data_1BXO
# 
_entry.id   1BXO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1BXO         
RCSB  RCSB008144   
WWPDB D_1000008144 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BXO 
_pdbx_database_status.recvd_initial_deposition_date   1998-10-07 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Khan, A.R.'     1 
'Parrish, J.C.'  2 
'Fraser, M.E.'   3 
'Smith, W.W.'    4 
'Bartlett, P.A.' 5 
'James, M.N.G.'  6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Lowering the entropic barrier for binding conformationally flexible inhibitors to enzymes.' Biochemistry   37  16839 
16845 1998 BICHAW US 0006-2960 0033 ? 9836576 10.1021/bi9821364 
1       
;Macrocyclic Inhibitors of Penicillopepsin. 3. Design, Synthesis, and Evaluation of an Inhibitor Bridged between P2 and P1'
;
J.Am.Chem.Soc. 120 4622  ?     1998 JACSAT US 0002-7863 0004 ? ?       ?                 
2       
;Macrocyclic Inhibitors of Penicillopepsin. 2.X-Ray Crystallographic Analyses of Penicillopepsin Complexed with a P3-P1 Macrocyclic Peptidyl Inhibitor and with its Two Acyclic Analogues
;
J.Am.Chem.Soc. 120 4610  ?     1998 JACSAT US 0002-7863 0004 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Khan, A.R.'     1  ? 
primary 'Parrish, J.C.'  2  ? 
primary 'Fraser, M.E.'   3  ? 
primary 'Smith, W.W.'    4  ? 
primary 'Bartlett, P.A.' 5  ? 
primary 'James, M.N.'    6  ? 
1       'Smith, W.W.'    7  ? 
1       'Bartlett, P.A.' 8  ? 
2       'Ding, J.'       9  ? 
2       'Fraser, M.E.'   10 ? 
2       'Meyer, J.H.'    11 ? 
2       'Bartlett, P.A.' 12 ? 
2       'James, M.N.G.'  13 ? 
# 
_cell.entry_id           1BXO 
_cell.length_a           96.980 
_cell.length_b           46.650 
_cell.length_c           65.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         115.57 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BXO 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (PENICILLOPEPSIN)' 33468.809 1   3.4.23.20 ? ? ? 
2 non-polymer man alpha-D-mannopyranose 180.156   2   ?         ? ? ? 
3 non-polymer syn 'SULFATE ION' 96.063    1   ?         ? ? ? 
4 non-polymer syn 
;METHYL CYCLO[(2S)-2-[[(1R)-1-(N-(L-N-(3-METHYLBUTANOYL)VALYL-L-ASPARTYL)AMINO)-3-METHYLBUTYL]HYDROXYPHOSPHINYLOXY]-3-(3-AMINOMETHYL)PHENYLPROPANOATE
;
638.689   1   ?         ? ? ? 
5 non-polymer syn GLYCEROL 92.094    2   ?         ? ? ? 
6 water       nat water 18.015    528 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AASGVATNTPTANDEEYITPVTIGGTTLNLNFDTGSADLWVFSTELPASQQSGHSVYNPSATGKELSGYTWSISYGDGSS
ASGNVFTDSVTVGGVTAHGQAVQAAQQISAQFQQDTNNDGLLGLAFSSINTVQPQSQTTFFDTVKSSLAQPLFAVALKHQ
QPGVYDFGFIDSSKYTGSLTYTGVDNSQGFWSFNVDSYTAGSQSGDGFSGIADTGTTLLLLDDSVVSQYYSQVSGAQQDS
NAGGYVFDCSTNLPDFSVSISGYTATVPGSLINYGPSGDGSTCLGGIQSNSGIGFSIFGDIFLKSQYVVFDSDGPQLGFA
PQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AASGVATNTPTANDEEYITPVTIGGTTLNLNFDTGSADLWVFSTELPASQQSGHSVYNPSATGKELSGYTWSISYGDGSS
ASGNVFTDSVTVGGVTAHGQAVQAAQQISAQFQQDTNNDGLLGLAFSSINTVQPQSQTTFFDTVKSSLAQPLFAVALKHQ
QPGVYDFGFIDSSKYTGSLTYTGVDNSQGFWSFNVDSYTAGSQSGDGFSGIADTGTTLLLLDDSVVSQYYSQVSGAQQDS
NAGGYVFDCSTNLPDFSVSISGYTATVPGSLINYGPSGDGSTCLGGIQSNSGIGFSIFGDIFLKSQYVVFDSDGPQLGFA
PQA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   SER n 
1 4   GLY n 
1 5   VAL n 
1 6   ALA n 
1 7   THR n 
1 8   ASN n 
1 9   THR n 
1 10  PRO n 
1 11  THR n 
1 12  ALA n 
1 13  ASN n 
1 14  ASP n 
1 15  GLU n 
1 16  GLU n 
1 17  TYR n 
1 18  ILE n 
1 19  THR n 
1 20  PRO n 
1 21  VAL n 
1 22  THR n 
1 23  ILE n 
1 24  GLY n 
1 25  GLY n 
1 26  THR n 
1 27  THR n 
1 28  LEU n 
1 29  ASN n 
1 30  LEU n 
1 31  ASN n 
1 32  PHE n 
1 33  ASP n 
1 34  THR n 
1 35  GLY n 
1 36  SER n 
1 37  ALA n 
1 38  ASP n 
1 39  LEU n 
1 40  TRP n 
1 41  VAL n 
1 42  PHE n 
1 43  SER n 
1 44  THR n 
1 45  GLU n 
1 46  LEU n 
1 47  PRO n 
1 48  ALA n 
1 49  SER n 
1 50  GLN n 
1 51  GLN n 
1 52  SER n 
1 53  GLY n 
1 54  HIS n 
1 55  SER n 
1 56  VAL n 
1 57  TYR n 
1 58  ASN n 
1 59  PRO n 
1 60  SER n 
1 61  ALA n 
1 62  THR n 
1 63  GLY n 
1 64  LYS n 
1 65  GLU n 
1 66  LEU n 
1 67  SER n 
1 68  GLY n 
1 69  TYR n 
1 70  THR n 
1 71  TRP n 
1 72  SER n 
1 73  ILE n 
1 74  SER n 
1 75  TYR n 
1 76  GLY n 
1 77  ASP n 
1 78  GLY n 
1 79  SER n 
1 80  SER n 
1 81  ALA n 
1 82  SER n 
1 83  GLY n 
1 84  ASN n 
1 85  VAL n 
1 86  PHE n 
1 87  THR n 
1 88  ASP n 
1 89  SER n 
1 90  VAL n 
1 91  THR n 
1 92  VAL n 
1 93  GLY n 
1 94  GLY n 
1 95  VAL n 
1 96  THR n 
1 97  ALA n 
1 98  HIS n 
1 99  GLY n 
1 100 GLN n 
1 101 ALA n 
1 102 VAL n 
1 103 GLN n 
1 104 ALA n 
1 105 ALA n 
1 106 GLN n 
1 107 GLN n 
1 108 ILE n 
1 109 SER n 
1 110 ALA n 
1 111 GLN n 
1 112 PHE n 
1 113 GLN n 
1 114 GLN n 
1 115 ASP n 
1 116 THR n 
1 117 ASN n 
1 118 ASN n 
1 119 ASP n 
1 120 GLY n 
1 121 LEU n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 PHE n 
1 127 SER n 
1 128 SER n 
1 129 ILE n 
1 130 ASN n 
1 131 THR n 
1 132 VAL n 
1 133 GLN n 
1 134 PRO n 
1 135 GLN n 
1 136 SER n 
1 137 GLN n 
1 138 THR n 
1 139 THR n 
1 140 PHE n 
1 141 PHE n 
1 142 ASP n 
1 143 THR n 
1 144 VAL n 
1 145 LYS n 
1 146 SER n 
1 147 SER n 
1 148 LEU n 
1 149 ALA n 
1 150 GLN n 
1 151 PRO n 
1 152 LEU n 
1 153 PHE n 
1 154 ALA n 
1 155 VAL n 
1 156 ALA n 
1 157 LEU n 
1 158 LYS n 
1 159 HIS n 
1 160 GLN n 
1 161 GLN n 
1 162 PRO n 
1 163 GLY n 
1 164 VAL n 
1 165 TYR n 
1 166 ASP n 
1 167 PHE n 
1 168 GLY n 
1 169 PHE n 
1 170 ILE n 
1 171 ASP n 
1 172 SER n 
1 173 SER n 
1 174 LYS n 
1 175 TYR n 
1 176 THR n 
1 177 GLY n 
1 178 SER n 
1 179 LEU n 
1 180 THR n 
1 181 TYR n 
1 182 THR n 
1 183 GLY n 
1 184 VAL n 
1 185 ASP n 
1 186 ASN n 
1 187 SER n 
1 188 GLN n 
1 189 GLY n 
1 190 PHE n 
1 191 TRP n 
1 192 SER n 
1 193 PHE n 
1 194 ASN n 
1 195 VAL n 
1 196 ASP n 
1 197 SER n 
1 198 TYR n 
1 199 THR n 
1 200 ALA n 
1 201 GLY n 
1 202 SER n 
1 203 GLN n 
1 204 SER n 
1 205 GLY n 
1 206 ASP n 
1 207 GLY n 
1 208 PHE n 
1 209 SER n 
1 210 GLY n 
1 211 ILE n 
1 212 ALA n 
1 213 ASP n 
1 214 THR n 
1 215 GLY n 
1 216 THR n 
1 217 THR n 
1 218 LEU n 
1 219 LEU n 
1 220 LEU n 
1 221 LEU n 
1 222 ASP n 
1 223 ASP n 
1 224 SER n 
1 225 VAL n 
1 226 VAL n 
1 227 SER n 
1 228 GLN n 
1 229 TYR n 
1 230 TYR n 
1 231 SER n 
1 232 GLN n 
1 233 VAL n 
1 234 SER n 
1 235 GLY n 
1 236 ALA n 
1 237 GLN n 
1 238 GLN n 
1 239 ASP n 
1 240 SER n 
1 241 ASN n 
1 242 ALA n 
1 243 GLY n 
1 244 GLY n 
1 245 TYR n 
1 246 VAL n 
1 247 PHE n 
1 248 ASP n 
1 249 CYS n 
1 250 SER n 
1 251 THR n 
1 252 ASN n 
1 253 LEU n 
1 254 PRO n 
1 255 ASP n 
1 256 PHE n 
1 257 SER n 
1 258 VAL n 
1 259 SER n 
1 260 ILE n 
1 261 SER n 
1 262 GLY n 
1 263 TYR n 
1 264 THR n 
1 265 ALA n 
1 266 THR n 
1 267 VAL n 
1 268 PRO n 
1 269 GLY n 
1 270 SER n 
1 271 LEU n 
1 272 ILE n 
1 273 ASN n 
1 274 TYR n 
1 275 GLY n 
1 276 PRO n 
1 277 SER n 
1 278 GLY n 
1 279 ASP n 
1 280 GLY n 
1 281 SER n 
1 282 THR n 
1 283 CYS n 
1 284 LEU n 
1 285 GLY n 
1 286 GLY n 
1 287 ILE n 
1 288 GLN n 
1 289 SER n 
1 290 ASN n 
1 291 SER n 
1 292 GLY n 
1 293 ILE n 
1 294 GLY n 
1 295 PHE n 
1 296 SER n 
1 297 ILE n 
1 298 PHE n 
1 299 GLY n 
1 300 ASP n 
1 301 ILE n 
1 302 PHE n 
1 303 LEU n 
1 304 LYS n 
1 305 SER n 
1 306 GLN n 
1 307 TYR n 
1 308 VAL n 
1 309 VAL n 
1 310 PHE n 
1 311 ASP n 
1 312 SER n 
1 313 ASP n 
1 314 GLY n 
1 315 PRO n 
1 316 GLN n 
1 317 LEU n 
1 318 GLY n 
1 319 PHE n 
1 320 ALA n 
1 321 PRO n 
1 322 GLN n 
1 323 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Penicillium janthinellum' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      5079 
_entity_src_nat.genus                      Penicillium 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PENP_PENJA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00798 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BXO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 323 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00798 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  323 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       323 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?                               'C3 H7 N O2'      89.093  
ASN 'L-peptide linking'           y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'           y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer                   . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking'           y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ?                               'C6 H12 O6'       180.156 
PHE 'L-peptide linking'           y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PP7 non-polymer                   . 
;METHYL CYCLO[(2S)-2-[[(1R)-1-(N-(L-N-(3-METHYLBUTANOYL)VALYL-L-ASPARTYL)AMINO)-3-METHYLBUTYL]HYDROXYPHOSPHINYLOXY]-3-(3-AMINOMETHYL)PHENYLPROPANOATE
;
?                               'C30 H47 N4 O9 P' 638.689 
PRO 'L-peptide linking'           y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer                   . 'SULFATE ION' ?                               'O4 S -2'         96.063  
THR 'L-peptide linking'           y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1BXO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.91 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    '0.1 M CH3COONA 35% AMMONIUM SULFATE PH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1997-11-15 
_diffrn_detector.details                'CRYSTAL AND MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.919 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.919 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BXO 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10 
_reflns.d_resolution_high            0.95 
_reflns.number_obs                   430728 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              0.055 
_reflns.pdbx_netI_over_sigmaI        3.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.76 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             0.95 
_reflns_shell.d_res_low              0.98 
_reflns_shell.percent_possible_all   53.8 
_reflns_shell.Rmerge_I_obs           0.16 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.036 
_reflns_shell.pdbx_redundancy        1.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BXO 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     430728 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            0.95 
_refine.ls_percent_reflns_obs                    98 
_refine.ls_R_factor_obs                          0.0991 
_refine.ls_R_factor_all                          0.1004 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.1247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  43072 
_refine.ls_number_parameters                     27864 
_refine.ls_number_restraints                     33863 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET (SWAT)' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'UNTIL NEAR END' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1PPL 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            10% 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1BXO 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      31 
_refine_analyze.occupancy_sum_hydrogen          2247.6 
_refine_analyze.occupancy_sum_non_hydrogen      2973.4 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2366 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         83 
_refine_hist.number_atoms_solvent             528 
_refine_hist.number_atoms_total               2977 
_refine_hist.d_res_high                       0.95 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.034 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.096 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.123 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.124 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1BXO 
_pdbx_refine.R_factor_all_no_cutoff                      0.1004 
_pdbx_refine.R_factor_obs_no_cutoff                      0.0991 
_pdbx_refine.free_R_factor_no_cutoff                     0.1247 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            43072 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.0933 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               136505 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1BXO 
_struct.title                     
;ACID PROTEINASE (PENICILLOPEPSIN) (E.C.3.4.23.20) COMPLEX WITH PHOSPHONATE INHIBITOR: METHYL CYCLO[(2S)-2-[[(1R)-1-(N-(L-N-(3-METHYLBUTANOYL)VALYL-L-ASPARTYL)AMINO)-3-METHYLBUT YL] HYDROXYPHOSPHINYLOXY]-3-(3-AMINOMETHYL) PHENYLPROPANOATE
;
_struct.pdbx_descriptor           'PROTEIN (PENICILLOPEPSIN) (3.4.23.20)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BXO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, PHOSPHONATE INHIBITORS, MACROCYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 12  ? ASP A 14  ? ALA A 12  ASP A 14  5 ? 3  
HELX_P HELX_P2  2  ALA A 48  ? GLN A 51  ? ALA A 48  GLN A 51  1 ? 4  
HELX_P HELX_P3  3  PRO A 59  ? THR A 62  ? PRO A 59  THR A 62  1 ? 4  
HELX_P HELX_P4  4  ALA A 110 ? GLN A 113 ? ALA A 110 GLN A 113 1 ? 4  
HELX_P HELX_P5  5  SER A 127 ? ILE A 129 ? SER A 127 ILE A 129 5 ? 3  
HELX_P HELX_P6  6  PHE A 140 ? SER A 147 ? PHE A 140 SER A 147 1 ? 8  
HELX_P HELX_P7  7  SER A 172 ? LYS A 174 ? SER A 172 LYS A 174 5 ? 3  
HELX_P HELX_P8  8  ASP A 223 ? GLN A 232 ? ASP A 223 GLN A 232 1 ? 10 
HELX_P HELX_P9  9  GLY A 269 ? ILE A 272 ? GLY A 269 ILE A 272 1 ? 4  
HELX_P HELX_P10 10 ASP A 300 ? SER A 305 ? ASP A 300 SER A 305 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 249 SG  B ? ? 1_555 A CYS 283 SG ? ? A CYS 249 A CYS 283 1_555 ? ? ? ? ? ? ? 2.068 ? ?               
covale1 covale one ? A SER 3   OG  ? ? ? 1_555 B MAN .   C1 ? ? A SER 3   A MAN 328 1_555 ? ? ? ? ? ? ? 1.418 ? O-Glycosylation 
covale2 covale one ? A THR 7   OG1 ? ? ? 1_555 C MAN .   C1 ? ? A THR 7   A MAN 329 1_555 ? ? ? ? ? ? ? 1.404 ? O-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 133 A . ? GLN 133 A PRO 134 A ? PRO 134 A 1 7.19  
2 GLY 314 A . ? GLY 314 A PRO 315 A ? PRO 315 A 1 -4.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 3 ? 
C ? 3 ? 
D ? 2 ? 
E ? 3 ? 
F ? 4 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 26  ? LEU A 30  ? THR A 26  LEU A 30  
A 2 TYR A 17  ? ILE A 23  ? TYR A 17  ILE A 23  
A 3 GLY A 4   ? PRO A 10  ? GLY A 4   PRO A 10  
A 4 GLY A 163 ? PHE A 167 ? GLY A 163 PHE A 167 
A 5 LEU A 152 ? ALA A 156 ? LEU A 152 ALA A 156 
A 6 GLN A 306 ? ASP A 311 ? GLN A 306 ASP A 311 
A 7 GLN A 316 ? PRO A 321 ? GLN A 316 PRO A 321 
A 8 THR A 180 ? GLY A 183 ? THR A 180 GLY A 183 
B 1 ASN A 31  ? ASP A 33  ? ASN A 31  ASP A 33  
B 2 GLY A 120 ? GLY A 123 ? GLY A 120 GLY A 123 
B 3 LEU A 39  ? VAL A 41  ? LEU A 39  VAL A 41  
C 1 TRP A 71  ? SER A 74  ? TRP A 71  SER A 74  
C 2 SER A 80  ? ASP A 88  ? SER A 80  ASP A 88  
C 3 GLN A 100 ? ILE A 108 ? GLN A 100 ILE A 108 
D 1 VAL A 90  ? VAL A 92  ? VAL A 90  VAL A 92  
D 2 VAL A 95  ? ALA A 97  ? VAL A 95  ALA A 97  
E 1 SER A 192 ? VAL A 195 ? SER A 192 VAL A 195 
E 2 PHE A 208 ? ALA A 212 ? PHE A 208 ALA A 212 
E 3 SER A 296 ? PHE A 298 ? SER A 296 PHE A 298 
F 1 GLN A 203 ? ASP A 206 ? GLN A 203 ASP A 206 
F 2 SER A 197 ? ALA A 200 ? SER A 197 ALA A 200 
F 3 PHE A 256 ? ILE A 260 ? PHE A 256 ILE A 260 
F 4 TYR A 263 ? VAL A 267 ? TYR A 263 VAL A 267 
G 1 LEU A 219 ? LEU A 221 ? LEU A 219 LEU A 221 
G 2 ILE A 287 ? SER A 289 ? ILE A 287 SER A 289 
H 1 GLN A 237 ? ASP A 239 ? GLN A 237 ASP A 239 
H 2 GLY A 244 ? VAL A 246 ? GLY A 244 VAL A 246 
I 1 ASN A 273 ? PRO A 276 ? ASN A 273 PRO A 276 
I 2 CYS A 283 ? GLY A 285 ? CYS A 283 GLY A 285 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 26  ? O THR A 26  N ILE A 23  ? N ILE A 23  
A 2 3 O ILE A 18  ? O ILE A 18  N THR A 9   ? N THR A 9   
A 3 4 O GLY A 4   ? O GLY A 4   N PHE A 167 ? N PHE A 167 
A 4 5 O VAL A 164 ? O VAL A 164 N ALA A 156 ? N ALA A 156 
A 5 6 O PHE A 153 ? O PHE A 153 N PHE A 310 ? N PHE A 310 
A 6 7 O TYR A 307 ? O TYR A 307 N ALA A 320 ? N ALA A 320 
A 7 8 O LEU A 317 ? O LEU A 317 N THR A 182 ? N THR A 182 
B 1 2 O ASN A 31  ? O ASN A 31  N LEU A 122 ? N LEU A 122 
B 2 3 O LEU A 121 ? O LEU A 121 N TRP A 40  ? N TRP A 40  
C 1 2 O TRP A 71  ? O TRP A 71  N GLY A 83  ? N GLY A 83  
C 2 3 O SER A 82  ? O SER A 82  N GLN A 107 ? N GLN A 107 
D 1 2 O VAL A 90  ? O VAL A 90  N ALA A 97  ? N ALA A 97  
E 1 2 O PHE A 193 ? O PHE A 193 N GLY A 210 ? N GLY A 210 
E 2 3 O ILE A 211 ? O ILE A 211 N SER A 296 ? N SER A 296 
F 1 2 O GLN A 203 ? O GLN A 203 N ALA A 200 ? N ALA A 200 
F 2 3 O THR A 199 ? O THR A 199 N SER A 257 ? N SER A 257 
F 3 4 O PHE A 256 ? O PHE A 256 N VAL A 267 ? N VAL A 267 
G 1 2 O LEU A 219 ? O LEU A 219 N GLN A 288 ? N GLN A 288 
H 1 2 O GLN A 237 ? O GLN A 237 N VAL A 246 ? N VAL A 246 
I 1 2 O TYR A 274 ? O TYR A 274 N LEU A 284 ? N LEU A 284 
# 
_struct_site.id                   CIC 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'CATALYTIC RESIDUES' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CIC 2 ASP A 33  ? ASP A 33  . ? 1_555 ? 
2 CIC 2 ASP A 213 ? ASP A 213 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BXO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BXO 
_atom_sites.fract_transf_matrix[1][1]   0.010311 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004934 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021436 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016871 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    A ALA A 1 1   ? 37.571  31.701  0.575  0.51 12.93  ? 1    ALA A N    1 
ATOM   2    N N    B ALA A 1 1   ? 38.430  24.822  0.206  0.49 23.76  ? 1    ALA A N    1 
ATOM   3    C CA   A ALA A 1 1   ? 36.928  31.049  1.825  0.51 12.11  ? 1    ALA A CA   1 
ATOM   4    C CA   B ALA A 1 1   ? 37.122  25.478  0.073  0.49 15.81  ? 1    ALA A CA   1 
ATOM   5    C C    A ALA A 1 1   ? 36.358  29.677  1.424  0.51 11.89  ? 1    ALA A C    1 
ATOM   6    C C    B ALA A 1 1   ? 36.585  26.290  1.256  0.49 16.91  ? 1    ALA A C    1 
ATOM   7    O O    A ALA A 1 1   ? 36.173  29.436  0.207  0.51 15.02  ? 1    ALA A O    1 
ATOM   8    O O    B ALA A 1 1   ? 36.878  26.089  2.459  0.49 20.20  ? 1    ALA A O    1 
ATOM   9    C CB   A ALA A 1 1   ? 35.890  31.947  2.407  0.51 15.12  ? 1    ALA A CB   1 
ATOM   10   C CB   B ALA A 1 1   ? 36.012  24.620  -0.267 0.49 26.70  ? 1    ALA A CB   1 
ATOM   11   H H1   A ALA A 1 1   ? 38.186  31.153  0.238  0.51 19.40  ? 1    ALA A H1   1 
ATOM   12   H H1   B ALA A 1 1   ? 39.049  25.432  0.402  0.49 35.63  ? 1    ALA A H1   1 
ATOM   13   H H2   A ALA A 1 1   ? 36.943  31.854  -0.036 0.51 19.40  ? 1    ALA A H2   1 
ATOM   14   H H2   B ALA A 1 1   ? 38.393  24.217  0.857  0.49 35.63  ? 1    ALA A H2   1 
ATOM   15   H H3   A ALA A 1 1   ? 37.955  32.470  0.806  0.51 19.40  ? 1    ALA A H3   1 
ATOM   16   H H3   B ALA A 1 1   ? 38.640  24.421  -0.560 0.49 35.63  ? 1    ALA A H3   1 
ATOM   17   H HA   A ALA A 1 1   ? 37.629  30.910  2.496  0.51 14.53  ? 1    ALA A HA   1 
ATOM   18   H HA   B ALA A 1 1   ? 37.211  26.111  -0.670 0.49 18.98  ? 1    ALA A HA   1 
ATOM   19   H HB1  A ALA A 1 1   ? 35.523  31.543  3.196  0.51 22.68  ? 1    ALA A HB1  1 
ATOM   20   H HB1  B ALA A 1 1   ? 35.252  25.157  -0.503 0.49 40.05  ? 1    ALA A HB1  1 
ATOM   21   H HB2  A ALA A 1 1   ? 36.288  32.791  2.635  0.51 22.68  ? 1    ALA A HB2  1 
ATOM   22   H HB2  B ALA A 1 1   ? 36.254  24.063  -1.011 0.49 40.05  ? 1    ALA A HB2  1 
ATOM   23   H HB3  A ALA A 1 1   ? 35.191  32.087  1.764  0.51 22.68  ? 1    ALA A HB3  1 
ATOM   24   H HB3  B ALA A 1 1   ? 35.792  24.068  0.487  0.49 40.05  ? 1    ALA A HB3  1 
ATOM   25   N N    A ALA A 1 2   ? 36.119  28.844  2.385  0.51 11.47  ? 2    ALA A N    1 
ATOM   26   N N    B ALA A 1 2   ? 35.819  27.381  0.954  0.49 13.16  ? 2    ALA A N    1 
ATOM   27   C CA   A ALA A 1 2   ? 35.645  27.496  2.174  0.51 12.36  ? 2    ALA A CA   1 
ATOM   28   C CA   B ALA A 1 2   ? 35.225  28.231  1.911  0.49 13.35  ? 2    ALA A CA   1 
ATOM   29   C C    A ALA A 1 2   ? 34.121  27.488  2.441  0.51 11.44  ? 2    ALA A C    1 
ATOM   30   C C    B ALA A 1 2   ? 33.839  27.726  2.309  0.49 12.87  ? 2    ALA A C    1 
ATOM   31   O O    A ALA A 1 2   ? 33.534  28.163  3.266  0.51 12.13  ? 2    ALA A O    1 
ATOM   32   O O    B ALA A 1 2   ? 33.215  28.327  3.208  0.49 14.03  ? 2    ALA A O    1 
ATOM   33   C CB   A ALA A 1 2   ? 36.339  26.562  3.151  0.51 14.15  ? 2    ALA A CB   1 
ATOM   34   C CB   B ALA A 1 2   ? 35.163  29.691  1.314  0.49 14.07  ? 2    ALA A CB   1 
ATOM   35   H H    A ALA A 1 2   ? 36.249  29.108  3.193  0.51 13.77  ? 2    ALA A H    1 
ATOM   36   H H    B ALA A 1 2   ? 35.689  27.563  0.124  0.49 15.80  ? 2    ALA A H    1 
ATOM   37   H HA   A ALA A 1 2   ? 35.828  27.215  1.253  0.51 14.83  ? 2    ALA A HA   1 
ATOM   38   H HA   B ALA A 1 2   ? 35.793  28.245  2.710  0.49 16.03  ? 2    ALA A HA   1 
ATOM   39   H HB1  A ALA A 1 2   ? 37.286  26.582  2.996  0.51 21.23  ? 2    ALA A HB1  1 
ATOM   40   H HB1  B ALA A 1 2   ? 34.805  30.291  1.972  0.49 21.11  ? 2    ALA A HB1  1 
ATOM   41   H HB2  A ALA A 1 2   ? 36.156  26.845  4.050  0.51 21.23  ? 2    ALA A HB2  1 
ATOM   42   H HB2  B ALA A 1 2   ? 36.047  29.975  1.068  0.49 21.11  ? 2    ALA A HB2  1 
ATOM   43   H HB3  A ALA A 1 2   ? 36.013  25.667  3.025  0.51 21.23  ? 2    ALA A HB3  1 
ATOM   44   H HB3  B ALA A 1 2   ? 34.599  29.695  0.537  0.49 21.11  ? 2    ALA A HB3  1 
ATOM   45   N N    . SER A 1 3   ? 33.400  26.636  1.690  1.00 11.95  ? 3    SER A N    1 
ATOM   46   C CA   . SER A 1 3   ? 32.040  26.144  1.992  1.00 10.82  ? 3    SER A CA   1 
ATOM   47   C C    . SER A 1 3   ? 31.848  24.805  1.309  1.00 10.52  ? 3    SER A C    1 
ATOM   48   O O    . SER A 1 3   ? 32.655  24.430  0.438  1.00 11.84  ? 3    SER A O    1 
ATOM   49   C CB   . SER A 1 3   ? 30.968  27.122  1.511  1.00 11.35  ? 3    SER A CB   1 
ATOM   50   O OG   . SER A 1 3   ? 30.901  26.986  0.106  1.00 12.31  ? 3    SER A OG   1 
ATOM   51   H H    . SER A 1 3   ? 33.766  26.351  0.965  1.00 14.34  ? 3    SER A H    1 
ATOM   52   H HA   . SER A 1 3   ? 31.952  26.024  2.961  1.00 12.98  ? 3    SER A HA   1 
ATOM   53   H HB2  . SER A 1 3   ? 30.112  26.909  1.913  1.00 13.62  ? 3    SER A HB2  1 
ATOM   54   H HB3  . SER A 1 3   ? 31.207  28.030  1.753  1.00 13.62  ? 3    SER A HB3  1 
ATOM   55   N N    . GLY A 1 4   ? 30.834  24.079  1.676  1.00 10.49  ? 4    GLY A N    1 
ATOM   56   C CA   . GLY A 1 4   ? 30.512  22.834  0.974  1.00 10.89  ? 4    GLY A CA   1 
ATOM   57   C C    . GLY A 1 4   ? 29.176  22.263  1.396  1.00 10.26  ? 4    GLY A C    1 
ATOM   58   O O    . GLY A 1 4   ? 28.605  22.690  2.405  1.00 11.44  ? 4    GLY A O    1 
ATOM   59   H H    . GLY A 1 4   ? 30.347  24.333  2.338  1.00 12.59  ? 4    GLY A H    1 
ATOM   60   H HA2  . GLY A 1 4   ? 30.498  23.002  0.019  1.00 13.07  ? 4    GLY A HA2  1 
ATOM   61   H HA3  . GLY A 1 4   ? 31.206  22.181  1.151  1.00 13.07  ? 4    GLY A HA3  1 
ATOM   62   N N    . VAL A 1 5   ? 28.710  21.319  0.615  1.00 11.16  ? 5    VAL A N    1 
ATOM   63   C CA   . VAL A 1 5   ? 27.479  20.571  0.867  1.00 11.16  ? 5    VAL A CA   1 
ATOM   64   C C    . VAL A 1 5   ? 27.829  19.129  1.037  1.00 11.15  ? 5    VAL A C    1 
ATOM   65   O O    . VAL A 1 5   ? 28.385  18.482  0.133  1.00 12.40  ? 5    VAL A O    1 
ATOM   66   C CB   . VAL A 1 5   ? 26.417  20.774  -0.244 1.00 11.88  ? 5    VAL A CB   1 
ATOM   67   C CG1  . VAL A 1 5   ? 25.158  19.959  0.075  1.00 13.89  ? 5    VAL A CG1  1 
ATOM   68   C CG2  . VAL A 1 5   ? 26.138  22.209  -0.484 1.00 13.40  ? 5    VAL A CG2  1 
ATOM   69   H H    . VAL A 1 5   ? 29.159  21.127  -0.093 1.00 13.40  ? 5    VAL A H    1 
ATOM   70   H HA   . VAL A 1 5   ? 27.099  20.891  1.711  1.00 13.39  ? 5    VAL A HA   1 
ATOM   71   H HB   . VAL A 1 5   ? 26.794  20.411  -1.073 1.00 14.25  ? 5    VAL A HB   1 
ATOM   72   H HG11 . VAL A 1 5   ? 25.400  19.041  0.220  1.00 20.83  ? 5    VAL A HG11 1 
ATOM   73   H HG12 . VAL A 1 5   ? 24.742  20.309  0.866  1.00 20.83  ? 5    VAL A HG12 1 
ATOM   74   H HG13 . VAL A 1 5   ? 24.545  20.016  -0.662 1.00 20.83  ? 5    VAL A HG13 1 
ATOM   75   H HG21 . VAL A 1 5   ? 25.736  22.592  0.299  1.00 20.10  ? 5    VAL A HG21 1 
ATOM   76   H HG22 . VAL A 1 5   ? 26.960  22.667  -0.679 1.00 20.10  ? 5    VAL A HG22 1 
ATOM   77   H HG23 . VAL A 1 5   ? 25.538  22.298  -1.228 1.00 20.10  ? 5    VAL A HG23 1 
ATOM   78   N N    . ALA A 1 6   ? 27.541  18.594  2.223  1.00 11.07  ? 6    ALA A N    1 
ATOM   79   C CA   . ALA A 1 6   ? 27.673  17.139  2.521  1.00 11.88  ? 6    ALA A CA   1 
ATOM   80   C C    . ALA A 1 6   ? 26.268  16.510  2.447  1.00 11.65  ? 6    ALA A C    1 
ATOM   81   O O    . ALA A 1 6   ? 25.348  16.992  3.080  1.00 15.46  ? 6    ALA A O    1 
ATOM   82   C CB   . ALA A 1 6   ? 28.299  16.947  3.866  1.00 14.07  ? 6    ALA A CB   1 
ATOM   83   H H    . ALA A 1 6   ? 27.265  19.115  2.849  1.00 13.28  ? 6    ALA A H    1 
ATOM   84   H HA   . ALA A 1 6   ? 28.244  16.725  1.841  1.00 14.25  ? 6    ALA A HA   1 
ATOM   85   H HB1  . ALA A 1 6   ? 28.382  16.008  4.048  1.00 21.10  ? 6    ALA A HB1  1 
ATOM   86   H HB2  . ALA A 1 6   ? 29.169  17.353  3.875  1.00 21.10  ? 6    ALA A HB2  1 
ATOM   87   H HB3  . ALA A 1 6   ? 27.748  17.356  4.537  1.00 21.10  ? 6    ALA A HB3  1 
ATOM   88   N N    . THR A 1 7   ? 26.148  15.452  1.717  1.00 10.78  ? 7    THR A N    1 
ATOM   89   C CA   . THR A 1 7   ? 24.840  14.800  1.548  1.00 11.00  ? 7    THR A CA   1 
ATOM   90   C C    . THR A 1 7   ? 24.630  13.731  2.590  1.00 11.62  ? 7    THR A C    1 
ATOM   91   O O    . THR A 1 7   ? 25.491  12.795  2.659  1.00 14.35  ? 7    THR A O    1 
ATOM   92   C CB   . THR A 1 7   ? 24.721  14.244  0.117  1.00 12.91  ? 7    THR A CB   1 
ATOM   93   O OG1  . THR A 1 7   ? 24.876  15.377  -0.755 1.00 14.16  ? 7    THR A OG1  1 
ATOM   94   C CG2  . THR A 1 7   ? 23.417  13.512  -0.133 1.00 15.78  ? 7    THR A CG2  1 
ATOM   95   H H    . THR A 1 7   ? 26.840  15.125  1.325  1.00 12.93  ? 7    THR A H    1 
ATOM   96   H HA   . THR A 1 7   ? 24.145  15.480  1.668  1.00 13.20  ? 7    THR A HA   1 
ATOM   97   H HB   . THR A 1 7   ? 25.463  13.623  -0.041 1.00 15.49  ? 7    THR A HB   1 
ATOM   98   H HG21 . THR A 1 7   ? 23.399  13.188  -1.036 1.00 23.68  ? 7    THR A HG21 1 
ATOM   99   H HG22 . THR A 1 7   ? 23.343  12.772  0.474  1.00 23.68  ? 7    THR A HG22 1 
ATOM   100  H HG23 . THR A 1 7   ? 22.681  14.113  0.005  1.00 23.68  ? 7    THR A HG23 1 
ATOM   101  N N    . ASN A 1 8   ? 23.502  13.773  3.284  1.00 11.01  ? 8    ASN A N    1 
ATOM   102  C CA   . ASN A 1 8   ? 23.142  12.749  4.254  1.00 11.73  ? 8    ASN A CA   1 
ATOM   103  C C    . ASN A 1 8   ? 22.057  11.854  3.680  1.00 11.42  ? 8    ASN A C    1 
ATOM   104  O O    . ASN A 1 8   ? 21.291  12.219  2.777  1.00 11.96  ? 8    ASN A O    1 
ATOM   105  C CB   . ASN A 1 8   ? 22.768  13.372  5.597  1.00 12.16  ? 8    ASN A CB   1 
ATOM   106  C CG   . ASN A 1 8   ? 21.517  14.252  5.564  1.00 11.82  ? 8    ASN A CG   1 
ATOM   107  O OD1  . ASN A 1 8   ? 20.443  13.813  5.165  1.00 13.57  ? 8    ASN A OD1  1 
ATOM   108  N ND2  . ASN A 1 8   ? 21.633  15.521  5.987  1.00 12.66  ? 8    ASN A ND2  1 
ATOM   109  H H    . ASN A 1 8   ? 22.962  14.430  3.157  1.00 13.21  ? 8    ASN A H    1 
ATOM   110  H HA   . ASN A 1 8   ? 23.935  12.192  4.399  1.00 14.08  ? 8    ASN A HA   1 
ATOM   111  H HB2  . ASN A 1 8   ? 22.629  12.659  6.241  1.00 14.59  ? 8    ASN A HB2  1 
ATOM   112  H HB3  . ASN A 1 8   ? 23.515  13.907  5.909  1.00 14.59  ? 8    ASN A HB3  1 
ATOM   113  H HD21 . ASN A 1 8   ? 22.393  15.814  6.264  1.00 15.20  ? 8    ASN A HD21 1 
ATOM   114  H HD22 . ASN A 1 8   ? 20.948  16.040  5.982  1.00 15.20  ? 8    ASN A HD22 1 
ATOM   115  N N    . THR A 1 9   ? 21.986  10.625  4.252  1.00 11.59  ? 9    THR A N    1 
ATOM   116  C CA   . THR A 1 9   ? 20.953  9.662   3.833  1.00 11.60  ? 9    THR A CA   1 
ATOM   117  C C    . THR A 1 9   ? 20.431  8.962   5.091  1.00 10.49  ? 9    THR A C    1 
ATOM   118  O O    . THR A 1 9   ? 21.255  8.439   5.900  1.00 11.42  ? 9    THR A O    1 
ATOM   119  C CB   A THR A 1 9   ? 21.719  8.701   2.942  0.56 15.10  ? 9    THR A CB   1 
ATOM   120  C CB   B THR A 1 9   ? 21.177  8.607   2.739  0.44 13.82  ? 9    THR A CB   1 
ATOM   121  O OG1  A THR A 1 9   ? 22.359  9.369   1.824  0.56 16.09  ? 9    THR A OG1  1 
ATOM   122  O OG1  B THR A 1 9   ? 19.891  8.034   2.263  0.44 13.93  ? 9    THR A OG1  1 
ATOM   123  C CG2  A THR A 1 9   ? 20.774  7.628   2.327  0.56 22.24  ? 9    THR A CG2  1 
ATOM   124  C CG2  B THR A 1 9   ? 22.149  7.553   3.149  0.44 17.40  ? 9    THR A CG2  1 
ATOM   125  H H    . THR A 1 9   ? 22.550  10.407  4.864  1.00 13.91  ? 9    THR A H    1 
ATOM   126  H HA   A THR A 1 9   ? 20.229  10.105  3.344  1.00 13.92  ? 9    THR A HA   1 
ATOM   127  H HB   A THR A 1 9   ? 22.405  8.250   3.477  0.56 18.12  ? 9    THR A HB   1 
ATOM   128  H HB   B THR A 1 9   ? 21.576  9.074   1.975  0.44 16.58  ? 9    THR A HB   1 
ATOM   129  H HG1  A THR A 1 9   ? 22.085  9.050   1.120  0.56 24.14  ? 9    THR A HG1  1 
ATOM   130  H HG1  B THR A 1 9   ? 19.914  7.217   2.331  0.44 20.89  ? 9    THR A HG1  1 
ATOM   131  H HG21 A THR A 1 9   ? 21.283  7.035   1.770  0.56 33.36  ? 9    THR A HG21 1 
ATOM   132  H HG21 B THR A 1 9   ? 22.267  6.929   2.429  0.44 26.11  ? 9    THR A HG21 1 
ATOM   133  H HG22 A THR A 1 9   ? 20.357  7.127   3.032  0.56 33.36  ? 9    THR A HG22 1 
ATOM   134  H HG22 B THR A 1 9   ? 22.992  7.960   3.360  0.44 26.11  ? 9    THR A HG22 1 
ATOM   135  H HG23 A THR A 1 9   ? 20.098  8.061   1.800  0.56 33.36  ? 9    THR A HG23 1 
ATOM   136  H HG23 B THR A 1 9   ? 21.814  7.091   3.921  0.44 26.11  ? 9    THR A HG23 1 
