8  7  7  LEU LEU C . n 
C 2 9  SER 9  8  8  SER SER C . n 
C 2 10 LYS 10 9  9  LYS LYS C . n 
C 2 11 LEU 11 10 10 LEU LEU C . n 
C 2 12 SER 12 11 11 SER SER C . n 
C 2 13 LEU 13 12 ?  ?   ?   C . n 
C 2 14 GLU 14 13 ?  ?   ?   C . n 
D 2 1  ACE 1  0  1  ACE ACE D . n 
D 2 2  SER 2  1  1  SER SER D . n 
D 2 3  THR 3  2  2  THR THR D . n 
D 2 4  VAL 4  3  3  VAL VAL D . n 
D 2 5  HIS 5  4  4  HIS HIS D . n 
D 2 6  GLU 6  5  5  GLU GLU D . n 
D 2 7  ILE 7  6  6  ILE ILE D . n 
D 2 8  LEU 8  7  7  LEU LEU D . n 
D 2 9  SER 9  8  8  SER SER D . n 
D 2 10 LYS 10 9  9  LYS LYS D . n 
D 2 11 LEU 11 10 10 LEU LEU D . n 
D 2 12 SER 12 11 11 SER SER D . n 
D 2 13 LEU 13 12 ?  ?   ?   D . n 
D 2 14 GLU 14 13 ?  ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PISA octameric  8 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G 
2 1,2 A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6130  ? 
1 MORE         -65   ? 
1 'SSA (A^2)'  10320 ? 
2 'ABSA (A^2)' 13470 ? 
2 MORE         -136  ? 
2 'SSA (A^2)'  19440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_756 -x+2,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 134.5352244972 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 58.5105097174 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-27 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     103 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     103 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_757 
_pdbx_validate_symm_contact.dist              1.91 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  C THR 2 ? ? O  C THR 2 ? ? 1.417 1.229 0.188  0.019 N 
2 1 N  D GLU 5 ? ? CA D GLU 5 ? ? 1.731 1.459 0.272  0.020 N 
3 1 CA D GLU 5 ? ? CB D GLU 5 ? ? 1.143 1.535 -0.392 0.022 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A GLU 35 ? ? CB A GLU 35 ? ? CG  A GLU 35 ? ? 127.62 113.40 14.22  2.20 N 
2  1 CA A GLU 37 ? ? C  A GLU 37 ? ? N   A PHE 38 ? ? 134.59 117.20 17.39  2.20 Y 
3  1 O  A GLU 37 ? ? C  A GLU 37 ? ? N   A PHE 38 ? ? 111.48 122.70 -11.22 1.60 Y 
4  1 CB A ASP 84 ? ? CG A ASP 84 ? ? OD1 A ASP 84 ? ? 127.30 118.30 9.00   0.90 N 
5  1 CB A TYR 85 ? ? CG A TYR 85 ? ? CD2 A TYR 85 ? ? 116.74 121.00 -4.26  0.60 N 
6  1 CG B MET 4  ? ? SD B MET 4  ? ? CE  B MET 4  ? ? 116.11 100.20 15.91  1.60 N 
7  1 N  B THR 10 ? ? CA B THR 10 ? ? CB  B THR 10 ? ? 124.58 110.30 14.28  1.90 N 
8  1 CD B ARG 62 ? ? NE B ARG 62 ? ? CZ  B ARG 62 ? ? 132.85 123.60 9.25   1.40 N 
9  1 O  C ACE 0  ? ? C  C ACE 0  ? ? N   C SER 1  ? ? 135.07 122.70 12.37  1.60 Y 
10 1 CA C THR 2  ? ? C  C THR 2  ? ? O   C THR 2  ? ? 133.39 120.10 13.29  2.10 N 
11 1 O  C THR 2  ? ? C  C THR 2  ? ? N   C VAL 3  ? ? 103.98 122.70 -18.72 1.60 Y 
12 1 C  D HIS 4  ? ? N  D GLU 5  ? ? CA  D GLU 5  ? ? 141.57 121.70 19.87  2.50 Y 
13 1 CB D GLU 5  ? ? CA D GLU 5  ? ? C   D GLU 5  ? ? 145.90 110.40 35.50  2.00 N 
14 1 CA D ILE 6  ? ? CB D ILE 6  ? ? CG1 D ILE 6  ? ? 123.51 111.00 12.51  1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 42 ? ? -51.48  -74.77 
2 1 ASP B 59 ? ? -117.63 76.04  
3 1 GLN B 60 ? ? -45.06  -70.02 
4 1 CYS B 61 ? ? -59.57  1.86   
5 1 GLU D 5  ? ? -38.42  -82.02 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 HIS A 6  ? ? -13.70 
2 1 THR A 10 ? ? -10.16 
3 1 ILE A 80 ? ? -11.62 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    D 
_pdbx_validate_chiral.auth_comp_id    GLU 
_pdbx_validate_chiral.auth_seq_id     5 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 92 ? A GLN 92 
2  1 Y 1 A LYS 93 ? A LYS 93 
3  1 Y 1 A GLY 94 ? A GLY 94 
4  1 Y 1 A LYS 95 ? A LYS 95 
5  1 Y 1 A LYS 96 ? A LYS 96 
6  1 Y 1 B GLN 92 ? B GLN 92 
7  1 Y 1 B LYS 93 ? B LYS 93 
8  1 Y 1 B GLY 94 ? B GLY 94 
9  1 Y 1 B LYS 95 ? B LYS 95 
10 1 Y 1 B LYS 96 ? B LYS 96 
11 1 Y 1 C LEU 12 ? C LEU 13 
12 1 Y 1 C GLU 13 ? C GLU 14 
13 1 Y 1 D LEU 12 ? D LEU 13 
14 1 Y 1 D GLU 13 ? D GLU 14 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  97  2  HOH HOH A . 
E 3 HOH 2  98  3  HOH HOH A . 
E 3 HOH 3  99  5  HOH HOH A . 
E 3 HOH 4  100 7  HOH HOH A . 
E 3 HOH 5  101 9  HOH HOH A . 
E 3 HOH 6  102 12 HOH HOH A . 
E 3 HOH 7  103 14 HOH HOH A . 
E 3 HOH 8  104 17 HOH HOH A . 
E 3 HOH 9  105 18 HOH HOH A . 
E 3 HOH 10 106 20 HOH HOH A . 
E 3 HOH 11 107 21 HOH HOH A . 
E 3 HOH 12 108 22 HOH HOH A . 
F 3 HOH 1  97  1  HOH HOH B . 
F 3 HOH 2  98  6  HOH HOH B . 
F 3 HOH 3  99  8  HOH HOH B . 
F 3 HOH 4  100 10 HOH HOH B . 
F 3 HOH 5  101 11 HOH HOH B . 
F 3 HOH 6  102 13 HOH HOH B . 
F 3 HOH 7  103 15 HOH HOH B . 
F 3 HOH 8  104 16 HOH HOH B . 
F 3 HOH 9  105 19 HOH HOH B . 
G 3 HOH 1  14  4  HOH HOH D . 
#