ATOM   137  N N    . PRO A 1 10  ? 19.112  8.885   5.296  1.00 10.13  ? 10   PRO A N    1 
ATOM   138  C CA   . PRO A 1 10  ? 18.569  8.131   6.435  1.00 10.16  ? 10   PRO A CA   1 
ATOM   139  C C    . PRO A 1 10  ? 18.742  6.644   6.214  1.00 10.55  ? 10   PRO A C    1 
ATOM   140  O O    . PRO A 1 10  ? 18.567  6.159   5.086  1.00 11.96  ? 10   PRO A O    1 
ATOM   141  C CB   . PRO A 1 10  ? 17.100  8.515   6.493  1.00 10.84  ? 10   PRO A CB   1 
ATOM   142  C CG   . PRO A 1 10  ? 16.777  8.959   5.031  1.00 11.52  ? 10   PRO A CG   1 
ATOM   143  C CD   . PRO A 1 10  ? 18.046  9.553   4.519  1.00 10.90  ? 10   PRO A CD   1 
ATOM   144  H HA   . PRO A 1 10  ? 19.019  8.402   7.262  1.00 12.19  ? 10   PRO A HA   1 
ATOM   145  H HB2  . PRO A 1 10  ? 16.553  7.758   6.756  1.00 13.01  ? 10   PRO A HB2  1 
ATOM   146  H HB3  . PRO A 1 10  ? 16.955  9.242   7.118  1.00 13.01  ? 10   PRO A HB3  1 
ATOM   147  H HG2  . PRO A 1 10  ? 16.512  8.198   4.491  1.00 13.82  ? 10   PRO A HG2  1 
ATOM   148  H HG3  . PRO A 1 10  ? 16.062  9.615   5.021  1.00 13.82  ? 10   PRO A HG3  1 
ATOM   149  H HD2  . PRO A 1 10  ? 18.150  9.379   3.570  1.00 13.09  ? 10   PRO A HD2  1 
ATOM   150  H HD3  . PRO A 1 10  ? 18.061  10.512  4.665  1.00 13.09  ? 10   PRO A HD3  1 
ATOM   151  N N    . THR A 1 11  ? 18.964  5.897   7.297  1.00 10.92  ? 11   THR A N    1 
ATOM   152  C CA   . THR A 1 11  ? 18.833  4.430   7.305  1.00 11.54  ? 11   THR A CA   1 
ATOM   153  C C    . THR A 1 11  ? 17.390  4.035   7.360  1.00 11.69  ? 11   THR A C    1 
ATOM   154  O O    . THR A 1 11  ? 16.477  4.876   7.359  1.00 11.66  ? 11   THR A O    1 
ATOM   155  C CB   . THR A 1 11  ? 19.677  3.843   8.445  1.00 12.91  ? 11   THR A CB   1 
ATOM   156  O OG1  . THR A 1 11  ? 19.127  4.307   9.685  1.00 12.86  ? 11   THR A OG1  1 
ATOM   157  C CG2  . THR A 1 11  ? 21.150  4.259   8.339  1.00 15.67  ? 11   THR A CG2  1 
ATOM   158  H H    . THR A 1 11  ? 19.194  6.291   8.025  1.00 13.11  ? 11   THR A H    1 
ATOM   159  H HA   . THR A 1 11  ? 19.200  4.094   6.460  1.00 13.85  ? 11   THR A HA   1 
ATOM   160  H HB   . THR A 1 11  ? 19.619  2.865   8.415  1.00 15.49  ? 11   THR A HB   1 
ATOM   161  H HG1  . THR A 1 11  ? 18.340  4.080   9.736  1.00 19.30  ? 11   THR A HG1  1 
ATOM   162  H HG21 . THR A 1 11  ? 21.644  3.874   9.067  1.00 23.51  ? 11   THR A HG21 1 
ATOM   163  H HG22 . THR A 1 11  ? 21.512  3.948   7.506  1.00 23.51  ? 11   THR A HG22 1 
ATOM   164  H HG23 . THR A 1 11  ? 21.215  5.216   8.379  1.00 23.51  ? 11   THR A HG23 1 
ATOM   165  N N    . ALA A 1 12  ? 17.074  2.708   7.469  1.00 13.33  ? 12   ALA A N    1 
ATOM   166  C CA   . ALA A 1 12  ? 15.690  2.293   7.497  1.00 15.10  ? 12   ALA A CA   1 
ATOM   167  C C    . ALA A 1 12  ? 14.934  3.014   8.661  1.00 13.30  ? 12   ALA A C    1 
ATOM   168  O O    . ALA A 1 12  ? 15.464  3.169   9.780  1.00 14.02  ? 12   ALA A O    1 
ATOM   169  C CB   . ALA A 1 12  ? 15.583  0.742   7.796  1.00 17.98  ? 12   ALA A CB   1 
ATOM   170  H H    . ALA A 1 12  ? 17.699  2.120   7.521  1.00 15.99  ? 12   ALA A H    1 
ATOM   171  H HA   . ALA A 1 12  ? 15.261  2.500   6.641  1.00 18.12  ? 12   ALA A HA   1 
ATOM   172  H HB1  . ALA A 1 12  ? 16.037  0.251   7.107  1.00 26.97  ? 12   ALA A HB1  1 
ATOM   173  H HB2  . ALA A 1 12  ? 15.987  0.551   8.645  1.00 26.97  ? 12   ALA A HB2  1 
ATOM   174  H HB3  . ALA A 1 12  ? 14.658  0.483   7.816  1.00 26.97  ? 12   ALA A HB3  1 
ATOM   175  N N    . ASN A 1 13  ? 13.729  3.448   8.379  1.00 14.32  ? 13   ASN A N    1 
ATOM   176  C CA   . ASN A 1 13  ? 12.870  4.167   9.258  1.00 15.07  ? 13   ASN A CA   1 
ATOM   177  C C    . ASN A 1 13  ? 13.448  5.486   9.730  1.00 13.15  ? 13   ASN A C    1 
ATOM   178  O O    . ASN A 1 13  ? 12.899  6.135   10.659 1.00 15.70  ? 13   ASN A O    1 
ATOM   179  C CB   . ASN A 1 13  ? 12.451  3.361   10.475 1.00 17.97  ? 13   ASN A CB   1 
ATOM   180  C CG   . ASN A 1 13  ? 11.689  2.130   10.074 1.00 27.03  ? 13   ASN A CG   1 
ATOM   181  O OD1  . ASN A 1 13  ? 12.260  0.979   10.303 1.00 40.94  ? 13   ASN A OD1  1 
ATOM   182  N ND2  . ASN A 1 13  ? 10.687  2.253   9.349  1.00 26.80  ? 13   ASN A ND2  1 
ATOM   183  H H    . ASN A 1 13  ? 13.430  3.285   7.589  1.00 17.18  ? 13   ASN A H    1 
ATOM   184  H HA   . ASN A 1 13  ? 12.054  4.374   8.757  1.00 18.08  ? 13   ASN A HA   1 
ATOM   185  H HB2  . ASN A 1 13  ? 13.239  3.103   10.978 1.00 21.56  ? 13   ASN A HB2  1 
ATOM   186  H HB3  . ASN A 1 13  ? 11.895  3.911   11.050 1.00 21.56  ? 13   ASN A HB3  1 
ATOM   187  H HD21 . ASN A 1 13  ? 10.340  3.030   9.224  1.00 32.16  ? 13   ASN A HD21 1 
ATOM   188  H HD22 . ASN A 1 13  ? 10.340  1.561   8.974  1.00 32.16  ? 13   ASN A HD22 1 
ATOM   189  N N    . ASP A 1 14  ? 14.499  6.018   9.075  1.00 11.05  ? 14   ASP A N    1 
ATOM   190  C CA   . ASP A 1 14  ? 15.165  7.233   9.514  1.00 10.63  ? 14   ASP A CA   1 
ATOM   191  C C    . ASP A 1 14  ? 15.690  7.089   10.967 1.00 10.11  ? 14   ASP A C    1 
ATOM   192  O O    . ASP A 1 14  ? 15.720  8.034   11.752 1.00 10.65  ? 14   ASP A O    1 
ATOM   193  C CB   . ASP A 1 14  ? 14.291  8.481   9.437  1.00 11.51  ? 14   ASP A CB   1 
ATOM   194  C CG   . ASP A 1 14  ? 13.473  8.698   8.166  1.00 10.66  ? 14   ASP A CG   1 
ATOM   195  O OD1  . ASP A 1 14  ? 13.863  8.269   7.058  1.00 11.64  ? 14   ASP A OD1  1 
ATOM   196  O OD2  . ASP A 1 14  ? 12.433  9.406   8.337  1.00 11.70  ? 14   ASP A OD2  1 
ATOM   197  H H    . ASP A 1 14  ? 14.786  5.623   8.367  1.00 13.26  ? 14   ASP A H    1 
ATOM   198  H HA   . ASP A 1 14  ? 15.940  7.375   8.931  1.00 12.76  ? 14   ASP A HA   1 
ATOM   199  H HB2  . ASP A 1 14  ? 13.676  8.460   10.187 1.00 13.81  ? 14   ASP A HB2  1 
ATOM   200  H HB3  . ASP A 1 14  ? 14.864  9.254   9.558  1.00 13.81  ? 14   ASP A HB3  1 
ATOM   201  N N    . GLU A 1 15  ? 16.244  5.900   11.265 1.00 10.71  ? 15   GLU A N    1 
ATOM   202  C CA   . GLU A 1 15  ? 16.810  5.683   12.610 1.00 10.44  ? 15   GLU A CA   1 
ATOM   203  C C    . GLU A 1 15  ? 18.029  6.564   12.880 1.00 10.21  ? 15   GLU A C    1 
ATOM   204  O O    . GLU A 1 15  ? 18.234  7.084   13.987 1.00 10.54  ? 15   GLU A O    1 
ATOM   205  C CB   . GLU A 1 15  ? 17.142  4.195   12.803 1.00 11.58  ? 15   GLU A CB   1 
ATOM   206  C CG   . GLU A 1 15  ? 17.565  3.875   14.203 1.00 13.84  ? 15   GLU A CG   1 
ATOM   207  C CD   . GLU A 1 15  ? 17.820  2.410   14.465 1.00 20.72  ? 15   GLU A CD   1 
ATOM   208  O OE1  . GLU A 1 15  ? 17.922  1.631   13.491 1.00 38.78  ? 15   GLU A OE1  1 
ATOM   209  O OE2  . GLU A 1 15  ? 17.992  2.063   15.640 1.00 24.53  ? 15   GLU A OE2  1 
ATOM   210  H H    . GLU A 1 15  ? 16.268  5.272   10.678 1.00 12.85  ? 15   GLU A H    1 
ATOM   211  H HA   . GLU A 1 15  ? 16.120  5.921   13.265 1.00 12.53  ? 15   GLU A HA   1 
ATOM   212  H HB2  . GLU A 1 15  ? 16.361  3.665   12.578 1.00 13.90  ? 15   GLU A HB2  1 
ATOM   213  H HB3  . GLU A 1 15  ? 17.854  3.948   12.192 1.00 13.90  ? 15   GLU A HB3  1 
ATOM   214  H HG2  . GLU A 1 15  ? 18.374  4.371   14.403 1.00 16.61  ? 15   GLU A HG2  1 
ATOM   215  H HG3  . GLU A 1 15  ? 16.875  4.183   14.812 1.00 16.61  ? 15   GLU A HG3  1 
ATOM   216  N N    . GLU A 1 16  ? 18.870  6.684   11.849 1.00 10.24  ? 16   GLU A N    1 
ATOM   217  C CA   . GLU A 1 16  ? 20.051  7.523   11.902 1.00 10.92  ? 16   GLU A CA   1 
ATOM   218  C C    . GLU A 1 16  ? 20.277  8.070   10.473 1.00 10.02  ? 16   GLU A C    1 
ATOM   219  O O    . GLU A 1 16  ? 19.699  7.539   9.507  1.00 11.22  ? 16   GLU A O    1 
ATOM   220  C CB   A GLU A 1 16  ? 21.373  6.662   12.118 0.42 14.12  ? 16   GLU A CB   1 
ATOM   221  C CB   B GLU A 1 16  ? 21.193  6.925   12.627 0.58 12.19  ? 16   GLU A CB   1 
ATOM   222  C CG   A GLU A 1 16  ? 21.520  5.735   13.206 0.42 16.14  ? 16   GLU A CG   1 
ATOM   223  C CG   B GLU A 1 16  ? 21.708  5.797   11.698 0.58 11.78  ? 16   GLU A CG   1 
ATOM   224  C CD   A GLU A 1 16  ? 22.286  4.559   13.103 0.42 23.98  ? 16   GLU A CD   1 
ATOM   225  C CD   B GLU A 1 16  ? 22.694  4.958   12.389 0.58 19.35  ? 16   GLU A CD   1 
ATOM   226  O OE1  A GLU A 1 16  ? 22.907  3.883   12.027 0.42 19.35  ? 16   GLU A OE1  1 
ATOM   227  O OE1  B GLU A 1 16  ? 22.241  4.416   13.544 0.58 30.16  ? 16   GLU A OE1  1 
ATOM   228  O OE2  A GLU A 1 16  ? 22.631  4.122   14.402 0.42 27.25  ? 16   GLU A OE2  1 
ATOM   229  O OE2  B GLU A 1 16  ? 23.840  4.845   12.319 0.58 28.78  ? 16   GLU A OE2  1 
ATOM   230  H H    . GLU A 1 16  ? 18.705  6.248   11.127 1.00 12.29  ? 16   GLU A H    1 
ATOM   231  H HA   A GLU A 1 16  ? 19.965  8.241   12.563 1.00 13.11  ? 16   GLU A HA   1 
ATOM   232  H HB2  A GLU A 1 16  ? 21.515  6.159   11.301 0.42 16.95  ? 16   GLU A HB2  1 
ATOM   233  H HB2  B GLU A 1 16  ? 21.886  7.586   12.783 0.58 14.62  ? 16   GLU A HB2  1 
ATOM   234  H HB3  A GLU A 1 16  ? 22.108  7.292   12.188 0.42 16.95  ? 16   GLU A HB3  1 
ATOM   235  H HB3  B GLU A 1 16  ? 20.908  6.564   13.481 0.58 14.62  ? 16   GLU A HB3  1 
ATOM   236  H HG2  A GLU A 1 16  ? 21.881  6.237   13.953 0.42 19.37  ? 16   GLU A HG2  1 
ATOM   237  H HG2  B GLU A 1 16  ? 20.962  5.248   11.411 0.58 14.14  ? 16   GLU A HG2  1 
ATOM   238  H HG3  A GLU A 1 16  ? 20.625  5.462   13.462 0.42 19.37  ? 16   GLU A HG3  1 
ATOM   239  H HG3  B GLU A 1 16  ? 22.114  6.188   10.908 0.58 14.14  ? 16   GLU A HG3  1 
ATOM   240  N N    . TYR A 1 17  ? 21.134  9.051   10.374 1.00 10.34  ? 17   TYR A N    1 
ATOM   241  C CA   . TYR A 1 17  ? 21.503  9.677   9.099  1.00 11.11  ? 17   TYR A CA   1 
ATOM   242  C C    . TYR A 1 17  ? 23.019  9.525   8.897  1.00 12.54  ? 17   TYR A C    1 
ATOM   243  O O    . TYR A 1 17  ? 23.785  9.757   9.846  1.00 15.20  ? 17   TYR A O    1 
ATOM   244  C CB   . TYR A 1 17  ? 21.070  11.143  9.057  1.00 11.82  ? 17   TYR A CB   1 
ATOM   245  C CG   . TYR A 1 17  ? 19.577  11.308  9.001  1.00 10.20  ? 17   TYR A CG   1 
ATOM   246  C CD1  . TYR A 1 17  ? 18.795  11.096  10.136 1.00 10.31  ? 17   TYR A CD1  1 
ATOM   247  C CD2  . TYR A 1 17  ? 18.944  11.637  7.803  1.00 10.57  ? 17   TYR A CD2  1 
ATOM   248  C CE1  . TYR A 1 17  ? 17.405  11.206  10.052 1.00 10.62  ? 17   TYR A CE1  1 
ATOM   249  C CE2  . TYR A 1 17  ? 17.570  11.775  7.735  1.00 9.84   ? 17   TYR A CE2  1 
ATOM   250  C CZ   . TYR A 1 17  ? 16.804  11.554  8.862  1.00 10.04  ? 17   TYR A CZ   1 
ATOM   251  O OH   . TYR A 1 17  ? 15.433  11.662  8.844  1.00 11.72  ? 17   TYR A OH   1 
ATOM   252  H H    . TYR A 1 17  ? 21.501  9.344   11.094 1.00 12.41  ? 17   TYR A H    1 
ATOM   253  H HA   . TYR A 1 17  ? 21.045  9.199   8.376  1.00 13.34  ? 17   TYR A HA   1 
ATOM   254  H HB2  . TYR A 1 17  ? 21.409  11.596  9.844  1.00 14.18  ? 17   TYR A HB2  1 
ATOM   255  H HB3  . TYR A 1 17  ? 21.464  11.567  8.278  1.00 14.18  ? 17   TYR A HB3  1 
ATOM   256  H HD1  . TYR A 1 17  ? 19.199  10.883  10.947 1.00 12.37  ? 17   TYR A HD1  1 
ATOM   257  H HD2  . TYR A 1 17  ? 19.455  11.766  7.037  1.00 12.68  ? 17   TYR A HD2  1 
ATOM   258  H HE1  . TYR A 1 17  ? 16.882  11.043  10.804 1.00 12.74  ? 17   TYR A HE1  1 
ATOM   259  H HE2  . TYR A 1 17  ? 17.165  12.016  6.934  1.00 11.81  ? 17   TYR A HE2  1 
ATOM   260  H HH   . TYR A 1 17  ? 15.186  11.871  8.090  1.00 17.58  ? 17   TYR A HH   1 
ATOM   261  N N    . ILE A 1 18  ? 23.408  9.108   7.734  1.00 11.48  ? 18   ILE A N    1 
ATOM   262  C CA   . ILE A 1 18  ? 24.809  8.787   7.408  1.00 11.68  ? 18   ILE A CA   1 
ATOM   263  C C    . ILE A 1 18  ? 25.327  9.712   6.302  1.00 10.33  ? 18   ILE A C    1 
ATOM   264  O O    . ILE A 1 18  ? 24.600  9.988   5.321  1.00 11.37  ? 18   ILE A O    1 
ATOM   265  C CB   . ILE A 1 18  ? 24.868  7.298   6.960  1.00 17.13  ? 18   ILE A CB   1 
ATOM   266  C CG1  . ILE A 1 18  ? 24.200  6.444   7.974  1.00 21.02  ? 18   ILE A CG1  1 
ATOM   267  C CG2  . ILE A 1 18  ? 26.153  6.909   6.470  1.00 19.54  ? 18   ILE A CG2  1 
ATOM   268  C CD1  . ILE A 1 18  ? 24.909  6.410   9.167  1.00 26.79  ? 18   ILE A CD1  1 
ATOM   269  H H    . ILE A 1 18  ? 22.815  9.014   7.118  1.00 13.77  ? 18   ILE A H    1 
ATOM   270  H HA   . ILE A 1 18  ? 25.361  8.903   8.209  1.00 14.01  ? 18   ILE A HA   1 
ATOM   271  H HB   . ILE A 1 18  ? 24.282  7.254   6.175  1.00 20.56  ? 18   ILE A HB   1 
ATOM   272  H HG12 . ILE A 1 18  ? 23.308  6.786   8.141  1.00 25.22  ? 18   ILE A HG12 1 
ATOM   273  H HG13 . ILE A 1 18  ? 24.114  5.543   7.626  1.00 25.22  ? 18   ILE A HG13 1 
ATOM   274  H HG21 . ILE A 1 18  ? 26.454  7.548   5.820  1.00 29.31  ? 18   ILE A HG21 1 
ATOM   275  H HG22 . ILE A 1 18  ? 26.777  6.876   7.199  1.00 29.31  ? 18   ILE A HG22 1 
ATOM   276  H HG23 . ILE A 1 18  ? 26.091  6.042   6.062  1.00 29.31  ? 18   ILE A HG23 1 
ATOM   277  H HD11 . ILE A 1 18  ? 24.458  5.835   9.790  1.00 40.18  ? 18   ILE A HD11 1 
ATOM   278  H HD12 . ILE A 1 18  ? 25.793  6.074   9.004  1.00 40.18  ? 18   ILE A HD12 1 
ATOM   279  H HD13 . ILE A 1 18  ? 24.965  7.296   9.532  1.00 40.18  ? 18   ILE A HD13 1 
ATOM   280  N N    . THR A 1 19  ? 26.570  10.142  6.452  1.00 10.14  ? 19   THR A N    1 
ATOM   281  C CA   . THR A 1 19  ? 27.218  11.090  5.551  1.00 10.09  ? 19   THR A CA   1 
ATOM   282  C C    . THR A 1 19  ? 28.640  10.596  5.308  1.00 9.73   ? 19   THR A C    1 
ATOM   283  O O    . THR A 1 19  ? 29.349  10.274  6.274  1.00 10.28  ? 19   THR A O    1 
ATOM   284  C CB   . THR A 1 19  ? 27.246  12.492  6.160  1.00 11.36  ? 19   THR A CB   1 
ATOM   285  O OG1  . THR A 1 19  ? 25.841  12.886  6.499  1.00 12.95  ? 19   THR A OG1  1 
ATOM   286  C CG2  . THR A 1 19  ? 27.814  13.502  5.292  1.00 13.70  ? 19   THR A CG2  1 
ATOM   287  H H    . THR A 1 19  ? 27.022  9.846   7.120  1.00 12.17  ? 19   THR A H    1 
ATOM   288  H HA   . THR A 1 19  ? 26.732  11.115  4.700  1.00 12.11  ? 19   THR A HA   1 
ATOM   289  H HB   . THR A 1 19  ? 27.770  12.461  6.987  1.00 13.63  ? 19   THR A HB   1 
ATOM   290  H HG1  . THR A 1 19  ? 25.509  12.320  6.990  1.00 19.42  ? 19   THR A HG1  1 
ATOM   291  H HG21 . THR A 1 19  ? 28.721  13.270  5.081  1.00 20.54  ? 19   THR A HG21 1 
ATOM   292  H HG22 . THR A 1 19  ? 27.301  13.554  4.482  1.00 20.54  ? 19   THR A HG22 1 
ATOM   293  H HG23 . THR A 1 19  ? 27.796  14.353  5.737  1.00 20.54  ? 19   THR A HG23 1 
ATOM   294  N N    . PRO A 1 20  ? 29.139  10.578  4.045  1.00 9.84   ? 20   PRO A N    1 
ATOM   295  C CA   . PRO A 1 20  ? 30.517  10.101  3.802  1.00 9.89   ? 20   PRO A CA   1 
ATOM   296  C C    . PRO A 1 20  ? 31.541  11.154  4.204  1.00 9.81   ? 20   PRO A C    1 
ATOM   297  O O    . PRO A 1 20  ? 31.348  12.377  4.007  1.00 11.12  ? 20   PRO A O    1 
ATOM   298  C CB   . PRO A 1 20  ? 30.533  9.815   2.272  1.00 11.62  ? 20   PRO A CB   1 
ATOM   299  C CG   . PRO A 1 20  ? 29.474  10.740  1.745  1.00 11.41  ? 20   PRO A CG   1 
ATOM   300  C CD   . PRO A 1 20  ? 28.401  10.874  2.782  1.00 11.24  ? 20   PRO A CD   1 
ATOM   301  H HA   . PRO A 1 20  ? 30.677  9.272   4.299  1.00 11.87  ? 20   PRO A HA   1 
ATOM   302  H HB2  . PRO A 1 20  ? 31.400  10.018  1.886  1.00 13.95  ? 20   PRO A HB2  1 
ATOM   303  H HB3  . PRO A 1 20  ? 30.313  8.889   2.086  1.00 13.95  ? 20   PRO A HB3  1 
ATOM   304  H HG2  . PRO A 1 20  ? 29.860  11.610  1.553  1.00 13.69  ? 20   PRO A HG2  1 
ATOM   305  H HG3  . PRO A 1 20  ? 29.100  10.384  0.925  1.00 13.69  ? 20   PRO A HG3  1 
ATOM   306  H HD2  . PRO A 1 20  ? 28.031  11.771  2.792  1.00 13.49  ? 20   PRO A HD2  1 
ATOM   307  H HD3  . PRO A 1 20  ? 27.686  10.235  2.633  1.00 13.49  ? 20   PRO A HD3  1 
ATOM   308  N N    . VAL A 1 21  ? 32.686  10.683  4.713  1.00 9.20   ? 21   VAL A N    1 
ATOM   309  C CA   . VAL A 1 21  ? 33.803  11.510  5.185  1.00 9.69   ? 21   VAL A CA   1 
ATOM   310  C C    . VAL A 1 21  ? 35.089  10.807  4.750  1.00 9.54   ? 21   VAL A C    1 
ATOM   311  O O    . VAL A 1 21  ? 35.233  9.595   4.994  1.00 10.06  ? 21   VAL A O    1 
ATOM   312  C CB   . VAL A 1 21  ? 33.772  11.600  6.729  1.00 10.16  ? 21   VAL A CB   1 
ATOM   313  C CG1  . VAL A 1 21  ? 34.941  12.414  7.252  1.00 11.38  ? 21   VAL A CG1  1 
ATOM   314  C CG2  . VAL A 1 21  ? 32.437  12.187  7.206  1.00 11.03  ? 21   VAL A CG2  1 
ATOM   315  H H    . VAL A 1 21  ? 32.773  9.829   4.768  1.00 11.04  ? 21   VAL A H    1 
ATOM   316  H HA   . VAL A 1 21  ? 33.754  12.406  4.790  1.00 11.63  ? 21   VAL A HA   1 
ATOM   317  H HB   . VAL A 1 21  ? 33.850  10.691  7.088  1.00 12.19  ? 21   VAL A HB   1 
ATOM   318  H HG11 . VAL A 1 21  ? 35.763  12.030  6.941  1.00 17.07  ? 21   VAL A HG11 1 
ATOM   319  H HG12 . VAL A 1 21  ? 34.869  13.317  6.935  1.00 17.07  ? 21   VAL A HG12 1 
ATOM   320  H HG13 . VAL A 1 21  ? 34.929  12.410  8.212  1.00 17.07  ? 21   VAL A HG13 1 
ATOM   321  H HG21 . VAL A 1 21  ? 32.352  13.089  6.888  1.00 16.54  ? 21   VAL A HG21 1 
ATOM   322  H HG22 . VAL A 1 21  ? 31.713  11.657  6.863  1.00 16.54  ? 21   VAL A HG22 1 
ATOM   323  H HG23 . VAL A 1 21  ? 32.409  12.183  8.165  1.00 16.54  ? 21   VAL A HG23 1 
ATOM   324  N N    . THR A 1 22  ? 36.015  11.551  4.132  1.00 9.66   ? 22   THR A N    1 
ATOM   325  C CA   . THR A 1 22  ? 37.285  10.935  3.710  1.00 9.49   ? 22   THR A CA   1 
ATOM   326  C C    . THR A 1 22  ? 38.367  11.267  4.697  1.00 10.11  ? 22   THR A C    1 
ATOM   327  O O    . THR A 1 22  ? 38.656  12.459  4.926  1.00 11.70  ? 22   THR A O    1 
ATOM   328  C CB   . THR A 1 22  ? 37.617  11.334  2.257  1.00 10.95  ? 22   THR A CB   1 
ATOM   329  O OG1  . THR A 1 22  ? 36.531  10.857  1.410  1.00 12.10  ? 22   THR A OG1  1 
ATOM   330  C CG2  . THR A 1 22  ? 38.923  10.709  1.780  1.00 13.13  ? 22   THR A CG2  1 
ATOM   331  H H    . THR A 1 22  ? 35.869  12.385  3.983  1.00 11.59  ? 22   THR A H    1 
ATOM   332  H HA   . THR A 1 22  ? 37.160  9.963   3.727  1.00 11.39  ? 22   THR A HA   1 
ATOM   333  H HB   . THR A 1 22  ? 37.679  12.310  2.191  1.00 13.14  ? 22   THR A HB   1 
ATOM   334  H HG1  . THR A 1 22  ? 36.830  10.346  0.843  1.00 18.14  ? 22   THR A HG1  1 
ATOM   335  H HG21 . THR A 1 22  ? 39.096  10.981  0.875  1.00 19.69  ? 22   THR A HG21 1 
ATOM   336  H HG22 . THR A 1 22  ? 39.643  11.000  2.344  1.00 19.69  ? 22   THR A HG22 1 
ATOM   337  H HG23 . THR A 1 22  ? 38.853  9.752   1.818  1.00 19.69  ? 22   THR A HG23 1 
ATOM   338  N N    . ILE A 1 23  ? 38.989  10.233  5.265  1.00 10.55  ? 23   ILE A N    1 
ATOM   339  C CA   . ILE A 1 23  ? 40.033  10.390  6.320  1.00 11.21  ? 23   ILE A CA   1 
ATOM   340  C C    . ILE A 1 23  ? 41.287  9.714   5.839  1.00 13.33  ? 23   ILE A C    1 
ATOM   341  O O    . ILE A 1 23  ? 41.302  8.506   5.585  1.00 14.33  ? 23   ILE A O    1 
ATOM   342  C CB   . ILE A 1 23  ? 39.569  9.778   7.617  1.00 13.38  ? 23   ILE A CB   1 
ATOM   343  C CG1  A ILE A 1 23  ? 38.279  10.314  8.178  0.34 15.03  ? 23   ILE A CG1  1 
ATOM   344  C CG1  B ILE A 1 23  ? 38.232  10.358  8.004  0.67 12.39  ? 23   ILE A CG1  1 
ATOM   345  C CG2  . ILE A 1 23  ? 40.638  10.002  8.658  1.00 15.93  ? 23   ILE A CG2  1 
ATOM   346  C CD1  A ILE A 1 23  ? 37.262  9.425   8.611  0.34 20.78  ? 23   ILE A CD1  1 
ATOM   347  C CD1  B ILE A 1 23  ? 37.713  9.972   9.361  0.67 17.84  ? 23   ILE A CD1  1 
ATOM   348  H H    . ILE A 1 23  ? 38.779  9.438   5.012  1.00 12.65  ? 23   ILE A H    1 
ATOM   349  H HA   . ILE A 1 23  ? 40.212  11.344  6.458  1.00 13.45  ? 23   ILE A HA   1 
ATOM   350  H HB   A ILE A 1 23  ? 39.468  8.812   7.483  1.00 16.05  ? 23   ILE A HB   1 
ATOM   351  H HG12 A ILE A 1 23  ? 38.507  10.879  8.933  0.34 18.03  ? 23   ILE A HG12 1 
ATOM   352  H HG12 B ILE A 1 23  ? 38.298  11.325  7.967  0.67 14.86  ? 23   ILE A HG12 1 
ATOM   353  H HG13 A ILE A 1 23  ? 37.889  10.890  7.502  0.34 18.03  ? 23   ILE A HG13 1 
ATOM   354  H HG13 B ILE A 1 23  ? 37.579  10.086  7.340  0.67 14.86  ? 23   ILE A HG13 1 
ATOM   355  H HG21 . ILE A 1 23  ? 40.358  9.618   9.492  1.00 23.90  ? 23   ILE A HG21 1 
ATOM   356  H HG22 . ILE A 1 23  ? 40.782  10.944  8.772  1.00 23.90  ? 23   ILE A HG22 1 
ATOM   357  H HG23 . ILE A 1 23  ? 41.455  9.586   8.372  1.00 23.90  ? 23   ILE A HG23 1 
ATOM   358  H HD11 A ILE A 1 23  ? 36.506  9.930   8.919  0.34 31.16  ? 23   ILE A HD11 1 
ATOM   359  H HD11 B ILE A 1 23  ? 36.859  10.387  9.506  0.67 26.77  ? 23   ILE A HD11 1 
ATOM   360  H HD12 A ILE A 1 23  ? 36.995  8.863   7.879  0.34 31.16  ? 23   ILE A HD12 1 
ATOM   361  H HD12 B ILE A 1 23  ? 37.617  9.018   9.407  0.67 26.77  ? 23   ILE A HD12 1 
ATOM   362  H HD13 A ILE A 1 23  ? 37.596  8.880   9.327  0.34 31.16  ? 23   ILE A HD13 1 
ATOM   363  H HD13 B ILE A 1 23  ? 38.330  10.265  10.035 0.67 26.77  ? 23   ILE A HD13 1 
ATOM   364  N N    . GLY A 1 24  ? 42.342  10.504  5.645  1.00 16.18  ? 24   GLY A N    1 
ATOM   365  C CA   . GLY A 1 24  ? 43.595  9.916   5.144  1.00 20.85  ? 24   GLY A CA   1 
ATOM   366  C C    . GLY A 1 24  ? 43.374  9.167   3.862  1.00 20.83  ? 24   GLY A C    1 
ATOM   367  O O    . GLY A 1 24  ? 43.955  8.078   3.659  1.00 23.22  ? 24   GLY A O    1 
ATOM   368  H H    . GLY A 1 24  ? 42.292  11.346  5.812  1.00 19.41  ? 24   GLY A H    1 
ATOM   369  H HA2  . GLY A 1 24  ? 44.244  10.622  4.996  1.00 25.02  ? 24   GLY A HA2  1 
ATOM   370  H HA3  . GLY A 1 24  ? 43.956  9.312   5.811  1.00 25.02  ? 24   GLY A HA3  1 
ATOM   371  N N    . GLY A 1 25  ? 42.495  9.662   3.007  1.00 18.74  ? 25   GLY A N    1 
ATOM   372  C CA   . GLY A 1 25  ? 42.224  8.933   1.780  1.00 20.27  ? 25   GLY A CA   1 
ATOM   373  C C    . GLY A 1 25  ? 41.207  7.824   1.759  1.00 15.24  ? 25   GLY A C    1 
ATOM   374  O O    . GLY A 1 25  ? 40.839  7.382   0.658  1.00 17.24  ? 25   GLY A O    1 
ATOM   375  H H    . GLY A 1 25  ? 42.091  10.403  3.174  1.00 22.48  ? 25   GLY A H    1 
ATOM   376  H HA2  . GLY A 1 25  ? 41.953  9.583   1.114  1.00 24.32  ? 25   GLY A HA2  1 
ATOM   377  H HA3  . GLY A 1 25  ? 43.065  8.556   1.479  1.00 24.32  ? 25   GLY A HA3  1 
ATOM   378  N N    . THR A 1 26  ? 40.706  7.345   2.898  1.00 13.50  ? 26   THR A N    1 
ATOM   379  C CA   . THR A 1 26  ? 39.671  6.278   2.998  1.00 12.27  ? 26   THR A CA   1 
ATOM   380  C C    . THR A 1 26  ? 38.334  6.903   3.302  1.00 10.53  ? 26   THR A C    1 
ATOM   381  O O    . THR A 1 26  ? 38.229  7.670   4.307  1.00 11.65  ? 26   THR A O    1 
ATOM   382  C CB   . THR A 1 26  ? 40.055  5.259   4.159  1.00 14.72  ? 26   THR A CB   1 
ATOM   383  O OG1  . THR A 1 26  ? 41.336  4.741   3.882  1.00 18.81  ? 26   THR A OG1  1 
ATOM   384  C CG2  . THR A 1 26  ? 39.051  4.105   4.208  1.00 16.56  ? 26   THR A CG2  1 
ATOM   385  H H    . THR A 1 26  ? 41.004  7.678   3.633  1.00 16.20  ? 26   THR A H    1 
ATOM   386  H HA   . THR A 1 26  ? 39.618  5.796   2.146  1.00 14.72  ? 26   THR A HA   1 
ATOM   387  H HB   . THR A 1 26  ? 40.065  5.726   5.020  1.00 17.66  ? 26   THR A HB   1 
ATOM   388  H HG1  . THR A 1 26  ? 41.291  3.925   3.808  1.00 28.22  ? 26   THR A HG1  1 
ATOM   389  H HG21 . THR A 1 26  ? 38.172  4.452   4.376  1.00 24.84  ? 26   THR A HG21 1 
ATOM   390  H HG22 . THR A 1 26  ? 39.056  3.640   3.368  1.00 24.84  ? 26   THR A HG22 1 
ATOM   391  H HG23 . THR A 1 26  ? 39.294  3.498   4.911  1.00 24.84  ? 26   THR A HG23 1 
ATOM   392  N N    . THR A 1 27  ? 37.278  6.575   2.560  1.00 9.68   ? 27   THR A N    1 
ATOM   393  C CA   . THR A 1 27  ? 35.967  7.138   2.833  1.00 9.20   ? 27   THR A CA   1 
ATOM   394  C C    . THR A 1 27  ? 35.177  6.201   3.782  1.00 9.32   ? 27   THR A C    1 
ATOM   395  O O    . THR A 1 27  ? 35.009  4.998   3.518  1.00 10.50  ? 27   THR A O    1 
ATOM   396  C CB   . THR A 1 27  ? 35.178  7.367   1.526  1.00 9.81   ? 27   THR A CB   1 
ATOM   397  O OG1  . THR A 1 27  ? 35.990  8.203   0.671  1.00 10.48  ? 27   THR A OG1  1 
ATOM   398  C CG2  . THR A 1 27  ? 33.832  7.960   1.771  1.00 10.46  ? 27   THR A CG2  1 
ATOM   399  H H    . THR A 1 27  ? 37.374  6.022   1.908  1.00 11.62  ? 27   THR A H    1 
ATOM   400  H HA   . THR A 1 27  ? 36.087  8.002   3.279  1.00 11.04  ? 27   THR A HA   1 
ATOM   401  H HB   . THR A 1 27  ? 35.057  6.501   1.083  1.00 11.77  ? 27   THR A HB   1 
ATOM   402  H HG1  . THR A 1 27  ? 36.721  7.849   0.556  1.00 15.72  ? 27   THR A HG1  1 
ATOM   403  H HG21 . THR A 1 27  ? 33.318  7.369   2.326  1.00 15.70  ? 27   THR A HG21 1 
ATOM   404  H HG22 . THR A 1 27  ? 33.930  8.808   2.211  1.00 15.70  ? 27   THR A HG22 1 
ATOM   405  H HG23 . THR A 1 27  ? 33.380  8.085   0.933  1.00 15.70  ? 27   THR A HG23 1 
ATOM   406  N N    . LEU A 1 28  ? 34.669  6.791   4.879  1.00 9.23   ? 28   LEU A N    1 
ATOM   407  C CA   . LEU A 1 28  ? 33.849  6.137   5.895  1.00 9.44   ? 28   LEU A CA   1 
ATOM   408  C C    . LEU A 1 28  ? 32.472  6.790   5.898  1.00 9.44   ? 28   LEU A C    1 
ATOM   409  O O    . LEU A 1 28  ? 32.351  7.986   5.653  1.00 10.84  ? 28   LEU A O    1 
ATOM   410  C CB   A LEU A 1 28  ? 34.514  6.233   7.266  0.44 11.28  ? 28   LEU A CB   1 
ATOM   411  C CB   B LEU A 1 28  ? 34.486  6.257   7.308  0.56 9.73   ? 28   LEU A CB   1 
ATOM   412  C CG   A LEU A 1 28  ? 35.934  5.873   7.361  0.44 13.14  ? 28   LEU A CG   1 
ATOM   413  C CG   B LEU A 1 28  ? 35.475  5.076   7.718  0.56 9.88   ? 28   LEU A CG   1 
ATOM   414  C CD1  A LEU A 1 28  ? 36.502  6.218   8.731  0.44 22.83  ? 28   LEU A CD1  1 
ATOM   415  C CD1  B LEU A 1 28  ? 36.670  4.998   6.761  0.56 10.76  ? 28   LEU A CD1  1 
ATOM   416  C CD2  A LEU A 1 28  ? 36.189  4.503   7.008  0.44 22.20  ? 28   LEU A CD2  1 
ATOM   417  C CD2  B LEU A 1 28  ? 35.920  5.218   9.155  0.56 10.19  ? 28   LEU A CD2  1 
ATOM   418  H H    . LEU A 1 28  ? 34.842  7.626   4.991  1.00 11.07  ? 28   LEU A H    1 
ATOM   419  H HA   A LEU A 1 28  ? 33.749  5.191   5.659  1.00 11.33  ? 28   LEU A HA   1 
ATOM   420  H HB2  A LEU A 1 28  ? 34.417  7.145   7.581  0.44 13.54  ? 28   LEU A HB2  1 
ATOM   421  H HB2  B LEU A 1 28  ? 34.974  7.094   7.354  0.56 11.68  ? 28   LEU A HB2  1 
ATOM   422  H HB3  A LEU A 1 28  ? 34.021  5.664   7.877  0.44 13.54  ? 28   LEU A HB3  1 
ATOM   423  H HB3  B LEU A 1 28  ? 33.772  6.300   7.963  0.56 11.68  ? 28   LEU A HB3  1 
ATOM   424  H HG   A LEU A 1 28  ? 36.411  6.427   6.708  0.44 15.77  ? 28   LEU A HG   1 
ATOM   425  H HG   B LEU A 1 28  ? 34.979  4.234   7.642  0.56 11.86  ? 28   LEU A HG   1 
ATOM   426  H HD11 A LEU A 1 28  ? 36.331  7.142   8.924  0.44 34.24  ? 28   LEU A HD11 1 
ATOM   427  H HD11 B LEU A 1 28  ? 36.353  4.913   5.859  0.56 16.14  ? 28   LEU A HD11 1 
ATOM   428  H HD12 A LEU A 1 28  ? 36.083  5.669   9.398  0.44 34.24  ? 28   LEU A HD12 1 
ATOM   429  H HD12 B LEU A 1 28  ? 37.197  5.797   6.842  0.56 16.14  ? 28   LEU A HD12 1 
ATOM   430  H HD13 A LEU A 1 28  ? 37.448  6.060   8.734  0.44 34.24  ? 28   LEU A HD13 1 
ATOM   431  H HD13 B LEU A 1 28  ? 37.210  4.236   6.984  0.56 16.14  ? 28   LEU A HD13 1 
ATOM   432  H HD21 A LEU A 1 28  ? 35.755  3.924   7.639  0.44 33.30  ? 28   LEU A HD21 1 
ATOM   433  H HD21 B LEU A 1 28  ? 36.444  6.016   9.250  0.56 15.29  ? 28   LEU A HD21 1 
ATOM   434  H HD22 A LEU A 1 28  ? 35.848  4.330   6.128  0.44 33.30  ? 28   LEU A HD22 1 
ATOM   435  H HD22 B LEU A 1 28  ? 35.150  5.271   9.725  0.56 15.29  ? 28   LEU A HD22 1 
ATOM   436  H HD23 A LEU A 1 28  ? 37.135  4.339   7.022  0.44 33.30  ? 28   LEU A HD23 1 
ATOM   437  H HD23 B LEU A 1 28  ? 36.450  4.456   9.402  0.56 15.29  ? 28   LEU A HD23 1 
ATOM   438  N N    . ASN A 1 29  ? 31.436  6.000   6.260  1.00 9.50   ? 29   ASN A N    1 
ATOM   439  C CA   . ASN A 1 29  ? 30.097  6.523   6.387  1.00 9.57   ? 29   ASN A CA   1 
ATOM   440  C C    . ASN A 1 29  ? 29.826  6.855   7.865  1.00 9.11   ? 29   ASN A C    1 
ATOM   441  O O    . ASN A 1 29  ? 29.663  5.913   8.673  1.00 10.86  ? 29   ASN A O    1 
ATOM   442  C CB   . ASN A 1 29  ? 29.084  5.519   5.859  1.00 11.05  ? 29   ASN A CB   1 
ATOM   443  C CG   . ASN A 1 29  ? 29.067  5.482   4.311  1.00 11.08  ? 29   ASN A CG   1 
ATOM   444  O OD1  . ASN A 1 29  ? 29.355  6.478   3.654  1.00 14.57  ? 29   ASN A OD1  1 
ATOM   445  N ND2  . ASN A 1 29  ? 28.675  4.346   3.797  1.00 12.72  ? 29   ASN A ND2  1 
ATOM   446  H H    . ASN A 1 29  ? 31.578  5.167   6.419  1.00 11.40  ? 29   ASN A H    1 
ATOM   447  H HA   . ASN A 1 29  ? 30.029  7.347   5.861  1.00 11.49  ? 29   ASN A HA   1 
ATOM   448  H HB2  . ASN A 1 29  ? 29.301  4.636   6.198  1.00 13.26  ? 29   ASN A HB2  1 
ATOM   449  H HB3  . ASN A 1 29  ? 28.201  5.754   6.184  1.00 13.26  ? 29   ASN A HB3  1 
ATOM   450  H HD21 . ASN A 1 29  ? 28.487  3.683   4.312  1.00 15.26  ? 29   ASN A HD21 1 
ATOM   451  H HD22 . ASN A 1 29  ? 28.605  4.260   2.944  1.00 15.26  ? 29   ASN A HD22 1 
ATOM   452  N N    . LEU A 1 30  ? 29.773  8.116   8.242  1.00 9.28   ? 30   LEU A N    1 
ATOM   453  C CA   . LEU A 1 30  ? 29.693  8.526   9.651  1.00 8.98   ? 30   LEU A CA   1 
ATOM   454  C C    . LEU A 1 30  ? 28.319  9.122   9.964  1.00 9.11   ? 30   LEU A C    1 
ATOM   455  O O    . LEU A 1 30  ? 27.628  9.728   9.139  1.00 10.03  ? 30   LEU A O    1 
ATOM   456  C CB   . LEU A 1 30  ? 30.794  9.522   10.029 1.00 9.54   ? 30   LEU A CB   1 
ATOM   457  C CG   . LEU A 1 30  ? 32.223  9.045   9.770  1.00 9.48   ? 30   LEU A CG   1 
ATOM   458  C CD1  . LEU A 1 30  ? 33.227  10.023  10.342 1.00 11.02  ? 30   LEU A CD1  1 
ATOM   459  C CD2  . LEU A 1 30  ? 32.519  7.663   10.360 1.00 10.19  ? 30   LEU A CD2  1 
ATOM   460  H H    . LEU A 1 30  ? 29.786  8.726   7.637  1.00 11.14  ? 30   LEU A H    1 
ATOM   461  H HA   . LEU A 1 30  ? 29.808  7.726   10.205 1.00 10.78  ? 30   LEU A HA   1 
ATOM   462  H HB2  . LEU A 1 30  ? 30.650  10.342  9.532  1.00 11.45  ? 30   LEU A HB2  1 
ATOM   463  H HB3  . LEU A 1 30  ? 30.707  9.732   10.972 1.00 11.45  ? 30   LEU A HB3  1 
ATOM   464  H HG   . LEU A 1 30  ? 32.359  8.999   8.800  1.00 11.38  ? 30   LEU A HG   1 
ATOM   465  H HD11 . LEU A 1 30  ? 33.093  10.101  11.289 1.00 16.53  ? 30   LEU A HD11 1 
ATOM   466  H HD12 . LEU A 1 30  ? 34.116  9.706   10.169 1.00 16.53  ? 30   LEU A HD12 1 
ATOM   467  H HD13 . LEU A 1 30  ? 33.108  10.882  9.930  1.00 16.53  ? 30   LEU A HD13 1 
ATOM   468  H HD21 . LEU A 1 30  ? 32.440  7.700   11.316 1.00 15.29  ? 30   LEU A HD21 1 
ATOM   469  H HD22 . LEU A 1 30  ? 31.893  7.025   10.011 1.00 15.29  ? 30   LEU A HD22 1 
ATOM   470  H HD23 . LEU A 1 30  ? 33.411  7.399   10.123 1.00 15.29  ? 30   LEU A HD23 1 
ATOM   471  N N    . ASN A 1 31  ? 27.940  9.022   11.257 1.00 9.16   ? 31   ASN A N    1 
ATOM   472  C CA   . ASN A 1 31  ? 26.740  9.610   11.809 1.00 9.12   ? 31   ASN A CA   1 
ATOM   473  C C    . ASN A 1 31  ? 27.066  11.002  12.352 1.00 8.83   ? 31   ASN A C    1 
ATOM   474  O O    . ASN A 1 31  ? 27.793  11.113  13.374 1.00 9.93   ? 31   ASN A O    1 
ATOM   475  C CB   . ASN A 1 31  ? 26.170  8.683   12.897 1.00 9.50   ? 31   ASN A CB   1 
ATOM   476  C CG   . ASN A 1 31  ? 24.909  9.154   13.507 1.00 9.80   ? 31   ASN A CG   1 
ATOM   477  O OD1  . ASN A 1 31  ? 24.455  10.259  13.311 1.00 11.66  ? 31   ASN A OD1  1 
ATOM   478  N ND2  . ASN A 1 31  ? 24.347  8.248   14.285 1.00 10.67  ? 31   ASN A ND2  1 
ATOM   479  H H    . ASN A 1 31  ? 28.449  8.577   11.789 1.00 11.00  ? 31   ASN A H    1 
ATOM   480  H HA   . ASN A 1 31  ? 26.076  9.699   11.094 1.00 10.95  ? 31   ASN A HA   1 
ATOM   481  H HB2  . ASN A 1 31  ? 26.018  7.807   12.509 1.00 11.40  ? 31   ASN A HB2  1 
ATOM   482  H HB3  . ASN A 1 31  ? 26.834  8.582   13.597 1.00 11.40  ? 31   ASN A HB3  1 
ATOM   483  H HD21 . ASN A 1 31  ? 24.717  7.479   14.386 1.00 12.80  ? 31   ASN A HD21 1 
ATOM   484  H HD22 . ASN A 1 31  ? 23.610  8.428   14.691 1.00 12.80  ? 31   ASN A HD22 1 
ATOM   485  N N    . PHE A 1 32  ? 26.633  12.081  11.686 1.00 9.24   ? 32   PHE A N    1 
ATOM   486  C CA   . PHE A 1 32  ? 26.888  13.440  12.118 1.00 9.10   ? 32   PHE A CA   1 
ATOM   487  C C    . PHE A 1 32  ? 25.989  13.780  13.310 1.00 9.27   ? 32   PHE A C    1 
ATOM   488  O O    . PHE A 1 32  ? 24.746  13.644  13.208 1.00 10.14  ? 32   PHE A O    1 
ATOM   489  C CB   . PHE A 1 32  ? 26.666  14.463  10.978 1.00 9.25   ? 32   PHE A CB   1 
ATOM   490  C CG   . PHE A 1 32  ? 27.741  14.510  9.943  1.00 8.91   ? 32   PHE A CG   1 
ATOM   491  C CD1  . PHE A 1 32  ? 28.612  13.447  9.662  1.00 9.40   ? 32   PHE A CD1  1 
ATOM   492  C CD2  . PHE A 1 32  ? 27.952  15.707  9.211  1.00 10.11  ? 32   PHE A CD2  1 
ATOM   493  C CE1  . PHE A 1 32  ? 29.548  13.533  8.704  1.00 9.66   ? 32   PHE A CE1  1 
ATOM   494  C CE2  . PHE A 1 32  ? 28.946  15.801  8.256  1.00 11.01  ? 32   PHE A CE2  1 
ATOM   495  C CZ   . PHE A 1 32  ? 29.765  14.713  8.026  1.00 10.90  ? 32   PHE A CZ   1 
ATOM   496  H H    . PHE A 1 32  ? 26.179  11.961  10.965 1.00 11.09  ? 32   PHE A H    1 
ATOM   497  H HA   . PHE A 1 32  ? 27.822  13.501  12.409 1.00 10.91  ? 32   PHE A HA   1 
ATOM   498  H HB2  . PHE A 1 32  ? 25.827  14.256  10.539 1.00 11.10  ? 32   PHE A HB2  1 
ATOM   499  H HB3  . PHE A 1 32  ? 26.580  15.346  11.370 1.00 11.10  ? 32   PHE A HB3  1 
ATOM   500  H HD1  . PHE A 1 32  ? 28.539  12.660  10.154 1.00 11.28  ? 32   PHE A HD1  1 
ATOM   501  H HD2  . PHE A 1 32  ? 27.410  16.444  9.377  1.00 12.13  ? 32   PHE A HD2  1 
ATOM   502  H HE1  . PHE A 1 32  ? 30.058  12.784  8.494  1.00 11.60  ? 32   PHE A HE1  1 
ATOM   503  H HE2  . PHE A 1 32  ? 29.062  16.588  7.774  1.00 13.21  ? 32   PHE A HE2  1 
ATOM   504  H HZ   . PHE A 1 32  ? 30.463  14.777  7.414  1.00 13.08  ? 32   PHE A HZ   1 
ATOM   505  N N    . ASP A 1 33  ? 26.605  14.208  14.416 1.00 8.86   ? 33   ASP A N    1 
ATOM   506  C CA   . ASP A 1 33  ? 25.880  14.224  15.692 1.00 8.42   ? 33   ASP A CA   1 
ATOM   507  C C    . ASP A 1 33  ? 26.075  15.589  16.407 1.00 8.13   ? 33   ASP A C    1 
ATOM   508  O O    . ASP A 1 33  ? 27.120  15.806  17.045 1.00 8.63   ? 33   ASP A O    1 
ATOM   509  C CB   . ASP A 1 33  ? 26.412  13.112  16.585 1.00 8.96   ? 33   ASP A CB   1 
ATOM   510  C CG   . ASP A 1 33  ? 25.713  13.079  17.910 1.00 8.82   ? 33   ASP A CG   1 
ATOM   511  O OD1  . ASP A 1 33  ? 24.690  13.761  18.106 1.00 9.11   ? 33   ASP A OD1  1 
ATOM   512  O OD2  . ASP A 1 33  ? 26.282  12.336  18.828 1.00 9.46   ? 33   ASP A OD2  1 
ATOM   513  H H    . ASP A 1 33  ? 27.422  14.473  14.380 1.00 10.63  ? 33   ASP A H    1 
ATOM   514  H HA   . ASP A 1 33  ? 24.925  14.078  15.526 1.00 10.11  ? 33   ASP A HA   1 
ATOM   515  H HB2  . ASP A 1 33  ? 26.292  12.259  16.139 1.00 10.75  ? 33   ASP A HB2  1 
ATOM   516  H HB3  . ASP A 1 33  ? 27.362  13.243  16.728 1.00 10.75  ? 33   ASP A HB3  1 
ATOM   517  N N    . THR A 1 34  ? 25.064  16.466  16.327 1.00 8.35   ? 34   THR A N    1 
ATOM   518  C CA   . THR A 1 34  ? 25.147  17.770  17.022 1.00 8.28   ? 34   THR A CA   1 
ATOM   519  C C    . THR A 1 34  ? 25.011  17.663  18.546 1.00 8.59   ? 34   THR A C    1 
ATOM   520  O O    . THR A 1 34  ? 25.173  18.709  19.217 1.00 9.00   ? 34   THR A O    1 
ATOM   521  C CB   . THR A 1 34  ? 24.118  18.754  16.428 1.00 8.73   ? 34   THR A CB   1 
ATOM   522  O OG1  . THR A 1 34  ? 22.792  18.248  16.685 1.00 8.54   ? 34   THR A OG1  1 
ATOM   523  C CG2  . THR A 1 34  ? 24.295  18.971  14.949 1.00 9.11   ? 34   THR A CG2  1 
ATOM   524  H H    . THR A 1 34  ? 24.362  16.270  15.870 1.00 10.02  ? 34   THR A H    1 
ATOM   525  H HA   . THR A 1 34  ? 26.037  18.138  16.837 1.00 9.94   ? 34   THR A HA   1 
ATOM   526  H HB   . THR A 1 34  ? 24.215  19.617  16.882 1.00 10.47  ? 34   THR A HB   1 
ATOM   527  H HG1  . THR A 1 34  ? 22.696  18.131  17.491 1.00 12.81  ? 34   THR A HG1  1 
ATOM   528  H HG21 . THR A 1 34  ? 23.633  19.590  14.635 1.00 13.66  ? 34   THR A HG21 1 
ATOM   529  H HG22 . THR A 1 34  ? 25.171  19.327  14.781 1.00 13.66  ? 34   THR A HG22 1 
ATOM   530  H HG23 . THR A 1 34  ? 24.196  18.134  14.489 1.00 13.66  ? 34   THR A HG23 1 
ATOM   531  N N    . GLY A 1 35  ? 24.771  16.459  19.087 1.00 8.44   ? 35   GLY A N    1 
ATOM   532  C CA   . GLY A 1 35  ? 24.730  16.202  20.510 1.00 8.79   ? 35   GLY A CA   1 
ATOM   533  C C    . GLY A 1 35  ? 26.025  15.705  21.158 1.00 8.52   ? 35   GLY A C    1 
ATOM   534  O O    . GLY A 1 35  ? 26.023  15.445  22.374 1.00 9.63   ? 35   GLY A O    1 
ATOM   535  H H    . GLY A 1 35  ? 24.633  15.799  18.554 1.00 10.13  ? 35   GLY A H    1 
ATOM   536  H HA2  . GLY A 1 35  ? 24.464  17.021  20.957 1.00 10.55  ? 35   GLY A HA2  1 
ATOM   537  H HA3  . GLY A 1 35  ? 24.037  15.544  20.678 1.00 10.55  ? 35   GLY A HA3  1 
ATOM   538  N N    . SER A 1 36  ? 27.123  15.554  20.389 1.00 8.50   ? 36   SER A N    1 
ATOM   539  C CA   . SER A 1 36  ? 28.384  15.164  20.992 1.00 8.51   ? 36   SER A CA   1 
ATOM   540  C C    . SER A 1 36  ? 29.505  15.804  20.188 1.00 8.14   ? 36   SER A C    1 
ATOM   541  O O    . SER A 1 36  ? 29.301  16.388  19.114 1.00 8.62   ? 36   SER A O    1 
ATOM   542  C CB   . SER A 1 36  ? 28.554  13.645  21.050 1.00 9.68   ? 36   SER A CB   1 
ATOM   543  O OG   . SER A 1 36  ? 28.731  13.102  19.745 1.00 10.73  ? 36   SER A OG   1 
ATOM   544  H H    . SER A 1 36  ? 27.076  15.689  19.541 1.00 10.20  ? 36   SER A H    1 
ATOM   545  H HA   . SER A 1 36  ? 28.416  15.517  21.906 1.00 10.21  ? 36   SER A HA   1 
ATOM   546  H HB2  . SER A 1 36  ? 29.324  13.426  21.598 1.00 11.62  ? 36   SER A HB2  1 
ATOM   547  H HB3  . SER A 1 36  ? 27.770  13.248  21.461 1.00 11.62  ? 36   SER A HB3  1 
ATOM   548  H HG   . SER A 1 36  ? 28.819  12.289  19.796 1.00 16.10  ? 36   SER A HG   1 
ATOM   549  N N    . ALA A 1 37  ? 30.753  15.723  20.711 1.00 8.40   ? 37   ALA A N    1 
ATOM   550  C CA   . ALA A 1 37  ? 31.879  16.489  20.170 1.00 8.52   ? 37   ALA A CA   1 
ATOM   551  C C    . ALA A 1 37  ? 33.094  15.626  19.828 1.00 8.27   ? 37   ALA A C    1 
ATOM   552  O O    . ALA A 1 37  ? 34.208  16.166  19.731 1.00 9.27   ? 37   ALA A O    1 
ATOM   553  C CB   . ALA A 1 37  ? 32.271  17.649  21.113 1.00 9.28   ? 37   ALA A CB   1 
ATOM   554  H H    . ALA A 1 37  ? 30.889  15.205  21.384 1.00 10.08  ? 37   ALA A H    1 
ATOM   555  H HA   . ALA A 1 37  ? 31.572  16.894  19.332 1.00 10.23  ? 37   ALA A HA   1 
ATOM   556  H HB1  . ALA A 1 37  ? 32.928  18.202  20.685 1.00 13.92  ? 37   ALA A HB1  1 
ATOM   557  H HB2  . ALA A 1 37  ? 31.493  18.174  21.315 1.00 13.92  ? 37   ALA A HB2  1 
ATOM   558  H HB3  . ALA A 1 37  ? 32.635  17.291  21.926 1.00 13.92  ? 37   ALA A HB3  1 
ATOM   559  N N    . ASP A 1 38  ? 32.894  14.342  19.583 1.00 8.87   ? 38   ASP A N    1 
ATOM   560  C CA   . ASP A 1 38  ? 33.971  13.421  19.235 1.00 8.91   ? 38   ASP A CA   1 
ATOM   561  C C    . ASP A 1 38  ? 33.819  12.920  17.792 1.00 8.77   ? 38   ASP A C    1 
ATOM   562  O O    . ASP A 1 38  ? 32.687  12.544  17.390 1.00 9.72   ? 38   ASP A O    1 
ATOM   563  C CB   . ASP A 1 38  ? 34.054  12.218  20.196 1.00 9.30   ? 38   ASP A CB   1 
ATOM   564  C CG   . ASP A 1 38  ? 34.581  12.587  21.600 1.00 9.28   ? 38   ASP A CG   1 
ATOM   565  O OD1  . ASP A 1 38  ? 34.101  13.576  22.208 1.00 10.11  ? 38   ASP A OD1  1 
ATOM   566  O OD2  . ASP A 1 38  ? 35.517  11.902  22.084 1.00 11.06  ? 38   ASP A OD2  1 
ATOM   567  H H    . ASP A 1 38  ? 32.092  14.036  19.630 1.00 10.64  ? 38   ASP A H    1 
ATOM   568  H HA   . ASP A 1 38  ? 34.817  13.912  19.295 1.00 10.69  ? 38   ASP A HA   1 
ATOM   569  H HB2  . ASP A 1 38  ? 33.172  11.825  20.285 1.00 11.16  ? 38   ASP A HB2  1 
ATOM   570  H HB3  . ASP A 1 38  ? 34.638  11.547  19.809 1.00 11.16  ? 38   ASP A HB3  1 
ATOM   571  N N    . LEU A 1 39  ? 34.897  12.899  17.049 1.00 9.04   ? 39   LEU A N    1 
ATOM   572  C CA   . LEU A 1 39  ? 34.998  12.284  15.720 1.00 8.82   ? 39   LEU A CA   1 
ATOM   573  C C    . LEU A 1 39  ? 35.739  10.960  15.961 1.00 8.43   ? 39   LEU A C    1 
ATOM   574  O O    . LEU A 1 39  ? 36.957  10.962  16.157 1.00 9.44   ? 39   LEU A O    1 
ATOM   575  C CB   . LEU A 1 39  ? 35.753  13.185  14.752 1.00 9.34   ? 39   LEU A CB   1 
ATOM   576  C CG   . LEU A 1 39  ? 35.732  12.754  13.286 1.00 12.81  ? 39   LEU A CG   1 
ATOM   577  C CD1  . LEU A 1 39  ? 36.469  13.827  12.439 1.00 16.21  ? 39   LEU A CD1  1 
ATOM   578  C CD2  . LEU A 1 39  ? 36.091  11.424  12.847 1.00 14.25  ? 39   LEU A CD2  1 
ATOM   579  H H    . LEU A 1 39  ? 35.603  13.275  17.365 1.00 10.85  ? 39   LEU A H    1 
ATOM   580  H HA   . LEU A 1 39  ? 34.100  12.101  15.371 1.00 10.58  ? 39   LEU A HA   1 
ATOM   581  H HB2  . LEU A 1 39  ? 35.380  14.078  14.812 1.00 11.21  ? 39   LEU A HB2  1 
ATOM   582  H HB3  . LEU A 1 39  ? 36.678  13.237  15.041 1.00 11.21  ? 39   LEU A HB3  1 
ATOM   583  H HG   . LEU A 1 39  ? 34.792  12.847  13.024 1.00 15.38  ? 39   LEU A HG   1 
ATOM   584  H HD11 . LEU A 1 39  ? 36.201  14.702  12.728 1.00 24.32  ? 39   LEU A HD11 1 
ATOM   585  H HD12 . LEU A 1 39  ? 37.417  13.729  12.553 1.00 24.32  ? 39   LEU A HD12 1 
ATOM   586  H HD13 . LEU A 1 39  ? 36.244  13.713  11.513 1.00 24.32  ? 39   LEU A HD13 1 
ATOM   587  H HD21 . LEU A 1 39  ? 37.003  11.244  13.086 1.00 21.38  ? 39   LEU A HD21 1 
ATOM   588  H HD22 . LEU A 1 39  ? 35.516  10.782  13.270 1.00 21.38  ? 39   LEU A HD22 1 
ATOM   589  H HD23 . LEU A 1 39  ? 35.991  11.364  11.894 1.00 21.38  ? 39   LEU A HD23 1 
ATOM   590  N N    . TRP A 1 40  ? 34.966  9.874   16.019 1.00 8.62   ? 40   TRP A N    1 
ATOM   591  C CA   . TRP A 1 40  ? 35.556  8.560   16.276 1.00 8.77   ? 40   TRP A CA   1 
ATOM   592  C C    . TRP A 1 40  ? 35.165  7.610   15.159 1.00 8.58   ? 40   TRP A C    1 
ATOM   593  O O    . TRP A 1 40  ? 34.074  7.721   14.554 1.00 9.21   ? 40   TRP A O    1 
ATOM   594  C CB   . TRP A 1 40  ? 35.219  7.981   17.665 1.00 8.87   ? 40   TRP A CB   1 
ATOM   595  C CG   . TRP A 1 40  ? 33.840  7.462   17.889 1.00 8.91   ? 40   TRP A CG   1 
ATOM   596  C CD1  . TRP A 1 40  ? 32.817  8.086   18.515 1.00 9.37   ? 40   TRP A CD1  1 
ATOM   597  C CD2  . TRP A 1 40  ? 33.342  6.150   17.536 1.00 9.04   ? 40   TRP A CD2  1 
ATOM   598  N NE1  . TRP A 1 40  ? 31.688  7.285   18.572 1.00 10.03  ? 40   TRP A NE1  1 
ATOM   599  C CE2  . TRP A 1 40  ? 32.014  6.063   17.999 1.00 9.59   ? 40   TRP A CE2  1 
ATOM   600  C CE3  . TRP A 1 40  ? 33.895  5.012   16.949 1.00 9.57   ? 40   TRP A CE3  1 
ATOM   601  C CZ2  . TRP A 1 40  ? 31.241  4.919   17.845 1.00 10.32  ? 40   TRP A CZ2  1 
ATOM   602  C CZ3  . TRP A 1 40  ? 33.143  3.868   16.786 1.00 10.45  ? 40   TRP A CZ3  1 
ATOM   603  C CH2  . TRP A 1 40  ? 31.813  3.820   17.227 1.00 10.75  ? 40   TRP A CH2  1 
ATOM   604  H H    . TRP A 1 40  ? 34.116  9.947   15.905 1.00 10.35  ? 40   TRP A H    1 
ATOM   605  H HA   . TRP A 1 40  ? 36.529  8.668   16.236 1.00 10.52  ? 40   TRP A HA   1 
ATOM   606  H HB2  . TRP A 1 40  ? 35.841  7.259   17.844 1.00 10.65  ? 40   TRP A HB2  1 
ATOM   607  H HB3  . TRP A 1 40  ? 35.387  8.673   18.324 1.00 10.65  ? 40   TRP A HB3  1 
ATOM   608  H HD1  . TRP A 1 40  ? 32.864  8.947   18.863 1.00 11.24  ? 40   TRP A HD1  1 
ATOM   609  H HE1  . TRP A 1 40  ? 30.925  7.504   18.902 1.00 12.03  ? 40   TRP A HE1  1 
ATOM   610  H HE3  . TRP A 1 40  ? 34.780  5.025   16.664 1.00 11.49  ? 40   TRP A HE3  1 
ATOM   611  H HZ2  . TRP A 1 40  ? 30.363  4.892   18.150 1.00 12.38  ? 40   TRP A HZ2  1 
ATOM   612  H HZ3  . TRP A 1 40  ? 33.522  3.122   16.380 1.00 12.54  ? 40   TRP A HZ3  1 
ATOM   613  H HH2  . TRP A 1 40  ? 31.313  3.046   17.103 1.00 12.90  ? 40   TRP A HH2  1 
ATOM   614  N N    . VAL A 1 41  ? 36.082  6.670   14.873 1.00 8.71   ? 41   VAL A N    1 
ATOM   615  C CA   . VAL A 1 41  ? 35.962  5.779   13.725 1.00 8.99   ? 41   VAL A CA   1 
ATOM   616  C C    . VAL A 1 41  ? 36.301  4.349   14.090 1.00 8.81   ? 41   VAL A C    1 
ATOM   617  O O    . VAL A 1 41  ? 37.209  4.048   14.878 1.00 9.34   ? 41   VAL A O    1 
ATOM   618  C CB   . VAL A 1 41  ? 36.844  6.262   12.553 1.00 9.69   ? 41   VAL A CB   1 
ATOM   619  C CG1  . VAL A 1 41  ? 36.356  7.613   12.022 1.00 11.45  ? 41   VAL A CG1  1 
ATOM   620  C CG2  . VAL A 1 41  ? 38.333  6.343   12.947 1.00 10.87  ? 41   VAL A CG2  1 
ATOM   621  H H    . VAL A 1 41  ? 36.767  6.590   15.388 1.00 10.45  ? 41   VAL A H    1 
ATOM   622  H HA   . VAL A 1 41  ? 35.029  5.799   13.426 1.00 10.79  ? 41   VAL A HA   1 
ATOM   623  H HB   . VAL A 1 41  ? 36.762  5.608   11.828 1.00 11.63  ? 41   VAL A HB   1 
ATOM   624  H HG11 . VAL A 1 41  ? 35.430  7.546   11.781 1.00 17.18  ? 41   VAL A HG11 1 
ATOM   625  H HG12 . VAL A 1 41  ? 36.463  8.282   12.702 1.00 17.18  ? 41   VAL A HG12 1 
ATOM   626  H HG13 . VAL A 1 41  ? 36.871  7.857   11.249 1.00 17.18  ? 41   VAL A HG13 1 
ATOM   627  H HG21 . VAL A 1 41  ? 38.448  7.007   13.631 1.00 16.31  ? 41   VAL A HG21 1 
ATOM   628  H HG22 . VAL A 1 41  ? 38.624  5.490   13.278 1.00 16.31  ? 41   VAL A HG22 1 
ATOM   629  H HG23 . VAL A 1 41  ? 38.856  6.583   12.178 1.00 16.31  ? 41   VAL A HG23 1 
ATOM   630  N N    . PHE A 1 42  ? 35.581  3.409   13.428 1.00 9.30   ? 42   PHE A N    1 
ATOM   631  C CA   . PHE A 1 42  ? 36.051  2.027   13.400 1.00 9.45   ? 42   PHE A CA   1 
ATOM   632  C C    . PHE A 1 42  ? 37.464  2.019   12.831 1.00 9.62   ? 42   PHE A C    1 
ATOM   633  O O    . PHE A 1 42  ? 37.767  2.787   11.880 1.00 10.41  ? 42   PHE A O    1 
ATOM   634  C CB   . PHE A 1 42  ? 35.117  1.143   12.548 1.00 10.49  ? 42   PHE A CB   1 
ATOM   635  C CG   . PHE A 1 42  ? 33.840  0.715   13.240 1.00 10.46  ? 42   PHE A CG   1 
ATOM   636  C CD1  . PHE A 1 42  ? 32.891  1.623   13.713 1.00 10.59  ? 42   PHE A CD1  1 
ATOM   637  C CD2  . PHE A 1 42  ? 33.557  -0.645  13.406 1.00 12.77  ? 42   PHE A CD2  1 
ATOM   638  C CE1  . PHE A 1 42  ? 31.726  1.214   14.338 1.00 11.81  ? 42   PHE A CE1  1 
ATOM   639  C CE2  . PHE A 1 42  ? 32.394  -1.069  14.044 1.00 14.18  ? 42   PHE A CE2  1 
ATOM   640  C CZ   . PHE A 1 42  ? 31.482  -0.147  14.474 1.00 13.66  ? 42   PHE A CZ   1 
ATOM   641  H H    . PHE A 1 42  ? 34.851  3.627   13.028 1.00 11.16  ? 42   PHE A H    1 
ATOM   642  H HA   . PHE A 1 42  ? 36.074  1.678   14.316 1.00 11.34  ? 42   PHE A HA   1 
ATOM   643  H HB2  . PHE A 1 42  ? 34.884  1.629   11.742 1.00 12.58  ? 42   PHE A HB2  1 
ATOM   644  H HB3  . PHE A 1 42  ? 35.605  0.348   12.280 1.00 12.58  ? 42   PHE A HB3  1 
ATOM   645  H HD1  . PHE A 1 42  ? 33.047  2.534   13.604 1.00 12.70  ? 42   PHE A HD1  1 
ATOM   646  H HD2  . PHE A 1 42  ? 34.157  -1.278  13.084 1.00 15.32  ? 42   PHE A HD2  1 
ATOM   647  H HE1  . PHE A 1 42  ? 31.117  1.838   14.660 1.00 14.17  ? 42   PHE A HE1  1 
ATOM   648  H HE2  . PHE A 1 42  ? 32.239  -1.977  14.176 1.00 17.01  ? 42   PHE A HE2  1 
ATOM   649  H HZ   . PHE A 1 42  ? 30.688  -0.434  14.864 1.00 16.40  ? 42   PHE A HZ   1 
ATOM   650  N N    . SER A 1 43  ? 38.342  1.166   13.382 1.00 10.05  ? 43   SER A N    1 
ATOM   651  C CA   . SER A 1 43  ? 39.770  1.198   12.999 1.00 10.36  ? 43   SER A CA   1 
ATOM   652  C C    . SER A 1 43  ? 40.362  -0.196  12.971 1.00 10.25  ? 43   SER A C    1 
ATOM   653  O O    . SER A 1 43  ? 39.759  -1.168  13.481 1.00 10.87  ? 43   SER A O    1 
ATOM   654  C CB   . SER A 1 43  ? 40.590  2.078   13.962 1.00 10.04  ? 43   SER A CB   1 
ATOM   655  O OG   . SER A 1 43  ? 41.000  1.411   15.139 1.00 10.47  ? 43   SER A OG   1 
ATOM   656  H H    . SER A 1 43  ? 38.071  0.594   13.964 1.00 12.06  ? 43   SER A H    1 
ATOM   657  H HA   . SER A 1 43  ? 39.838  1.580   12.099 1.00 12.43  ? 43   SER A HA   1 
ATOM   658  H HB2  . SER A 1 43  ? 41.377  2.401   13.497 1.00 12.04  ? 43   SER A HB2  1 
ATOM   659  H HB3  . SER A 1 43  ? 40.057  2.850   14.210 1.00 12.04  ? 43   SER A HB3  1 
ATOM   660  H HG   . SER A 1 43  ? 41.468  0.769   14.940 1.00 15.70  ? 43   SER A HG   1 
ATOM   661  N N    . THR A 1 44  ? 41.569  -0.281  12.457 1.00 10.56  ? 44   THR A N    1 
ATOM   662  C CA   . THR A 1 44  ? 42.364  -1.512  12.454 1.00 11.75  ? 44   THR A CA   1 
ATOM   663  C C    . THR A 1 44  ? 42.854  -1.926  13.845 1.00 11.27  ? 44   THR A C    1 
ATOM   664  O O    . THR A 1 44  ? 43.451  -3.031  13.969 1.00 12.55  ? 44   THR A O    1 
ATOM   665  C CB   . THR A 1 44  ? 43.558  -1.343  11.501 1.00 13.75  ? 44   THR A CB   1 
ATOM   666  O OG1  . THR A 1 44  ? 44.331  -0.193  11.885 1.00 14.76  ? 44   THR A OG1  1 
ATOM   667  C CG2  . THR A 1 44  ? 43.133  -1.240  10.072 1.00 16.25  ? 44   THR A CG2  1 
ATOM   668  H H    . THR A 1 44  ? 41.911  0.425   12.103 1.00 12.67  ? 44   THR A H    1 
ATOM   669  H HA   . THR A 1 44  ? 41.801  -2.234  12.106 1.00 14.10  ? 44   THR A HA   1 
ATOM   670  H HB   . THR A 1 44  ? 44.129  -2.134  11.590 1.00 16.51  ? 44   THR A HB   1 
ATOM   671  H HG1  . THR A 1 44  ? 44.562  -0.268  12.668 1.00 22.14  ? 44   THR A HG1  1 
ATOM   672  H HG21 . THR A 1 44  ? 43.907  -1.138  9.514  1.00 24.37  ? 44   THR A HG21 1 
ATOM   673  H HG22 . THR A 1 44  ? 42.660  -2.037  9.820  1.00 24.37  ? 44   THR A HG22 1 
ATOM   674  H HG23 . THR A 1 44  ? 42.557  -0.480  9.963  1.00 24.37  ? 44   THR A HG23 1 
ATOM   675  N N    . GLU A 1 45  ? 42.627  -1.189  14.868 1.00 10.50  ? 45   GLU A N    1 
ATOM   676  C CA   . GLU A 1 45  ? 42.889  -1.520  16.263 1.00 10.57  ? 45   GLU A CA   1 
ATOM   677  C C    . GLU A 1 45  ? 41.766  -2.292  16.893 1.00 10.26  ? 45   GLU A C    1 
ATOM   678  O O    . GLU A 1 45  ? 41.940  -2.812  18.022 1.00 12.28  ? 45   GLU A O    1 
ATOM   679  C CB   . GLU A 1 45  ? 43.243  -0.277  17.088 1.00 10.41  ? 45   GLU A CB   1 
ATOM   680  C CG   . GLU A 1 45  ? 44.373  0.547   16.505 1.00 11.19  ? 45   GLU A CG   1 
ATOM   681  C CD   . GLU A 1 45  ? 44.700  1.753   17.264 1.00 11.14  ? 45   GLU A CD   1 
ATOM   682  O OE1  . GLU A 1 45  ? 43.689  2.438   17.691 1.00 12.64  ? 45   GLU A OE1  1 
ATOM   683  O OE2  . GLU A 1 45  ? 45.828  2.191   17.386 1.00 15.46  ? 45   GLU A OE2  1 
ATOM   684  H H    . GLU A 1 45  ? 42.282  -0.416  14.715 1.00 12.60  ? 45   GLU A H    1 
ATOM   685  H HA   . GLU A 1 45  ? 43.677  -2.103  16.274 1.00 12.68  ? 45   GLU A HA   1 
ATOM   686  H HB2  . GLU A 1 45  ? 42.455  0.283   17.162 1.00 12.49  ? 45   GLU A HB2  1 
ATOM   687  H HB3  . GLU A 1 45  ? 43.490  -0.556  17.983 1.00 12.49  ? 45   GLU A HB3  1 
ATOM   688  H HG2  . GLU A 1 45  ? 45.166  -0.010  16.451 1.00 13.43  ? 45   GLU A HG2  1 
ATOM   689  H HG3  . GLU A 1 45  ? 44.134  0.805   15.601 1.00 13.43  ? 45   GLU A HG3  1 
ATOM   690  N N    . LEU A 1 46  ? 40.601  -2.422  16.238 1.00 10.29  ? 46   LEU A N    1 
ATOM   691  C CA   . LEU A 1 46  ? 39.518  -3.301  16.696 1.00 10.53  ? 46   LEU A CA   1 
ATOM   692  C C    . LEU A 1 46  ? 39.908  -4.793  16.385 1.00 12.03  ? 46   LEU A C    1 
ATOM   693  O O    . LEU A 1 46  ? 40.613  -5.029  15.364 1.00 12.29  ? 46   LEU A O    1 
ATOM   694  C CB   . LEU A 1 46  ? 38.206  -2.997  15.990 1.00 10.56  ? 46   LEU A CB   1 
ATOM   695  C CG   . LEU A 1 46  ? 37.555  -1.657  16.372 1.00 11.03  ? 46   LEU A CG   1 
ATOM   696  C CD1  . LEU A 1 46  ? 36.400  -1.387  15.427 1.00 11.93  ? 46   LEU A CD1  1 
ATOM   697  C CD2  . LEU A 1 46  ? 37.092  -1.704  17.839 1.00 12.39  ? 46   LEU A CD2  1 
ATOM   698  H H    . LEU A 1 46  ? 40.484  -1.969  15.516 1.00 12.35  ? 46   LEU A H    1 
ATOM   699  H HA   . LEU A 1 46  ? 39.399  -3.192  17.663 1.00 12.64  ? 46   LEU A HA   1 
ATOM   700  H HB2  . LEU A 1 46  ? 38.364  -3.001  15.033 1.00 12.68  ? 46   LEU A HB2  1 
ATOM   701  H HB3  . LEU A 1 46  ? 37.579  -3.710  16.185 1.00 12.68  ? 46   LEU A HB3  1 
ATOM   702  H HG   . LEU A 1 46  ? 38.219  -0.943  16.272 1.00 13.23  ? 46   LEU A HG   1 
ATOM   703  H HD11 . LEU A 1 46  ? 36.724  -1.367  14.523 1.00 17.90  ? 46   LEU A HD11 1 
ATOM   704  H HD12 . LEU A 1 46  ? 35.745  -2.083  15.516 1.00 17.90  ? 46   LEU A HD12 1 
ATOM   705  H HD13 . LEU A 1 46  ? 36.001  -0.542  15.643 1.00 17.90  ? 46   LEU A HD13 1 
ATOM   706  H HD21 . LEU A 1 46  ? 36.443  -2.403  17.947 1.00 18.58  ? 46   LEU A HD21 1 
ATOM   707  H HD22 . LEU A 1 46  ? 37.846  -1.875  18.407 1.00 18.58  ? 46   LEU A HD22 1 
ATOM   708  H HD23 . LEU A 1 46  ? 36.697  -0.862  18.076 1.00 18.58  ? 46   LEU A HD23 1 
ATOM   709  N N    . PRO A 1 47  ? 39.360  -5.723  17.102 1.00 12.98  ? 47   PRO A N    1 
ATOM   710  C CA   . PRO A 1 47  ? 39.468  -7.134  16.649 1.00 14.83  ? 47   PRO A CA   1 
ATOM   711  C C    . PRO A 1 47  ? 38.933  -7.270  15.232 1.00 13.63  ? 47   PRO A C    1 
ATOM   712  O O    . PRO A 1 47  ? 37.953  -6.604  14.829 1.00 12.81  ? 47   PRO A O    1 
ATOM   713  C CB   . PRO A 1 47  ? 38.595  -7.906  17.627 1.00 17.07  ? 47   PRO A CB   1 
ATOM   714  C CG   . PRO A 1 47  ? 38.361  -7.021  18.769 1.00 18.72  ? 47   PRO A CG   1 
ATOM   715  C CD   . PRO A 1 47  ? 38.563  -5.606  18.294 1.00 14.29  ? 47   PRO A CD   1 
ATOM   716  H HA   . PRO A 1 47  ? 40.397  -7.442  16.698 1.00 17.79  ? 47   PRO A HA   1 
ATOM   717  H HB2  . PRO A 1 47  ? 37.754  -8.149  17.210 1.00 20.48  ? 47   PRO A HB2  1 
ATOM   718  H HB3  . PRO A 1 47  ? 39.044  -8.717  17.914 1.00 20.48  ? 47   PRO A HB3  1 
ATOM   719  H HG2  . PRO A 1 47  ? 37.458  -7.137  19.103 1.00 22.46  ? 47   PRO A HG2  1 
ATOM   720  H HG3  . PRO A 1 47  ? 38.983  -7.227  19.485 1.00 22.46  ? 47   PRO A HG3  1 
ATOM   721  H HD2  . PRO A 1 47  ? 37.711  -5.185  18.098 1.00 17.14  ? 47   PRO A HD2  1 
ATOM   722  H HD3  . PRO A 1 47  ? 39.024  -5.081  18.967 1.00 17.14  ? 47   PRO A HD3  1 
ATOM   723  N N    . ALA A 1 48  ? 39.561  -8.149  14.431 1.00 14.59  ? 48   ALA A N    1 
ATOM   724  C CA   . ALA A 1 48  ? 39.187  -8.323  13.062 1.00 15.42  ? 48   ALA A CA   1 
ATOM   725  C C    . ALA A 1 48  ? 37.694  -8.642  12.868 1.00 13.56  ? 48   ALA A C    1 
ATOM   726  O O    . ALA A 1 48  ? 37.032  -8.162  11.953 1.00 14.68  ? 48   ALA A O    1 
ATOM   727  C CB   . ALA A 1 48  ? 39.994  -9.477  12.355 1.00 19.09  ? 48   ALA A CB   1 
ATOM   728  H H    . ALA A 1 48  ? 40.206  -8.619  14.751 1.00 17.51  ? 48   ALA A H    1 
ATOM   729  H HA   . ALA A 1 48  ? 39.380  -7.487  12.589 1.00 18.50  ? 48   ALA A HA   1 
ATOM   730  H HB1  . ALA A 1 48  ? 39.765  -9.502  11.423 1.00 28.63  ? 48   ALA A HB1  1 
ATOM   731  H HB2  . ALA A 1 48  ? 40.935  -9.313  12.449 1.00 28.63  ? 48   ALA A HB2  1 
ATOM   732  H HB3  . ALA A 1 48  ? 39.773  -10.318 12.762 1.00 28.63  ? 48   ALA A HB3  1 
ATOM   733  N N    . SER A 1 49  ? 37.130  -9.441  13.795 1.00 13.99  ? 49   SER A N    1 
ATOM   734  C CA   . SER A 1 49  ? 35.724  -9.812  13.636 1.00 14.75  ? 49   SER A CA   1 
ATOM   735  C C    . SER A 1 49  ? 34.794  -8.604  13.725 1.00 14.78  ? 49   SER A C    1 
ATOM   736  O O    . SER A 1 49  ? 33.683  -8.619  13.180 1.00 16.73  ? 49   SER A O    1 
ATOM   737  C CB   . SER A 1 49  ? 35.359  -10.882 14.594 1.00 18.31  ? 49   SER A CB   1 
ATOM   738  O OG   . SER A 1 49  ? 35.466  -10.389 15.942 1.00 20.83  ? 49   SER A OG   1 
ATOM   739  H H    . SER A 1 49  ? 37.586  -9.726  14.465 1.00 16.79  ? 49   SER A H    1 
ATOM   740  H HA   . SER A 1 49  ? 35.625  -10.186 12.736 1.00 17.71  ? 49   SER A HA   1 
ATOM   741  H HB2  . SER A 1 49  ? 34.451  -11.177 14.425 1.00 21.97  ? 49   SER A HB2  1 
ATOM   742  H HB3  . SER A 1 49  ? 35.951  -11.642 14.477 1.00 21.97  ? 49   SER A HB3  1 
ATOM   743  H HG   . SER A 1 49  ? 36.236  -10.148 16.084 1.00 31.24  ? 49   SER A HG   1 
ATOM   744  N N    . GLN A 1 50  ? 35.203  -7.564  14.478 1.00 12.90  ? 50   GLN A N    1 
ATOM   745  C CA   . GLN A 1 50  ? 34.393  -6.343  14.645 1.00 13.10  ? 50   GLN A CA   1 
ATOM   746  C C    . GLN A 1 50  ? 34.581  -5.370  13.506 1.00 13.60  ? 50   GLN A C    1 
ATOM   747  O O    . GLN A 1 50  ? 33.763  -4.469  13.343 1.00 15.35  ? 50   GLN A O    1 
ATOM   748  C CB   . GLN A 1 50  ? 34.701  -5.689  15.973 1.00 14.79  ? 50   GLN A CB   1 
ATOM   749  C CG   . GLN A 1 50  ? 34.175  -6.587  17.150 1.00 17.24  ? 50   GLN A CG   1 
ATOM   750  C CD   . GLN A 1 50  ? 34.435  -6.113  18.488 1.00 18.12  ? 50   GLN A CD   1 
ATOM   751  O OE1  . GLN A 1 50  ? 34.669  -4.937  18.674 1.00 21.46  ? 50   GLN A OE1  1 
ATOM   752  N NE2  . GLN A 1 50  ? 34.600  -6.903  19.502 1.00 26.62  ? 50   GLN A NE2  1 
ATOM   753  H H    . GLN A 1 50  ? 35.965  -7.614  14.875 1.00 15.48  ? 50   GLN A H    1 
ATOM   754  H HA   . GLN A 1 50  ? 33.450  -6.610  14.656 1.00 15.72  ? 50   GLN A HA   1 
ATOM   755  H HB2  . GLN A 1 50  ? 35.659  -5.565  16.061 1.00 17.75  ? 50   GLN A HB2  1 
ATOM   756  H HB3  . GLN A 1 50  ? 34.278  -4.817  16.013 1.00 17.75  ? 50   GLN A HB3  1 
ATOM   757  H HG2  . GLN A 1 50  ? 33.216  -6.688  17.047 1.00 20.68  ? 50   GLN A HG2  1 
ATOM   758  H HG3  . GLN A 1 50  ? 34.570  -7.467  17.059 1.00 20.68  ? 50   GLN A HG3  1 
ATOM   759  H HE21 . GLN A 1 50  ? 34.447  -7.746  19.421 1.00 31.95  ? 50   GLN A HE21 1 
ATOM   760  H HE22 . GLN A 1 50  ? 34.862  -6.585  20.257 1.00 31.95  ? 50   GLN A HE22 1 
ATOM   761  N N    . GLN A 1 51  ? 35.589  -5.505  12.679 1.00 13.63  ? 51   GLN A N    1 
ATOM   762  C CA   . GLN A 1 51  ? 35.860  -4.717  11.489 1.00 13.93  ? 51   GLN A CA   1 
ATOM   763  C C    . GLN A 1 51  ? 34.908  -5.133  10.346 1.00 14.88  ? 51   GLN A C    1 
ATOM   764  O O    . GLN A 1 51  ? 34.663  -4.368  9.426  1.00 15.36  ? 51   GLN A O    1 
ATOM   765  C CB   . GLN A 1 51  ? 37.282  -4.783  11.065 1.00 14.02  ? 51   GLN A CB   1 
ATOM   766  C CG   . GLN A 1 51  ? 38.279  -4.243  12.072 1.00 14.11  ? 51   GLN A CG   1 
ATOM   767  C CD   . GLN A 1 51  ? 39.733  -4.410  11.594 1.00 14.68  ? 51   GLN A CD   1 
ATOM   768  O OE1  . GLN A 1 51  ? 40.029  -4.184  10.393 1.00 18.18  ? 51   GLN A OE1  1 
ATOM   769  N NE2  . GLN A 1 51  ? 40.590  -4.789  12.502 1.00 14.95  ? 51   GLN A NE2  1 
ATOM   770  H H    . GLN A 1 51  ? 36.153  -6.128  12.861 1.00 16.35  ? 51   GLN A H    1 
ATOM   771  H HA   . GLN A 1 51  ? 35.663  -3.782  11.707 1.00 16.71  ? 51   GLN A HA   1 
ATOM   772  H HB2  . GLN A 1 51  ? 37.504  -5.708  10.876 1.00 16.82  ? 51   GLN A HB2  1 
ATOM   773  H HB3  . GLN A 1 51  ? 37.379  -4.285  10.238 1.00 16.82  ? 51   GLN A HB3  1 
ATOM   774  H HG2  . GLN A 1 51  ? 38.100  -3.303  12.225 1.00 16.93  ? 51   GLN A HG2  1 
ATOM   775  H HG3  . GLN A 1 51  ? 38.165  -4.710  12.915 1.00 16.93  ? 51   GLN A HG3  1 
ATOM   776  H HE21 . GLN A 1 51  ? 40.328  -4.928  13.310 1.00 17.95  ? 51   GLN A HE21 1 
ATOM   777  H HE22 . GLN A 1 51  ? 41.417  -4.900  12.294 1.00 17.95  ? 51   GLN A HE22 1 
ATOM   778  N N    . SER A 1 52  ? 34.489  -6.382  10.331 1.00 17.87  ? 52   SER A N    1 
ATOM   779  C CA   . SER A 1 52  ? 33.645  -6.913  9.211  1.00 20.14  ? 52   SER A CA   1 
ATOM   780  C C    . SER A 1 52  ? 32.383  -6.106  9.049  1.00 19.96  ? 52   SER A C    1 
ATOM   781  O O    . SER A 1 52  ? 31.696  -5.693  9.995  1.00 19.92  ? 52   SER A O    1 
ATOM   782  C CB   A SER A 1 52  ? 33.671  -8.255  9.481  0.46 26.73  ? 52   SER A CB   1 
ATOM   783  C CB   B SER A 1 52  ? 33.057  -8.506  9.636  0.54 23.76  ? 52   SER A CB   1 
ATOM   784  O OG   A SER A 1 52  ? 32.906  -9.071  8.425  0.46 38.27  ? 52   SER A OG   1 
ATOM   785  O OG   B SER A 1 52  ? 34.351  -9.116  9.705  0.54 29.06  ? 52   SER A OG   1 
ATOM   786  H H    . SER A 1 52  ? 34.705  -6.905  10.979 1.00 21.44  ? 52   SER A H    1 
ATOM   787  H HA   A SER A 1 52  ? 34.164  -6.786  8.389  1.00 24.16  ? 52   SER A HA   1 
ATOM   788  H HB2  A SER A 1 52  ? 34.593  -8.556  9.512  0.46 32.08  ? 52   SER A HB2  1 
ATOM   789  H HB2  B SER A 1 52  ? 32.593  -8.518  10.487 0.54 28.51  ? 52   SER A HB2  1 
ATOM   790  H HB3  A SER A 1 52  ? 33.277  -8.412  10.353 0.46 32.08  ? 52   SER A HB3  1 
ATOM   791  H HB3  B SER A 1 52  ? 32.498  -8.894  8.945  0.54 28.51  ? 52   SER A HB3  1 
ATOM   792  H HG   A SER A 1 52  ? 32.816  -9.842  8.688  0.46 57.40  ? 52   SER A HG   1 
ATOM   793  H HG   B SER A 1 52  ? 34.776  -8.787  10.324 0.54 43.59  ? 52   SER A HG   1 
ATOM   794  N N    . GLY A 1 53  ? 31.999  -5.821  7.813  1.00 20.15  ? 53   GLY A N    1 
ATOM   795  C CA   . GLY A 1 53  ? 30.813  -5.020  7.454  1.00 21.37  ? 53   GLY A CA   1 
ATOM   796  C C    . GLY A 1 53  ? 31.040  -3.524  7.526  1.00 18.20  ? 53   GLY A C    1 
ATOM   797  O O    . GLY A 1 53  ? 30.097  -2.774  7.291  1.00 21.29  ? 53   GLY A O    1 
ATOM   798  H H    . GLY A 1 53  ? 32.480  -6.127  7.169  1.00 24.19  ? 53   GLY A H    1 
ATOM   799  H HA2  . GLY A 1 53  ? 30.541  -5.251  6.552  1.00 25.65  ? 53   GLY A HA2  1 
ATOM   800  H HA3  . GLY A 1 53  ? 30.085  -5.254  8.050  1.00 25.65  ? 53   GLY A HA3  1 
ATOM   801  N N    . HIS A 1 54  ? 32.302  -3.096  7.806  1.00 14.51  ? 54   HIS A N    1 
ATOM   802  C CA   . HIS A 1 54  ? 32.632  -1.671  7.922  1.00 12.48  ? 54   HIS A CA   1 
ATOM   803  C C    . HIS A 1 54  ? 33.741  -1.288  6.997  1.00 12.09  ? 54   HIS A C    1 
ATOM   804  O O    . HIS A 1 54  ? 34.627  -2.103  6.654  1.00 14.53  ? 54   HIS A O    1 
ATOM   805  C CB   . HIS A 1 54  ? 33.079  -1.380  9.372  1.00 11.81  ? 54   HIS A CB   1 
ATOM   806  C CG   . HIS A 1 54  ? 31.934  -1.523  10.343 1.00 11.59  ? 54   HIS A CG   1 
ATOM   807  N ND1  . HIS A 1 54  ? 31.037  -0.498  10.545 1.00 12.13  ? 54   HIS A ND1  1 
ATOM   808  C CD2  . HIS A 1 54  ? 31.501  -2.559  11.075 1.00 13.51  ? 54   HIS A CD2  1 
ATOM   809  C CE1  . HIS A 1 54  ? 30.122  -0.880  11.432 1.00 12.82  ? 54   HIS A CE1  1 
ATOM   810  N NE2  . HIS A 1 54  ? 30.354  -2.127  11.770 1.00 14.01  ? 54   HIS A NE2  1 
ATOM   811  H H    . HIS A 1 54  ? 32.924  -3.678  7.918  1.00 17.41  ? 54   HIS A H    1 
ATOM   812  H HA   . HIS A 1 54  ? 31.838  -1.136  7.715  1.00 14.97  ? 54   HIS A HA   1 
ATOM   813  H HB2  . HIS A 1 54  ? 33.788  -1.995  9.619  1.00 14.17  ? 54   HIS A HB2  1 
ATOM   814  H HB3  . HIS A 1 54  ? 33.433  -0.478  9.424  1.00 14.17  ? 54   HIS A HB3  1 
ATOM   815  H HD1  . HIS A 1 54  ? 31.064  0.270   10.159 1.00 14.55  ? 54   HIS A HD1  1 
ATOM   816  H HD2  . HIS A 1 54  ? 31.886  -3.405  11.116 1.00 16.22  ? 54   HIS A HD2  1 
ATOM   817  H HE1  . HIS A 1 54  ? 29.431  -0.351  11.758 1.00 15.38  ? 54   HIS A HE1  1 
ATOM   818  N N    . SER A 1 55  ? 33.800  0.012   6.677  1.00 11.67  ? 55   SER A N    1 
ATOM   819  C CA   . SER A 1 55  ? 35.032  0.644   6.245  1.00 11.23  ? 55   SER A CA   1 
ATOM   820  C C    . SER A 1 55  ? 35.774  1.070   7.519  1.00 10.90  ? 55   SER A C    1 
ATOM   821  O O    . SER A 1 55  ? 35.137  1.545   8.475  1.00 12.32  ? 55   SER A O    1 
ATOM   822  C CB   . SER A 1 55  ? 34.740  1.828   5.327  1.00 12.40  ? 55   SER A CB   1 
ATOM   823  O OG   . SER A 1 55  ? 34.041  1.400   4.186  1.00 13.52  ? 55   SER A OG   1 
ATOM   824  H H    . SER A 1 55  ? 33.084  0.487   6.729  1.00 14.01  ? 55   SER A H    1 
ATOM   825  H HA   . SER A 1 55  ? 35.576  -0.011  5.760  1.00 13.48  ? 55   SER A HA   1 
ATOM   826  H HB2  . SER A 1 55  ? 34.211  2.487   5.805  1.00 14.88  ? 55   SER A HB2  1 
ATOM   827  H HB3  . SER A 1 55  ? 35.573  2.247   5.061  1.00 14.88  ? 55   SER A HB3  1 
ATOM   828  H HG   . SER A 1 55  ? 34.493  0.850   3.779  1.00 20.28  ? 55   SER A HG   1 
ATOM   829  N N    . VAL A 1 56  ? 37.088  0.902   7.520  1.00 11.63  ? 56   VAL A N    1 
ATOM   830  C CA   . VAL A 1 56  ? 37.859  1.148   8.745  1.00 11.72  ? 56   VAL A CA   1 
ATOM   831  C C    . VAL A 1 56  ? 39.042  2.069   8.438  1.00 11.06  ? 56   VAL A C    1 
ATOM   832  O O    . VAL A 1 56  ? 39.677  2.055   7.373  1.00 13.17  ? 56   VAL A O    1 
ATOM   833  C CB   . VAL A 1 56  ? 38.342  -0.133  9.447  1.00 14.74  ? 56   VAL A CB   1 
ATOM   834  C CG1  . VAL A 1 56  ? 37.137  -1.037  9.795  1.00 15.58  ? 56   VAL A CG1  1 
ATOM   835  C CG2  . VAL A 1 56  ? 39.357  -0.862  8.673  1.00 19.28  ? 56   VAL A CG2  1 
ATOM   836  H H    . VAL A 1 56  ? 37.489  0.649   6.803  1.00 13.96  ? 56   VAL A H    1 
ATOM   837  H HA   . VAL A 1 56  ? 37.273  1.623   9.371  1.00 14.07  ? 56   VAL A HA   1 
ATOM   838  H HB   . VAL A 1 56  ? 38.758  0.137   10.292 1.00 17.69  ? 56   VAL A HB   1 
ATOM   839  H HG11 . VAL A 1 56  ? 36.498  -0.535  10.307 1.00 23.37  ? 56   VAL A HG11 1 
ATOM   840  H HG12 . VAL A 1 56  ? 36.725  -1.347  8.986  1.00 23.37  ? 56   VAL A HG12 1 
ATOM   841  H HG13 . VAL A 1 56  ? 37.439  -1.789  10.309 1.00 23.37  ? 56   VAL A HG13 1 
ATOM   842  H HG21 . VAL A 1 56  ? 38.970  -1.175  7.852  1.00 28.91  ? 56   VAL A HG21 1 
ATOM   843  H HG22 . VAL A 1 56  ? 40.092  -0.277  8.477  1.00 28.91  ? 56   VAL A HG22 1 
ATOM   844  H HG23 . VAL A 1 56  ? 39.672  -1.611  9.184  1.00 28.91  ? 56   VAL A HG23 1 
ATOM   845  N N    . TYR A 1 57  ? 39.374  2.872   9.448  1.00 10.87  ? 57   TYR A N    1 
ATOM   846  C CA   . TYR A 1 57  ? 40.538  3.739   9.433  1.00 10.50  ? 57   TYR A CA   1 
ATOM   847  C C    . TYR A 1 57  ? 41.787  2.942   9.804  1.00 10.53  ? 57   TYR A C    1 
ATOM   848  O O    . TYR A 1 57  ? 41.805  2.231   10.813 1.00 11.49  ? 57   TYR A O    1 
ATOM   849  C CB   . TYR A 1 57  ? 40.330  4.875   10.451 1.00 11.09  ? 57   TYR A CB   1 
ATOM   850  C CG   . TYR A 1 57  ? 41.473  5.841   10.576 1.00 10.88  ? 57   TYR A CG   1 
ATOM   851  C CD1  . TYR A 1 57  ? 42.006  6.488   9.484  1.00 12.22  ? 57   TYR A CD1  1 
ATOM   852  C CD2  . TYR A 1 57  ? 41.981  6.142   11.841 1.00 11.98  ? 57   TYR A CD2  1 
ATOM   853  C CE1  . TYR A 1 57  ? 43.079  7.404   9.678  1.00 12.10  ? 57   TYR A CE1  1 
ATOM   854  C CE2  . TYR A 1 57  ? 43.034  7.053   11.993 1.00 12.14  ? 57   TYR A CE2  1 
ATOM   855  C CZ   . TYR A 1 57  ? 43.574  7.688   10.892 1.00 11.27  ? 57   TYR A CZ   1 
ATOM   856  O OH   . TYR A 1 57  ? 44.604  8.583   11.119 1.00 12.87  ? 57   TYR A OH   1 
ATOM   857  H H    . TYR A 1 57  ? 38.872  2.876   10.146 1.00 13.05  ? 57   TYR A H    1 
ATOM   858  H HA   . TYR A 1 57  ? 40.648  4.121   8.537  1.00 12.60  ? 57   TYR A HA   1 
ATOM   859  H HB2  . TYR A 1 57  ? 39.535  5.371   10.200 1.00 13.30  ? 57   TYR A HB2  1 
ATOM   860  H HB3  . TYR A 1 57  ? 40.164  4.481   11.322 1.00 13.30  ? 57   TYR A HB3  1 
ATOM   861  H HD1  . TYR A 1 57  ? 41.670  6.329   8.632  1.00 14.67  ? 57   TYR A HD1  1 
ATOM   862  H HD2  . TYR A 1 57  ? 41.617  5.732   12.592 1.00 14.38  ? 57   TYR A HD2  1 
ATOM   863  H HE1  . TYR A 1 57  ? 43.451  7.821   8.934  1.00 14.52  ? 57   TYR A HE1  1 
ATOM   864  H HE2  . TYR A 1 57  ? 43.371  7.232   12.841 1.00 14.56  ? 57   TYR A HE2  1 
ATOM   865  H HH   . TYR A 1 57  ? 44.852  8.901   10.405 1.00 19.30  ? 57   TYR A HH   1 
ATOM   866  N N    . ASN A 1 58  ? 42.875  3.089   9.003  1.00 11.85  ? 58   ASN A N    1 
ATOM   867  C CA   . ASN A 1 58  ? 44.184  2.509   9.266  1.00 13.49  ? 58   ASN A CA   1 
ATOM   868  C C    . ASN A 1 58  ? 45.121  3.634   9.618  1.00 13.02  ? 58   ASN A C    1 
ATOM   869  O O    . ASN A 1 58  ? 45.718  4.270   8.769  1.00 15.27  ? 58   ASN A O    1 
ATOM   870  C CB   . ASN A 1 58  ? 44.685  1.759   8.018  1.00 16.29  ? 58   ASN A CB   1 
ATOM   871  C CG   . ASN A 1 58  ? 46.035  1.058   8.294  1.00 23.33  ? 58   ASN A CG   1 
ATOM   872  O OD1  . ASN A 1 58  ? 46.600  0.430   7.422  1.00 40.82  ? 58   ASN A OD1  1 
ATOM   873  N ND2  . ASN A 1 58  ? 46.655  1.192   9.375  1.00 23.15  ? 58   ASN A ND2  1 
ATOM   874  H H    . ASN A 1 58  ? 42.783  3.559   8.288  1.00 14.22  ? 58   ASN A H    1 
ATOM   875  H HA   . ASN A 1 58  ? 44.121  1.886   10.019 1.00 16.19  ? 58   ASN A HA   1 
ATOM   876  H HB2  . ASN A 1 58  ? 44.027  1.098   7.753  1.00 19.55  ? 58   ASN A HB2  1 
ATOM   877  H HB3  . ASN A 1 58  ? 44.791  2.387   7.286  1.00 19.55  ? 58   ASN A HB3  1 
ATOM   878  H HD21 . ASN A 1 58  ? 46.298  1.629   10.024 1.00 27.78  ? 58   ASN A HD21 1 
ATOM   879  H HD22 . ASN A 1 58  ? 47.437  0.846   9.468  1.00 27.78  ? 58   ASN A HD22 1 
ATOM   880  N N    . PRO A 1 59  ? 45.326  3.868   10.921 1.00 13.56  ? 59   PRO A N    1 
ATOM   881  C CA   . PRO A 1 59  ? 46.143  5.008   11.328 1.00 14.39  ? 59   PRO A CA   1 
ATOM   882  C C    . PRO A 1 59  ? 47.574  4.880   10.900 1.00 15.62  ? 59   PRO A C    1 
ATOM   883  O O    . PRO A 1 59  ? 48.291  5.922   10.755 1.00 17.53  ? 59   PRO A O    1 
ATOM   884  C CB   . PRO A 1 59  ? 46.077  5.003   12.835 1.00 17.34  ? 59   PRO A CB   1 
ATOM   885  C CG   . PRO A 1 59  ? 45.218  3.873   13.260 1.00 18.56  ? 59   PRO A CG   1 
ATOM   886  C CD   . PRO A 1 59  ? 44.705  3.204   12.076 1.00 17.17  ? 59   PRO A CD   1 
ATOM   887  H HA   . PRO A 1 59  ? 45.759  5.839   10.976 1.00 17.26  ? 59   PRO A HA   1 
ATOM   888  H HB2  . PRO A 1 59  ? 46.967  4.901   13.206 1.00 20.81  ? 59   PRO A HB2  1 
ATOM   889  H HB3  . PRO A 1 59  ? 45.706  5.840   13.154 1.00 20.81  ? 59   PRO A HB3  1 
ATOM   890  H HG2  . PRO A 1 59  ? 45.733  3.250   13.795 1.00 22.27  ? 59   PRO A HG2  1 
ATOM   891  H HG3  . PRO A 1 59  ? 44.482  4.203   13.799 1.00 22.27  ? 59   PRO A HG3  1 
ATOM   892  H HD2  . PRO A 1 59  ? 44.937  2.262   12.091 1.00 20.60  ? 59   PRO A HD2  1 
ATOM   893  H HD3  . PRO A 1 59  ? 43.739  3.284   12.033 1.00 20.60  ? 59   PRO A HD3  1 
ATOM   894  N N    . SER A 1 60  ? 48.127  3.670   10.764 1.00 17.51  ? 60   SER A N    1 
ATOM   895  C CA   . SER A 1 60  ? 49.508  3.432   10.464 1.00 20.79  ? 60   SER A CA   1 
ATOM   896  C C    . SER A 1 60  ? 49.844  4.071   9.106  1.00 19.34  ? 60   SER A C    1 
ATOM   897  O O    . SER A 1 60  ? 50.998  4.487   8.860  1.00 28.18  ? 60   SER A O    1 
ATOM   898  C CB   A SER A 1 60  ? 49.945  1.842   10.710 0.53 24.57  ? 60   SER A CB   1 
ATOM   899  C CB   B SER A 1 60  ? 49.833  2.175   10.239 0.47 24.49  ? 60   SER A CB   1 
ATOM   900  O OG   A SER A 1 60  ? 49.833  1.642   11.836 0.53 34.38  ? 60   SER A OG   1 
ATOM   901  O OG   B SER A 1 60  ? 49.743  1.825   9.262  0.47 37.63  ? 60   SER A OG   1 
ATOM   902  H H    . SER A 1 60  ? 47.617  2.984   10.864 1.00 21.01  ? 60   SER A H    1 
ATOM   903  H HA   A SER A 1 60  ? 50.013  3.947   11.128 1.00 24.95  ? 60   SER A HA   1 
ATOM   904  H HB2  A SER A 1 60  ? 49.368  1.251   10.202 0.53 29.48  ? 60   SER A HB2  1 
ATOM   905  H HB2  B SER A 1 60  ? 50.753  2.048   10.520 0.47 29.38  ? 60   SER A HB2  1 
ATOM   906  H HB3  A SER A 1 60  ? 50.862  1.696   10.430 0.53 29.48  ? 60   SER A HB3  1 
ATOM   907  H HB3  B SER A 1 60  ? 49.280  1.617   10.808 0.47 29.38  ? 60   SER A HB3  1 
ATOM   908  H HG   A SER A 1 60  ? 49.048  1.736   12.053 0.53 51.57  ? 60   SER A HG   1 
ATOM   909  H HG   B SER A 1 60  ? 48.962  1.885   9.021  0.47 56.45  ? 60   SER A HG   1 
ATOM   910  N N    . ALA A 1 61  ? 48.858  4.083   8.177  1.00 19.66  ? 61   ALA A N    1 
ATOM   911  C CA   . ALA A 1 61  ? 49.131  4.553   6.865  1.00 22.22  ? 61   ALA A CA   1 
ATOM   912  C C    . ALA A 1 61  ? 49.341  6.015   6.746  1.00 22.19  ? 61   ALA A C    1 
ATOM   913  O O    . ALA A 1 61  ? 50.238  6.466   6.002  1.00 25.27  ? 61   ALA A O    1 
ATOM   914  C CB   . ALA A 1 61  ? 48.123  4.043   5.884  1.00 34.32  ? 61   ALA A CB   1 
ATOM   915  H H    . ALA A 1 61  ? 48.069  3.807   8.380  1.00 23.60  ? 61   ALA A H    1 
ATOM   916  H HA   . ALA A 1 61  ? 49.983  4.142   6.608  1.00 26.66  ? 61   ALA A HA   1 
ATOM   917  H HB1  . ALA A 1 61  ? 48.418  4.239   4.992  1.00 51.48  ? 61   ALA A HB1  1 
ATOM   918  H HB2  . ALA A 1 61  ? 48.028  3.093   5.988  1.00 51.48  ? 61   ALA A HB2  1 
ATOM   919  H HB3  . ALA A 1 61  ? 47.278  4.469   6.043  1.00 51.48  ? 61   ALA A HB3  1 
ATOM   920  N N    . THR A 1 62  ? 48.517  6.833   7.442  1.00 18.20  ? 62   THR A N    1 
ATOM   921  C CA   . THR A 1 62  ? 48.550  8.284   7.261  1.00 16.83  ? 62   THR A CA   1 
ATOM   922  C C    . THR A 1 62  ? 48.425  9.135   8.555  1.00 14.90  ? 62   THR A C    1 
ATOM   923  O O    . THR A 1 62  ? 48.580  10.338  8.442  1.00 16.72  ? 62   THR A O    1 
ATOM   924  C CB   . THR A 1 62  ? 47.239  8.642   6.360  1.00 16.55  ? 62   THR A CB   1 
ATOM   925  O OG1  . THR A 1 62  ? 46.095  8.097   7.037  1.00 17.05  ? 62   THR A OG1  1 
ATOM   926  C CG2  . THR A 1 62  ? 47.316  8.012   4.967  1.00 21.95  ? 62   THR A CG2  1 
ATOM   927  H H    . THR A 1 62  ? 47.963  6.492   8.004  1.00 21.84  ? 62   THR A H    1 
ATOM   928  H HA   . THR A 1 62  ? 49.363  8.538   6.776  1.00 20.20  ? 62   THR A HA   1 
ATOM   929  H HB   . THR A 1 62  ? 47.146  9.614   6.280  1.00 19.87  ? 62   THR A HB   1 
ATOM   930  H HG1  . THR A 1 62  ? 45.708  7.572   6.541  1.00 25.57  ? 62   THR A HG1  1 
ATOM   931  H HG21 . THR A 1 62  ? 46.533  8.250   4.465  1.00 32.93  ? 62   THR A HG21 1 
ATOM   932  H HG22 . THR A 1 62  ? 48.098  8.334   4.512  1.00 32.93  ? 62   THR A HG22 1 
ATOM   933  H HG23 . THR A 1 62  ? 47.365  7.057   5.050  1.00 32.93  ? 62   THR A HG23 1 
ATOM   934  N N    . GLY A 1 63  ? 48.149  8.592   9.650  1.00 14.26  ? 63   GLY A N    1 
ATOM   935  C CA   . GLY A 1 63  ? 47.885  9.332   10.851 1.00 14.49  ? 63   GLY A CA   1 
ATOM   936  C C    . GLY A 1 63  ? 49.138  9.621   11.627 1.00 12.94  ? 63   GLY A C    1 
ATOM   937  O O    . GLY A 1 63  ? 50.156  8.907   11.561 1.00 16.42  ? 63   GLY A O    1 
ATOM   938  H H    . GLY A 1 63  ? 48.117  7.733   9.684  1.00 17.11  ? 63   GLY A H    1 
ATOM   939  H HA2  . GLY A 1 63  ? 47.453  10.169  10.620 1.00 17.39  ? 63   GLY A HA2  1 
ATOM   940  H HA3  . GLY A 1 63  ? 47.274  8.825   11.409 1.00 17.39  ? 63   GLY A HA3  1 
ATOM   941  N N    . LYS A 1 64  ? 49.096  10.653  12.462 1.00 12.09  ? 64   LYS A N    1 
ATOM   942  C CA   . LYS A 1 64  ? 50.190  11.023  13.406 1.00 12.98  ? 64   LYS A CA   1 
ATOM   943  C C    . LYS A 1 64  ? 49.641  10.899  14.827 1.00 12.77  ? 64   LYS A C    1 
ATOM   944  O O    . LYS A 1 64  ? 48.746  11.606  15.250 1.00 13.04  ? 64   LYS A O    1 
ATOM   945  C CB   . LYS A 1 64  ? 50.689  12.477  13.028 1.00 16.29  ? 64   LYS A CB   1 
ATOM   946  C CG   . LYS A 1 64  ? 51.184  12.632  11.649 1.00 25.75  ? 64   LYS A CG   1 
ATOM   947  C CD   . LYS A 1 64  ? 52.465  11.748  11.308 1.00 41.53  ? 64   LYS A CD   1 
ATOM   948  C CE   . LYS A 1 64  ? 52.961  12.176  10.041 1.00 49.98  ? 64   LYS A CE   1 
ATOM   949  N NZ   . LYS A 1 64  ? 54.519  11.577  10.357 1.00 65.41  ? 64   LYS A NZ   1 
ATOM   950  H H    . LYS A 1 64  ? 48.389  11.142  12.459 1.00 14.51  ? 64   LYS A H    1 
ATOM   951  H HA   . LYS A 1 64  ? 50.932  10.392  13.295 1.00 15.58  ? 64   LYS A HA   1 
ATOM   952  H HB2  . LYS A 1 64  ? 49.957  13.098  13.163 1.00 19.55  ? 64   LYS A HB2  1 
ATOM   953  H HB3  . LYS A 1 64  ? 51.400  12.726  13.639 1.00 19.55  ? 64   LYS A HB3  1 
ATOM   954  H HG2  . LYS A 1 64  ? 50.472  12.397  11.034 1.00 30.90  ? 64   LYS A HG2  1 
ATOM   955  H HG3  . LYS A 1 64  ? 51.403  13.566  11.500 1.00 30.90  ? 64   LYS A HG3  1 
ATOM   956  H HD2  . LYS A 1 64  ? 53.145  11.866  11.990 1.00 49.84  ? 64   LYS A HD2  1 
ATOM   957  H HD3  . LYS A 1 64  ? 52.224  10.809  11.273 1.00 49.84  ? 64   LYS A HD3  1 
ATOM   958  H HE2  . LYS A 1 64  ? 52.528  11.736  9.293  1.00 59.98  ? 64   LYS A HE2  1 
ATOM   959  H HE3  . LYS A 1 64  ? 52.939  13.139  9.928  1.00 59.98  ? 64   LYS A HE3  1 
ATOM   960  H HZ1  . LYS A 1 64  ? 55.058  11.778  9.678  1.00 98.11  ? 64   LYS A HZ1  1 
ATOM   961  H HZ2  . LYS A 1 64  ? 54.833  11.946  11.104 1.00 98.11  ? 64   LYS A HZ2  1 
ATOM   962  H HZ3  . LYS A 1 64  ? 54.483  10.693  10.456 1.00 98.11  ? 64   LYS A HZ3  1 
ATOM   963  N N    . GLU A 1 65  ? 50.239  9.976   15.610 1.00 14.10  ? 65   GLU A N    1 
ATOM   964  C CA   . GLU A 1 65  ? 49.774  9.762   16.935 1.00 15.85  ? 65   GLU A CA   1 
ATOM   965  C C    . GLU A 1 65  ? 49.895  10.954  17.793 1.00 18.03  ? 65   GLU A C    1 
ATOM   966  O O    . GLU A 1 65  ? 50.870  11.783  17.691 1.00 24.00  ? 65   GLU A O    1 
ATOM   967  C CB   . GLU A 1 65  ? 50.611  8.611   17.590 1.00 18.76  ? 65   GLU A CB   1 
ATOM   968  C CG   A GLU A 1 65  ? 52.021  9.121   18.016 0.55 25.15  ? 65   GLU A CG   1 
ATOM   969  C CG   B GLU A 1 65  ? 52.093  9.242   17.686 0.45 14.00  ? 65   GLU A CG   1 
ATOM   970  C CD   A GLU A 1 65  ? 52.983  7.961   18.191 0.55 23.56  ? 65   GLU A CD   1 
ATOM   971  C CD   B GLU A 1 65  ? 52.926  8.356   18.700 0.45 13.54  ? 65   GLU A CD   1 
ATOM   972  O OE1  A GLU A 1 65  ? 52.325  6.858   18.303 0.55 43.51  ? 65   GLU A OE1  1 
ATOM   973  O OE1  B GLU A 1 65  ? 52.895  7.086   18.499 0.45 11.86  ? 65   GLU A OE1  1 
ATOM   974  O OE2  A GLU A 1 65  ? 54.143  8.144   18.139 0.55 22.90  ? 65   GLU A OE2  1 
ATOM   975  O OE2  B GLU A 1 65  ? 53.565  8.829   19.585 0.45 12.61  ? 65   GLU A OE2  1 
ATOM   976  H H    . GLU A 1 65  ? 50.901  9.518   15.307 1.00 16.92  ? 65   GLU A H    1 
ATOM   977  H HA   . GLU A 1 65  ? 48.833  9.490   16.900 1.00 19.02  ? 65   GLU A HA   1 
ATOM   978  H HB2  . GLU A 1 65  ? 50.142  8.272   18.369 1.00 22.51  ? 65   GLU A HB2  1 
ATOM   979  H HB3  . GLU A 1 65  ? 50.709  7.881   16.958 1.00 22.51  ? 65   GLU A HB3  1 
ATOM   980  H HG2  A GLU A 1 65  ? 52.363  9.726   17.339 0.55 30.17  ? 65   GLU A HG2  1 
ATOM   981  H HG2  B GLU A 1 65  ? 52.516  9.239   16.813 0.45 16.80  ? 65   GLU A HG2  1 
ATOM   982  H HG3  A GLU A 1 65  ? 51.950  9.611   18.849 0.55 30.17  ? 65   GLU A HG3  1 
ATOM   983  H HG3  B GLU A 1 65  ? 52.047  10.159  18.001 0.45 16.80  ? 65   GLU A HG3  1 
ATOM   984  N N    . LEU A 1 66  ? 48.929  11.084  18.737 1.00 18.43  ? 66   LEU A N    1 
ATOM   985  C CA   . LEU A 1 66  ? 49.161  11.940  19.958 1.00 20.86  ? 66   LEU A CA   1 
ATOM   986  C C    . LEU A 1 66  ? 49.583  11.082  21.085 1.00 22.42  ? 66   LEU A C    1 
ATOM   987  O O    . LEU A 1 66  ? 48.745  10.445  21.654 1.00 18.59  ? 66   LEU A O    1 
ATOM   988  C CB   . LEU A 1 66  ? 47.923  12.640  20.334 1.00 20.37  ? 66   LEU A CB   1 
ATOM   989  C CG   . LEU A 1 66  ? 47.375  13.616  19.293 1.00 25.26  ? 66   LEU A CG   1 
ATOM   990  C CD1  . LEU A 1 66  ? 46.164  14.446  19.915 1.00 25.40  ? 66   LEU A CD1  1 
ATOM   991  C CD2  . LEU A 1 66  ? 48.386  14.685  18.846 1.00 42.74  ? 66   LEU A CD2  1 
ATOM   992  H H    . LEU A 1 66  ? 48.179  10.674  18.639 1.00 22.12  ? 66   LEU A H    1 
ATOM   993  H HA   . LEU A 1 66  ? 49.862  12.598  19.768 1.00 25.03  ? 66   LEU A HA   1 
ATOM   994  H HB2  . LEU A 1 66  ? 47.241  11.976  20.520 1.00 24.45  ? 66   LEU A HB2  1 
ATOM   995  H HB3  . LEU A 1 66  ? 48.085  13.128  21.156 1.00 24.45  ? 66   LEU A HB3  1 
ATOM   996  H HG   . LEU A 1 66  ? 47.060  13.116  18.510 1.00 30.32  ? 66   LEU A HG   1 
ATOM   997  H HD11 . LEU A 1 66  ? 45.482  13.841  20.216 1.00 38.10  ? 66   LEU A HD11 1 
ATOM   998  H HD12 . LEU A 1 66  ? 46.481  14.966  20.657 1.00 38.10  ? 66   LEU A HD12 1 
ATOM   999  H HD13 . LEU A 1 66  ? 45.800  15.031  19.247 1.00 38.10  ? 66   LEU A HD13 1 
ATOM   1000 H HD21 . LEU A 1 66  ? 47.970  15.273  18.211 1.00 64.11  ? 66   LEU A HD21 1 
ATOM   1001 H HD22 . LEU A 1 66  ? 48.676  15.190  19.609 1.00 64.11  ? 66   LEU A HD22 1 
ATOM   1002 H HD23 . LEU A 1 66  ? 49.144  14.259  18.438 1.00 64.11  ? 66   LEU A HD23 1 
ATOM   1003 N N    . SER A 1 67  ? 50.936  10.872  21.404 1.00 26.19  ? 67   SER A N    1 
ATOM   1004 C CA   . SER A 1 67  ? 51.370  9.981   22.322 1.00 30.05  ? 67   SER A CA   1 
ATOM   1005 C C    . SER A 1 67  ? 50.825  10.386  23.664 1.00 21.49  ? 67   SER A C    1 
ATOM   1006 O O    . SER A 1 67  ? 50.815  11.528  24.178 1.00 18.61  ? 67   SER A O    1 
ATOM   1007 C CB   A SER A 1 67  ? 53.030  9.562   22.598 0.46 21.11  ? 67   SER A CB   1 
ATOM   1008 C CB   B SER A 1 67  ? 52.762  9.402   22.827 0.54 25.75  ? 67   SER A CB   1 
ATOM   1009 O OG   A SER A 1 67  ? 53.455  10.832  22.746 0.46 33.23  ? 67   SER A OG   1 
ATOM   1010 O OG   B SER A 1 67  ? 53.221  8.204   23.856 0.54 19.18  ? 67   SER A OG   1 
ATOM   1011 H H    . SER A 1 67  ? 51.525  11.341  20.988 1.00 31.43  ? 67   SER A H    1 
ATOM   1012 H HA   A SER A 1 67  ? 50.921  9.139   22.102 1.00 36.06  ? 67   SER A HA   1 
ATOM   1013 H HB2  A SER A 1 67  ? 53.153  9.030   23.400 0.46 25.33  ? 67   SER A HB2  1 
ATOM   1014 H HB2  B SER A 1 67  ? 53.226  9.182   22.004 0.54 30.90  ? 67   SER A HB2  1 
ATOM   1015 H HB3  A SER A 1 67  ? 53.435  9.118   21.836 0.46 25.33  ? 67   SER A HB3  1 
ATOM   1016 H HB3  B SER A 1 67  ? 53.219  10.184  23.175 0.54 30.90  ? 67   SER A HB3  1 
ATOM   1017 H HG   A SER A 1 67  ? 53.282  11.259  22.067 0.46 49.85  ? 67   SER A HG   1 
ATOM   1018 H HG   B SER A 1 67  ? 52.872  7.498   23.626 0.54 28.77  ? 67   SER A HG   1 
ATOM   1019 N N    . GLY A 1 68  ? 50.317  9.376   24.354 1.00 22.61  ? 68   GLY A N    1 
ATOM   1020 C CA   . GLY A 1 68  ? 49.789  9.486   25.632 1.00 18.98  ? 68   GLY A CA   1 
ATOM   1021 C C    . GLY A 1 68  ? 48.321  9.851   25.708 1.00 16.44  ? 68   GLY A C    1 
ATOM   1022 O O    . GLY A 1 68  ? 47.765  9.999   26.783 1.00 17.25  ? 68   GLY A O    1 
ATOM   1023 H H    . GLY A 1 68  ? 50.315  8.600   23.985 1.00 27.13  ? 68   GLY A H    1 
ATOM   1024 H HA2  . GLY A 1 68  ? 49.917  8.640   26.088 1.00 22.78  ? 68   GLY A HA2  1 
ATOM   1025 H HA3  . GLY A 1 68  ? 50.296  10.157  26.115 1.00 22.78  ? 68   GLY A HA3  1 
ATOM   1026 N N    . TYR A 1 69  ? 47.682  10.115  24.526 1.00 14.55  ? 69   TYR A N    1 
ATOM   1027 C CA   . TYR A 1 69  ? 46.307  10.611  24.501 1.00 12.11  ? 69   TYR A CA   1 
ATOM   1028 C C    . TYR A 1 69  ? 45.332  9.433   24.265 1.00 12.67  ? 69   TYR A C    1 
ATOM   1029 O O    . TYR A 1 69  ? 45.619  8.469   23.529 1.00 15.98  ? 69   TYR A O    1 
ATOM   1030 C CB   . TYR A 1 69  ? 46.107  11.703  23.434 1.00 12.45  ? 69   TYR A CB   1 
ATOM   1031 C CG   . TYR A 1 69  ? 46.645  13.046  23.846 1.00 11.06  ? 69   TYR A CG   1 
ATOM   1032 C CD1  . TYR A 1 69  ? 48.013  13.253  24.076 1.00 12.48  ? 69   TYR A CD1  1 
ATOM   1033 C CD2  . TYR A 1 69  ? 45.782  14.110  24.028 1.00 12.98  ? 69   TYR A CD2  1 
ATOM   1034 C CE1  . TYR A 1 69  ? 48.455  14.517  24.514 1.00 14.89  ? 69   TYR A CE1  1 
ATOM   1035 C CE2  . TYR A 1 69  ? 46.275  15.356  24.453 1.00 16.30  ? 69   TYR A CE2  1 
ATOM   1036 C CZ   . TYR A 1 69  ? 47.625  15.568  24.706 1.00 16.83  ? 69   TYR A CZ   1 
ATOM   1037 O OH   . TYR A 1 69  ? 48.063  16.752  25.162 1.00 26.27  ? 69   TYR A OH   1 
ATOM   1038 H H    . TYR A 1 69  ? 48.098  9.986   23.785 1.00 17.46  ? 69   TYR A H    1 
ATOM   1039 H HA   . TYR A 1 69  ? 46.108  11.001  25.378 1.00 14.53  ? 69   TYR A HA   1 
ATOM   1040 H HB2  . TYR A 1 69  ? 46.547  11.426  22.615 1.00 14.94  ? 69   TYR A HB2  1 
ATOM   1041 H HB3  . TYR A 1 69  ? 45.159  11.788  23.246 1.00 14.94  ? 69   TYR A HB3  1 
ATOM   1042 H HD1  . TYR A 1 69  ? 48.622  12.563  23.941 1.00 14.97  ? 69   TYR A HD1  1 
ATOM   1043 H HD2  . TYR A 1 69  ? 44.872  14.002  23.868 1.00 15.57  ? 69   TYR A HD2  1 
ATOM   1044 H HE1  . TYR A 1 69  ? 49.363  14.635  24.678 1.00 17.87  ? 69   TYR A HE1  1 
ATOM   1045 H HE2  . TYR A 1 69  ? 45.679  16.060  24.569 1.00 19.56  ? 69   TYR A HE2  1 
ATOM   1046 H HH   . TYR A 1 69  ? 48.874  16.718  25.275 1.00 39.41  ? 69   TYR A HH   1 
ATOM   1047 N N    . THR A 1 70  ? 44.184  9.530   24.865 1.00 10.81  ? 70   THR A N    1 
ATOM   1048 C CA   . THR A 1 70  ? 43.130  8.524   24.761 1.00 10.76  ? 70   THR A CA   1 
ATOM   1049 C C    . THR A 1 70  ? 41.783  9.202   24.670 1.00 9.69   ? 70   THR A C    1 
ATOM   1050 O O    . THR A 1 70  ? 41.650  10.434  24.865 1.00 11.39  ? 70   THR A O    1 
ATOM   1051 C CB   . THR A 1 70  ? 43.170  7.563   25.974 1.00 12.08  ? 70   THR A CB   1 
ATOM   1052 O OG1  . THR A 1 70  ? 42.995  8.327   27.176 1.00 13.51  ? 70   THR A OG1  1 
ATOM   1053 C CG2  . THR A 1 70  ? 44.391  6.685   26.025 1.00 14.88  ? 70   THR A CG2  1 
ATOM   1054 H H    . THR A 1 70  ? 44.036  10.225  25.350 1.00 12.97  ? 70   THR A H    1 
ATOM   1055 H HA   . THR A 1 70  ? 43.274  8.003   23.943 1.00 12.92  ? 70   THR A HA   1 
ATOM   1056 H HB   . THR A 1 70  ? 42.394  6.970   25.895 1.00 14.49  ? 70   THR A HB   1 
ATOM   1057 H HG1  . THR A 1 70  ? 43.609  8.165   27.695 1.00 20.26  ? 70   THR A HG1  1 
ATOM   1058 H HG21 . THR A 1 70  ? 44.343  6.115   26.796 1.00 22.33  ? 70   THR A HG21 1 
ATOM   1059 H HG22 . THR A 1 70  ? 44.432  6.147   25.231 1.00 22.33  ? 70   THR A HG22 1 
ATOM   1060 H HG23 . THR A 1 70  ? 45.178  7.233   26.080 1.00 22.33  ? 70   THR A HG23 1 
ATOM   1061 N N    . TRP A 1 71  ? 40.712  8.427   24.426 1.00 9.64   ? 71   TRP A N    1 
ATOM   1062 C CA   . TRP A 1 71  ? 39.361  8.951   24.465 1.00 9.62   ? 71   TRP A CA   1 
ATOM   1063 C C    . TRP A 1 71  ? 38.439  7.812   24.943 1.00 9.61   ? 71   TRP A C    1 
ATOM   1064 O O    . TRP A 1 71  ? 38.717  6.618   24.785 1.00 10.05  ? 71   TRP A O    1 
ATOM   1065 C CB   . TRP A 1 71  ? 38.891  9.468   23.078 1.00 9.59   ? 71   TRP A CB   1 
ATOM   1066 C CG   . TRP A 1 71  ? 38.863  8.405   22.021 1.00 9.36   ? 71   TRP A CG   1 
ATOM   1067 C CD1  . TRP A 1 71  ? 39.967  7.945   21.322 1.00 9.10   ? 71   TRP A CD1  1 
ATOM   1068 C CD2  . TRP A 1 71  ? 37.726  7.639   21.560 1.00 8.91   ? 71   TRP A CD2  1 
ATOM   1069 N NE1  . TRP A 1 71  ? 39.562  6.936   20.449 1.00 9.32   ? 71   TRP A NE1  1 
ATOM   1070 C CE2  . TRP A 1 71  ? 38.199  6.741   20.571 1.00 9.19   ? 71   TRP A CE2  1 
ATOM   1071 C CE3  . TRP A 1 71  ? 36.350  7.665   21.865 1.00 9.46   ? 71   TRP A CE3  1 
ATOM   1072 C CZ2  . TRP A 1 71  ? 37.334  5.897   19.874 1.00 9.25   ? 71   TRP A CZ2  1 
ATOM   1073 C CZ3  . TRP A 1 71  ? 35.492  6.804   21.168 1.00 9.75   ? 71   TRP A CZ3  1 
ATOM   1074 C CH2  . TRP A 1 71  ? 36.007  5.932   20.193 1.00 9.71   ? 71   TRP A CH2  1 
ATOM   1075 H H    . TRP A 1 71  ? 40.833  7.595   24.242 1.00 11.56  ? 71   TRP A H    1 
ATOM   1076 H HA   . TRP A 1 71  ? 39.322  9.687   25.111 1.00 11.54  ? 71   TRP A HA   1 
ATOM   1077 H HB2  . TRP A 1 71  ? 38.001  9.844   23.168 1.00 11.50  ? 71   TRP A HB2  1 
ATOM   1078 H HB3  . TRP A 1 71  ? 39.484  10.180  22.791 1.00 11.50  ? 71   TRP A HB3  1 
ATOM   1079 H HD1  . TRP A 1 71  ? 40.838  8.259   21.420 1.00 10.92  ? 71   TRP A HD1  1 
ATOM   1080 H HE1  . TRP A 1 71  ? 40.080  6.503   19.917 1.00 11.18  ? 71   TRP A HE1  1 
ATOM   1081 H HE3  . TRP A 1 71  ? 36.019  8.242   22.515 1.00 11.35  ? 71   TRP A HE3  1 
ATOM   1082 H HZ2  . TRP A 1 71  ? 37.652  5.327   19.212 1.00 11.10  ? 71   TRP A HZ2  1 
ATOM   1083 H HZ3  . TRP A 1 71  ? 34.580  6.810   21.350 1.00 11.70  ? 71   TRP A HZ3  1 
ATOM   1084 H HH2  . TRP A 1 71  ? 35.423  5.359   19.750 1.00 11.65  ? 71   TRP A HH2  1 
ATOM   1085 N N    . SER A 1 72  ? 37.297  8.228   25.503 1.00 10.25  ? 72   SER A N    1 
ATOM   1086 C CA   . SER A 1 72  ? 36.281  7.292   25.997 1.00 10.45  ? 72   SER A CA   1 
ATOM   1087 C C    . SER A 1 72  ? 34.956  8.053   26.121 1.00 10.48  ? 72   SER A C    1 
ATOM   1088 O O    . SER A 1 72  ? 34.927  9.068   26.866 1.00 12.40  ? 72   SER A O    1 
ATOM   1089 C CB   . SER A 1 72  ? 36.720  6.712   27.360 1.00 11.59  ? 72   SER A CB   1 
ATOM   1090 O OG   . SER A 1 72  ? 35.699  5.851   27.839 1.00 14.21  ? 72   SER A OG   1 
ATOM   1091 H H    . SER A 1 72  ? 37.153  9.073   25.577 1.00 12.30  ? 72   SER A H    1 
ATOM   1092 H HA   . SER A 1 72  ? 36.175  6.561   25.353 1.00 12.54  ? 72   SER A HA   1 
ATOM   1093 H HB2  . SER A 1 72  ? 37.548  6.217   27.258 1.00 13.90  ? 72   SER A HB2  1 
ATOM   1094 H HB3  . SER A 1 72  ? 36.870  7.431   27.993 1.00 13.90  ? 72   SER A HB3  1 
ATOM   1095 H HG   . SER A 1 72  ? 35.922  5.538   28.563 1.00 21.32  ? 72   SER A HG   1 
ATOM   1096 N N    . ILE A 1 73  ? 33.940  7.612   25.452 1.00 9.91   ? 73   ILE A N    1 
ATOM   1097 C CA   . ILE A 1 73  ? 32.658  8.317   25.398 1.00 10.12  ? 73   ILE A CA   1 
ATOM   1098 C C    . ILE A 1 73  ? 31.538  7.389   25.735 1.00 9.89   ? 73   ILE A C    1 
ATOM   1099 O O    . ILE A 1 73  ? 31.559  6.174   25.425 1.00 11.63  ? 73   ILE A O    1 
ATOM   1100 C CB   . ILE A 1 73  ? 32.473  8.982   24.007 1.00 10.79  ? 73   ILE A CB   1 
ATOM   1101 C CG1  . ILE A 1 73  ? 31.298  9.985   23.997 1.00 11.49  ? 73   ILE A CG1  1 
ATOM   1102 C CG2  . ILE A 1 73  ? 32.327  7.963   22.908 1.00 12.88  ? 73   ILE A CG2  1 
ATOM   1103 C CD1  . ILE A 1 73  ? 31.374  10.988  22.847 1.00 13.07  ? 73   ILE A CD1  1 
ATOM   1104 H H    . ILE A 1 73  ? 34.022  6.873   25.020 1.00 11.90  ? 73   ILE A H    1 
ATOM   1105 H HA   . ILE A 1 73  ? 32.676  9.028   26.072 1.00 12.15  ? 73   ILE A HA   1 
ATOM   1106 H HB   . ILE A 1 73  ? 33.289  9.492   23.820 1.00 12.95  ? 73   ILE A HB   1 
ATOM   1107 H HG12 . ILE A 1 73  ? 30.464  9.493   23.931 1.00 13.79  ? 73   ILE A HG12 1 
ATOM   1108 H HG13 . ILE A 1 73  ? 31.289  10.469  24.837 1.00 13.79  ? 73   ILE A HG13 1 
ATOM   1109 H HG21 . ILE A 1 73  ? 33.067  7.352   22.938 1.00 19.32  ? 73   ILE A HG21 1 
ATOM   1110 H HG22 . ILE A 1 73  ? 31.507  7.479   23.028 1.00 19.32  ? 73   ILE A HG22 1 
ATOM   1111 H HG23 . ILE A 1 73  ? 32.314  8.409   22.058 1.00 19.32  ? 73   ILE A HG23 1 
ATOM   1112 H HD11 . ILE A 1 73  ? 32.186  11.495  22.918 1.00 19.61  ? 73   ILE A HD11 1 
ATOM   1113 H HD12 . ILE A 1 73  ? 31.363  10.517  22.011 1.00 19.61  ? 73   ILE A HD12 1 
ATOM   1114 H HD13 . ILE A 1 73  ? 30.621  11.582  22.890 1.00 19.61  ? 73   ILE A HD13 1 
ATOM   1115 N N    . SER A 1 74  ? 30.486  7.917   26.356 1.00 10.68  ? 74   SER A N    1 
ATOM   1116 C CA   . SER A 1 74  ? 29.265  7.242   26.716 1.00 11.07  ? 74   SER A CA   1 
ATOM   1117 C C    . SER A 1 74  ? 28.078  8.081   26.292 1.00 10.61  ? 74   SER A C    1 
ATOM   1118 O O    . SER A 1 74  ? 28.112  9.319   26.411 1.00 14.29  ? 74   SER A O    1 
ATOM   1119 C CB   A SER A 1 74  ? 29.093  7.194   28.308 0.49 17.63  ? 74   SER A CB   1 
ATOM   1120 C CB   B SER A 1 74  ? 29.343  6.955   28.281 0.51 15.93  ? 74   SER A CB   1 
ATOM   1121 O OG   A SER A 1 74  ? 28.050  6.538   28.684 0.49 32.94  ? 74   SER A OG   1 
ATOM   1122 O OG   B SER A 1 74  ? 30.353  6.275   28.704 0.51 18.23  ? 74   SER A OG   1 
ATOM   1123 H H    . SER A 1 74  ? 30.541  8.749   26.565 1.00 12.81  ? 74   SER A H    1 
ATOM   1124 H HA   A SER A 1 74  ? 29.225  6.345   26.326 1.00 13.28  ? 74   SER A HA   1 
ATOM   1125 H HB2  A SER A 1 74  ? 29.881  6.784   28.698 0.49 21.16  ? 74   SER A HB2  1 
ATOM   1126 H HB2  B SER A 1 74  ? 29.341  7.807   28.744 0.51 19.11  ? 74   SER A HB2  1 
ATOM   1127 H HB3  A SER A 1 74  ? 29.033  8.101   28.647 0.49 21.16  ? 74   SER A HB3  1 
ATOM   1128 H HB3  B SER A 1 74  ? 28.535  6.485   28.541 0.51 19.11  ? 74   SER A HB3  1 
ATOM   1129 H HG   A SER A 1 74  ? 28.052  6.465   29.501 0.49 49.41  ? 74   SER A HG   1 
ATOM   1130 H HG   B SER A 1 74  ? 31.046  6.665   28.506 0.51 27.35  ? 74   SER A HG   1 
ATOM   1131 N N    . TYR A 1 75  ? 27.046  7.442   25.794 1.00 9.90   ? 75   TYR A N    1 
ATOM   1132 C CA   . TYR A 1 75  ? 25.855  8.117   25.235 1.00 9.72   ? 75   TYR A CA   1 
ATOM   1133 C C    . TYR A 1 75  ? 24.616  7.804   26.018 1.00 9.68   ? 75   TYR A C    1 
ATOM   1134 O O    . TYR A 1 75  ? 24.529  6.876   26.838 1.00 11.37  ? 75   TYR A O    1 
ATOM   1135 C CB   . TYR A 1 75  ? 25.691  7.692   23.741 1.00 9.87   ? 75   TYR A CB   1 
ATOM   1136 C CG   . TYR A 1 75  ? 26.856  8.065   22.858 1.00 9.58   ? 75   TYR A CG   1 
ATOM   1137 C CD1  . TYR A 1 75  ? 27.051  9.342   22.387 1.00 9.46   ? 75   TYR A CD1  1 
ATOM   1138 C CD2  . TYR A 1 75  ? 27.783  7.066   22.453 1.00 10.19  ? 75   TYR A CD2  1 
ATOM   1139 C CE1  . TYR A 1 75  ? 28.115  9.673   21.520 1.00 9.83   ? 75   TYR A CE1  1 
ATOM   1140 C CE2  . TYR A 1 75  ? 28.835  7.388   21.631 1.00 10.16  ? 75   TYR A CE2  1 
ATOM   1141 C CZ   . TYR A 1 75  ? 29.010  8.689   21.152 1.00 9.85   ? 75   TYR A CZ   1 
ATOM   1142 O OH   . TYR A 1 75  ? 30.076  8.914   20.304 1.00 10.54  ? 75   TYR A OH   1 
ATOM   1143 H H    . TYR A 1 75  ? 27.063  6.583   25.792 1.00 11.88  ? 75   TYR A H    1 
ATOM   1144 H HA   . TYR A 1 75  ? 26.005  9.085   25.267 1.00 11.66  ? 75   TYR A HA   1 
ATOM   1145 H HB2  . TYR A 1 75  ? 25.568  6.730   23.704 1.00 11.84  ? 75   TYR A HB2  1 
ATOM   1146 H HB3  . TYR A 1 75  ? 24.888  8.104   23.387 1.00 11.84  ? 75   TYR A HB3  1 
ATOM   1147 H HD1  . TYR A 1 75  ? 26.462  10.012  22.650 1.00 11.35  ? 75   TYR A HD1  1 
ATOM   1148 H HD2  . TYR A 1 75  ? 27.676  6.190   22.746 1.00 12.22  ? 75   TYR A HD2  1 
ATOM   1149 H HE1  . TYR A 1 75  ? 28.211  10.541  21.201 1.00 11.79  ? 75   TYR A HE1  1 
ATOM   1150 H HE2  . TYR A 1 75  ? 29.442  6.727   21.388 1.00 12.19  ? 75   TYR A HE2  1 
ATOM   1151 H HH   . TYR A 1 75  ? 30.079  9.700   20.071 1.00 15.82  ? 75   TYR A HH   1 
ATOM   1152 N N    . GLY A 1 76  ? 23.536  8.570   25.737 1.00 10.29  ? 76   GLY A N    1 
ATOM   1153 C CA   . GLY A 1 76  ? 22.305  8.467   26.491 1.00 11.28  ? 76   GLY A CA   1 
ATOM   1154 C C    . GLY A 1 76  ? 21.618  7.120   26.468 1.00 10.69  ? 76   GLY A C    1 
ATOM   1155 O O    . GLY A 1 76  ? 21.012  6.726   27.451 1.00 13.19  ? 76   GLY A O    1 
ATOM   1156 H H    . GLY A 1 76  ? 23.582  9.135   25.091 1.00 12.34  ? 76   GLY A H    1 
ATOM   1157 H HA2  . GLY A 1 76  ? 22.495  8.694   27.414 1.00 13.54  ? 76   GLY A HA2  1 
ATOM   1158 H HA3  . GLY A 1 76  ? 21.685  9.130   26.151 1.00 13.54  ? 76   GLY A HA3  1 
ATOM   1159 N N    . ASP A 1 77  ? 21.748  6.375   25.335 1.00 10.89  ? 77   ASP A N    1 
ATOM   1160 C CA   . ASP A 1 77  ? 21.209  5.002   25.238 1.00 11.86  ? 77   ASP A CA   1 
ATOM   1161 C C    . ASP A 1 77  ? 22.104  3.945   25.868 1.00 11.85  ? 77   ASP A C    1 
ATOM   1162 O O    . ASP A 1 77  ? 21.801  2.749   25.742 1.00 14.25  ? 77   ASP A O    1 
ATOM   1163 C CB   . ASP A 1 77  ? 20.837  4.633   23.793 1.00 12.71  ? 77   ASP A CB   1 
ATOM   1164 C CG   . ASP A 1 77  ? 22.003  4.754   22.854 1.00 12.27  ? 77   ASP A CG   1 
ATOM   1165 O OD1  . ASP A 1 77  ? 23.202  4.690   23.321 1.00 12.02  ? 77   ASP A OD1  1 
ATOM   1166 O OD2  . ASP A 1 77  ? 21.716  4.877   21.608 1.00 15.16  ? 77   ASP A OD2  1 
ATOM   1167 H H    . ASP A 1 77  ? 22.156  6.713   24.657 1.00 13.07  ? 77   ASP A H    1 
ATOM   1168 H HA   . ASP A 1 77  ? 20.373  4.997   25.749 1.00 14.23  ? 77   ASP A HA   1 
ATOM   1169 H HB2  . ASP A 1 77  ? 20.506  3.721   23.773 1.00 15.25  ? 77   ASP A HB2  1 
ATOM   1170 H HB3  . ASP A 1 77  ? 20.123  5.215   23.490 1.00 15.25  ? 77   ASP A HB3  1 
ATOM   1171 N N    . GLY A 1 78  ? 23.152  4.354   26.566 1.00 11.26  ? 78   GLY A N    1 
ATOM   1172 C CA   . GLY A 1 78  ? 24.062  3.404   27.225 1.00 12.31  ? 78   GLY A CA   1 
ATOM   1173 C C    . GLY A 1 78  ? 25.147  2.863   26.352 1.00 11.49  ? 78   GLY A C    1 
ATOM   1174 O O    . GLY A 1 78  ? 25.974  2.064   26.857 1.00 14.44  ? 78   GLY A O    1 
ATOM   1175 H H    . GLY A 1 78  ? 23.306  5.198   26.636 1.00 13.52  ? 78   GLY A H    1 
ATOM   1176 H HA2  . GLY A 1 78  ? 24.469  3.844   27.987 1.00 14.77  ? 78   GLY A HA2  1 
ATOM   1177 H HA3  . GLY A 1 78  ? 23.538  2.660   27.563 1.00 14.77  ? 78   GLY A HA3  1 
ATOM   1178 N N    . SER A 1 79  ? 25.204  3.225   25.084 1.00 10.60  ? 79   SER A N    1 
ATOM   1179 C CA   . SER A 1 79  ? 26.289  2.797   24.226 1.00 10.53  ? 79   SER A CA   1 
ATOM   1180 C C    . SER A 1 79  ? 27.571  3.535   24.564 1.00 9.87   ? 79   SER A C    1 
ATOM   1181 O O    . SER A 1 79  ? 27.563  4.605   25.250 1.00 10.63  ? 79   SER A O    1 
ATOM   1182 C CB   . SER A 1 79  ? 25.869  2.989   22.762 1.00 11.20  ? 79   SER A CB   1 
ATOM   1183 O OG   . SER A 1 79  ? 25.719  4.324   22.415 1.00 11.65  ? 79   SER A OG   1 
ATOM   1184 H H    . SER A 1 79  ? 24.584  3.726   24.761 1.00 12.72  ? 79   SER A H    1 
ATOM   1185 H HA   . SER A 1 79  ? 26.439  1.840   24.377 1.00 12.63  ? 79   SER A HA   1 
ATOM   1186 H HB2  . SER A 1 79  ? 26.537  2.586   22.186 1.00 13.44  ? 79   SER A HB2  1 
ATOM   1187 H HB3  . SER A 1 79  ? 25.029  2.527   22.611 1.00 13.44  ? 79   SER A HB3  1 
ATOM   1188 H HG   . SER A 1 79  ? 25.146  4.667   22.890 1.00 17.47  ? 79   SER A HG   1 
ATOM   1189 N N    . SER A 1 80  ? 28.706  3.006   24.115 1.00 10.22  ? 80   SER A N    1 
ATOM   1190 C CA   . SER A 1 80  ? 30.014  3.574   24.474 1.00 10.19  ? 80   SER A CA   1 
ATOM   1191 C C    . SER A 1 80  ? 31.053  3.099   23.464 1.00 10.25  ? 80   SER A C    1 
ATOM   1192 O O    . SER A 1 80  ? 30.886  2.097   22.760 1.00 10.99  ? 80   SER A O    1 
ATOM   1193 C CB   . SER A 1 80  ? 30.414  3.189   25.882 1.00 11.97  ? 80   SER A CB   1 
ATOM   1194 O OG   . SER A 1 80  ? 30.599  1.787   26.058 1.00 13.14  ? 80   SER A OG   1 
ATOM   1195 H H    . SER A 1 80  ? 28.674  2.315   23.603 1.00 12.26  ? 80   SER A H    1 
ATOM   1196 H HA   . SER A 1 80  ? 29.954  4.551   24.423 1.00 12.23  ? 80   SER A HA   1 
ATOM   1197 H HB2  . SER A 1 80  ? 31.239  3.645   26.110 1.00 14.37  ? 80   SER A HB2  1 
ATOM   1198 H HB3  . SER A 1 80  ? 29.729  3.494   26.497 1.00 14.37  ? 80   SER A HB3  1 
ATOM   1199 H HG   . SER A 1 80  ? 31.190  1.524   25.554 1.00 19.72  ? 80   SER A HG   1 
ATOM   1200 N N    . ALA A 1 81  ? 32.205  3.818   23.468 1.00 9.72   ? 81   ALA A N    1 
ATOM   1201 C CA   . ALA A 1 81  ? 33.364  3.445   22.662 1.00 9.63   ? 81   ALA A CA   1 
ATOM   1202 C C    . ALA A 1 81  ? 34.604  4.120   23.250 1.00 9.41   ? 81   ALA A C    1 
ATOM   1203 O O    . ALA A 1 81  ? 34.465  5.120   23.984 1.00 10.10  ? 81   ALA A O    1 
ATOM   1204 C CB   . ALA A 1 81  ? 33.155  3.825   21.172 1.00 10.65  ? 81   ALA A CB   1 
ATOM   1205 H H    . ALA A 1 81  ? 32.254  4.519   23.964 1.00 11.67  ? 81   ALA A H    1 
ATOM   1206 H HA   . ALA A 1 81  ? 33.482  2.474   22.721 1.00 11.55  ? 81   ALA A HA   1 
ATOM   1207 H HB1  . ALA A 1 81  ? 33.920  3.550   20.661 1.00 15.97  ? 81   ALA A HB1  1 
ATOM   1208 H HB2  . ALA A 1 81  ? 32.371  3.385   20.836 1.00 15.97  ? 81   ALA A HB2  1 
ATOM   1209 H HB3  . ALA A 1 81  ? 33.046  4.776   21.096 1.00 15.97  ? 81   ALA A HB3  1 
ATOM   1210 N N    . SER A 1 82  ? 35.786  3.593   22.950 1.00 9.40   ? 82   SER A N    1 
ATOM   1211 C CA   . SER A 1 82  ? 37.034  4.177   23.443 1.00 9.54   ? 82   SER A CA   1 
ATOM   1212 C C    . SER A 1 82  ? 38.189  3.776   22.576 1.00 9.05   ? 82   SER A C    1 
ATOM   1213 O O    . SER A 1 82  ? 38.136  2.816   21.783 1.00 9.74   ? 82   SER A O    1 
ATOM   1214 C CB   . SER A 1 82  ? 37.273  3.778   24.922 1.00 10.27  ? 82   SER A CB   1 
ATOM   1215 O OG   . SER A 1 82  ? 37.415  2.338   25.024 1.00 11.27  ? 82   SER A OG   1 
ATOM   1216 H H    . SER A 1 82  ? 35.819  2.891   22.454 1.00 11.28  ? 82   SER A H    1 
ATOM   1217 H HA   . SER A 1 82  ? 36.949  5.153   23.403 1.00 11.45  ? 82   SER A HA   1 
ATOM   1218 H HB2  . SER A 1 82  ? 38.076  4.210   25.251 1.00 12.32  ? 82   SER A HB2  1 
ATOM   1219 H HB3  . SER A 1 82  ? 36.526  4.072   25.465 1.00 12.32  ? 82   SER A HB3  1 
ATOM   1220 H HG   . SER A 1 82  ? 38.053  2.094   24.570 1.00 16.91  ? 82   SER A HG   1 
ATOM   1221 N N    . GLY A 1 83  ? 39.322  4.490   22.736 1.00 9.26   ? 83   GLY A N    1 
ATOM   1222 C CA   . GLY A 1 83  ? 40.529  4.171   21.985 1.00 9.22   ? 83   GLY A CA   1 
ATOM   1223 C C    . GLY A 1 83  ? 41.610  5.229   22.144 1.00 9.15   ? 83   GLY A C    1 
ATOM   1224 O O    . GLY A 1 83  ? 41.768  5.847   23.231 1.00 9.42   ? 83   GLY A O    1 
ATOM   1225 H H    . GLY A 1 83  ? 39.332  5.146   23.291 1.00 11.11  ? 83   GLY A H    1 
ATOM   1226 H HA2  . GLY A 1 83  ? 40.874  3.317   22.288 1.00 11.06  ? 83   GLY A HA2  1 
ATOM   1227 H HA3  . GLY A 1 83  ? 40.305  4.085   21.045 1.00 11.06  ? 83   GLY A HA3  1 
ATOM   1228 N N    . ASN A 1 84  ? 42.387  5.413   21.100 1.00 9.30   ? 84   ASN A N    1 
ATOM   1229 C CA   . ASN A 1 84  ? 43.523  6.329   21.072 1.00 9.33   ? 84   ASN A CA   1 
ATOM   1230 C C    . ASN A 1 84  ? 43.351  7.353   19.910 1.00 9.10   ? 84   ASN A C    1 
ATOM   1231 O O    . ASN A 1 84  ? 42.288  7.376   19.262 1.00 9.20   ? 84   ASN A O    1 
ATOM   1232 C CB   . ASN A 1 84  ? 44.882  5.604   21.089 1.00 10.29  ? 84   ASN A CB   1 
ATOM   1233 C CG   . ASN A 1 84  ? 45.053  4.669   19.916 1.00 10.10  ? 84   ASN A CG   1 
ATOM   1234 O OD1  . ASN A 1 84  ? 46.150  3.967   19.843 1.00 15.44  ? 84   ASN A OD1  1 
ATOM   1235 N ND2  . ASN A 1 84  ? 44.167  4.585   19.036 1.00 9.52   ? 84   ASN A ND2  1 
ATOM   1236 H H    . ASN A 1 84  ? 42.215  4.964   20.387 1.00 11.16  ? 84   ASN A H    1 
ATOM   1237 H HA   . ASN A 1 84  ? 43.479  6.847   21.902 1.00 11.19  ? 84   ASN A HA   1 
ATOM   1238 H HB2  . ASN A 1 84  ? 45.594  6.263   21.076 1.00 12.34  ? 84   ASN A HB2  1 
ATOM   1239 H HB3  . ASN A 1 84  ? 44.961  5.097   21.913 1.00 12.34  ? 84   ASN A HB3  1 
ATOM   1240 H HD21 . ASN A 1 84  ? 43.450  5.056   19.101 1.00 11.43  ? 84   ASN A HD21 1 
ATOM   1241 H HD22 . ASN A 1 84  ? 44.275  4.057   18.366 1.00 11.43  ? 84   ASN A HD22 1 
ATOM   1242 N N    . VAL A 1 85  ? 44.326  8.242   19.732 1.00 9.30   ? 85   VAL A N    1 
ATOM   1243 C CA   . VAL A 1 85  ? 44.103  9.476   18.948 1.00 9.44   ? 85   VAL A CA   1 
ATOM   1244 C C    . VAL A 1 85  ? 45.233  9.699   17.965 1.00 9.40   ? 85   VAL A C    1 
ATOM   1245 O O    . VAL A 1 85  ? 46.425  9.673   18.351 1.00 10.20  ? 85   VAL A O    1 
ATOM   1246 C CB   . VAL A 1 85  ? 43.928  10.710  19.872 1.00 10.00  ? 85   VAL A CB   1 
ATOM   1247 C CG1  . VAL A 1 85  ? 43.444  11.901  19.054 1.00 12.43  ? 85   VAL A CG1  1 
ATOM   1248 C CG2  . VAL A 1 85  ? 42.906  10.432  20.995 1.00 10.63  ? 85   VAL A CG2  1 
ATOM   1249 H H    . VAL A 1 85  ? 45.099  8.095   20.079 1.00 11.16  ? 85   VAL A H    1 
ATOM   1250 H HA   . VAL A 1 85  ? 43.275  9.362   18.436 1.00 11.32  ? 85   VAL A HA   1 
ATOM   1251 H HB   . VAL A 1 85  ? 44.793  10.931  20.275 1.00 12.00  ? 85   VAL A HB   1 
ATOM   1252 H HG11 . VAL A 1 85  ? 44.071  12.082  18.350 1.00 18.64  ? 85   VAL A HG11 1 
ATOM   1253 H HG12 . VAL A 1 85  ? 42.586  11.700  18.673 1.00 18.64  ? 85   VAL A HG12 1 
ATOM   1254 H HG13 . VAL A 1 85  ? 43.370  12.671  19.623 1.00 18.64  ? 85   VAL A HG13 1 
ATOM   1255 H HG21 . VAL A 1 85  ? 42.049  10.237  20.608 1.00 15.95  ? 85   VAL A HG21 1 
ATOM   1256 H HG22 . VAL A 1 85  ? 43.199  9.681   21.517 1.00 15.95  ? 85   VAL A HG22 1 
ATOM   1257 H HG23 . VAL A 1 85  ? 42.833  11.205  21.560 1.00 15.95  ? 85   VAL A HG23 1 
ATOM   1258 N N    . PHE A 1 86  ? 44.872  10.048  16.724 1.00 9.90   ? 86   PHE A N    1 
ATOM   1259 C CA   . PHE A 1 86  ? 45.782  10.398  15.663 1.00 10.05  ? 86   PHE A CA   1 
ATOM   1260 C C    . PHE A 1 86  ? 45.321  11.682  14.989 1.00 10.66  ? 86   PHE A C    1 
ATOM   1261 O O    . PHE A 1 86  ? 44.123  11.886  14.879 1.00 17.37  ? 86   PHE A O    1 
ATOM   1262 C CB   . PHE A 1 86  ? 45.850  9.284   14.584 1.00 11.20  ? 86   PHE A CB   1 
ATOM   1263 C CG   . PHE A 1 86  ? 46.370  7.962   15.130 1.00 11.51  ? 86   PHE A CG   1 
ATOM   1264 C CD1  . PHE A 1 86  ? 45.470  7.109   15.787 1.00 12.28  ? 86   PHE A CD1  1 
ATOM   1265 C CD2  . PHE A 1 86  ? 47.697  7.599   15.018 1.00 12.38  ? 86   PHE A CD2  1 
ATOM   1266 C CE1  . PHE A 1 86  ? 45.923  5.932   16.353 1.00 13.57  ? 86   PHE A CE1  1 
ATOM   1267 C CE2  . PHE A 1 86  ? 48.148  6.400   15.552 1.00 14.99  ? 86   PHE A CE2  1 
ATOM   1268 C CZ   . PHE A 1 86  ? 47.273  5.594   16.230 1.00 15.00  ? 86   PHE A CZ   1 
ATOM   1269 H H    . PHE A 1 86  ? 44.031  10.065  16.546 1.00 11.88  ? 86   PHE A H    1 
ATOM   1270 H HA   . PHE A 1 86  ? 46.676  10.536  16.039 1.00 12.06  ? 86   PHE A HA   1 
ATOM   1271 H HB2  . PHE A 1 86  ? 44.964  9.147   14.214 1.00 13.44  ? 86   PHE A HB2  1 
ATOM   1272 H HB3  . PHE A 1 86  ? 46.429  9.578   13.863 1.00 13.44  ? 86   PHE A HB3  1 
ATOM   1273 H HD1  . PHE A 1 86  ? 44.569  7.335   15.841 1.00 14.74  ? 86   PHE A HD1  1 
ATOM   1274 H HD2  . PHE A 1 86  ? 48.294  8.162   14.581 1.00 14.86  ? 86   PHE A HD2  1 
ATOM   1275 H HE1  . PHE A 1 86  ? 45.337  5.373   16.810 1.00 16.28  ? 86   PHE A HE1  1 
ATOM   1276 H HE2  . PHE A 1 86  ? 49.037  6.146   15.450 1.00 17.98  ? 86   PHE A HE2  1 
ATOM   1277 H HZ   . PHE A 1 86  ? 47.583  4.806   16.616 1.00 18.00  ? 86   PHE A HZ   1 
ATOM   1278 N N    . THR A 1 87  ? 46.201  12.516  14.490 1.00 10.02  ? 87   THR A N    1 
ATOM   1279 C CA   . THR A 1 87  ? 45.744  13.590  13.604 1.00 10.15  ? 87   THR A CA   1 
ATOM   1280 C C    . THR A 1 87  ? 45.909  13.173  12.130 1.00 10.12  ? 87   THR A C    1 
ATOM   1281 O O    . THR A 1 87  ? 46.809  12.402  11.770 1.00 11.33  ? 87   THR A O    1 
ATOM   1282 C CB   . THR A 1 87  ? 46.518  14.884  13.904 1.00 12.51  ? 87   THR A CB   1 
ATOM   1283 O OG1  . THR A 1 87  ? 47.878  14.696  13.730 1.00 15.21  ? 87   THR A OG1  1 
ATOM   1284 C CG2  . THR A 1 87  ? 46.182  15.378  15.362 1.00 14.91  ? 87   THR A CG2  1 
ATOM   1285 H H    . THR A 1 87  ? 47.036  12.433  14.679 1.00 12.03  ? 87   THR A H    1 
ATOM   1286 H HA   . THR A 1 87  ? 44.793  13.750  13.776 1.00 12.18  ? 87   THR A HA   1 
ATOM   1287 H HB   . THR A 1 87  ? 46.221  15.572  13.272 1.00 15.01  ? 87   THR A HB   1 
ATOM   1288 H HG1  . THR A 1 87  ? 48.274  15.395  13.895 1.00 22.81  ? 87   THR A HG1  1 
ATOM   1289 H HG21 . THR A 1 87  ? 46.660  16.190  15.544 1.00 22.36  ? 87   THR A HG21 1 
ATOM   1290 H HG22 . THR A 1 87  ? 45.238  15.539  15.436 1.00 22.36  ? 87   THR A HG22 1 
ATOM   1291 H HG23 . THR A 1 87  ? 46.441  14.705  15.996 1.00 22.36  ? 87   THR A HG23 1 
ATOM   1292 N N    . ASP A 1 88  ? 45.001  13.671  11.298 1.00 9.77   ? 88   ASP A N    1 
ATOM   1293 C CA   . ASP A 1 88  ? 44.976  13.293  9.884  1.00 10.26  ? 88   ASP A CA   1 
ATOM   1294 C C    . ASP A 1 88  ? 44.152  14.343  9.122  1.00 9.94   ? 88   ASP A C    1 
ATOM   1295 O O    . ASP A 1 88  ? 43.550  15.257  9.684  1.00 11.13  ? 88   ASP A O    1 
ATOM   1296 C CB   . ASP A 1 88  ? 44.407  11.853  9.732  1.00 10.75  ? 88   ASP A CB   1 
ATOM   1297 C CG   . ASP A 1 88  ? 44.997  11.062  8.580  1.00 11.59  ? 88   ASP A CG   1 
ATOM   1298 O OD1  . ASP A 1 88  ? 45.348  11.641  7.528  1.00 12.79  ? 88   ASP A OD1  1 
ATOM   1299 O OD2  . ASP A 1 88  ? 45.145  9.806   8.752  1.00 12.99  ? 88   ASP A OD2  1 
ATOM   1300 H H    . ASP A 1 88  ? 44.417  14.227  11.595 1.00 11.73  ? 88   ASP A H    1 
ATOM   1301 H HA   . ASP A 1 88  ? 45.894  13.305  9.540  1.00 12.31  ? 88   ASP A HA   1 
ATOM   1302 H HB2  . ASP A 1 88  ? 44.567  11.367  10.556 1.00 12.90  ? 88   ASP A HB2  1 
ATOM   1303 H HB3  . ASP A 1 88  ? 43.446  11.911  9.608  1.00 12.90  ? 88   ASP A HB3  1 
ATOM   1304 N N    . SER A 1 89  ? 44.125  14.180  7.777  1.00 10.35  ? 89   SER A N    1 
ATOM   1305 C CA   . SER A 1 89  ? 43.277  14.987  6.918  1.00 10.60  ? 89   SER A CA   1 
ATOM   1306 C C    . SER A 1 89  ? 41.881  14.408  6.881  1.00 10.55  ? 89   SER A C    1 
ATOM   1307 O O    . SER A 1 89  ? 41.690  13.212  6.683  1.00 13.85  ? 89   SER A O    1 
ATOM   1308 C CB   A SER A 1 89  ? 43.795  15.258  5.481  0.33 14.54  ? 89   SER A CB   1 
ATOM   1309 C CB   B SER A 1 89  ? 43.877  14.827  5.413  0.33 13.01  ? 89   SER A CB   1 
ATOM   1310 C CB   C SER A 1 89  ? 43.884  14.929  5.560  0.34 12.78  ? 89   SER A CB   1 
ATOM   1311 O OG   A SER A 1 89  ? 45.069  15.868  5.521  0.33 17.23  ? 89   SER A OG   1 
ATOM   1312 O OG   B SER A 1 89  ? 43.774  13.617  4.919  0.33 15.05  ? 89   SER A OG   1 
ATOM   1313 O OG   C SER A 1 89  ? 43.224  15.705  4.601  0.34 14.64  ? 89   SER A OG   1 
ATOM   1314 H H    . SER A 1 89  ? 44.627  13.579  7.420  1.00 12.42  ? 89   SER A H    1 
ATOM   1315 H HA   A SER A 1 89  ? 43.200  15.862  7.352  1.00 12.72  ? 89   SER A HA   1 
ATOM   1316 H HB2  A SER A 1 89  ? 43.851  14.422  4.993  0.33 17.44  ? 89   SER A HB2  1 
ATOM   1317 H HB2  B SER A 1 89  ? 43.412  15.444  4.826  0.33 15.62  ? 89   SER A HB2  1 
ATOM   1318 H HB2  C SER A 1 89  ? 44.806  15.226  5.619  0.34 15.33  ? 89   SER A HB2  1 
ATOM   1319 H HB3  A SER A 1 89  ? 43.173  15.838  5.015  0.33 17.44  ? 89   SER A HB3  1 
ATOM   1320 H HB3  B SER A 1 89  ? 44.813  15.081  5.423  0.33 15.62  ? 89   SER A HB3  1 
ATOM   1321 H HB3  C SER A 1 89  ? 43.891  14.007  5.262  0.34 15.33  ? 89   SER A HB3  1 
ATOM   1322 H HG   A SER A 1 89  ? 45.571  15.421  5.990  0.33 25.85  ? 89   SER A HG   1 
ATOM   1323 H HG   B SER A 1 89  ? 42.990  13.379  4.942  0.33 22.58  ? 89   SER A HG   1 
ATOM   1324 H HG   C SER A 1 89  ? 43.599  15.621  3.877  0.34 21.96  ? 89   SER A HG   1 
ATOM   1325 N N    . VAL A 1 90  ? 40.877  15.276  7.092  1.00 10.11  ? 90   VAL A N    1 
ATOM   1326 C CA   . VAL A 1 90  ? 39.461  14.870  7.145  1.00 9.76   ? 90   VAL A CA   1 
ATOM   1327 C C    . VAL A 1 90  ? 38.693  15.796  6.214  1.00 9.90   ? 90   VAL A C    1 
ATOM   1328 O O    . VAL A 1 90  ? 38.702  17.032  6.396  1.00 11.05  ? 90   VAL A O    1 
ATOM   1329 C CB   . VAL A 1 90  ? 38.924  14.993  8.563  1.00 10.10  ? 90   VAL A CB   1 
ATOM   1330 C CG1  . VAL A 1 90  ? 37.398  14.732  8.613  1.00 10.94  ? 90   VAL A CG1  1 
ATOM   1331 C CG2  . VAL A 1 90  ? 39.649  13.999  9.505  1.00 10.88  ? 90   VAL A CG2  1 
ATOM   1332 H H    . VAL A 1 90  ? 41.069  16.108  7.201  1.00 12.14  ? 90   VAL A H    1 
ATOM   1333 H HA   . VAL A 1 90  ? 39.372  13.943  6.837  1.00 11.71  ? 90   VAL A HA   1 
ATOM   1334 H HB   . VAL A 1 90  ? 39.094  15.904  8.882  1.00 12.12  ? 90   VAL A HB   1 
ATOM   1335 H HG11 . VAL A 1 90  ? 37.215  13.847  8.291  1.00 16.41  ? 90   VAL A HG11 1 
ATOM   1336 H HG12 . VAL A 1 90  ? 37.089  14.814  9.518  1.00 16.41  ? 90   VAL A HG12 1 
ATOM   1337 H HG13 . VAL A 1 90  ? 36.946  15.374  8.061  1.00 16.41  ? 90   VAL A HG13 1 
ATOM   1338 H HG21 . VAL A 1 90  ? 39.296  14.085  10.393 1.00 16.32  ? 90   VAL A HG21 1 
ATOM   1339 H HG22 . VAL A 1 90  ? 39.511  13.102  9.191  1.00 16.32  ? 90   VAL A HG22 1 
ATOM   1340 H HG23 . VAL A 1 90  ? 40.589  14.194  9.513  1.00 16.32  ? 90   VAL A HG23 1 
ATOM   1341 N N    . THR A 1 91  ? 37.991  15.212  5.201  1.00 9.70   ? 91   THR A N    1 
ATOM   1342 C CA   . THR A 1 91  ? 37.269  16.015  4.192  1.00 9.96   ? 91   THR A CA   1 
ATOM   1343 C C    . THR A 1 91  ? 35.767  15.649  4.254  1.00 9.68   ? 91   THR A C    1 
ATOM   1344 O O    . THR A 1 91  ? 35.377  14.479  4.187  1.00 10.16  ? 91   THR A O    1 
ATOM   1345 C CB   . THR A 1 91  ? 37.835  15.758  2.775  1.00 11.31  ? 91   THR A CB   1 
ATOM   1346 O OG1  . THR A 1 91  ? 39.255  16.124  2.805  1.00 13.33  ? 91   THR A OG1  1 
ATOM   1347 C CG2  . THR A 1 91  ? 37.108  16.618  1.771  1.00 13.34  ? 91   THR A CG2  1 
ATOM   1348 H H    . THR A 1 91  ? 37.966  14.354  5.149  1.00 11.64  ? 91   THR A H    1 
ATOM   1349 H HA   . THR A 1 91  ? 37.374  16.965  4.408  1.00 11.95  ? 91   THR A HA   1 
ATOM   1350 H HB   . THR A 1 91  ? 37.737  14.811  2.541  1.00 13.57  ? 91   THR A HB   1 
ATOM   1351 H HG1  . THR A 1 91  ? 39.647  15.657  3.354  1.00 19.99  ? 91   THR A HG1  1 
ATOM   1352 H HG21 . THR A 1 91  ? 36.173  16.400  1.781  1.00 20.01  ? 91   THR A HG21 1 
ATOM   1353 H HG22 . THR A 1 91  ? 37.223  17.543  1.999  1.00 20.01  ? 91   THR A HG22 1 
ATOM   1354 H HG23 . THR A 1 91  ? 37.465  16.458  0.895  1.00 20.01  ? 91   THR A HG23 1 
ATOM   1355 N N    . VAL A 1 92  ? 34.952  16.700  4.350  1.00 9.74   ? 92   VAL A N    1 
ATOM   1356 C CA   . VAL A 1 92  ? 33.494  16.638  4.459  1.00 10.02  ? 92   VAL A CA   1 
ATOM   1357 C C    . VAL A 1 92  ? 32.933  17.614  3.421  1.00 10.35  ? 92   VAL A C    1 
ATOM   1358 O O    . VAL A 1 92  ? 33.268  18.832  3.493  1.00 10.68  ? 92   VAL A O    1 
ATOM   1359 C CB   . VAL A 1 92  ? 33.030  17.088  5.854  1.00 10.58  ? 92   VAL A CB   1 
ATOM   1360 C CG1  . VAL A 1 92  ? 31.510  17.190  5.927  1.00 12.00  ? 92   VAL A CG1  1 
ATOM   1361 C CG2  . VAL A 1 92  ? 33.566  16.117  6.936  1.00 10.90  ? 92   VAL A CG2  1 
ATOM   1362 H H    . VAL A 1 92  ? 35.314  17.480  4.348  1.00 11.69  ? 92   VAL A H    1 
ATOM   1363 H HA   . VAL A 1 92  ? 33.179  15.728  4.274  1.00 12.03  ? 92   VAL A HA   1 
ATOM   1364 H HB   . VAL A 1 92  ? 33.405  17.976  6.029  1.00 12.69  ? 92   VAL A HB   1 
ATOM   1365 H HG11 . VAL A 1 92  ? 31.122  16.333  5.734  1.00 18.00  ? 92   VAL A HG11 1 
ATOM   1366 H HG12 . VAL A 1 92  ? 31.250  17.468  6.809  1.00 18.00  ? 92   VAL A HG12 1 
ATOM   1367 H HG13 . VAL A 1 92  ? 31.201  17.833  5.285  1.00 18.00  ? 92   VAL A HG13 1 
ATOM   1368 H HG21 . VAL A 1 92  ? 33.189  15.245  6.799  1.00 16.36  ? 92   VAL A HG21 1 
ATOM   1369 H HG22 . VAL A 1 92  ? 34.523  16.065  6.874  1.00 16.36  ? 92   VAL A HG22 1 
ATOM   1370 H HG23 . VAL A 1 92  ? 33.319  16.439  7.806  1.00 16.36  ? 92   VAL A HG23 1 
ATOM   1371 N N    . GLY A 1 93  ? 32.097  17.143  2.474  1.00 11.12  ? 93   GLY A N    1 
ATOM   1372 C CA   . GLY A 1 93  ? 31.526  18.095  1.502  1.00 12.48  ? 93   GLY A CA   1 
ATOM   1373 C C    . GLY A 1 93  ? 32.530  18.907  0.753  1.00 11.58  ? 93   GLY A C    1 
ATOM   1374 O O    . GLY A 1 93  ? 32.262  20.068  0.399  1.00 12.99  ? 93   GLY A O    1 
ATOM   1375 H H    . GLY A 1 93  ? 31.902  16.306  2.437  1.00 13.34  ? 93   GLY A H    1 
ATOM   1376 H HA2  . GLY A 1 93  ? 30.992  17.599  0.862  1.00 14.97  ? 93   GLY A HA2  1 
ATOM   1377 H HA3  . GLY A 1 93  ? 30.931  18.698  1.974  1.00 14.97  ? 93   GLY A HA3  1 
ATOM   1378 N N    . GLY A 1 94  ? 33.725  18.358  0.515  1.00 11.61  ? 94   GLY A N    1 
ATOM   1379 C CA   . GLY A 1 94  ? 34.797  19.076  -0.174 1.00 12.22  ? 94   GLY A CA   1 
ATOM   1380 C C    . GLY A 1 94  ? 35.623  20.009  0.688  1.00 12.38  ? 94   GLY A C    1 
ATOM   1381 O O    . GLY A 1 94  ? 36.559  20.670  0.151  1.00 14.88  ? 94   GLY A O    1 
ATOM   1382 H H    . GLY A 1 94  ? 33.870  17.552  0.778  1.00 13.94  ? 94   GLY A H    1 
ATOM   1383 H HA2  . GLY A 1 94  ? 35.392  18.424  -0.576 1.00 14.67  ? 94   GLY A HA2  1 
ATOM   1384 H HA3  . GLY A 1 94  ? 34.403  19.594  -0.894 1.00 14.67  ? 94   GLY A HA3  1 
ATOM   1385 N N    . VAL A 1 95  ? 35.288  20.157  1.952  1.00 11.38  ? 95   VAL A N    1 
ATOM   1386 C CA   . VAL A 1 95  ? 36.005  21.043  2.898  1.00 11.30  ? 95   VAL A CA   1 
ATOM   1387 C C    . VAL A 1 95  ? 36.985  20.154  3.691  1.00 10.86  ? 95   VAL A C    1 
ATOM   1388 O O    . VAL A 1 95  ? 36.548  19.189  4.350  1.00 11.01  ? 95   VAL A O    1 
ATOM   1389 C CB   . VAL A 1 95  ? 35.032  21.765  3.861  1.00 11.96  ? 95   VAL A CB   1 
ATOM   1390 C CG1  . VAL A 1 95  ? 35.794  22.607  4.856  1.00 14.06  ? 95   VAL A CG1  1 
ATOM   1391 C CG2  . VAL A 1 95  ? 34.022  22.606  3.068  1.00 13.49  ? 95   VAL A CG2  1 
ATOM   1392 H H    . VAL A 1 95  ? 34.613  19.713  2.246  1.00 13.66  ? 95   VAL A H    1 
ATOM   1393 H HA   . VAL A 1 95  ? 36.512  21.712  2.392  1.00 13.56  ? 95   VAL A HA   1 
ATOM   1394 H HB   . VAL A 1 95  ? 34.534  21.082  4.358  1.00 14.35  ? 95   VAL A HB   1 
ATOM   1395 H HG11 . VAL A 1 95  ? 36.418  22.053  5.331  1.00 21.09  ? 95   VAL A HG11 1 
ATOM   1396 H HG12 . VAL A 1 95  ? 36.270  23.300  4.392  1.00 21.09  ? 95   VAL A HG12 1 
ATOM   1397 H HG13 . VAL A 1 95  ? 35.179  23.002  5.478  1.00 21.09  ? 95   VAL A HG13 1 
ATOM   1398 H HG21 . VAL A 1 95  ? 34.486  23.299  2.592  1.00 20.24  ? 95   VAL A HG21 1 
ATOM   1399 H HG22 . VAL A 1 95  ? 33.558  22.044  2.443  1.00 20.24  ? 95   VAL A HG22 1 
ATOM   1400 H HG23 . VAL A 1 95  ? 33.390  23.002  3.673  1.00 20.24  ? 95   VAL A HG23 1 
ATOM   1401 N N    . THR A 1 96  ? 38.275  20.468  3.657  1.00 12.23  ? 96   THR A N    1 
ATOM   1402 C CA   . THR A 1 96  ? 39.312  19.695  4.358  1.00 12.64  ? 96   THR A CA   1 
ATOM   1403 C C    . THR A 1 96  ? 39.792  20.375  5.624  1.00 12.91  ? 96   THR A C    1 
ATOM   1404 O O    . THR A 1 96  ? 40.209  21.551  5.660  1.00 14.83  ? 96   THR A O    1 
ATOM   1405 C CB   . THR A 1 96  ? 40.483  19.372  3.431  1.00 14.20  ? 96   THR A CB   1 
ATOM   1406 O OG1  . THR A 1 96  ? 40.017  18.640  2.258  1.00 15.40  ? 96   THR A OG1  1 
ATOM   1407 C CG2  . THR A 1 96  ? 41.574  18.580  4.085  1.00 15.58  ? 96   THR A CG2  1 
ATOM   1408 H H    . THR A 1 96  ? 38.516  21.158  3.203  1.00 14.68  ? 96   THR A H    1 
ATOM   1409 H HA   . THR A 1 96  ? 38.909  18.842  4.622  1.00 15.17  ? 96   THR A HA   1 
ATOM   1410 H HB   . THR A 1 96  ? 40.868  20.219  3.125  1.00 17.04  ? 96   THR A HB   1 
ATOM   1411 H HG1  . THR A 1 96  ? 39.423  19.067  1.888  1.00 23.10  ? 96   THR A HG1  1 
ATOM   1412 H HG21 . THR A 1 96  ? 42.275  18.416  3.450  1.00 23.37  ? 96   THR A HG21 1 
ATOM   1413 H HG22 . THR A 1 96  ? 41.925  19.074  4.830  1.00 23.37  ? 96   THR A HG22 1 
ATOM   1414 H HG23 . THR A 1 96  ? 41.220  17.743  4.394  1.00 23.37  ? 96   THR A HG23 1 
ATOM   1415 N N    . ALA A 1 97  ? 39.775  19.593  6.703  1.00 12.88  ? 97   ALA A N    1 
ATOM   1416 C CA   . ALA A 1 97  ? 40.424  19.913  7.969  1.00 13.54  ? 97   ALA A CA   1 
ATOM   1417 C C    . ALA A 1 97  ? 41.759  19.209  7.983  1.00 12.73  ? 97   ALA A C    1 
ATOM   1418 O O    . ALA A 1 97  ? 41.847  17.945  7.998  1.00 14.48  ? 97   ALA A O    1 
ATOM   1419 C CB   . ALA A 1 97  ? 39.614  19.427  9.141  1.00 14.63  ? 97   ALA A CB   1 
ATOM   1420 H H    . ALA A 1 97  ? 39.352  18.846  6.649  1.00 15.46  ? 97   ALA A H    1 
ATOM   1421 H HA   . ALA A 1 97  ? 40.558  20.882  8.037  1.00 16.25  ? 97   ALA A HA   1 
ATOM   1422 H HB1  . ALA A 1 97  ? 38.760  19.865  9.145  1.00 21.94  ? 97   ALA A HB1  1 
ATOM   1423 H HB2  . ALA A 1 97  ? 39.486  18.478  9.070  1.00 21.94  ? 97   ALA A HB2  1 
ATOM   1424 H HB3  . ALA A 1 97  ? 40.080  19.626  9.957  1.00 21.94  ? 97   ALA A HB3  1 
ATOM   1425 N N    . HIS A 1 98  ? 42.835  19.966  8.042  1.00 14.15  ? 98   HIS A N    1 
ATOM   1426 C CA   . HIS A 1 98  ? 44.156  19.411  8.155  1.00 13.65  ? 98   HIS A CA   1 
ATOM   1427 C C    . HIS A 1 98  ? 44.533  19.282  9.646  1.00 12.48  ? 98   HIS A C    1 
ATOM   1428 O O    . HIS A 1 98  ? 44.161  20.176  10.444 1.00 14.26  ? 98   HIS A O    1 
ATOM   1429 C CB   A HIS A 1 98  ? 45.218  20.190  7.315  0.50 17.94  ? 98   HIS A CB   1 
ATOM   1430 C CB   B HIS A 1 98  ? 45.260  20.463  7.551  0.50 19.94  ? 98   HIS A CB   1 
ATOM   1431 C CG   A HIS A 1 98  ? 45.376  19.990  6.066  0.50 21.01  ? 98   HIS A CG   1 
ATOM   1432 C CG   B HIS A 1 98  ? 44.619  20.814  6.111  0.50 20.69  ? 98   HIS A CG   1 
ATOM   1433 N ND1  A HIS A 1 98  ? 45.861  18.635  5.276  0.50 28.00  ? 98   HIS A ND1  1 
ATOM   1434 N ND1  B HIS A 1 98  ? 45.107  19.985  5.086  0.50 25.27  ? 98   HIS A ND1  1 
ATOM   1435 C CD2  A HIS A 1 98  ? 44.747  20.789  5.042  0.50 24.18  ? 98   HIS A CD2  1 
ATOM   1436 C CD2  B HIS A 1 98  ? 43.769  21.856  5.616  0.50 24.67  ? 98   HIS A CD2  1 
ATOM   1437 C CE1  A HIS A 1 98  ? 45.621  19.303  3.859  0.50 31.57  ? 98   HIS A CE1  1 
ATOM   1438 C CE1  B HIS A 1 98  ? 44.353  20.554  3.946  0.50 24.44  ? 98   HIS A CE1  1 
ATOM   1439 N NE2  A HIS A 1 98  ? 44.981  20.319  3.743  0.50 26.64  ? 98   HIS A NE2  1 
ATOM   1440 N NE2  B HIS A 1 98  ? 43.601  21.782  4.289  0.50 27.18  ? 98   HIS A NE2  1 
ATOM   1441 H H    . HIS A 1 98  ? 42.744  20.820  8.011  1.00 16.98  ? 98   HIS A H    1 
ATOM   1442 H HA   A HIS A 1 98  ? 44.115  18.502  7.791  1.00 16.38  ? 98   HIS A HA   1 
ATOM   1443 H HB2  A HIS A 1 98  ? 45.025  21.134  7.426  0.50 21.53  ? 98   HIS A HB2  1 
ATOM   1444 H HB2  B HIS A 1 98  ? 45.339  21.253  8.107  0.50 23.93  ? 98   HIS A HB2  1 
ATOM   1445 H HB3  A HIS A 1 98  ? 46.078  20.031  7.735  0.50 21.53  ? 98   HIS A HB3  1 
ATOM   1446 H HB3  B HIS A 1 98  ? 46.132  20.047  7.460  0.50 23.93  ? 98   HIS A HB3  1 
ATOM   1447 H HD1  A HIS A 1 98  ? 46.137  17.862  5.533  0.50 33.59  ? 98   HIS A HD1  1 
ATOM   1448 H HD1  B HIS A 1 98  ? 45.675  19.339  5.113  0.50 30.33  ? 98   HIS A HD1  1 
ATOM   1449 H HD2  A HIS A 1 98  ? 44.235  21.543  5.227  0.50 29.01  ? 98   HIS A HD2  1 
ATOM   1450 H HD2  B HIS A 1 98  ? 43.380  22.508  6.153  0.50 29.60  ? 98   HIS A HD2  1 
ATOM   1451 H HE1  A HIS A 1 98  ? 45.981  18.903  3.100  0.50 37.88  ? 98   HIS A HE1  1 
ATOM   1452 H HE1  B HIS A 1 98  ? 44.352  20.177  3.096  0.50 29.33  ? 98   HIS A HE1  1 
ATOM   1453 N N    . GLY A 1 99  ? 45.149  18.221  10.011 1.00 14.37  ? 99   GLY A N    1 
ATOM   1454 C CA   . GLY A 1 99  ? 45.550  18.029  11.403 1.00 16.27  ? 99   GLY A CA   1 
ATOM   1455 C C    . GLY A 1 99  ? 44.356  17.797  12.341 1.00 13.26  ? 99   GLY A C    1 
ATOM   1456 O O    . GLY A 1 99  ? 44.462  18.070  13.542 1.00 16.57  ? 99   GLY A O    1 
ATOM   1457 H H    . GLY A 1 99  ? 45.329  17.614  9.429  1.00 17.24  ? 99   GLY A H    1 
ATOM   1458 H HA2  . GLY A 1 99  ? 46.147  17.266  11.457 1.00 19.52  ? 99   GLY A HA2  1 
ATOM   1459 H HA3  . GLY A 1 99  ? 46.040  18.811  11.702 1.00 19.52  ? 99   GLY A HA3  1 
ATOM   1460 N N    . GLN A 1 100 ? 43.252  17.318  11.814 1.00 11.13  ? 100  GLN A N    1 
ATOM   1461 C CA   . GLN A 1 100 ? 42.058  17.027  12.641 1.00 10.18  ? 100  GLN A CA   1 
ATOM   1462 C C    . GLN A 1 100 ? 42.327  15.808  13.538 1.00 9.38   ? 100  GLN A C    1 
ATOM   1463 O O    . GLN A 1 100 ? 42.822  14.779  13.057 1.00 9.75   ? 100  GLN A O    1 
ATOM   1464 C CB   . GLN A 1 100 ? 40.876  16.739  11.711 1.00 10.38  ? 100  GLN A CB   1 
ATOM   1465 C CG   . GLN A 1 100 ? 39.602  16.268  12.411 1.00 10.29  ? 100  GLN A CG   1 
ATOM   1466 C CD   . GLN A 1 100 ? 39.038  17.273  13.418 1.00 10.51  ? 100  GLN A CD   1 
ATOM   1467 O OE1  . GLN A 1 100 ? 39.017  18.483  13.128 1.00 11.66  ? 100  GLN A OE1  1 
ATOM   1468 N NE2  . GLN A 1 100 ? 38.580  16.767  14.565 1.00 10.74  ? 100  GLN A NE2  1 
ATOM   1469 H H    . GLN A 1 100 ? 43.222  17.170  10.968 1.00 13.35  ? 100  GLN A H    1 
ATOM   1470 H HA   . GLN A 1 100 ? 41.851  17.804  13.200 1.00 12.22  ? 100  GLN A HA   1 
ATOM   1471 H HB2  . GLN A 1 100 ? 40.672  17.546  11.213 1.00 12.45  ? 100  GLN A HB2  1 
ATOM   1472 H HB3  . GLN A 1 100 ? 41.144  16.061  11.071 1.00 12.45  ? 100  GLN A HB3  1 
ATOM   1473 H HG2  . GLN A 1 100 ? 38.926  16.085  11.740 1.00 12.34  ? 100  GLN A HG2  1 
ATOM   1474 H HG3  . GLN A 1 100 ? 39.789  15.436  12.873 1.00 12.34  ? 100  GLN A HG3  1 
ATOM   1475 H HE21 . GLN A 1 100 ? 38.621  15.921  14.708 1.00 12.89  ? 100  GLN A HE21 1 
ATOM   1476 H HE22 . GLN A 1 100 ? 38.243  17.288  15.161 1.00 12.89  ? 100  GLN A HE22 1 
ATOM   1477 N N    . ALA A 1 101 ? 41.899  15.903  14.796 1.00 9.69   ? 101  ALA A N    1 
ATOM   1478 C CA   . ALA A 1 101 ? 41.974  14.724  15.698 1.00 9.74   ? 101  ALA A CA   1 
ATOM   1479 C C    . ALA A 1 101 ? 40.933  13.683  15.287 1.00 9.19   ? 101  ALA A C    1 
ATOM   1480 O O    . ALA A 1 101 ? 39.712  13.970  15.237 1.00 10.17  ? 101  ALA A O    1 
ATOM   1481 C CB   . ALA A 1 101 ? 41.743  15.160  17.133 1.00 11.07  ? 101  ALA A CB   1 
ATOM   1482 H H    . ALA A 1 101 ? 41.578  16.646  15.086 1.00 11.62  ? 101  ALA A H    1 
ATOM   1483 H HA   . ALA A 1 101 ? 42.867  14.326  15.627 1.00 11.69  ? 101  ALA A HA   1 
ATOM   1484 H HB1  . ALA A 1 101 ? 41.818  14.400  17.715 1.00 16.60  ? 101  ALA A HB1  1 
ATOM   1485 H HB2  . ALA A 1 101 ? 42.401  15.815  17.378 1.00 16.60  ? 101  ALA A HB2  1 
ATOM   1486 H HB3  . ALA A 1 101 ? 40.866  15.541  17.215 1.00 16.60  ? 101  ALA A HB3  1 
ATOM   1487 N N    . VAL A 1 102 ? 41.450  12.475  15.009 1.00 9.02   ? 102  VAL A N    1 
ATOM   1488 C CA   . VAL A 1 102 ? 40.653  11.316  14.630 1.00 9.05   ? 102  VAL A CA   1 
ATOM   1489 C C    . VAL A 1 102 ? 40.820  10.282  15.790 1.00 9.03   ? 102  VAL A C    1 
ATOM   1490 O O    . VAL A 1 102 ? 41.939  9.858   16.109 1.00 9.68   ? 102  VAL A O    1 
ATOM   1491 C CB   . VAL A 1 102 ? 41.109  10.723  13.288 1.00 9.69   ? 102  VAL A CB   1 
ATOM   1492 C CG1  . VAL A 1 102 ? 40.291  9.437   12.963 1.00 10.21  ? 102  VAL A CG1  1 
ATOM   1493 C CG2  . VAL A 1 102 ? 40.995  11.771  12.165 1.00 11.14  ? 102  VAL A CG2  1 
ATOM   1494 H H    . VAL A 1 102 ? 42.304  12.380  15.057 1.00 10.82  ? 102  VAL A H    1 
ATOM   1495 H HA   . VAL A 1 102 ? 39.711  11.579  14.564 1.00 10.86  ? 102  VAL A HA   1 
ATOM   1496 H HB   . VAL A 1 102 ? 42.052  10.469  13.373 1.00 11.63  ? 102  VAL A HB   1 
ATOM   1497 H HG11 . VAL A 1 102 ? 39.358  9.657   12.911 1.00 15.32  ? 102  VAL A HG11 1 
ATOM   1498 H HG12 . VAL A 1 102 ? 40.582  9.077   12.122 1.00 15.32  ? 102  VAL A HG12 1 
ATOM   1499 H HG13 . VAL A 1 102 ? 40.428  8.787   13.655 1.00 15.32  ? 102  VAL A HG13 1 
ATOM   1500 H HG21 . VAL A 1 102 ? 41.281  11.383  11.335 1.00 16.72  ? 102  VAL A HG21 1 
ATOM   1501 H HG22 . VAL A 1 102 ? 40.082  12.058  12.087 1.00 16.72  ? 102  VAL A HG22 1 
ATOM   1502 H HG23 . VAL A 1 102 ? 41.551  12.526  12.374 1.00 16.72  ? 102  VAL A HG23 1 
ATOM   1503 N N    . GLN A 1 103 ? 39.693  9.916   16.374 1.00 8.55   ? 103  GLN A N    1 
ATOM   1504 C CA   . GLN A 1 103 ? 39.667  9.040   17.571 1.00 8.57   ? 103  GLN A CA   1 
ATOM   1505 C C    . GLN A 1 103 ? 39.464  7.609   17.084 1.00 8.65   ? 103  GLN A C    1 
ATOM   1506 O O    . GLN A 1 103 ? 38.352  7.220   16.672 1.00 9.12   ? 103  GLN A O    1 
ATOM   1507 C CB   . GLN A 1 103 ? 38.587  9.541   18.518 1.00 8.93   ? 103  GLN A CB   1 
ATOM   1508 C CG   . GLN A 1 103 ? 38.877  10.985  18.972 1.00 9.42   ? 103  GLN A CG   1 
ATOM   1509 C CD   . GLN A 1 103 ? 37.769  11.626  19.724 1.00 9.62   ? 103  GLN A CD   1 
ATOM   1510 O OE1  . GLN A 1 103 ? 37.403  12.794  19.569 1.00 10.33  ? 103  GLN A OE1  1 
ATOM   1511 N NE2  . GLN A 1 103 ? 37.190  10.814  20.574 1.00 8.82   ? 103  GLN A NE2  1 
ATOM   1512 H H    . GLN A 1 103 ? 38.947  10.195  16.049 1.00 10.26  ? 103  GLN A H    1 
ATOM   1513 H HA   . GLN A 1 103 ? 40.534  9.098   18.024 1.00 10.28  ? 103  GLN A HA   1 
ATOM   1514 H HB2  . GLN A 1 103 ? 37.726  9.510   18.071 1.00 10.71  ? 103  GLN A HB2  1 
ATOM   1515 H HB3  . GLN A 1 103 ? 38.543  8.961   19.294 1.00 10.71  ? 103  GLN A HB3  1 
ATOM   1516 H HG2  . GLN A 1 103 ? 39.670  10.981  19.531 1.00 11.30  ? 103  GLN A HG2  1 
ATOM   1517 H HG3  . GLN A 1 103 ? 39.073  11.523  18.189 1.00 11.30  ? 103  GLN A HG3  1 
ATOM   1518 H HE21 . GLN A 1 103 ? 37.471  10.006  20.656 1.00 10.58  ? 103  GLN A HE21 1 
ATOM   1519 H HE22 . GLN A 1 103 ? 36.529  11.090  21.050 1.00 10.58  ? 103  GLN A HE22 1 
ATOM   1520 N N    . ALA A 1 104 ? 40.553  6.843   17.018 1.00 8.87   ? 104  ALA A N    1 
ATOM   1521 C CA   . ALA A 1 104 ? 40.529  5.477   16.487 1.00 8.87   ? 104  ALA A CA   1 
ATOM   1522 C C    . ALA A 1 104 ? 39.983  4.524   17.570 1.00 9.17   ? 104  ALA A C    1 
ATOM   1523 O O    . ALA A 1 104 ? 40.523  4.466   18.690 1.00 9.67   ? 104  ALA A O    1 
ATOM   1524 C CB   . ALA A 1 104 ? 41.932  5.076   16.088 1.00 9.99   ? 104  ALA A CB   1 
ATOM   1525 H H    . ALA A 1 104 ? 41.300  7.164   17.298 1.00 10.65  ? 104  ALA A H    1 
ATOM   1526 H HA   . ALA A 1 104 ? 39.946  5.444   15.701 1.00 10.64  ? 104  ALA A HA   1 
ATOM   1527 H HB1  . ALA A 1 104 ? 41.921  4.181   15.738 1.00 14.98  ? 104  ALA A HB1  1 
ATOM   1528 H HB2  . ALA A 1 104 ? 42.258  5.678   15.415 1.00 14.98  ? 104  ALA A HB2  1 
ATOM   1529 H HB3  . ALA A 1 104 ? 42.506  5.112   16.856 1.00 14.98  ? 104  ALA A HB3  1 
ATOM   1530 N N    . ALA A 1 105 ? 38.941  3.754   17.224 1.00 8.91   ? 105  ALA A N    1 
ATOM   1531 C CA   . ALA A 1 105 ? 38.356  2.847   18.198 1.00 9.55   ? 105  ALA A CA   1 
ATOM   1532 C C    . ALA A 1 105 ? 39.226  1.611   18.433 1.00 9.15   ? 105  ALA A C    1 
ATOM   1533 O O    . ALA A 1 105 ? 39.682  0.939   17.492 1.00 9.76   ? 105  ALA A O    1 
ATOM   1534 C CB   . ALA A 1 105 ? 36.967  2.388   17.763 1.00 10.07  ? 105  ALA A CB   1 
ATOM   1535 H H    . ALA A 1 105 ? 38.620  3.797   16.428 1.00 10.69  ? 105  ALA A H    1 
ATOM   1536 H HA   . ALA A 1 105 ? 38.269  3.326   19.049 1.00 11.46  ? 105  ALA A HA   1 
ATOM   1537 H HB1  . ALA A 1 105 ? 36.581  1.841   18.451 1.00 15.10  ? 105  ALA A HB1  1 
ATOM   1538 H HB2  . ALA A 1 105 ? 36.409  3.154   17.613 1.00 15.10  ? 105  ALA A HB2  1 
ATOM   1539 H HB3  . ALA A 1 105 ? 37.038  1.879   16.952 1.00 15.10  ? 105  ALA A HB3  1 
ATOM   1540 N N    . GLN A 1 106 ? 39.367  1.287   19.702 1.00 9.66   ? 106  GLN A N    1 
ATOM   1541 C CA   . GLN A 1 106 ? 39.898  0.021   20.237 1.00 9.84   ? 106  GLN A CA   1 
ATOM   1542 C C    . GLN A 1 106 ? 38.809  -0.850  20.884 1.00 10.11  ? 106  GLN A C    1 
ATOM   1543 O O    . GLN A 1 106 ? 38.973  -2.083  20.888 1.00 11.14  ? 106  GLN A O    1 
ATOM   1544 C CB   . GLN A 1 106 ? 41.004  0.290   21.273 1.00 10.05  ? 106  GLN A CB   1 
ATOM   1545 C CG   . GLN A 1 106 ? 42.296  0.806   20.634 1.00 11.16  ? 106  GLN A CG   1 
ATOM   1546 C CD   . GLN A 1 106 ? 43.321  1.203   21.642 1.00 11.60  ? 106  GLN A CD   1 
ATOM   1547 O OE1  . GLN A 1 106 ? 43.131  2.152   22.353 1.00 14.31  ? 106  GLN A OE1  1 
ATOM   1548 N NE2  . GLN A 1 106 ? 44.419  0.412   21.732 1.00 13.17  ? 106  GLN A NE2  1 
ATOM   1549 H H    . GLN A 1 106 ? 39.124  1.876   20.279 1.00 11.59  ? 106  GLN A H    1 
ATOM   1550 H HA   . GLN A 1 106 ? 40.292  -0.483  19.494 1.00 11.80  ? 106  GLN A HA   1 
ATOM   1551 H HB2  . GLN A 1 106 ? 40.686  0.943   21.915 1.00 12.06  ? 106  GLN A HB2  1 
ATOM   1552 H HB3  . GLN A 1 106 ? 41.194  -0.531  21.754 1.00 12.06  ? 106  GLN A HB3  1 
ATOM   1553 H HG2  . GLN A 1 106 ? 42.665  0.113   20.064 1.00 13.40  ? 106  GLN A HG2  1 
ATOM   1554 H HG3  . GLN A 1 106 ? 42.089  1.571   20.075 1.00 13.40  ? 106  GLN A HG3  1 
ATOM   1555 H HE21 . GLN A 1 106 ? 44.511  -0.258  21.201 1.00 15.80  ? 106  GLN A HE21 1 
ATOM   1556 H HE22 . GLN A 1 106 ? 45.022  0.580   22.321 1.00 15.80  ? 106  GLN A HE22 1 
ATOM   1557 N N    . GLN A 1 107 ? 37.783  -0.238  21.426 1.00 10.21  ? 107  GLN A N    1 
ATOM   1558 C CA   . GLN A 1 107 ? 36.672  -0.935  22.093 1.00 10.70  ? 107  GLN A CA   1 
ATOM   1559 C C    . GLN A 1 107 ? 35.374  -0.272  21.661 1.00 10.88  ? 107  GLN A C    1 
ATOM   1560 O O    . GLN A 1 107 ? 35.286  0.993   21.643 1.00 11.78  ? 107  GLN A O    1 
ATOM   1561 C CB   . GLN A 1 107 ? 36.784  -0.846  23.643 1.00 12.74  ? 107  GLN A CB   1 
ATOM   1562 C CG   . GLN A 1 107 ? 38.101  -1.376  24.209 1.00 16.93  ? 107  GLN A CG   1 
ATOM   1563 C CD   . GLN A 1 107 ? 38.161  -2.766  24.317 1.00 24.97  ? 107  GLN A CD   1 
ATOM   1564 O OE1  . GLN A 1 107 ? 37.101  -3.471  24.497 1.00 30.51  ? 107  GLN A OE1  1 
ATOM   1565 N NE2  . GLN A 1 107 ? 39.336  -3.381  24.250 1.00 24.60  ? 107  GLN A NE2  1 
ATOM   1566 H H    . GLN A 1 107 ? 37.759  0.621   21.390 1.00 12.25  ? 107  GLN A H    1 
ATOM   1567 H HA   . GLN A 1 107 ? 36.665  -1.876  21.820 1.00 12.84  ? 107  GLN A HA   1 
ATOM   1568 H HB2  . GLN A 1 107 ? 36.682  0.081   23.909 1.00 15.28  ? 107  GLN A HB2  1 
ATOM   1569 H HB3  . GLN A 1 107 ? 36.053  -1.347  24.036 1.00 15.28  ? 107  GLN A HB3  1 
ATOM   1570 H HG2  . GLN A 1 107 ? 38.827  -1.077  23.639 1.00 20.31  ? 107  GLN A HG2  1 
ATOM   1571 H HG3  . GLN A 1 107 ? 38.239  -0.990  25.088 1.00 20.31  ? 107  GLN A HG3  1 
ATOM   1572 H HE21 . GLN A 1 107 ? 40.054  -2.924  24.130 1.00 29.52  ? 107  GLN A HE21 1 
ATOM   1573 H HE22 . GLN A 1 107 ? 39.379  -4.237  24.327 1.00 29.52  ? 107  GLN A HE22 1 
ATOM   1574 N N    . ILE A 1 108 ? 34.337  -1.060  21.363 1.00 11.20  ? 108  ILE A N    1 
ATOM   1575 C CA   . ILE A 1 108 ? 33.014  -0.564  21.038 1.00 11.14  ? 108  ILE A CA   1 
ATOM   1576 C C    . ILE A 1 108 ? 31.983  -1.415  21.770 1.00 11.52  ? 108  ILE A C    1 
ATOM   1577 O O    . ILE A 1 108 ? 32.151  -2.643  21.906 1.00 13.46  ? 108  ILE A O    1 
ATOM   1578 C CB   . ILE A 1 108 ? 32.740  -0.568  19.505 1.00 11.88  ? 108  ILE A CB   1 
ATOM   1579 C CG1  . ILE A 1 108 ? 33.095  -1.935  18.885 1.00 13.03  ? 108  ILE A CG1  1 
ATOM   1580 C CG2  . ILE A 1 108 ? 33.455  0.573   18.823 1.00 13.00  ? 108  ILE A CG2  1 
ATOM   1581 C CD1  . ILE A 1 108 ? 32.629  -2.063  17.433 1.00 14.80  ? 108  ILE A CD1  1 
ATOM   1582 H H    . ILE A 1 108 ? 34.461  -1.911  21.364 1.00 13.44  ? 108  ILE A H    1 
ATOM   1583 H HA   . ILE A 1 108 ? 32.941  0.358   21.363 1.00 13.37  ? 108  ILE A HA   1 
ATOM   1584 H HB   . ILE A 1 108 ? 31.778  -0.430  19.379 1.00 14.26  ? 108  ILE A HB   1 
ATOM   1585 H HG12 . ILE A 1 108 ? 34.056  -2.059  18.921 1.00 15.63  ? 108  ILE A HG12 1 
ATOM   1586 H HG13 . ILE A 1 108 ? 32.685  -2.639  19.412 1.00 15.63  ? 108  ILE A HG13 1 
ATOM   1587 H HG21 . ILE A 1 108 ? 33.211  1.401   19.243 1.00 19.50  ? 108  ILE A HG21 1 
ATOM   1588 H HG22 . ILE A 1 108 ? 34.404  0.446   18.896 1.00 19.50  ? 108  ILE A HG22 1 
ATOM   1589 H HG23 . ILE A 1 108 ? 33.206  0.599   17.896 1.00 19.50  ? 108  ILE A HG23 1 
ATOM   1590 H HD11 . ILE A 1 108 ? 32.870  -2.929  17.095 1.00 22.19  ? 108  ILE A HD11 1 
ATOM   1591 H HD12 . ILE A 1 108 ? 31.675  -1.959  17.393 1.00 22.19  ? 108  ILE A HD12 1 
ATOM   1592 H HD13 . ILE A 1 108 ? 33.048  -1.383  16.901 1.00 22.19  ? 108  ILE A HD13 1 
ATOM   1593 N N    . SER A 1 109 ? 30.897  -0.797  22.237 1.00 11.49  ? 109  SER A N    1 
ATOM   1594 C CA   . SER A 1 109 ? 29.867  -1.520  22.949 1.00 12.75  ? 109  SER A CA   1 
ATOM   1595 C C    . SER A 1 109 ? 28.972  -2.293  22.021 1.00 13.66  ? 109  SER A C    1 
ATOM   1596 O O    . SER A 1 109 ? 29.027  -2.181  20.784 1.00 13.85  ? 109  SER A O    1 
ATOM   1597 C CB   . SER A 1 109 ? 29.050  -0.575  23.814 1.00 12.47  ? 109  SER A CB   1 
ATOM   1598 O OG   . SER A 1 109 ? 28.192  0.263   23.042 1.00 12.31  ? 109  SER A OG   1 
ATOM   1599 H H    . SER A 1 109 ? 30.807  0.049   22.111 1.00 13.78  ? 109  SER A H    1 
ATOM   1600 H HA   . SER A 1 109 ? 30.309  -2.163  23.543 1.00 15.31  ? 109  SER A HA   1 
ATOM   1601 H HB2  . SER A 1 109 ? 28.514  -1.094  24.434 1.00 14.96  ? 109  SER A HB2  1 
ATOM   1602 H HB3  . SER A 1 109 ? 29.652  -0.020  24.334 1.00 14.96  ? 109  SER A HB3  1 
ATOM   1603 H HG   . SER A 1 109 ? 27.669  -0.201  22.613 1.00 18.46  ? 109  SER A HG   1 
ATOM   1604 N N    . ALA A 1 110 ? 28.079  -3.136  22.585 1.00 15.28  ? 110  ALA A N    1 
ATOM   1605 C CA   . ALA A 1 110 ? 27.208  -4.005  21.800 1.00 17.09  ? 110  ALA A CA   1 
ATOM   1606 C C    . ALA A 1 110 ? 26.408  -3.264  20.774 1.00 16.55  ? 110  ALA A C    1 
ATOM   1607 O O    . ALA A 1 110 ? 26.262  -3.786  19.614 1.00 16.98  ? 110  ALA A O    1 
ATOM   1608 C CB   . ALA A 1 110 ? 26.268  -4.784  22.841 1.00 20.87  ? 110  ALA A CB   1 
ATOM   1609 H H    . ALA A 1 110 ? 28.021  -3.162  23.443 1.00 18.34  ? 110  ALA A H    1 
ATOM   1610 H HA   . ALA A 1 110 ? 27.767  -4.663  21.337 1.00 20.51  ? 110  ALA A HA   1 
ATOM   1611 H HB1  . ALA A 1 110 ? 25.733  -5.427  22.370 1.00 31.30  ? 110  ALA A HB1  1 
ATOM   1612 H HB2  . ALA A 1 110 ? 26.814  -5.236  23.489 1.00 31.30  ? 110  ALA A HB2  1 
ATOM   1613 H HB3  . ALA A 1 110 ? 25.696  -4.156  23.288 1.00 31.30  ? 110  ALA A HB3  1 
ATOM   1614 N N    . GLN A 1 111 ? 25.855  -2.101  21.073 1.00 15.30  ? 111  GLN A N    1 
ATOM   1615 C CA   . GLN A 1 111 ? 25.021  -1.407  20.108 1.00 15.61  ? 111  GLN A CA   1 
ATOM   1616 C C    . GLN A 1 111 ? 25.831  -1.116  18.828 1.00 14.71  ? 111  GLN A C    1 
ATOM   1617 O O    . GLN A 1 111 ? 25.317  -1.293  17.706 1.00 16.75  ? 111  GLN A O    1 
ATOM   1618 C CB   . GLN A 1 111 ? 24.440  -0.155  20.676 1.00 15.84  ? 111  GLN A CB   1 
ATOM   1619 C CG   . GLN A 1 111 ? 23.613  0.696   19.675 1.00 20.50  ? 111  GLN A CG   1 
ATOM   1620 C CD   . GLN A 1 111 ? 22.968  1.871   20.434 1.00 17.68  ? 111  GLN A CD   1 
ATOM   1621 O OE1  . GLN A 1 111 ? 23.190  3.086   20.024 1.00 20.35  ? 111  GLN A OE1  1 
ATOM   1622 N NE2  . GLN A 1 111 ? 22.271  1.621   21.492 1.00 20.47  ? 111  GLN A NE2  1 
ATOM   1623 H H    . GLN A 1 111 ? 25.990  -1.752  21.847 1.00 18.36  ? 111  GLN A H    1 
ATOM   1624 H HA   . GLN A 1 111 ? 24.280  -2.001  19.867 1.00 18.73  ? 111  GLN A HA   1 
ATOM   1625 H HB2  . GLN A 1 111 ? 23.870  -0.391  21.424 1.00 19.01  ? 111  GLN A HB2  1 
ATOM   1626 H HB3  . GLN A 1 111 ? 25.163  0.392   21.021 1.00 19.01  ? 111  GLN A HB3  1 
ATOM   1627 H HG2  . GLN A 1 111 ? 24.190  1.034   18.972 1.00 24.60  ? 111  GLN A HG2  1 
ATOM   1628 H HG3  . GLN A 1 111 ? 22.924  0.149   19.266 1.00 24.60  ? 111  GLN A HG3  1 
ATOM   1629 H HE21 . GLN A 1 111 ? 22.141  0.808   21.739 1.00 24.56  ? 111  GLN A HE21 1 
ATOM   1630 H HE22 . GLN A 1 111 ? 21.937  2.268   21.949 1.00 24.56  ? 111  GLN A HE22 1 
ATOM   1631 N N    . PHE A 1 112 ? 27.065  -0.616  18.982 1.00 13.74  ? 112  PHE A N    1 
ATOM   1632 C CA   . PHE A 1 112 ? 27.903  -0.343  17.819 1.00 13.69  ? 112  PHE A CA   1 
ATOM   1633 C C    . PHE A 1 112 ? 28.364  -1.626  17.103 1.00 15.76  ? 112  PHE A C    1 
ATOM   1634 O O    . PHE A 1 112 ? 28.448  -1.616  15.848 1.00 16.90  ? 112  PHE A O    1 
ATOM   1635 C CB   . PHE A 1 112 ? 29.090  0.559   18.214 1.00 13.48  ? 112  PHE A CB   1 
ATOM   1636 C CG   . PHE A 1 112 ? 28.656  1.945   18.652 1.00 11.73  ? 112  PHE A CG   1 
ATOM   1637 C CD1  . PHE A 1 112 ? 27.988  2.809   17.789 1.00 12.57  ? 112  PHE A CD1  1 
ATOM   1638 C CD2  . PHE A 1 112 ? 28.911  2.373   19.933 1.00 12.15  ? 112  PHE A CD2  1 
ATOM   1639 C CE1  . PHE A 1 112 ? 27.553  4.036   18.244 1.00 13.51  ? 112  PHE A CE1  1 
ATOM   1640 C CE2  . PHE A 1 112 ? 28.470  3.630   20.391 1.00 12.93  ? 112  PHE A CE2  1 
ATOM   1641 C CZ   . PHE A 1 112 ? 27.785  4.441   19.525 1.00 12.24  ? 112  PHE A CZ   1 
ATOM   1642 H H    . PHE A 1 112 ? 27.364  -0.455  19.772 1.00 16.49  ? 112  PHE A H    1 
ATOM   1643 H HA   . PHE A 1 112 ? 27.357  0.162   17.182 1.00 16.42  ? 112  PHE A HA   1 
ATOM   1644 H HB2  . PHE A 1 112 ? 29.580  0.138   18.938 1.00 16.18  ? 112  PHE A HB2  1 
ATOM   1645 H HB3  . PHE A 1 112 ? 29.691  0.640   17.458 1.00 16.18  ? 112  PHE A HB3  1 
ATOM   1646 H HD1  . PHE A 1 112 ? 27.835  2.559   16.907 1.00 15.08  ? 112  PHE A HD1  1 
ATOM   1647 H HD2  . PHE A 1 112 ? 29.386  1.820   20.510 1.00 14.58  ? 112  PHE A HD2  1 
ATOM   1648 H HE1  . PHE A 1 112 ? 27.092  4.598   17.664 1.00 16.21  ? 112  PHE A HE1  1 
ATOM   1649 H HE2  . PHE A 1 112 ? 28.641  3.904   21.264 1.00 15.51  ? 112  PHE A HE2  1 
ATOM   1650 H HZ   . PHE A 1 112 ? 27.477  5.271   19.811 1.00 14.69  ? 112  PHE A HZ   1 
ATOM   1651 N N    . GLN A 1 113 ? 28.612  -2.708  17.873 1.00 16.12  ? 113  GLN A N    1 
ATOM   1652 C CA   . GLN A 1 113 ? 28.958  -4.047  17.312 1.00 17.53  ? 113  GLN A CA   1 
ATOM   1653 C C    . GLN A 1 113 ? 27.773  -4.577  16.511 1.00 18.01  ? 113  GLN A C    1 
ATOM   1654 O O    . GLN A 1 113 ? 28.029  -5.516  15.704 1.00 22.18  ? 113  GLN A O    1 
ATOM   1655 C CB   . GLN A 1 113 ? 29.277  -5.065  18.447 1.00 18.85  ? 113  GLN A CB   1 
ATOM   1656 C CG   . GLN A 1 113 ? 30.577  -4.761  19.162 1.00 18.77  ? 113  GLN A CG   1 
ATOM   1657 C CD   . GLN A 1 113 ? 30.878  -5.775  20.233 1.00 24.16  ? 113  GLN A CD   1 
ATOM   1658 O OE1  . GLN A 1 113 ? 30.744  -6.960  19.919 1.00 36.56  ? 113  GLN A OE1  1 
ATOM   1659 N NE2  . GLN A 1 113 ? 31.291  -5.349  21.360 1.00 23.08  ? 113  GLN A NE2  1 
ATOM   1660 H H    . GLN A 1 113 ? 28.568  -2.621  18.727 1.00 19.34  ? 113  GLN A H    1 
ATOM   1661 H HA   . GLN A 1 113 ? 29.737  -3.961  16.723 1.00 21.03  ? 113  GLN A HA   1 
ATOM   1662 H HB2  . GLN A 1 113 ? 28.552  -5.057  19.092 1.00 22.62  ? 113  GLN A HB2  1 
ATOM   1663 H HB3  . GLN A 1 113 ? 29.326  -5.956  18.067 1.00 22.62  ? 113  GLN A HB3  1 
ATOM   1664 H HG2  . GLN A 1 113 ? 31.302  -4.751  18.518 1.00 22.52  ? 113  GLN A HG2  1 
ATOM   1665 H HG3  . GLN A 1 113 ? 30.523  -3.879  19.564 1.00 22.52  ? 113  GLN A HG3  1 
ATOM   1666 H HE21 . GLN A 1 113 ? 31.357  -4.504  21.503 1.00 27.70  ? 113  GLN A HE21 1 
ATOM   1667 H HE22 . GLN A 1 113 ? 31.504  -5.907  21.979 1.00 27.70  ? 113  GLN A HE22 1 
ATOM   1668 N N    . GLN A 1 114 ? 26.571  -4.114  16.640 1.00 15.75  ? 114  GLN A N    1 
ATOM   1669 C CA   . GLN A 1 114 ? 25.371  -4.592  15.919 1.00 15.96  ? 114  GLN A CA   1 
ATOM   1670 C C    . GLN A 1 114 ? 24.966  -3.647  14.795 1.00 18.40  ? 114  GLN A C    1 
ATOM   1671 O O    . GLN A 1 114 ? 24.025  -3.980  14.030 1.00 26.00  ? 114  GLN A O    1 
ATOM   1672 C CB   . GLN A 1 114 ? 24.260  -4.886  16.930 1.00 19.96  ? 114  GLN A CB   1 
ATOM   1673 C CG   . GLN A 1 114 ? 24.544  -6.013  17.890 1.00 22.42  ? 114  GLN A CG   1 
ATOM   1674 C CD   . GLN A 1 114 ? 23.855  -6.080  19.102 1.00 34.68  ? 114  GLN A CD   1 
ATOM   1675 O OE1  . GLN A 1 114 ? 24.285  -6.702  20.182 1.00 51.34  ? 114  GLN A OE1  1 
ATOM   1676 N NE2  . GLN A 1 114 ? 22.689  -5.391  19.272 1.00 54.96  ? 114  GLN A NE2  1 
ATOM   1677 H H    . GLN A 1 114 ? 26.459  -3.469  17.197 1.00 18.90  ? 114  GLN A H    1 
ATOM   1678 H HA   . GLN A 1 114 ? 25.610  -5.446  15.502 1.00 19.15  ? 114  GLN A HA   1 
ATOM   1679 H HB2  . GLN A 1 114 ? 24.092  -4.080  17.444 1.00 23.96  ? 114  GLN A HB2  1 
ATOM   1680 H HB3  . GLN A 1 114 ? 23.448  -5.095  16.442 1.00 23.96  ? 114  GLN A HB3  1 
ATOM   1681 H HG2  . GLN A 1 114 ? 24.380  -6.844  17.417 1.00 26.91  ? 114  GLN A HG2  1 
ATOM   1682 H HG3  . GLN A 1 114 ? 25.491  -5.987  18.095 1.00 26.91  ? 114  GLN A HG3  1 
ATOM   1683 H HE21 . GLN A 1 114 ? 22.346  -4.959  18.613 1.00 65.95  ? 114  GLN A HE21 1 
ATOM   1684 H HE22 . GLN A 1 114 ? 22.299  -5.389  20.038 1.00 65.95  ? 114  GLN A HE22 1 
ATOM   1685 N N    . ASP A 1 115 ? 25.569  -2.465  14.631 1.00 17.64  ? 115  ASP A N    1 
ATOM   1686 C CA   . ASP A 1 115 ? 25.109  -1.483  13.646 1.00 19.23  ? 115  ASP A CA   1 
ATOM   1687 C C    . ASP A 1 115 ? 26.179  -1.404  12.600 1.00 17.76  ? 115  ASP A C    1 
ATOM   1688 O O    . ASP A 1 115 ? 27.202  -0.748  12.712 1.00 20.37  ? 115  ASP A O    1 
ATOM   1689 C CB   . ASP A 1 115 ? 24.942  -0.089  14.352 1.00 23.32  ? 115  ASP A CB   1 
ATOM   1690 C CG   . ASP A 1 115 ? 24.318  0.957   13.262 1.00 25.66  ? 115  ASP A CG   1 
ATOM   1691 O OD1  . ASP A 1 115 ? 24.147  0.665   12.115 1.00 29.50  ? 115  ASP A OD1  1 
ATOM   1692 O OD2  . ASP A 1 115 ? 23.989  2.055   13.874 1.00 30.60  ? 115  ASP A OD2  1 
ATOM   1693 H H    . ASP A 1 115 ? 26.250  -2.275  15.121 1.00 21.17  ? 115  ASP A H    1 
ATOM   1694 H HA   . ASP A 1 115 ? 24.260  -1.769  13.248 1.00 23.08  ? 115  ASP A HA   1 
ATOM   1695 H HB2  . ASP A 1 115 ? 24.348  -0.171  15.114 1.00 27.98  ? 115  ASP A HB2  1 
ATOM   1696 H HB3  . ASP A 1 115 ? 25.802  0.230   14.666 1.00 27.98  ? 115  ASP A HB3  1 
ATOM   1697 N N    . THR A 1 116 ? 25.813  -1.982  11.465 1.00 18.35  ? 116  THR A N    1 
ATOM   1698 C CA   . THR A 1 116 ? 26.753  -1.883  10.351 1.00 18.40  ? 116  THR A CA   1 
ATOM   1699 C C    . THR A 1 116 ? 26.402  -0.723  9.390  1.00 18.96  ? 116  THR A C    1 
ATOM   1700 O O    . THR A 1 116 ? 27.115  -0.609  8.368  1.00 21.63  ? 116  THR A O    1 
ATOM   1701 C CB   . THR A 1 116 ? 26.729  -3.116  9.613  1.00 21.94  ? 116  THR A CB   1 
ATOM   1702 O OG1  . THR A 1 116 ? 25.458  -3.485  9.004  1.00 25.48  ? 116  THR A OG1  1 
ATOM   1703 C CG2  . THR A 1 116 ? 27.312  -4.393  10.332 1.00 33.21  ? 116  THR A CG2  1 
ATOM   1704 H H    . THR A 1 116 ? 25.063  -2.395  11.389 1.00 22.02  ? 116  THR A H    1 
ATOM   1705 H HA   . THR A 1 116 ? 27.655  -1.741  10.706 1.00 22.08  ? 116  THR A HA   1 
ATOM   1706 H HB   . THR A 1 116 ? 27.331  -2.963  8.855  1.00 26.33  ? 116  THR A HB   1 
ATOM   1707 H HG1  . THR A 1 116 ? 25.548  -4.184  8.584  1.00 38.23  ? 116  THR A HG1  1 
ATOM   1708 H HG21 . THR A 1 116 ? 27.289  -5.139  9.729  1.00 49.81  ? 116  THR A HG21 1 
ATOM   1709 H HG22 . THR A 1 116 ? 28.220  -4.224  10.597 1.00 49.81  ? 116  THR A HG22 1 
ATOM   1710 H HG23 . THR A 1 116 ? 26.784  -4.592  11.109 1.00 49.81  ? 116  THR A HG23 1 
ATOM   1711 N N    . ASN A 1 117 ? 25.450  0.103   9.774  1.00 20.06  ? 117  ASN A N    1 
ATOM   1712 C CA   . ASN A 1 117 ? 25.148  1.218   8.887  1.00 21.60  ? 117  ASN A CA   1 
ATOM   1713 C C    . ASN A 1 117 ? 26.114  2.365   8.976  1.00 19.19  ? 117  ASN A C    1 
ATOM   1714 O O    . ASN A 1 117 ? 26.158  3.205   8.039  1.00 22.74  ? 117  ASN A O    1 
ATOM   1715 C CB   . ASN A 1 117 ? 23.761  1.724   9.020  1.00 28.89  ? 117  ASN A CB   1 
ATOM   1716 C CG   . ASN A 1 117 ? 22.569  0.762   8.874  1.00 28.99  ? 117  ASN A CG   1 
ATOM   1717 O OD1  . ASN A 1 117 ? 22.523  0.120   7.810  1.00 37.29  ? 117  ASN A OD1  1 
ATOM   1718 N ND2  . ASN A 1 117 ? 21.778  0.836   10.081 1.00 31.65  ? 117  ASN A ND2  1 
ATOM   1719 H H    . ASN A 1 117 ? 25.026  -0.010  10.514 1.00 24.08  ? 117  ASN A H    1 
ATOM   1720 H HA   . ASN A 1 117 ? 25.224  0.869   7.974  1.00 25.92  ? 117  ASN A HA   1 
ATOM   1721 H HB2  . ASN A 1 117 ? 23.690  2.141   9.893  1.00 34.67  ? 117  ASN A HB2  1 
ATOM   1722 H HB3  . ASN A 1 117 ? 23.646  2.427   8.362  1.00 34.67  ? 117  ASN A HB3  1 
ATOM   1723 H HD21 . ASN A 1 117 ? 22.007  1.374   10.712 1.00 37.98  ? 117  ASN A HD21 1 
ATOM   1724 H HD22 . ASN A 1 117 ? 21.078  0.344   10.168 1.00 37.98  ? 117  ASN A HD22 1 
ATOM   1725 N N    . ASN A 1 118 ? 26.880  2.465   10.051 1.00 14.32  ? 118  ASN A N    1 
ATOM   1726 C CA   . ASN A 1 118 ? 27.829  3.573   10.207 1.00 12.79  ? 118  ASN A CA   1 
ATOM   1727 C C    . ASN A 1 118 ? 29.165  2.944   10.577 1.00 11.22  ? 118  ASN A C    1 
ATOM   1728 O O    . ASN A 1 118 ? 29.286  1.807   11.008 1.00 13.16  ? 118  ASN A O    1 
ATOM   1729 C CB   . ASN A 1 118 ? 27.473  4.705   11.239 1.00 14.84  ? 118  ASN A CB   1 
ATOM   1730 C CG   . ASN A 1 118 ? 27.580  4.309   12.614 1.00 14.53  ? 118  ASN A CG   1 
ATOM   1731 O OD1  . ASN A 1 118 ? 28.625  3.879   13.164 1.00 15.44  ? 118  ASN A OD1  1 
ATOM   1732 N ND2  . ASN A 1 118 ? 26.467  4.319   13.377 1.00 38.07  ? 118  ASN A ND2  1 
ATOM   1733 H H    . ASN A 1 118 ? 26.820  1.870   10.669 1.00 17.18  ? 118  ASN A H    1 
ATOM   1734 H HA   . ASN A 1 118 ? 27.935  3.996   9.330  1.00 15.35  ? 118  ASN A HA   1 
ATOM   1735 H HB2  . ASN A 1 118 ? 28.063  5.460   11.087 1.00 17.81  ? 118  ASN A HB2  1 
ATOM   1736 H HB3  . ASN A 1 118 ? 26.566  5.003   11.072 1.00 17.81  ? 118  ASN A HB3  1 
ATOM   1737 H HD21 . ASN A 1 118 ? 25.724  4.604   13.050 1.00 45.68  ? 118  ASN A HD21 1 
ATOM   1738 H HD22 . ASN A 1 118 ? 26.501  4.042   14.190 1.00 45.68  ? 118  ASN A HD22 1 
ATOM   1739 N N    . ASP A 1 119 ? 30.192  3.755   10.357 1.00 9.85   ? 119  ASP A N    1 
ATOM   1740 C CA   . ASP A 1 119 ? 31.583  3.458   10.656 1.00 9.70   ? 119  ASP A CA   1 
ATOM   1741 C C    . ASP A 1 119 ? 32.154  4.378   11.745 1.00 9.10   ? 119  ASP A C    1 
ATOM   1742 O O    . ASP A 1 119 ? 33.376  4.535   11.875 1.00 9.79   ? 119  ASP A O    1 
ATOM   1743 C CB   . ASP A 1 119 ? 32.434  3.546   9.399  1.00 10.50  ? 119  ASP A CB   1 
ATOM   1744 C CG   . ASP A 1 119 ? 31.902  2.682   8.251  1.00 10.28  ? 119  ASP A CG   1 
ATOM   1745 O OD1  . ASP A 1 119 ? 31.550  1.490   8.508  1.00 11.15  ? 119  ASP A OD1  1 
ATOM   1746 O OD2  . ASP A 1 119 ? 31.844  3.207   7.082  1.00 10.87  ? 119  ASP A OD2  1 
ATOM   1747 H H    . ASP A 1 119 ? 30.020  4.522   10.008 1.00 11.82  ? 119  ASP A H    1 
ATOM   1748 H HA   . ASP A 1 119 ? 31.630  2.536   10.987 1.00 11.64  ? 119  ASP A HA   1 
ATOM   1749 H HB2  . ASP A 1 119 ? 32.471  4.470   9.108  1.00 12.60  ? 119  ASP A HB2  1 
ATOM   1750 H HB3  . ASP A 1 119 ? 33.339  3.266   9.611  1.00 12.60  ? 119  ASP A HB3  1 
ATOM   1751 N N    . GLY A 1 120 ? 31.252  4.991   12.555 1.00 9.33   ? 120  GLY A N    1 
ATOM   1752 C CA   . GLY A 1 120 ? 31.611  5.899   13.612 1.00 9.15   ? 120  GLY A CA   1 
ATOM   1753 C C    . GLY A 1 120 ? 30.751  7.169   13.547 1.00 8.55   ? 120  GLY A C    1 
ATOM   1754 O O    . GLY A 1 120 ? 29.707  7.226   12.853 1.00 9.15   ? 120  GLY A O    1 
ATOM   1755 H H    . GLY A 1 120 ? 30.417  4.826   12.430 1.00 11.19  ? 120  GLY A H    1 
ATOM   1756 H HA2  . GLY A 1 120 ? 31.484  5.465   14.470 1.00 10.98  ? 120  GLY A HA2  1 
ATOM   1757 H HA3  . GLY A 1 120 ? 32.548  6.137   13.530 1.00 10.98  ? 120  GLY A HA3  1 
ATOM   1758 N N    . LEU A 1 121 ? 31.174  8.165   14.336 1.00 8.80   ? 121  LEU A N    1 
ATOM   1759 C CA   . LEU A 1 121 ? 30.419  9.405   14.558 1.00 8.74   ? 121  LEU A CA   1 
ATOM   1760 C C    . LEU A 1 121 ? 31.306  10.608  14.249 1.00 8.68   ? 121  LEU A C    1 
ATOM   1761 O O    . LEU A 1 121 ? 32.533  10.573  14.476 1.00 9.58   ? 121  LEU A O    1 
ATOM   1762 C CB   . LEU A 1 121 ? 29.912  9.544   16.050 1.00 10.85  ? 121  LEU A CB   1 
ATOM   1763 C CG   . LEU A 1 121 ? 28.462  9.023   16.266 1.00 12.27  ? 121  LEU A CG   1 
ATOM   1764 C CD1  . LEU A 1 121 ? 28.411  7.525   16.092 1.00 12.76  ? 121  LEU A CD1  1 
ATOM   1765 C CD2  . LEU A 1 121 ? 27.927  9.478   17.623 1.00 13.32  ? 121  LEU A CD2  1 
ATOM   1766 H H    . LEU A 1 121 ? 31.930  8.074   14.736 1.00 10.55  ? 121  LEU A H    1 
ATOM   1767 H HA   . LEU A 1 121 ? 29.645  9.418   13.956 1.00 10.48  ? 121  LEU A HA   1 
ATOM   1768 H HB2  . LEU A 1 121 ? 30.511  9.051   16.632 1.00 13.02  ? 121  LEU A HB2  1 
ATOM   1769 H HB3  . LEU A 1 121 ? 29.951  10.478  16.308 1.00 13.02  ? 121  LEU A HB3  1 
ATOM   1770 H HG   . LEU A 1 121 ? 27.896  9.423   15.573 1.00 14.72  ? 121  LEU A HG   1 
ATOM   1771 H HD11 . LEU A 1 121 ? 28.756  7.291   15.227 1.00 19.15  ? 121  LEU A HD11 1 
ATOM   1772 H HD12 . LEU A 1 121 ? 28.943  7.106   16.773 1.00 19.15  ? 121  LEU A HD12 1 
ATOM   1773 H HD13 . LEU A 1 121 ? 27.502  7.225   16.166 1.00 19.15  ? 121  LEU A HD13 1 
ATOM   1774 H HD21 . LEU A 1 121 ? 28.453  9.083   18.322 1.00 19.98  ? 121  LEU A HD21 1 
ATOM   1775 H HD22 . LEU A 1 121 ? 27.980  10.434  17.683 1.00 19.98  ? 121  LEU A HD22 1 
ATOM   1776 H HD23 . LEU A 1 121 ? 27.013  9.201   17.715 1.00 19.98  ? 121  LEU A HD23 1 
ATOM   1777 N N    . LEU A 1 122 ? 30.661  11.683  13.768 1.00 8.76   ? 122  LEU A N    1 
ATOM   1778 C CA   . LEU A 1 122 ? 31.344  12.983  13.609 1.00 8.30   ? 122  LEU A CA   1 
ATOM   1779 C C    . LEU A 1 122 ? 30.563  13.990  14.472 1.00 8.23   ? 122  LEU A C    1 
ATOM   1780 O O    . LEU A 1 122 ? 29.450  14.410  14.123 1.00 9.00   ? 122  LEU A O    1 
ATOM   1781 C CB   . LEU A 1 122 ? 31.481  13.386  12.143 1.00 8.98   ? 122  LEU A CB   1 
ATOM   1782 C CG   . LEU A 1 122 ? 32.312  14.658  11.878 1.00 9.42   ? 122  LEU A CG   1 
ATOM   1783 C CD1  . LEU A 1 122 ? 33.040  14.572  10.530 1.00 10.52  ? 122  LEU A CD1  1 
ATOM   1784 C CD2  . LEU A 1 122 ? 31.466  15.938  11.958 1.00 10.59  ? 122  LEU A CD2  1 
ATOM   1785 H H    . LEU A 1 122 ? 29.833  11.612  13.548 1.00 10.52  ? 122  LEU A H    1 
ATOM   1786 H HA   . LEU A 1 122 ? 32.245  12.899  13.984 1.00 9.96   ? 122  LEU A HA   1 
ATOM   1787 H HB2  . LEU A 1 122 ? 31.886  12.649  11.660 1.00 10.77  ? 122  LEU A HB2  1 
ATOM   1788 H HB3  . LEU A 1 122 ? 30.592  13.519  11.778 1.00 10.77  ? 122  LEU A HB3  1 
ATOM   1789 H HG   . LEU A 1 122 ? 32.996  14.713  12.577 1.00 11.31  ? 122  LEU A HG   1 
ATOM   1790 H HD11 . LEU A 1 122 ? 33.562  13.767  10.499 1.00 15.78  ? 122  LEU A HD11 1 
ATOM   1791 H HD12 . LEU A 1 122 ? 32.395  14.563  9.818  1.00 15.78  ? 122  LEU A HD12 1 
ATOM   1792 H HD13 . LEU A 1 122 ? 33.617  15.332  10.428 1.00 15.78  ? 122  LEU A HD13 1 
ATOM   1793 H HD21 . LEU A 1 122 ? 30.813  15.936  11.254 1.00 15.89  ? 122  LEU A HD21 1 
ATOM   1794 H HD22 . LEU A 1 122 ? 31.019  15.974  12.808 1.00 15.89  ? 122  LEU A HD22 1 
ATOM   1795 H HD23 . LEU A 1 122 ? 32.035  16.705  11.864 1.00 15.89  ? 122  LEU A HD23 1 
ATOM   1796 N N    . GLY A 1 123 ? 31.148  14.374  15.592 1.00 8.77   ? 123  GLY A N    1 
ATOM   1797 C CA   . GLY A 1 123 ? 30.499  15.261  16.539 1.00 8.70   ? 123  GLY A CA   1 
ATOM   1798 C C    . GLY A 1 123 ? 30.524  16.727  16.075 1.00 8.44   ? 123  GLY A C    1 
ATOM   1799 O O    . GLY A 1 123 ? 31.514  17.211  15.566 1.00 9.51   ? 123  GLY A O    1 
ATOM   1800 H H    . GLY A 1 123 ? 31.941  14.089  15.766 1.00 10.52  ? 123  GLY A H    1 
ATOM   1801 H HA2  . GLY A 1 123 ? 29.578  14.981  16.658 1.00 10.44  ? 123  GLY A HA2  1 
ATOM   1802 H HA3  . GLY A 1 123 ? 30.944  15.192  17.398 1.00 10.44  ? 123  GLY A HA3  1 
ATOM   1803 N N    . LEU A 1 124 ? 29.387  17.412  16.326 1.00 8.33   ? 124  LEU A N    1 
ATOM   1804 C CA   . LEU A 1 124 ? 29.182  18.806  15.949 1.00 8.42   ? 124  LEU A CA   1 
ATOM   1805 C C    . LEU A 1 124 ? 28.662  19.662  17.125 1.00 8.81   ? 124  LEU A C    1 
ATOM   1806 O O    . LEU A 1 124 ? 28.258  20.821  16.912 1.00 9.51   ? 124  LEU A O    1 
ATOM   1807 C CB   . LEU A 1 124 ? 28.221  18.899  14.728 1.00 9.06   ? 124  LEU A CB   1 
ATOM   1808 C CG   . LEU A 1 124 ? 28.794  18.347  13.429 1.00 9.03   ? 124  LEU A CG   1 
ATOM   1809 C CD1  . LEU A 1 124 ? 27.645  18.220  12.404 1.00 10.88  ? 124  LEU A CD1  1 
ATOM   1810 C CD2  . LEU A 1 124 ? 29.928  19.218  12.895 1.00 11.12  ? 124  LEU A CD2  1 
ATOM   1811 H H    . LEU A 1 124 ? 28.748  17.003  16.730 1.00 10.00  ? 124  LEU A H    1 
ATOM   1812 H HA   . LEU A 1 124 ? 30.049  19.171  15.675 1.00 10.11  ? 124  LEU A HA   1 
ATOM   1813 H HB2  . LEU A 1 124 ? 27.407  18.416  14.938 1.00 10.87  ? 124  LEU A HB2  1 
ATOM   1814 H HB3  . LEU A 1 124 ? 27.984  19.830  14.591 1.00 10.87  ? 124  LEU A HB3  1 
ATOM   1815 H HG   . LEU A 1 124 ? 29.151  17.451  13.605 1.00 10.83  ? 124  LEU A HG   1 
ATOM   1816 H HD11 . LEU A 1 124 ? 26.950  17.667  12.769 1.00 16.32  ? 124  LEU A HD11 1 
ATOM   1817 H HD12 . LEU A 1 124 ? 27.292  19.091  12.209 1.00 16.32  ? 124  LEU A HD12 1 
ATOM   1818 H HD13 . LEU A 1 124 ? 27.978  17.822  11.596 1.00 16.32  ? 124  LEU A HD13 1 
ATOM   1819 H HD21 . LEU A 1 124 ? 30.263  18.842  12.078 1.00 16.68  ? 124  LEU A HD21 1 
ATOM   1820 H HD22 . LEU A 1 124 ? 29.599  20.105  12.729 1.00 16.68  ? 124  LEU A HD22 1 
ATOM   1821 H HD23 . LEU A 1 124 ? 30.635  19.256  13.543 1.00 16.68  ? 124  LEU A HD23 1 
ATOM   1822 N N    . ALA A 1 125 ? 28.667  19.111  18.349 1.00 8.51   ? 125  ALA A N    1 
ATOM   1823 C CA   . ALA A 1 125 ? 28.459  19.909  19.579 1.00 8.47   ? 125  ALA A CA   1 
ATOM   1824 C C    . ALA A 1 125 ? 29.679  20.771  19.818 1.00 8.89   ? 125  ALA A C    1 
ATOM   1825 O O    . ALA A 1 125 ? 30.680  20.734  19.065 1.00 10.06  ? 125  ALA A O    1 
ATOM   1826 C CB   . ALA A 1 125 ? 28.164  19.022  20.757 1.00 9.11   ? 125  ALA A CB   1 
ATOM   1827 H H    . ALA A 1 125 ? 28.795  18.264  18.421 1.00 10.22  ? 125  ALA A H    1 
ATOM   1828 H HA   . ALA A 1 125 ? 27.689  20.498  19.437 1.00 10.16  ? 125  ALA A HA   1 
ATOM   1829 H HB1  . ALA A 1 125 ? 28.002  19.564  21.533 1.00 13.66  ? 125  ALA A HB1  1 
ATOM   1830 H HB2  . ALA A 1 125 ? 27.386  18.491  20.570 1.00 13.66  ? 125  ALA A HB2  1 
ATOM   1831 H HB3  . ALA A 1 125 ? 28.914  18.445  20.920 1.00 13.66  ? 125  ALA A HB3  1 
ATOM   1832 N N    . PHE A 1 126 ? 29.639  21.611  20.872 1.00 9.12   ? 126  PHE A N    1 
ATOM   1833 C CA   . PHE A 1 126 ? 30.798  22.482  21.158 1.00 9.28   ? 126  PHE A CA   1 
ATOM   1834 C C    . PHE A 1 126 ? 31.977  21.642  21.619 1.00 9.06   ? 126  PHE A C    1 
ATOM   1835 O O    . PHE A 1 126 ? 31.856  20.638  22.349 1.00 10.08  ? 126  PHE A O    1 
ATOM   1836 C CB   . PHE A 1 126 ? 30.381  23.535  22.226 1.00 9.74   ? 126  PHE A CB   1 
ATOM   1837 C CG   . PHE A 1 126 ? 29.384  24.526  21.693 1.00 9.76   ? 126  PHE A CG   1 
ATOM   1838 C CD1  . PHE A 1 126 ? 28.032  24.277  21.661 1.00 10.39  ? 126  PHE A CD1  1 
ATOM   1839 C CD2  . PHE A 1 126 ? 29.817  25.741  21.139 1.00 11.89  ? 126  PHE A CD2  1 
ATOM   1840 C CE1  . PHE A 1 126 ? 27.119  25.175  21.087 1.00 11.14  ? 126  PHE A CE1  1 
ATOM   1841 C CE2  . PHE A 1 126 ? 28.880  26.645  20.562 1.00 13.50  ? 126  PHE A CE2  1 
ATOM   1842 C CZ   . PHE A 1 126 ? 27.559  26.308  20.531 1.00 11.58  ? 126  PHE A CZ   1 
ATOM   1843 H H    . PHE A 1 126 ? 28.943  21.640  21.376 1.00 10.95  ? 126  PHE A H    1 
ATOM   1844 H HA   . PHE A 1 126 ? 31.049  22.952  20.335 1.00 11.14  ? 126  PHE A HA   1 
ATOM   1845 H HB2  . PHE A 1 126 ? 29.996  23.077  22.990 1.00 11.69  ? 126  PHE A HB2  1 
ATOM   1846 H HB3  . PHE A 1 126 ? 31.170  24.009  22.530 1.00 11.69  ? 126  PHE A HB3  1 
ATOM   1847 H HD1  . PHE A 1 126 ? 27.712  23.487  22.032 1.00 12.47  ? 126  PHE A HD1  1 
ATOM   1848 H HD2  . PHE A 1 126 ? 30.722  25.957  21.148 1.00 14.26  ? 126  PHE A HD2  1 
ATOM   1849 H HE1  . PHE A 1 126 ? 26.210  24.981  21.094 1.00 13.37  ? 126  PHE A HE1  1 
ATOM   1850 H HE2  . PHE A 1 126 ? 29.166  27.456  20.210 1.00 16.20  ? 126  PHE A HE2  1 
ATOM   1851 H HZ   . PHE A 1 126 ? 26.953  26.878  20.116 1.00 13.89  ? 126  PHE A HZ   1 
ATOM   1852 N N    . SER A 1 127 ? 33.192  22.093  21.230 1.00 9.55   ? 127  SER A N    1 
ATOM   1853 C CA   . SER A 1 127 ? 34.416  21.319  21.507 1.00 9.89   ? 127  SER A CA   1 
ATOM   1854 C C    . SER A 1 127 ? 34.722  21.190  22.986 1.00 10.07  ? 127  SER A C    1 
ATOM   1855 O O    . SER A 1 127 ? 35.481  20.276  23.386 1.00 10.45  ? 127  SER A O    1 
ATOM   1856 C CB   . SER A 1 127 ? 35.591  21.906  20.783 1.00 10.87  ? 127  SER A CB   1 
ATOM   1857 O OG   . SER A 1 127 ? 35.467  21.773  19.352 1.00 11.90  ? 127  SER A OG   1 
ATOM   1858 H H    . SER A 1 127 ? 33.252  22.844  20.815 1.00 11.46  ? 127  SER A H    1 
ATOM   1859 H HA   . SER A 1 127 ? 34.277  20.414  21.156 1.00 11.87  ? 127  SER A HA   1 
ATOM   1860 H HB2  . SER A 1 127 ? 35.670  22.845  21.011 1.00 13.04  ? 127  SER A HB2  1 
ATOM   1861 H HB3  . SER A 1 127 ? 36.401  21.459  21.076 1.00 13.04  ? 127  SER A HB3  1 
ATOM   1862 H HG   . SER A 1 127 ? 34.791  22.162  19.099 1.00 17.85  ? 127  SER A HG   1 
ATOM   1863 N N    . SER A 1 128 ? 34.133  22.032  23.856 1.00 10.16  ? 128  SER A N    1 
ATOM   1864 C CA   . SER A 1 128 ? 34.337  21.935  25.289 1.00 10.98  ? 128  SER A CA   1 
ATOM   1865 C C    . SER A 1 128 ? 33.965  20.569  25.866 1.00 11.02  ? 128  SER A C    1 
ATOM   1866 O O    . SER A 1 128 ? 34.559  20.220  26.923 1.00 14.00  ? 128  SER A O    1 
ATOM   1867 C CB   . SER A 1 128 ? 33.537  23.033  26.014 1.00 12.06  ? 128  SER A CB   1 
ATOM   1868 O OG   . SER A 1 128 ? 32.163  22.821  25.806 1.00 13.78  ? 128  SER A OG   1 
ATOM   1869 H H    . SER A 1 128 ? 33.617  22.649  23.551 1.00 12.20  ? 128  SER A H    1 
ATOM   1870 H HA   . SER A 1 128 ? 35.288  22.088  25.468 1.00 13.17  ? 128  SER A HA   1 
ATOM   1871 H HB2  . SER A 1 128 ? 33.733  23.010  26.963 1.00 14.47  ? 128  SER A HB2  1 
ATOM   1872 H HB3  . SER A 1 128 ? 33.790  23.904  25.672 1.00 14.47  ? 128  SER A HB3  1 
ATOM   1873 H HG   . SER A 1 128 ? 31.735  23.404  26.191 1.00 20.66  ? 128  SER A HG   1 
ATOM   1874 N N    . ILE A 1 129 ? 33.095  19.806  25.204 1.00 9.40   ? 129  ILE A N    1 
ATOM   1875 C CA   . ILE A 1 129 ? 32.664  18.489  25.722 1.00 9.69   ? 129  ILE A CA   1 
ATOM   1876 C C    . ILE A 1 129 ? 33.314  17.335  24.926 1.00 9.51   ? 129  ILE A C    1 
ATOM   1877 O O    . ILE A 1 129 ? 32.909  16.157  25.094 1.00 10.00  ? 129  ILE A O    1 
ATOM   1878 C CB   . ILE A 1 129 ? 31.168  18.357  25.866 1.00 10.10  ? 129  ILE A CB   1 
ATOM   1879 C CG1  . ILE A 1 129 ? 30.382  18.494  24.544 1.00 9.81   ? 129  ILE A CG1  1 
ATOM   1880 C CG2  . ILE A 1 129 ? 30.661  19.334  26.946 1.00 11.47  ? 129  ILE A CG2  1 
ATOM   1881 C CD1  . ILE A 1 129 ? 28.955  18.065  24.587 1.00 10.65  ? 129  ILE A CD1  1 
ATOM   1882 H H    . ILE A 1 129 ? 32.775  20.087  24.457 1.00 11.28  ? 129  ILE A H    1 
ATOM   1883 H HA   . ILE A 1 129 ? 33.027  18.426  26.630 1.00 11.62  ? 129  ILE A HA   1 
ATOM   1884 H HB   . ILE A 1 129 ? 30.997  17.453  26.202 1.00 12.12  ? 129  ILE A HB   1 
ATOM   1885 H HG12 . ILE A 1 129 ? 30.413  19.423  24.266 1.00 11.77  ? 129  ILE A HG12 1 
ATOM   1886 H HG13 . ILE A 1 129 ? 30.836  17.973  23.864 1.00 11.77  ? 129  ILE A HG13 1 
ATOM   1887 H HG21 . ILE A 1 129 ? 30.879  20.234  26.692 1.00 17.21  ? 129  ILE A HG21 1 
ATOM   1888 H HG22 . ILE A 1 129 ? 29.709  19.248  27.034 1.00 17.21  ? 129  ILE A HG22 1 
ATOM   1889 H HG23 . ILE A 1 129 ? 31.079  19.128  27.786 1.00 17.21  ? 129  ILE A HG23 1 
ATOM   1890 H HD11 . ILE A 1 129 ? 28.907  17.138  24.831 1.00 15.97  ? 129  ILE A HD11 1 
ATOM   1891 H HD12 . ILE A 1 129 ? 28.482  18.593  25.235 1.00 15.97  ? 129  ILE A HD12 1 
ATOM   1892 H HD13 . ILE A 1 129 ? 28.558  18.189  23.722 1.00 15.97  ? 129  ILE A HD13 1 
ATOM   1893 N N    . ASN A 1 130 ? 34.320  17.615  24.120 1.00 9.33   ? 130  ASN A N    1 
ATOM   1894 C CA   . ASN A 1 130 ? 35.119  16.539  23.505 1.00 8.95   ? 130  ASN A CA   1 
ATOM   1895 C C    . ASN A 1 130 ? 35.795  15.728  24.643 1.00 9.11   ? 130  ASN A C    1 
ATOM   1896 O O    . ASN A 1 130 ? 36.288  16.333  25.620 1.00 10.12  ? 130  ASN A O    1 
ATOM   1897 C CB   . ASN A 1 130 ? 36.144  17.169  22.548 1.00 9.21   ? 130  ASN A CB   1 
ATOM   1898 C CG   . ASN A 1 130 ? 37.121  16.124  22.035 1.00 8.97   ? 130  ASN A CG   1 
ATOM   1899 O OD1  . ASN A 1 130 ? 38.198  15.901  22.636 1.00 9.56   ? 130  ASN A OD1  1 
ATOM   1900 N ND2  . ASN A 1 130 ? 36.736  15.426  20.965 1.00 9.62   ? 130  ASN A ND2  1 
ATOM   1901 H H    . ASN A 1 130 ? 34.513  18.436  23.950 1.00 11.20  ? 130  ASN A H    1 
ATOM   1902 H HA   . ASN A 1 130 ? 34.526  15.947  22.997 1.00 10.74  ? 130  ASN A HA   1 
ATOM   1903 H HB2  . ASN A 1 130 ? 35.680  17.573  21.798 1.00 11.05  ? 130  ASN A HB2  1 
ATOM   1904 H HB3  . ASN A 1 130 ? 36.632  17.868  23.011 1.00 11.05  ? 130  ASN A HB3  1 
ATOM   1905 H HD21 . ASN A 1 130 ? 35.989  15.608  20.579 1.00 11.55  ? 130  ASN A HD21 1 
ATOM   1906 H HD22 . ASN A 1 130 ? 37.235  14.795  20.660 1.00 11.55  ? 130  ASN A HD22 1 
ATOM   1907 N N    . THR A 1 131 ? 35.842  14.397  24.499 1.00 9.07   ? 131  THR A N    1 
ATOM   1908 C CA   . THR A 1 131 ? 36.316  13.531  25.601 1.00 9.40   ? 131  THR A CA   1 
ATOM   1909 C C    . THR A 1 131 ? 37.787  13.195  25.578 1.00 9.73   ? 131  THR A C    1 
ATOM   1910 O O    . THR A 1 131 ? 38.258  12.428  26.474 1.00 11.27  ? 131  THR A O    1 
ATOM   1911 C CB   . THR A 1 131 ? 35.521  12.168  25.669 1.00 9.66   ? 131  THR A CB   1 
ATOM   1912 O OG1  . THR A 1 131 ? 35.989  11.253  24.682 1.00 10.51  ? 131  THR A OG1  1 
ATOM   1913 C CG2  . THR A 1 131 ? 34.011  12.359  25.603 1.00 10.52  ? 131  THR A CG2  1 
ATOM   1914 H H    . THR A 1 131 ? 35.592  14.041  23.757 1.00 10.88  ? 131  THR A H    1 
ATOM   1915 H HA   . THR A 1 131 ? 36.143  14.009  26.439 1.00 11.28  ? 131  THR A HA   1 
ATOM   1916 H HB   . THR A 1 131 ? 35.718  11.768  26.542 1.00 11.59  ? 131  THR A HB   1 
ATOM   1917 H HG1  . THR A 1 131 ? 36.803  11.174  24.746 1.00 15.77  ? 131  THR A HG1  1 
ATOM   1918 H HG21 . THR A 1 131 ? 33.578  11.503  25.650 1.00 15.78  ? 131  THR A HG21 1 
ATOM   1919 H HG22 . THR A 1 131 ? 33.724  12.903  26.340 1.00 15.78  ? 131  THR A HG22 1 
ATOM   1920 H HG23 . THR A 1 131 ? 33.778  12.790  24.777 1.00 15.78  ? 131  THR A HG23 1 
ATOM   1921 N N    . VAL A 1 132 ? 38.557  13.666  24.620 1.00 9.44   ? 132  VAL A N    1 
ATOM   1922 C CA   . VAL A 1 132 ? 39.993  13.282  24.546 1.00 9.20   ? 132  VAL A CA   1 
ATOM   1923 C C    . VAL A 1 132 ? 40.735  13.736  25.807 1.00 9.40   ? 132  VAL A C    1 
ATOM   1924 O O    . VAL A 1 132 ? 40.530  14.882  26.297 1.00 9.91   ? 132  VAL A O    1 
ATOM   1925 C CB   . VAL A 1 132 ? 40.651  13.850  23.239 1.00 9.43   ? 132  VAL A CB   1 
ATOM   1926 C CG1  . VAL A 1 132 ? 42.153  13.623  23.258 1.00 9.86   ? 132  VAL A CG1  1 
ATOM   1927 C CG2  . VAL A 1 132 ? 40.009  13.193  22.031 1.00 9.56   ? 132  VAL A CG2  1 
ATOM   1928 H H    . VAL A 1 132 ? 38.228  14.201  24.032 1.00 11.33  ? 132  VAL A H    1 
ATOM   1929 H HA   . VAL A 1 132 ? 40.040  12.304  24.506 1.00 11.04  ? 132  VAL A HA   1 
ATOM   1930 H HB   . VAL A 1 132 ? 40.481  14.814  23.197 1.00 11.31  ? 132  VAL A HB   1 
ATOM   1931 H HG11 . VAL A 1 132 ? 42.531  14.046  24.032 1.00 14.78  ? 132  VAL A HG11 1 
ATOM   1932 H HG12 . VAL A 1 132 ? 42.334  12.680  23.288 1.00 14.78  ? 132  VAL A HG12 1 
ATOM   1933 H HG13 . VAL A 1 132 ? 42.543  13.998  22.465 1.00 14.78  ? 132  VAL A HG13 1 
ATOM   1934 H HG21 . VAL A 1 132 ? 40.176  12.248  22.055 1.00 14.35  ? 132  VAL A HG21 1 
ATOM   1935 H HG22 . VAL A 1 132 ? 39.062  13.351  22.046 1.00 14.35  ? 132  VAL A HG22 1 
ATOM   1936 H HG23 . VAL A 1 132 ? 40.383  13.564  21.229 1.00 14.35  ? 132  VAL A HG23 1 
ATOM   1937 N N    . GLN A 1 133 ? 41.575  12.855  26.292 1.00 9.61   ? 133  GLN A N    1 
ATOM   1938 C CA   . GLN A 1 133 ? 42.419  13.080  27.491 1.00 10.12  ? 133  GLN A CA   1 
ATOM   1939 C C    . GLN A 1 133 ? 43.861  12.903  27.130 1.00 9.34   ? 133  GLN A C    1 
ATOM   1940 O O    . GLN A 1 133 ? 44.217  12.054  26.317 1.00 10.33  ? 133  GLN A O    1 
ATOM   1941 C CB   . GLN A 1 133 ? 42.072  11.996  28.559 1.00 13.09  ? 133  GLN A CB   1 
ATOM   1942 C CG   . GLN A 1 133 ? 40.661  11.871  28.977 1.00 13.12  ? 133  GLN A CG   1 
ATOM   1943 C CD   . GLN A 1 133 ? 40.255  13.085  29.614 1.00 13.60  ? 133  GLN A CD   1 
ATOM   1944 O OE1  . GLN A 1 133 ? 40.915  13.720  30.436 1.00 16.89  ? 133  GLN A OE1  1 
ATOM   1945 N NE2  . GLN A 1 133 ? 39.032  13.558  29.297 1.00 18.93  ? 133  GLN A NE2  1 
ATOM   1946 H H    . GLN A 1 133 ? 41.642  12.098  25.890 1.00 11.53  ? 133  GLN A H    1 
ATOM   1947 H HA   . GLN A 1 133 ? 42.265  13.978  27.853 1.00 12.14  ? 133  GLN A HA   1 
ATOM   1948 H HB2  . GLN A 1 133 ? 42.357  11.136  28.214 1.00 15.71  ? 133  GLN A HB2  1 
ATOM   1949 H HB3  . GLN A 1 133 ? 42.602  12.177  29.351 1.00 15.71  ? 133  GLN A HB3  1 
ATOM   1950 H HG2  . GLN A 1 133 ? 40.102  11.701  28.203 1.00 15.74  ? 133  GLN A HG2  1 
ATOM   1951 H HG3  . GLN A 1 133 ? 40.564  11.127  29.592 1.00 15.74  ? 133  GLN A HG3  1 
ATOM   1952 H HE21 . GLN A 1 133 ? 38.544  13.139  28.726 1.00 22.72  ? 133  GLN A HE21 1 
ATOM   1953 H HE22 . GLN A 1 133 ? 38.741  14.279  29.665 1.00 22.72  ? 133  GLN A HE22 1 
ATOM   1954 N N    . PRO A 1 134 ? 44.769  13.686  27.761 1.00 9.59   ? 134  PRO A N    1 
ATOM   1955 C CA   . PRO A 1 134 ? 44.468  14.603  28.893 1.00 9.97   ? 134  PRO A CA   1 
ATOM   1956 C C    . PRO A 1 134 ? 43.953  15.975  28.490 1.00 10.49  ? 134  PRO A C    1 
ATOM   1957 O O    . PRO A 1 134 ? 43.531  16.709  29.388 1.00 12.09  ? 134  PRO A O    1 
ATOM   1958 C CB   . PRO A 1 134 ? 45.811  14.662  29.653 1.00 11.33  ? 134  PRO A CB   1 
ATOM   1959 C CG   . PRO A 1 134 ? 46.847  14.508  28.541 1.00 11.36  ? 134  PRO A CG   1 
ATOM   1960 C CD   . PRO A 1 134 ? 46.230  13.447  27.615 1.00 10.81  ? 134  PRO A CD   1 
ATOM   1961 H HA   . PRO A 1 134 ? 43.802  14.177  29.471 1.00 11.96  ? 134  PRO A HA   1 
ATOM   1962 H HB2  . PRO A 1 134 ? 45.916  15.510  30.113 1.00 13.59  ? 134  PRO A HB2  1 
ATOM   1963 H HB3  . PRO A 1 134 ? 45.880  13.941  30.297 1.00 13.59  ? 134  PRO A HB3  1 
ATOM   1964 H HG2  . PRO A 1 134 ? 46.980  15.346  28.071 1.00 13.63  ? 134  PRO A HG2  1 
ATOM   1965 H HG3  . PRO A 1 134 ? 47.697  14.207  28.897 1.00 13.63  ? 134  PRO A HG3  1 
ATOM   1966 H HD2  . PRO A 1 134 ? 46.516  13.576  26.696 1.00 12.97  ? 134  PRO A HD2  1 
ATOM   1967 H HD3  . PRO A 1 134 ? 46.470  12.552  27.899 1.00 12.97  ? 134  PRO A HD3  1 
ATOM   1968 N N    . GLN A 1 135 ? 44.053  16.346  27.200 1.00 10.55  ? 135  GLN A N    1 
ATOM   1969 C CA   . GLN A 1 135 ? 43.530  17.630  26.737 1.00 10.92  ? 135  GLN A CA   1 
ATOM   1970 C C    . GLN A 1 135 ? 42.530  17.395  25.625 1.00 11.09  ? 135  GLN A C    1 
ATOM   1971 O O    . GLN A 1 135 ? 42.813  16.643  24.649 1.00 11.55  ? 135  GLN A O    1 
ATOM   1972 C CB   . GLN A 1 135 ? 44.653  18.576  26.261 1.00 11.57  ? 135  GLN A CB   1 
ATOM   1973 C CG   . GLN A 1 135 ? 45.696  18.829  27.352 1.00 12.50  ? 135  GLN A CG   1 
ATOM   1974 C CD   . GLN A 1 135 ? 46.689  19.900  26.907 1.00 13.76  ? 135  GLN A CD   1 
ATOM   1975 O OE1  . GLN A 1 135 ? 46.569  21.099  27.232 1.00 19.45  ? 135  GLN A OE1  1 
ATOM   1976 N NE2  . GLN A 1 135 ? 47.613  19.494  26.036 1.00 18.28  ? 135  GLN A NE2  1 
ATOM   1977 H H    . GLN A 1 135 ? 44.431  15.817  26.637 1.00 12.65  ? 135  GLN A H    1 
ATOM   1978 H HA   . GLN A 1 135 ? 43.064  18.059  27.484 1.00 13.10  ? 135  GLN A HA   1 
ATOM   1979 H HB2  . GLN A 1 135 ? 45.090  18.187  25.487 1.00 13.89  ? 135  GLN A HB2  1 
ATOM   1980 H HB3  . GLN A 1 135 ? 44.263  19.422  25.990 1.00 13.89  ? 135  GLN A HB3  1 
ATOM   1981 H HG2  . GLN A 1 135 ? 45.252  19.117  28.165 1.00 15.00  ? 135  GLN A HG2  1 
ATOM   1982 H HG3  . GLN A 1 135 ? 46.171  18.006  27.544 1.00 15.00  ? 135  GLN A HG3  1 
ATOM   1983 H HE21 . GLN A 1 135 ? 47.674  18.661  25.831 1.00 21.94  ? 135  GLN A HE21 1 
ATOM   1984 H HE22 . GLN A 1 135 ? 48.148  20.065  25.680 1.00 21.94  ? 135  GLN A HE22 1 
ATOM   1985 N N    . SER A 1 136 ? 41.411  18.064  25.692 1.00 11.13  ? 136  SER A N    1 
ATOM   1986 C CA   . SER A 1 136 ? 40.358  17.966  24.690 1.00 11.08  ? 136  SER A CA   1 
ATOM   1987 C C    . SER A 1 136 ? 40.850  18.529  23.329 1.00 10.30  ? 136  SER A C    1 
ATOM   1988 O O    . SER A 1 136 ? 41.736  19.389  23.255 1.00 12.18  ? 136  SER A O    1 
ATOM   1989 C CB   . SER A 1 136 ? 39.077  18.642  25.148 1.00 12.63  ? 136  SER A CB   1 
ATOM   1990 O OG   . SER A 1 136 ? 39.258  19.983  25.322 1.00 15.26  ? 136  SER A OG   1 
ATOM   1991 H H    . SER A 1 136 ? 41.290  18.590  26.362 1.00 13.35  ? 136  SER A H    1 
ATOM   1992 H HA   . SER A 1 136 ? 40.160  17.015  24.562 1.00 13.30  ? 136  SER A HA   1 
ATOM   1993 H HB2  . SER A 1 136 ? 38.382  18.495  24.488 1.00 15.15  ? 136  SER A HB2  1 
ATOM   1994 H HB3  . SER A 1 136 ? 38.785  18.246  25.984 1.00 15.15  ? 136  SER A HB3  1 
ATOM   1995 H HG   . SER A 1 136 ? 39.841  20.109  25.885 1.00 22.89  ? 136  SER A HG   1 
ATOM   1996 N N    . GLN A 1 137 ? 40.214  18.017  22.264 1.00 9.91   ? 137  GLN A N    1 
ATOM   1997 C CA   . GLN A 1 137 ? 40.483  18.380  20.892 1.00 10.40  ? 137  GLN A CA   1 
ATOM   1998 C C    . GLN A 1 137 ? 39.268  19.095  20.264 1.00 10.46  ? 137  GLN A C    1 
ATOM   1999 O O    . GLN A 1 137 ? 38.175  19.021  20.775 1.00 12.67  ? 137  GLN A O    1 
ATOM   2000 C CB   . GLN A 1 137 ? 40.848  17.102  20.075 1.00 10.95  ? 137  GLN A CB   1 
ATOM   2001 C CG   . GLN A 1 137 ? 42.027  16.333  20.695 1.00 11.29  ? 137  GLN A CG   1 
ATOM   2002 C CD   . GLN A 1 137 ? 43.285  17.060  20.731 1.00 12.69  ? 137  GLN A CD   1 
ATOM   2003 O OE1  . GLN A 1 137 ? 43.736  17.567  19.688 1.00 15.16  ? 137  GLN A OE1  1 
ATOM   2004 N NE2  . GLN A 1 137 ? 43.911  17.171  21.924 1.00 13.77  ? 137  GLN A NE2  1 
ATOM   2005 H H    . GLN A 1 137 ? 39.602  17.430  22.409 1.00 11.89  ? 137  GLN A H    1 
ATOM   2006 H HA   . GLN A 1 137 ? 41.249  18.992  20.875 1.00 12.48  ? 137  GLN A HA   1 
ATOM   2007 H HB2  . GLN A 1 137 ? 40.074  16.518  20.035 1.00 13.14  ? 137  GLN A HB2  1 
ATOM   2008 H HB3  . GLN A 1 137 ? 41.076  17.357  19.168 1.00 13.14  ? 137  GLN A HB3  1 
ATOM   2009 H HG2  . GLN A 1 137 ? 41.790  16.084  21.601 1.00 13.55  ? 137  GLN A HG2  1 
ATOM   2010 H HG3  . GLN A 1 137 ? 42.159  15.515  20.192 1.00 13.55  ? 137  GLN A HG3  1 
ATOM   2011 H HE21 . GLN A 1 137 ? 43.570  16.807  22.624 1.00 16.52  ? 137  GLN A HE21 1 
ATOM   2012 H HE22 . GLN A 1 137 ? 44.651  17.606  21.983 1.00 16.52  ? 137  GLN A HE22 1 
ATOM   2013 N N    . THR A 1 138 ? 39.486  19.755  19.113 1.00 11.27  ? 138  THR A N    1 
ATOM   2014 C CA   . THR A 1 138 ? 38.398  20.432  18.398 1.00 11.74  ? 138  THR A CA   1 
ATOM   2015 C C    . THR A 1 138 ? 37.640  19.540  17.447 1.00 10.94  ? 138  THR A C    1 
ATOM   2016 O O    . THR A 1 138 ? 38.272  18.691  16.754 1.00 11.40  ? 138  THR A O    1 
ATOM   2017 C CB   . THR A 1 138 ? 38.796  21.698  17.653 1.00 12.45  ? 138  THR A CB   1 
ATOM   2018 O OG1  . THR A 1 138 ? 39.902  21.390  16.816 1.00 13.56  ? 138  THR A OG1  1 
ATOM   2019 C CG2  . THR A 1 138 ? 39.188  22.801  18.604 1.00 16.39  ? 138  THR A CG2  1 
ATOM   2020 H H    . THR A 1 138 ? 40.282  19.781  18.788 1.00 13.53  ? 138  THR A H    1 
ATOM   2021 H HA   . THR A 1 138 ? 37.754  20.710  19.082 1.00 14.09  ? 138  THR A HA   1 
ATOM   2022 H HB   . THR A 1 138 ? 38.045  21.999  17.100 1.00 14.94  ? 138  THR A HB   1 
ATOM   2023 H HG1  . THR A 1 138 ? 40.537  21.868  17.014 1.00 20.34  ? 138  THR A HG1  1 
ATOM   2024 H HG21 . THR A 1 138 ? 38.446  23.008  19.177 1.00 24.59  ? 138  THR A HG21 1 
ATOM   2025 H HG22 . THR A 1 138 ? 39.933  22.514  19.137 1.00 24.59  ? 138  THR A HG22 1 
ATOM   2026 H HG23 . THR A 1 138 ? 39.434  23.582  18.104 1.00 24.59  ? 138  THR A HG23 1 
ATOM   2027 N N    . THR A 1 139 ? 36.343  19.766  17.333 1.00 11.01  ? 139  THR A N    1 
ATOM   2028 C CA   . THR A 1 139 ? 35.515  19.116  16.331 1.00 10.66  ? 139  THR A CA   1 
ATOM   2029 C C    . THR A 1 139 ? 35.960  19.503  14.939 1.00 10.22  ? 139  THR A C    1 
ATOM   2030 O O    . THR A 1 139 ? 36.640  20.557  14.738 1.00 10.41  ? 139  THR A O    1 
ATOM   2031 C CB   . THR A 1 139 ? 34.025  19.469  16.521 1.00 11.08  ? 139  THR A CB   1 
ATOM   2032 O OG1  . THR A 1 139 ? 33.844  20.851  16.164 1.00 11.53  ? 139  THR A OG1  1 
ATOM   2033 C CG2  . THR A 1 139 ? 33.475  19.171  17.876 1.00 11.64  ? 139  THR A CG2  1 
ATOM   2034 H H    . THR A 1 139 ? 35.973  20.323  17.874 1.00 13.21  ? 139  THR A H    1 
ATOM   2035 H HA   . THR A 1 139 ? 35.617  18.146  16.429 1.00 12.79  ? 139  THR A HA   1 
ATOM   2036 H HB   . THR A 1 139 ? 33.515  18.934  15.877 1.00 13.29  ? 139  THR A HB   1 
ATOM   2037 H HG1  . THR A 1 139 ? 34.151  20.982  15.415 1.00 17.29  ? 139  THR A HG1  1 
ATOM   2038 H HG21 . THR A 1 139 ? 32.547  19.416  17.906 1.00 17.47  ? 139  THR A HG21 1 
ATOM   2039 H HG22 . THR A 1 139 ? 33.565  18.233  18.058 1.00 17.47  ? 139  THR A HG22 1 
ATOM   2040 H HG23 . THR A 1 139 ? 33.960  19.673  18.535 1.00 17.47  ? 139  THR A HG23 1 
ATOM   2041 N N    . PHE A 1 140 ? 35.533  18.737  13.950 1.00 10.13  ? 140  PHE A N    1 
ATOM   2042 C CA   . PHE A 1 140 ? 35.741  19.095  12.549 1.00 9.86   ? 140  PHE A CA   1 
ATOM   2043 C C    . PHE A 1 140 ? 35.306  20.566  12.315 1.00 9.54   ? 140  PHE A C    1 
ATOM   2044 O O    . PHE A 1 140 ? 35.990  21.340  11.648 1.00 9.83   ? 140  PHE A O    1 
ATOM   2045 C CB   . PHE A 1 140 ? 34.979  18.132  11.654 1.00 10.38  ? 140  PHE A CB   1 
ATOM   2046 C CG   . PHE A 1 140 ? 34.954  18.559  10.181 1.00 10.54  ? 140  PHE A CG   1 
ATOM   2047 C CD1  . PHE A 1 140 ? 36.051  18.286  9.343  1.00 11.22  ? 140  PHE A CD1  1 
ATOM   2048 C CD2  . PHE A 1 140 ? 33.876  19.261  9.674  1.00 10.71  ? 140  PHE A CD2  1 
ATOM   2049 C CE1  . PHE A 1 140 ? 36.062  18.749  8.035  1.00 12.26  ? 140  PHE A CE1  1 
ATOM   2050 C CE2  . PHE A 1 140 ? 33.925  19.758  8.366  1.00 11.82  ? 140  PHE A CE2  1 
ATOM   2051 C CZ   . PHE A 1 140 ? 34.990  19.499  7.551  1.00 12.31  ? 140  PHE A CZ   1 
ATOM   2052 H H    . PHE A 1 140 ? 35.121  18.006  14.137 1.00 12.16  ? 140  PHE A H    1 
ATOM   2053 H HA   . PHE A 1 140 ? 36.696  19.017  12.347 1.00 11.83  ? 140  PHE A HA   1 
ATOM   2054 H HB2  . PHE A 1 140 ? 35.386  17.254  11.719 1.00 12.46  ? 140  PHE A HB2  1 
ATOM   2055 H HB3  . PHE A 1 140 ? 34.067  18.059  11.975 1.00 12.46  ? 140  PHE A HB3  1 
ATOM   2056 H HD1  . PHE A 1 140 ? 36.770  17.794  9.667  1.00 13.47  ? 140  PHE A HD1  1 
ATOM   2057 H HD2  . PHE A 1 140 ? 33.122  19.402  10.199 1.00 12.86  ? 140  PHE A HD2  1 
ATOM   2058 H HE1  . PHE A 1 140 ? 36.784  18.558  7.480  1.00 14.72  ? 140  PHE A HE1  1 
ATOM   2059 H HE2  . PHE A 1 140 ? 33.220  20.274  8.046  1.00 14.18  ? 140  PHE A HE2  1 
ATOM   2060 H HZ   . PHE A 1 140 ? 35.001  19.822  6.679  1.00 14.77  ? 140  PHE A HZ   1 
ATOM   2061 N N    . PHE A 1 141 ? 34.102  20.900  12.802 1.00 9.56   ? 141  PHE A N    1 
ATOM   2062 C CA   . PHE A 1 141 ? 33.572  22.228  12.557 1.00 9.55   ? 141  PHE A CA   1 
ATOM   2063 C C    . PHE A 1 141 ? 34.470  23.308  13.191 1.00 9.51   ? 141  PHE A C    1 
ATOM   2064 O O    . PHE A 1 141 ? 34.781  24.315  12.554 1.00 10.17  ? 141  PHE A O    1 
ATOM   2065 C CB   . PHE A 1 141 ? 32.130  22.328  13.078 1.00 10.04  ? 141  PHE A CB   1 
ATOM   2066 C CG   . PHE A 1 141 ? 31.536  23.722  12.969 1.00 10.32  ? 141  PHE A CG   1 
ATOM   2067 C CD1  . PHE A 1 141 ? 31.352  24.376  11.800 1.00 11.18  ? 141  PHE A CD1  1 
ATOM   2068 C CD2  . PHE A 1 141 ? 31.131  24.381  14.148 1.00 12.34  ? 141  PHE A CD2  1 
ATOM   2069 C CE1  . PHE A 1 141 ? 30.815  25.733  11.757 1.00 11.81  ? 141  PHE A CE1  1 
ATOM   2070 C CE2  . PHE A 1 141 ? 30.589  25.620  14.170 1.00 13.61  ? 141  PHE A CE2  1 
ATOM   2071 C CZ   . PHE A 1 141 ? 30.469  26.289  12.977 1.00 13.56  ? 141  PHE A CZ   1 
ATOM   2072 H H    . PHE A 1 141 ? 33.647  20.330  13.258 1.00 11.47  ? 141  PHE A H    1 
ATOM   2073 H HA   . PHE A 1 141 ? 33.556  22.376  11.588 1.00 11.46  ? 141  PHE A HA   1 
ATOM   2074 H HB2  . PHE A 1 141 ? 31.573  21.710  12.578 1.00 12.05  ? 141  PHE A HB2  1 
ATOM   2075 H HB3  . PHE A 1 141 ? 32.113  22.052  14.008 1.00 12.05  ? 141  PHE A HB3  1 
ATOM   2076 H HD1  . PHE A 1 141 ? 31.574  23.950  11.003 1.00 13.42  ? 141  PHE A HD1  1 
ATOM   2077 H HD2  . PHE A 1 141 ? 31.243  23.938  14.958 1.00 14.81  ? 141  PHE A HD2  1 
ATOM   2078 H HE1  . PHE A 1 141 ? 30.711  26.197  10.958 1.00 14.17  ? 141  PHE A HE1  1 
ATOM   2079 H HE2  . PHE A 1 141 ? 30.306  26.006  14.967 1.00 16.33  ? 141  PHE A HE2  1 
ATOM   2080 H HZ   . PHE A 1 141 ? 30.140  27.158  12.989 1.00 16.28  ? 141  PHE A HZ   1 
ATOM   2081 N N    . ASP A 1 142 ? 34.878  23.171  14.455 1.00 9.99   ? 142  ASP A N    1 
ATOM   2082 C CA   . ASP A 1 142 ? 35.710  24.127  15.088 1.00 10.35  ? 142  ASP A CA   1 
ATOM   2083 C C    . ASP A 1 142 ? 37.067  24.211  14.435 1.00 10.68  ? 142  ASP A C    1 
ATOM   2084 O O    . ASP A 1 142 ? 37.663  25.310  14.371 1.00 12.30  ? 142  ASP A O    1 
ATOM   2085 C CB   . ASP A 1 142 ? 35.793  23.919  16.633 1.00 12.08  ? 142  ASP A CB   1 
ATOM   2086 C CG   . ASP A 1 142 ? 34.623  24.497  17.344 1.00 14.09  ? 142  ASP A CG   1 
ATOM   2087 O OD1  . ASP A 1 142 ? 34.088  25.497  16.931 1.00 16.15  ? 142  ASP A OD1  1 
ATOM   2088 O OD2  . ASP A 1 142 ? 34.258  23.905  18.419 1.00 19.37  ? 142  ASP A OD2  1 
ATOM   2089 H H    . ASP A 1 142 ? 34.627  22.480  14.900 1.00 11.99  ? 142  ASP A H    1 
ATOM   2090 H HA   . ASP A 1 142 ? 35.283  24.998  14.950 1.00 12.41  ? 142  ASP A HA   1 
ATOM   2091 H HB2  . ASP A 1 142 ? 35.844  22.969  16.824 1.00 14.49  ? 142  ASP A HB2  1 
ATOM   2092 H HB3  . ASP A 1 142 ? 36.605  24.333  16.966 1.00 14.49  ? 142  ASP A HB3  1 
ATOM   2093 N N    . THR A 1 143 ? 37.601  23.099  13.920 1.00 10.43  ? 143  THR A N    1 
ATOM   2094 C CA   . THR A 1 143 ? 38.891  23.145  13.195 1.00 11.00  ? 143  THR A CA   1 
ATOM   2095 C C    . THR A 1 143 ? 38.796  24.013  11.970 1.00 11.14  ? 143  THR A C    1 
ATOM   2096 O O    . THR A 1 143 ? 39.722  24.797  11.687 1.00 13.03  ? 143  THR A O    1 
ATOM   2097 C CB   . THR A 1 143 ? 39.364  21.712  12.827 1.00 11.20  ? 143  THR A CB   1 
ATOM   2098 O OG1  . THR A 1 143 ? 39.537  20.987  14.059 1.00 11.87  ? 143  THR A OG1  1 
ATOM   2099 C CG2  . THR A 1 143 ? 40.626  21.718  12.022 1.00 12.41  ? 143  THR A CG2  1 
ATOM   2100 H H    . THR A 1 143 ? 37.191  22.349  14.012 1.00 12.51  ? 143  THR A H    1 
ATOM   2101 H HA   . THR A 1 143 ? 39.559  23.539  13.793 1.00 13.20  ? 143  THR A HA   1 
ATOM   2102 H HB   . THR A 1 143 ? 38.661  21.275  12.303 1.00 13.44  ? 143  THR A HB   1 
ATOM   2103 H HG1  . THR A 1 143 ? 40.305  20.703  14.104 1.00 17.81  ? 143  THR A HG1  1 
ATOM   2104 H HG21 . THR A 1 143 ? 40.879  20.814  11.817 1.00 18.61  ? 143  THR A HG21 1 
ATOM   2105 H HG22 . THR A 1 143 ? 40.483  22.202  11.205 1.00 18.61  ? 143  THR A HG22 1 
ATOM   2106 H HG23 . THR A 1 143 ? 41.325  22.140  12.526 1.00 18.61  ? 143  THR A HG23 1 
ATOM   2107 N N    . VAL A 1 144 ? 37.699  23.908  11.169 1.00 10.65  ? 144  VAL A N    1 
ATOM   2108 C CA   . VAL A 1 144 ? 37.561  24.600  9.902  1.00 10.69  ? 144  VAL A CA   1 
ATOM   2109 C C    . VAL A 1 144 ? 36.838  25.947  9.995  1.00 10.35  ? 144  VAL A C    1 
ATOM   2110 O O    . VAL A 1 144 ? 36.840  26.681  8.982  1.00 11.03  ? 144  VAL A O    1 
ATOM   2111 C CB   . VAL A 1 144 ? 36.893  23.723  8.789  1.00 10.96  ? 144  VAL A CB   1 
ATOM   2112 C CG1  . VAL A 1 144 ? 37.675  22.414  8.642  1.00 13.34  ? 144  VAL A CG1  1 
ATOM   2113 C CG2  . VAL A 1 144 ? 35.425  23.510  9.051  1.00 10.66  ? 144  VAL A CG2  1 
ATOM   2114 H H    . VAL A 1 144 ? 37.052  23.404  11.430 1.00 12.78  ? 144  VAL A H    1 
ATOM   2115 H HA   . VAL A 1 144 ? 38.470  24.794  9.593  1.00 12.83  ? 144  VAL A HA   1 
ATOM   2116 H HB   . VAL A 1 144 ? 36.973  24.211  7.943  1.00 13.16  ? 144  VAL A HB   1 
ATOM   2117 H HG11 . VAL A 1 144 ? 38.600  22.611  8.477  1.00 20.02  ? 144  VAL A HG11 1 
ATOM   2118 H HG12 . VAL A 1 144 ? 37.596  21.901  9.450  1.00 20.02  ? 144  VAL A HG12 1 
ATOM   2119 H HG13 . VAL A 1 144 ? 37.319  21.910  7.907  1.00 20.02  ? 144  VAL A HG13 1 
ATOM   2120 H HG21 . VAL A 1 144 ? 35.314  23.011  9.864  1.00 15.99  ? 144  VAL A HG21 1 
ATOM   2121 H HG22 . VAL A 1 144 ? 34.988  24.360  9.135  1.00 15.99  ? 144  VAL A HG22 1 
ATOM   2122 H HG23 . VAL A 1 144 ? 35.037  23.021  8.321  1.00 15.99  ? 144  VAL A HG23 1 
ATOM   2123 N N    . LYS A 1 145 ? 36.207  26.285  11.103 1.00 11.14  ? 145  LYS A N    1 
ATOM   2124 C CA   . LYS A 1 145 ? 35.198  27.366  11.071 1.00 12.71  ? 145  LYS A CA   1 
ATOM   2125 C C    . LYS A 1 145 ? 35.807  28.707  10.641 1.00 12.79  ? 145  LYS A C    1 
ATOM   2126 O O    . LYS A 1 145 ? 35.089  29.462  9.930  1.00 13.51  ? 145  LYS A O    1 
ATOM   2127 C CB   . LYS A 1 145 ? 34.280  27.485  12.243 1.00 14.23  ? 145  LYS A CB   1 
ATOM   2128 C CG   . LYS A 1 145 ? 34.920  27.927  13.485 1.00 14.62  ? 145  LYS A CG   1 
ATOM   2129 C CD   . LYS A 1 145 ? 33.927  28.139  14.711 1.00 17.03  ? 145  LYS A CD   1 
ATOM   2130 C CE   . LYS A 1 145 ? 34.582  28.615  15.911 1.00 23.64  ? 145  LYS A CE   1 
ATOM   2131 N NZ   . LYS A 1 145 ? 35.327  27.984  16.661 1.00 38.56  ? 145  LYS A NZ   1 
ATOM   2132 H H    . LYS A 1 145 ? 36.382  25.878  11.841 1.00 13.37  ? 145  LYS A H    1 
ATOM   2133 H HA   . LYS A 1 145 ? 34.608  27.121  10.327 1.00 15.26  ? 145  LYS A HA   1 
ATOM   2134 H HB2  . LYS A 1 145 ? 33.574  28.111  12.019 1.00 17.07  ? 145  LYS A HB2  1 
ATOM   2135 H HB3  . LYS A 1 145 ? 33.866  26.622  12.399 1.00 17.07  ? 145  LYS A HB3  1 
ATOM   2136 H HG2  . LYS A 1 145 ? 35.588  27.271  13.738 1.00 17.55  ? 145  LYS A HG2  1 
ATOM   2137 H HG3  . LYS A 1 145 ? 35.381  28.763  13.313 1.00 17.55  ? 145  LYS A HG3  1 
ATOM   2138 H HD2  . LYS A 1 145 ? 33.242  28.776  14.454 1.00 20.44  ? 145  LYS A HD2  1 
ATOM   2139 H HD3  . LYS A 1 145 ? 33.487  27.297  14.907 1.00 20.44  ? 145  LYS A HD3  1 
ATOM   2140 H HE2  . LYS A 1 145 ? 35.093  29.392  15.634 1.00 28.36  ? 145  LYS A HE2  1 
ATOM   2141 H HE3  . LYS A 1 145 ? 33.870  28.951  16.478 1.00 28.36  ? 145  LYS A HE3  1 
ATOM   2142 H HZ1  . LYS A 1 145 ? 35.574  28.504  17.340 1.00 57.84  ? 145  LYS A HZ1  1 
ATOM   2143 H HZ2  . LYS A 1 145 ? 34.897  27.271  16.975 1.00 57.84  ? 145  LYS A HZ2  1 
ATOM   2144 H HZ3  . LYS A 1 145 ? 36.048  27.721  16.211 1.00 57.84  ? 145  LYS A HZ3  1 
ATOM   2145 N N    . SER A 1 146 ? 37.015  29.050  11.069 1.00 13.11  ? 146  SER A N    1 
ATOM   2146 C CA   . SER A 1 146 ? 37.550  30.386  10.667 1.00 13.99  ? 146  SER A CA   1 
ATOM   2147 C C    . SER A 1 146 ? 37.963  30.433  9.187  1.00 13.75  ? 146  SER A C    1 
ATOM   2148 O O    . SER A 1 146 ? 38.182  31.506  8.667  1.00 16.35  ? 146  SER A O    1 
ATOM   2149 C CB   . SER A 1 146 ? 38.675  30.753  11.548 1.00 18.21  ? 146  SER A CB   1 
ATOM   2150 O OG   . SER A 1 146 ? 39.826  29.936  11.298 1.00 19.31  ? 146  SER A OG   1 
ATOM   2151 H H    . SER A 1 146 ? 37.476  28.519  11.563 1.00 15.74  ? 146  SER A H    1 
ATOM   2152 H HA   . SER A 1 146 ? 36.838  31.046  10.800 1.00 16.79  ? 146  SER A HA   1 
ATOM   2153 H HB2  . SER A 1 146 ? 38.905  31.685  11.404 1.00 21.85  ? 146  SER A HB2  1 
ATOM   2154 H HB3  . SER A 1 146 ? 38.404  30.652  12.474 1.00 21.85  ? 146  SER A HB3  1 
ATOM   2155 H HG   . SER A 1 146 ? 40.063  30.030  10.518 1.00 28.97  ? 146  SER A HG   1 
ATOM   2156 N N    . SER A 1 147 ? 38.040  29.283  8.505  1.00 11.93  ? 147  SER A N    1 
ATOM   2157 C CA   . SER A 1 147 ? 38.316  29.194  7.072  1.00 13.01  ? 147  SER A CA   1 
ATOM   2158 C C    . SER A 1 147 ? 37.055  29.279  6.264  1.00 12.33  ? 147  SER A C    1 
ATOM   2159 O O    . SER A 1 147 ? 37.115  29.467  5.021  1.00 15.23  ? 147  SER A O    1 
ATOM   2160 C CB   A SER A 1 147 ? 39.019  27.921  6.638  0.51 15.37  ? 147  SER A CB   1 
ATOM   2161 C CB   B SER A 1 147 ? 39.128  27.887  6.875  0.49 15.36  ? 147  SER A CB   1 
ATOM   2162 O OG   A SER A 1 147 ? 38.192  26.800  6.604  0.51 18.15  ? 147  SER A OG   1 
ATOM   2163 O OG   B SER A 1 147 ? 40.364  27.843  7.544  0.49 15.34  ? 147  SER A OG   1 
ATOM   2164 H H    . SER A 1 147 ? 37.921  28.549  8.939  1.00 14.31  ? 147  SER A H    1 
ATOM   2165 H HA   A SER A 1 147 ? 38.885  29.953  6.826  1.00 15.62  ? 147  SER A HA   1 
ATOM   2166 H HB2  A SER A 1 147 ? 39.396  28.058  5.755  0.51 18.45  ? 147  SER A HB2  1 
ATOM   2167 H HB2  B SER A 1 147 ? 38.588  27.140  7.178  0.49 18.43  ? 147  SER A HB2  1 
ATOM   2168 H HB3  A SER A 1 147 ? 39.754  27.748  7.247  0.51 18.45  ? 147  SER A HB3  1 
ATOM   2169 H HB3  B SER A 1 147 ? 39.289  27.764  5.926  0.49 18.43  ? 147  SER A HB3  1 
ATOM   2170 H HG   A SER A 1 147 ? 37.847  26.692  7.340  0.51 27.23  ? 147  SER A HG   1 
ATOM   2171 H HG   B SER A 1 147 ? 40.830  28.471  7.298  0.49 23.01  ? 147  SER A HG   1 
ATOM   2172 N N    . LEU A 1 148 ? 35.905  29.021  6.863  1.00 12.26  ? 148  LEU A N    1 
ATOM   2173 C CA   . LEU A 1 148 ? 34.627  29.049  6.167  1.00 11.80  ? 148  LEU A CA   1 
ATOM   2174 C C    . LEU A 1 148 ? 34.220  30.508  5.862  1.00 12.04  ? 148  LEU A C    1 
ATOM   2175 O O    . LEU A 1 148 ? 34.592  31.440  6.551  1.00 13.38  ? 148  LEU A O    1 
ATOM   2176 C CB   . LEU A 1 148 ? 33.522  28.411  7.027  1.00 12.30  ? 148  LEU A CB   1 
ATOM   2177 C CG   . LEU A 1 148 ? 33.684  26.903  7.357  1.00 12.38  ? 148  LEU A CG   1 
ATOM   2178 C CD1  . LEU A 1 148 ? 32.567  26.478  8.343  1.00 13.57  ? 148  LEU A CD1  1 
ATOM   2179 C CD2  . LEU A 1 148 ? 33.670  26.035  6.093  1.00 14.88  ? 148  LEU A CD2  1 
ATOM   2180 H H    . LEU A 1 148 ? 35.912  28.828  7.702  1.00 14.71  ? 148  LEU A H    1 
ATOM   2181 H HA   . LEU A 1 148 ? 34.707  28.553  5.325  1.00 14.16  ? 148  LEU A HA   1 
ATOM   2182 H HB2  . LEU A 1 148 ? 33.471  28.899  7.863  1.00 14.76  ? 148  LEU A HB2  1 
ATOM   2183 H HB3  . LEU A 1 148 ? 32.675  28.531  6.570  1.00 14.76  ? 148  LEU A HB3  1 
ATOM   2184 H HG   . LEU A 1 148 ? 34.548  26.779  7.802  1.00 14.85  ? 148  LEU A HG   1 
ATOM   2185 H HD11 . LEU A 1 148 ? 32.599  27.037  9.123  1.00 20.35  ? 148  LEU A HD11 1 
ATOM   2186 H HD12 . LEU A 1 148 ? 31.712  26.571  7.917  1.00 20.35  ? 148  LEU A HD12 1 
ATOM   2187 H HD13 . LEU A 1 148 ? 32.698  25.563  8.600  1.00 20.35  ? 148  LEU A HD13 1 
ATOM   2188 H HD21 . LEU A 1 148 ? 32.822  26.124  5.653  1.00 22.33  ? 148  LEU A HD21 1 
ATOM   2189 H HD22 . LEU A 1 148 ? 34.369  26.322  5.501  1.00 22.33  ? 148  LEU A HD22 1 
ATOM   2190 H HD23 . LEU A 1 148 ? 33.811  25.117  6.335  1.00 22.33  ? 148  LEU A HD23 1 
ATOM   2191 N N    . ALA A 1 149 ? 33.367  30.685  4.849  1.00 12.08  ? 149  ALA A N    1 
ATOM   2192 C CA   . ALA A 1 149 ? 32.843  31.979  4.519  1.00 13.56  ? 149  ALA A CA   1 
ATOM   2193 C C    . ALA A 1 149 ? 32.111  32.580  5.712  1.00 13.26  ? 149  ALA A C    1 
ATOM   2194 O O    . ALA A 1 149 ? 32.248  33.796  6.015  1.00 15.09  ? 149  ALA A O    1 
ATOM   2195 C CB   . ALA A 1 149 ? 31.965  31.910  3.282  1.00 16.18  ? 149  ALA A CB   1 
ATOM   2196 H H    . ALA A 1 149 ? 33.125  30.005  4.382  1.00 14.49  ? 149  ALA A H    1 
ATOM   2197 H HA   . ALA A 1 149 ? 33.602  32.562  4.311  1.00 16.27  ? 149  ALA A HA   1 
ATOM   2198 H HB1  . ALA A 1 149 ? 31.678  32.795  3.044  1.00 24.27  ? 149  ALA A HB1  1 
ATOM   2199 H HB2  . ALA A 1 149 ? 32.465  31.530  2.556  1.00 24.27  ? 149  ALA A HB2  1 
ATOM   2200 H HB3  . ALA A 1 149 ? 31.198  31.362  3.464  1.00 24.27  ? 149  ALA A HB3  1 
ATOM   2201 N N    . GLN A 1 150 ? 31.228  31.792  6.372  1.00 12.07  ? 150  GLN A N    1 
ATOM   2202 C CA   . GLN A 1 150 ? 30.587  32.171  7.625  1.00 11.60  ? 150  GLN A CA   1 
ATOM   2203 C C    . GLN A 1 150 ? 30.764  30.998  8.600  1.00 10.81  ? 150  GLN A C    1 
ATOM   2204 O O    . GLN A 1 150 ? 30.691  29.840  8.175  1.00 10.80  ? 150  GLN A O    1 
ATOM   2205 C CB   A GLN A 1 150 ? 29.095  32.398  7.498  0.52 13.26  ? 150  GLN A CB   1 
ATOM   2206 C CB   B GLN A 1 150 ? 29.143  32.455  7.333  0.48 14.08  ? 150  GLN A CB   1 
ATOM   2207 C CG   A GLN A 1 150 ? 28.865  33.540  6.369  0.52 19.35  ? 150  GLN A CG   1 
ATOM   2208 C CG   B GLN A 1 150 ? 28.809  33.668  6.554  0.48 14.91  ? 150  GLN A CG   1 
ATOM   2209 C CD   A GLN A 1 150 ? 27.283  33.639  6.294  0.52 21.22  ? 150  GLN A CD   1 
ATOM   2210 C CD   B GLN A 1 150 ? 27.480  34.119  6.250  0.48 19.12  ? 150  GLN A CD   1 
ATOM   2211 O OE1  A GLN A 1 150 ? 26.772  33.011  5.346  0.52 32.92  ? 150  GLN A OE1  1 
ATOM   2212 O OE1  B GLN A 1 150 ? 27.213  35.292  5.926  0.48 22.08  ? 150  GLN A OE1  1 
ATOM   2213 N NE2  A GLN A 1 150 ? 26.756  34.622  7.119  0.52 28.79  ? 150  GLN A NE2  1 
ATOM   2214 N NE2  B GLN A 1 150 ? 26.531  33.130  6.341  0.48 17.16  ? 150  GLN A NE2  1 
ATOM   2215 H H    . GLN A 1 150 ? 31.035  31.025  6.032  1.00 14.49  ? 150  GLN A H    1 
ATOM   2216 H HA   A GLN A 1 150 ? 31.017  32.974  7.989  1.00 13.92  ? 150  GLN A HA   1 
ATOM   2217 H HB2  A GLN A 1 150 ? 28.653  31.576  7.237  0.52 15.92  ? 150  GLN A HB2  1 
ATOM   2218 H HB2  B GLN A 1 150 ? 28.782  31.690  6.859  0.48 16.89  ? 150  GLN A HB2  1 
ATOM   2219 H HB3  A GLN A 1 150 ? 28.728  32.689  8.348  0.52 15.92  ? 150  GLN A HB3  1 
ATOM   2220 H HB3  B GLN A 1 150 ? 28.676  32.511  8.181  0.48 16.89  ? 150  GLN A HB3  1 
ATOM   2221 H HG2  A GLN A 1 150 ? 29.257  34.385  6.639  0.52 23.22  ? 150  GLN A HG2  1 
ATOM   2222 H HG2  B GLN A 1 150 ? 29.245  34.406  7.008  0.48 17.89  ? 150  GLN A HG2  1 
ATOM   2223 H HG3  A GLN A 1 150 ? 29.241  33.272  5.517  0.52 23.22  ? 150  GLN A HG3  1 
ATOM   2224 H HG3  B GLN A 1 150 ? 29.259  33.569  5.700  0.48 17.89  ? 150  GLN A HG3  1 
ATOM   2225 H HE21 A GLN A 1 150 ? 27.241  34.967  7.741  0.52 34.55  ? 150  GLN A HE21 1 
ATOM   2226 H HE21 B GLN A 1 150 ? 26.761  32.333  6.569  0.48 20.59  ? 150  GLN A HE21 1 
ATOM   2227 H HE22 A GLN A 1 150 ? 25.946  34.887  7.009  0.52 34.55  ? 150  GLN A HE22 1 
ATOM   2228 H HE22 B GLN A 1 150 ? 25.707  33.308  6.171  0.48 20.59  ? 150  GLN A HE22 1 
ATOM   2229 N N    . PRO A 1 151 ? 30.959  31.278  9.879  1.00 10.97  ? 151  PRO A N    1 
ATOM   2230 C CA   . PRO A 1 151 ? 31.279  30.213  10.881 1.00 10.29  ? 151  PRO A CA   1 
ATOM   2231 C C    . PRO A 1 151 ? 29.994  29.564  11.386 1.00 9.66   ? 151  PRO A C    1 
ATOM   2232 O O    . PRO A 1 151 ? 29.578  29.707  12.566 1.00 10.22  ? 151  PRO A O    1 
ATOM   2233 C CB   . PRO A 1 151 ? 32.083  30.977  11.937 1.00 11.72  ? 151  PRO A CB   1 
ATOM   2234 C CG   . PRO A 1 151 ? 31.403  32.328  11.956 1.00 12.44  ? 151  PRO A CG   1 
ATOM   2235 C CD   . PRO A 1 151 ? 31.162  32.639  10.489 1.00 11.95  ? 151  PRO A CD   1 
ATOM   2236 H HA   . PRO A 1 151 ? 31.848  29.532  10.465 1.00 12.35  ? 151  PRO A HA   1 
ATOM   2237 H HB2  . PRO A 1 151 ? 32.027  30.543  12.803 1.00 14.06  ? 151  PRO A HB2  1 
ATOM   2238 H HB3  . PRO A 1 151 ? 33.015  31.056  11.680 1.00 14.06  ? 151  PRO A HB3  1 
ATOM   2239 H HG2  . PRO A 1 151 ? 30.565  32.288  12.444 1.00 14.93  ? 151  PRO A HG2  1 
ATOM   2240 H HG3  . PRO A 1 151 ? 31.973  32.998  12.363 1.00 14.93  ? 151  PRO A HG3  1 
ATOM   2241 H HD2  . PRO A 1 151 ? 30.375  33.195  10.373 1.00 14.34  ? 151  PRO A HD2  1 
ATOM   2242 H HD3  . PRO A 1 151 ? 31.927  33.087  10.096 1.00 14.34  ? 151  PRO A HD3  1 
ATOM   2243 N N    . LEU A 1 152 ? 29.354  28.803  10.490 1.00 9.85   ? 152  LEU A N    1 
ATOM   2244 C CA   . LEU A 1 152 ? 28.068  28.175  10.750 1.00 9.24   ? 152  LEU A CA   1 
ATOM   2245 C C    . LEU A 1 152 ? 27.971  26.896  9.912  1.00 9.14   ? 152  LEU A C    1 
ATOM   2246 O O    . LEU A 1 152 ? 28.697  26.722  8.910  1.00 9.49   ? 152  LEU A O    1 
ATOM   2247 C CB   . LEU A 1 152 ? 26.885  29.145  10.498 1.00 9.92   ? 152  LEU A CB   1 
ATOM   2248 C CG   . LEU A 1 152 ? 26.708  29.654  9.030  1.00 11.35  ? 152  LEU A CG   1 
ATOM   2249 C CD1  . LEU A 1 152 ? 26.007  28.669  8.104  1.00 12.48  ? 152  LEU A CD1  1 
ATOM   2250 C CD2  . LEU A 1 152 ? 25.927  30.989  9.064  1.00 12.89  ? 152  LEU A CD2  1 
ATOM   2251 H H    . LEU A 1 152 ? 29.722  28.680  9.722  1.00 11.82  ? 152  LEU A H    1 
ATOM   2252 H HA   . LEU A 1 152 ? 28.048  27.917  11.695 1.00 11.09  ? 152  LEU A HA   1 
ATOM   2253 H HB2  . LEU A 1 152 ? 26.065  28.700  10.766 1.00 11.91  ? 152  LEU A HB2  1 
ATOM   2254 H HB3  . LEU A 1 152 ? 26.996  29.917  11.075 1.00 11.91  ? 152  LEU A HB3  1 
ATOM   2255 H HG   . LEU A 1 152 ? 27.599  29.833  8.663  1.00 13.62  ? 152  LEU A HG   1 
ATOM   2256 H HD11 . LEU A 1 152 ? 26.495  27.842  8.088  1.00 18.72  ? 152  LEU A HD11 1 
ATOM   2257 H HD12 . LEU A 1 152 ? 25.116  28.509  8.424  1.00 18.72  ? 152  LEU A HD12 1 
ATOM   2258 H HD13 . LEU A 1 152 ? 25.968  29.035  7.218  1.00 18.72  ? 152  LEU A HD13 1 
ATOM   2259 H HD21 . LEU A 1 152 ? 25.036  30.831  9.383  1.00 19.33  ? 152  LEU A HD21 1 
ATOM   2260 H HD22 . LEU A 1 152 ? 26.372  31.605  9.650  1.00 19.33  ? 152  LEU A HD22 1 
ATOM   2261 H HD23 . LEU A 1 152 ? 25.889  31.360  8.179  1.00 19.33  ? 152  LEU A HD23 1 
ATOM   2262 N N    . PHE A 1 153 ? 27.032  26.047  10.312 1.00 8.87   ? 153  PHE A N    1 
ATOM   2263 C CA   . PHE A 1 153 ? 26.561  24.954  9.459  1.00 8.81   ? 153  PHE A CA   1 
ATOM   2264 C C    . PHE A 1 153 ? 25.050  24.885  9.571  1.00 8.83   ? 153  PHE A C    1 
ATOM   2265 O O    . PHE A 1 153 ? 24.469  25.453  10.493 1.00 10.18  ? 153  PHE A O    1 
ATOM   2266 C CB   . PHE A 1 153 ? 27.269  23.599  9.770  1.00 9.25   ? 153  PHE A CB   1 
ATOM   2267 C CG   . PHE A 1 153 ? 26.963  23.049  11.171 1.00 8.99   ? 153  PHE A CG   1 
ATOM   2268 C CD1  . PHE A 1 153 ? 27.769  23.397  12.263 1.00 9.69   ? 153  PHE A CD1  1 
ATOM   2269 C CD2  . PHE A 1 153 ? 25.881  22.180  11.386 1.00 9.27   ? 153  PHE A CD2  1 
ATOM   2270 C CE1  . PHE A 1 153 ? 27.486  22.887  13.546 1.00 9.78   ? 153  PHE A CE1  1 
ATOM   2271 C CE2  . PHE A 1 153 ? 25.592  21.697  12.642 1.00 9.58   ? 153  PHE A CE2  1 
ATOM   2272 C CZ   . PHE A 1 153 ? 26.416  22.057  13.727 1.00 9.50   ? 153  PHE A CZ   1 
ATOM   2273 H H    . PHE A 1 153 ? 26.690  26.141  11.096 1.00 10.65  ? 153  PHE A H    1 
ATOM   2274 H HA   . PHE A 1 153 ? 26.776  25.191  8.533  1.00 10.57  ? 153  PHE A HA   1 
ATOM   2275 H HB2  . PHE A 1 153 ? 26.994  22.944  9.110  1.00 11.09  ? 153  PHE A HB2  1 
ATOM   2276 H HB3  . PHE A 1 153 ? 28.227  23.720  9.683  1.00 11.09  ? 153  PHE A HB3  1 
ATOM   2277 H HD1  . PHE A 1 153 ? 28.493  23.967  12.141 1.00 11.62  ? 153  PHE A HD1  1 
ATOM   2278 H HD2  . PHE A 1 153 ? 25.349  21.926  10.666 1.00 11.12  ? 153  PHE A HD2  1 
ATOM   2279 H HE1  . PHE A 1 153 ? 28.026  23.115  14.267 1.00 11.74  ? 153  PHE A HE1  1 
ATOM   2280 H HE2  . PHE A 1 153 ? 24.860  21.139  12.774 1.00 11.50  ? 153  PHE A HE2  1 
ATOM   2281 H HZ   . PHE A 1 153 ? 26.229  21.726  14.576 1.00 11.40  ? 153  PHE A HZ   1 
ATOM   2282 N N    . ALA A 1 154 ? 24.404  24.188  8.644  1.00 9.39   ? 154  ALA A N    1 
ATOM   2283 C CA   . ALA A 1 154 ? 22.950  24.137  8.646  1.00 9.58   ? 154  ALA A CA   1 
ATOM   2284 C C    . ALA A 1 154 ? 22.515  22.741  8.178  1.00 9.96   ? 154  ALA A C    1 
ATOM   2285 O O    . ALA A 1 154 ? 23.253  22.062  7.419  1.00 11.63  ? 154  ALA A O    1 
ATOM   2286 C CB   . ALA A 1 154 ? 22.348  25.214  7.767  1.00 10.93  ? 154  ALA A CB   1 
ATOM   2287 H H    . ALA A 1 154 ? 24.847  23.765  8.040  1.00 11.27  ? 154  ALA A H    1 
ATOM   2288 H HA   . ALA A 1 154 ? 22.635  24.271  9.564  1.00 11.49  ? 154  ALA A HA   1 
ATOM   2289 H HB1  . ALA A 1 154 ? 21.390  25.159  7.804  1.00 16.40  ? 154  ALA A HB1  1 
ATOM   2290 H HB2  . ALA A 1 154 ? 22.631  26.077  8.078  1.00 16.40  ? 154  ALA A HB2  1 
ATOM   2291 H HB3  . ALA A 1 154 ? 22.640  25.088  6.861  1.00 16.40  ? 154  ALA A HB3  1 
ATOM   2292 N N    . VAL A 1 155 ? 21.344  22.305  8.612  1.00 9.49   ? 155  VAL A N    1 
ATOM   2293 C CA   . VAL A 1 155 ? 20.906  20.933  8.411  1.00 9.70   ? 155  VAL A CA   1 
ATOM   2294 C C    . VAL A 1 155 ? 19.491  20.854  7.885  1.00 9.02   ? 155  VAL A C    1 
ATOM   2295 O O    . VAL A 1 155 ? 18.558  21.450  8.432  1.00 8.99   ? 155  VAL A O    1 
ATOM   2296 C CB   A VAL A 1 155 ? 20.961  20.338  9.851  0.52 9.47   ? 155  VAL A CB   1 
ATOM   2297 C CB   B VAL A 1 155 ? 21.159  19.853  9.487  0.48 9.69   ? 155  VAL A CB   1 
ATOM   2298 C CG1  A VAL A 1 155 ? 20.565  18.834  9.796  0.52 12.53  ? 155  VAL A CG1  1 
ATOM   2299 C CG1  B VAL A 1 155 ? 20.235  20.167  10.646 0.48 10.88  ? 155  VAL A CG1  1 
ATOM   2300 C CG2  A VAL A 1 155 ? 22.294  20.501  10.551 0.52 10.57  ? 155  VAL A CG2  1 
ATOM   2301 C CG2  B VAL A 1 155 ? 20.943  18.384  9.070  0.48 10.10  ? 155  VAL A CG2  1 
ATOM   2302 H H    . VAL A 1 155 ? 20.824  22.851  9.026  1.00 11.38  ? 155  VAL A H    1 
ATOM   2303 H HA   A VAL A 1 155 ? 21.522  20.457  7.817  1.00 11.64  ? 155  VAL A HA   1 
ATOM   2304 H HB   A VAL A 1 155 ? 20.286  20.802  10.389 0.52 11.37  ? 155  VAL A HB   1 
ATOM   2305 H HB   B VAL A 1 155 ? 22.082  19.947  9.801  0.48 11.63  ? 155  VAL A HB   1 
ATOM   2306 H HG11 A VAL A 1 155 ? 19.721  18.741  9.350  0.52 18.79  ? 155  VAL A HG11 1 
ATOM   2307 H HG11 B VAL A 1 155 ? 20.361  21.079  10.918 0.48 16.32  ? 155  VAL A HG11 1 
ATOM   2308 H HG12 A VAL A 1 155 ? 21.237  18.343  9.316  0.52 18.79  ? 155  VAL A HG12 1 
ATOM   2309 H HG12 B VAL A 1 155 ? 19.324  20.037  10.373 0.48 16.32  ? 155  VAL A HG12 1 
ATOM   2310 H HG13 A VAL A 1 155 ? 20.495  18.489  10.689 0.52 18.79  ? 155  VAL A HG13 1 
ATOM   2311 H HG13 B VAL A 1 155 ? 20.435  19.583  11.382 0.48 16.32  ? 155  VAL A HG13 1 
ATOM   2312 H HG21 A VAL A 1 155 ? 22.969  20.014  10.072 0.52 15.86  ? 155  VAL A HG21 1 
ATOM   2313 H HG21 B VAL A 1 155 ? 20.029  18.258  8.805  0.48 15.14  ? 155  VAL A HG21 1 
ATOM   2314 H HG22 A VAL A 1 155 ? 22.530  21.431  10.577 0.52 15.86  ? 155  VAL A HG22 1 
ATOM   2315 H HG22 B VAL A 1 155 ? 21.522  18.172  8.335  0.48 15.14  ? 155  VAL A HG22 1 
ATOM   2316 H HG23 A VAL A 1 155 ? 22.229  20.162  11.446 0.52 15.86  ? 155  VAL A HG23 1 
ATOM   2317 H HG23 B VAL A 1 155 ? 21.144  17.808  9.812  0.48 15.14  ? 155  VAL A HG23 1 
ATOM   2318 N N    . ALA A 1 156 ? 19.321  20.007  6.824  1.00 9.28   ? 156  ALA A N    1 
ATOM   2319 C CA   . ALA A 1 156 ? 18.028  19.519  6.351  1.00 9.51   ? 156  ALA A CA   1 
ATOM   2320 C C    . ALA A 1 156 ? 18.052  17.994  6.440  1.00 9.51   ? 156  ALA A C    1 
ATOM   2321 O O    . ALA A 1 156 ? 18.722  17.326  5.609  1.00 10.83  ? 156  ALA A O    1 
ATOM   2322 C CB   . ALA A 1 156 ? 17.666  19.948  4.935  1.00 11.67  ? 156  ALA A CB   1 
ATOM   2323 H H    . ALA A 1 156 ? 20.025  19.744  6.406  1.00 11.13  ? 156  ALA A H    1 
ATOM   2324 H HA   . ALA A 1 156 ? 17.334  19.850  6.959  1.00 11.41  ? 156  ALA A HA   1 
ATOM   2325 H HB1  . ALA A 1 156 ? 16.798  19.605  4.709  1.00 17.50  ? 156  ALA A HB1  1 
ATOM   2326 H HB2  . ALA A 1 156 ? 17.655  20.906  4.884  1.00 17.50  ? 156  ALA A HB2  1 
ATOM   2327 H HB3  . ALA A 1 156 ? 18.317  19.602  4.320  1.00 17.50  ? 156  ALA A HB3  1 
ATOM   2328 N N    . LEU A 1 157 ? 17.362  17.422  7.417  1.00 9.41   ? 157  LEU A N    1 
ATOM   2329 C CA   . LEU A 1 157 ? 17.082  15.983  7.516  1.00 9.30   ? 157  LEU A CA   1 
ATOM   2330 C C    . LEU A 1 157 ? 15.698  15.741  6.913  1.00 9.54   ? 157  LEU A C    1 
ATOM   2331 O O    . LEU A 1 157 ? 14.761  16.498  7.220  1.00 10.35  ? 157  LEU A O    1 
ATOM   2332 C CB   . LEU A 1 157 ? 17.107  15.486  8.966  1.00 9.83   ? 157  LEU A CB   1 
ATOM   2333 C CG   . LEU A 1 157 ? 18.387  15.740  9.772  1.00 9.67   ? 157  LEU A CG   1 
ATOM   2334 C CD1  . LEU A 1 157 ? 18.292  15.013  11.109 1.00 10.87  ? 157  LEU A CD1  1 
ATOM   2335 C CD2  . LEU A 1 157 ? 19.628  15.288  9.019  1.00 10.71  ? 157  LEU A CD2  1 
ATOM   2336 H H    . LEU A 1 157 ? 17.055  17.931  8.039  1.00 11.29  ? 157  LEU A H    1 
ATOM   2337 H HA   . LEU A 1 157 ? 17.750  15.490  6.996  1.00 11.16  ? 157  LEU A HA   1 
ATOM   2338 H HB2  . LEU A 1 157 ? 16.368  15.900  9.438  1.00 11.80  ? 157  LEU A HB2  1 
ATOM   2339 H HB3  . LEU A 1 157 ? 16.942  14.530  8.957  1.00 11.80  ? 157  LEU A HB3  1 
ATOM   2340 H HG   . LEU A 1 157 ? 18.461  16.702  9.945  1.00 11.60  ? 157  LEU A HG   1 
ATOM   2341 H HD11 . LEU A 1 157 ? 17.506  15.304  11.576 1.00 16.30  ? 157  LEU A HD11 1 
ATOM   2342 H HD12 . LEU A 1 157 ? 18.241  14.067  10.955 1.00 16.30  ? 157  LEU A HD12 1 
ATOM   2343 H HD13 . LEU A 1 157 ? 19.070  15.210  11.637 1.00 16.30  ? 157  LEU A HD13 1 
ATOM   2344 H HD21 . LEU A 1 157 ? 19.580  14.342  8.862  1.00 16.07  ? 157  LEU A HD21 1 
ATOM   2345 H HD22 . LEU A 1 157 ? 19.679  15.749  8.179  1.00 16.07  ? 157  LEU A HD22 1 
ATOM   2346 H HD23 . LEU A 1 157 ? 20.409  15.486  9.541  1.00 16.07  ? 157  LEU A HD23 1 
ATOM   2347 N N    . LYS A 1 158 ? 15.531  14.662  6.151  1.00 9.74   ? 158  LYS A N    1 
ATOM   2348 C CA   . LYS A 1 158 ? 14.256  14.375  5.492  1.00 10.05  ? 158  LYS A CA   1 
ATOM   2349 C C    . LYS A 1 158 ? 13.776  12.967  5.822  1.00 10.07  ? 158  LYS A C    1 
ATOM   2350 O O    . LYS A 1 158 ? 14.535  12.083  6.257  1.00 10.71  ? 158  LYS A O    1 
ATOM   2351 C CB   . LYS A 1 158 ? 14.413  14.552  3.963  1.00 11.07  ? 158  LYS A CB   1 
ATOM   2352 C CG   . LYS A 1 158 ? 14.928  15.916  3.563  1.00 12.99  ? 158  LYS A CG   1 
ATOM   2353 C CD   . LYS A 1 158 ? 14.824  16.225  2.121  1.00 15.67  ? 158  LYS A CD   1 
ATOM   2354 C CE   . LYS A 1 158 ? 15.162  17.660  1.811  1.00 33.65  ? 158  LYS A CE   1 
ATOM   2355 N NZ   . LYS A 1 158 ? 14.396  17.872  0.534  1.00 64.96  ? 158  LYS A NZ   1 
ATOM   2356 H H    . LYS A 1 158 ? 16.190  14.120  6.043  1.00 11.69  ? 158  LYS A H    1 
ATOM   2357 H HA   . LYS A 1 158 ? 13.587  15.016  5.813  1.00 12.06  ? 158  LYS A HA   1 
ATOM   2358 H HB2  . LYS A 1 158 ? 15.024  13.876  3.631  1.00 13.29  ? 158  LYS A HB2  1 
ATOM   2359 H HB3  . LYS A 1 158 ? 13.552  14.405  3.541  1.00 13.29  ? 158  LYS A HB3  1 
ATOM   2360 H HG2  . LYS A 1 158 ? 14.436  16.589  4.058  1.00 15.58  ? 158  LYS A HG2  1 
ATOM   2361 H HG3  . LYS A 1 158 ? 15.859  15.984  3.826  1.00 15.58  ? 158  LYS A HG3  1 
ATOM   2362 H HD2  . LYS A 1 158 ? 15.426  15.644  1.628  1.00 18.80  ? 158  LYS A HD2  1 
ATOM   2363 H HD3  . LYS A 1 158 ? 13.921  16.039  1.821  1.00 18.80  ? 158  LYS A HD3  1 
ATOM   2364 H HE2  . LYS A 1 158 ? 14.856  18.256  2.512  1.00 40.38  ? 158  LYS A HE2  1 
ATOM   2365 H HE3  . LYS A 1 158 ? 16.115  17.781  1.678  1.00 40.38  ? 158  LYS A HE3  1 
ATOM   2366 H HZ1  . LYS A 1 158 ? 14.688  17.304  -0.085 1.00 97.44  ? 158  LYS A HZ1  1 
ATOM   2367 H HZ2  . LYS A 1 158 ? 13.529  17.731  0.681  1.00 97.44  ? 158  LYS A HZ2  1 
ATOM   2368 H HZ3  . LYS A 1 158 ? 14.516  18.707  0.251  1.00 97.44  ? 158  LYS A HZ3  1 
ATOM   2369 N N    . HIS A 1 159 ? 12.485  12.722  5.570  1.00 10.70  ? 159  HIS A N    1 
ATOM   2370 C CA   . HIS A 1 159 ? 11.886  11.421  5.735  1.00 10.81  ? 159  HIS A CA   1 
ATOM   2371 C C    . HIS A 1 159 ? 12.102  10.595  4.411  1.00 11.25  ? 159  HIS A C    1 
ATOM   2372 O O    . HIS A 1 159 ? 11.563  10.954  3.357  1.00 11.95  ? 159  HIS A O    1 
ATOM   2373 C CB   . HIS A 1 159 ? 10.394  11.530  6.016  1.00 12.62  ? 159  HIS A CB   1 
ATOM   2374 C CG   . HIS A 1 159 ? 9.688   10.189  6.125  1.00 14.21  ? 159  HIS A CG   1 
ATOM   2375 N ND1  . HIS A 1 159 ? 10.154  9.194   6.972  1.00 14.56  ? 159  HIS A ND1  1 
ATOM   2376 C CD2  . HIS A 1 159 ? 8.632   9.648   5.488  1.00 17.77  ? 159  HIS A CD2  1 
ATOM   2377 C CE1  . HIS A 1 159 ? 9.353   8.103   6.877  1.00 16.58  ? 159  HIS A CE1  1 
ATOM   2378 N NE2  . HIS A 1 159 ? 8.405   8.377   5.981  1.00 18.64  ? 159  HIS A NE2  1 
ATOM   2379 H H    . HIS A 1 159 ? 11.991  13.370  5.298  1.00 12.84  ? 159  HIS A H    1 
ATOM   2380 H HA   . HIS A 1 159 ? 12.322  10.957  6.480  1.00 12.97  ? 159  HIS A HA   1 
ATOM   2381 H HB2  . HIS A 1 159 ? 10.267  12.018  6.845  1.00 15.15  ? 159  HIS A HB2  1 
ATOM   2382 H HB3  . HIS A 1 159 ? 9.979   12.045  5.306  1.00 15.15  ? 159  HIS A HB3  1 
ATOM   2383 H HD1  . HIS A 1 159 ? 10.845  9.259   7.480  1.00 17.47  ? 159  HIS A HD1  1 
ATOM   2384 H HD2  . HIS A 1 159 ? 8.135   10.064  4.821  1.00 21.32  ? 159  HIS A HD2  1 
ATOM   2385 H HE1  . HIS A 1 159 ? 9.447   7.308   7.350  1.00 19.90  ? 159  HIS A HE1  1 
ATOM   2386 N N    . GLN A 1 160 ? 12.908  9.545   4.507  1.00 11.06  ? 160  GLN A N    1 
ATOM   2387 C CA   . GLN A 1 160 ? 13.101  8.652   3.368  1.00 11.62  ? 160  GLN A CA   1 
ATOM   2388 C C    . GLN A 1 160 ? 13.520  9.389   2.111  1.00 11.30  ? 160  GLN A C    1 
ATOM   2389 O O    . GLN A 1 160 ? 13.117  9.011   0.979  1.00 13.01  ? 160  GLN A O    1 
ATOM   2390 C CB   . GLN A 1 160 ? 11.860  7.778   3.111  1.00 12.96  ? 160  GLN A CB   1 
ATOM   2391 C CG   . GLN A 1 160 ? 11.623  6.820   4.309  1.00 16.01  ? 160  GLN A CG   1 
ATOM   2392 C CD   . GLN A 1 160 ? 10.263  5.987   4.141  1.00 21.36  ? 160  GLN A CD   1 
ATOM   2393 O OE1  . GLN A 1 160 ? 10.179  4.925   4.855  1.00 30.27  ? 160  GLN A OE1  1 
ATOM   2394 N NE2  . GLN A 1 160 ? 9.387   6.349   3.271  1.00 30.39  ? 160  GLN A NE2  1 
ATOM   2395 H H    . GLN A 1 160 ? 13.319  9.389   5.246  1.00 13.27  ? 160  GLN A H    1 
ATOM   2396 H HA   . GLN A 1 160 ? 13.834  8.045   3.601  1.00 13.95  ? 160  GLN A HA   1 
ATOM   2397 H HB2  . GLN A 1 160 ? 11.082  8.345   2.989  1.00 15.55  ? 160  GLN A HB2  1 
ATOM   2398 H HB3  . GLN A 1 160 ? 11.987  7.261   2.301  1.00 15.55  ? 160  GLN A HB3  1 
ATOM   2399 H HG2  . GLN A 1 160 ? 12.369  6.204   4.379  1.00 19.21  ? 160  GLN A HG2  1 
ATOM   2400 H HG3  . GLN A 1 160 ? 11.584  7.336   5.129  1.00 19.21  ? 160  GLN A HG3  1 
ATOM   2401 H HE21 . GLN A 1 160 ? 9.500   7.074   2.822  1.00 36.47  ? 160  GLN A HE21 1 
ATOM   2402 H HE22 . GLN A 1 160 ? 8.689   5.865   3.137  1.00 36.47  ? 160  GLN A HE22 1 
ATOM   2403 N N    . GLN A 1 161 ? 14.407  10.371  2.249  1.00 11.39  ? 161  GLN A N    1 
ATOM   2404 C CA   . GLN A 1 161 ? 14.986  11.077  1.139  1.00 11.36  ? 161  GLN A CA   1 
ATOM   2405 C C    . GLN A 1 161 ? 16.353  11.592  1.565  1.00 10.35  ? 161  GLN A C    1 
ATOM   2406 O O    . GLN A 1 161 ? 16.552  11.901  2.737  1.00 10.78  ? 161  GLN A O    1 
ATOM   2407 C CB   . GLN A 1 161 ? 14.126  12.305  0.731  1.00 13.76  ? 161  GLN A CB   1 
ATOM   2408 C CG   . GLN A 1 161 ? 12.738  12.060  0.284  1.00 17.74  ? 161  GLN A CG   1 
ATOM   2409 C CD   . GLN A 1 161 ? 12.052  13.516  0.119  1.00 30.12  ? 161  GLN A CD   1 
ATOM   2410 O OE1  . GLN A 1 161 ? 12.609  14.377  -0.569 1.00 35.23  ? 161  GLN A OE1  1 
ATOM   2411 N NE2  . GLN A 1 161 ? 11.233  13.851  1.310  1.00 49.40  ? 161  GLN A NE2  1 
ATOM   2412 H H    . GLN A 1 161 ? 14.645  10.595  3.044  1.00 13.66  ? 161  GLN A H    1 
ATOM   2413 H HA   . GLN A 1 161 ? 15.083  10.471  0.375  1.00 13.63  ? 161  GLN A HA   1 
ATOM   2414 H HB2  . GLN A 1 161 ? 14.091  12.909  1.489  1.00 16.51  ? 161  GLN A HB2  1 
ATOM   2415 H HB3  . GLN A 1 161 ? 14.590  12.769  0.016  1.00 16.51  ? 161  GLN A HB3  1 
ATOM   2416 H HG2  . GLN A 1 161 ? 12.732  11.585  -0.562 1.00 21.28  ? 161  GLN A HG2  1 
ATOM   2417 H HG3  . GLN A 1 161 ? 12.258  11.531  0.940  1.00 21.28  ? 161  GLN A HG3  1 
ATOM   2418 H HE21 . GLN A 1 161 ? 10.859  13.225  1.766  1.00 59.28  ? 161  GLN A HE21 1 
ATOM   2419 H HE22 . GLN A 1 161 ? 11.132  14.673  1.545  1.00 59.28  ? 161  GLN A HE22 1 
ATOM   2420 N N    . PRO A 1 162 ? 17.287  11.791  0.642  1.00 10.82  ? 162  PRO A N    1 
ATOM   2421 C CA   . PRO A 1 162 ? 18.591  12.387  1.006  1.00 11.12  ? 162  PRO A CA   1 
ATOM   2422 C C    . PRO A 1 162 ? 18.380  13.866  1.406  1.00 10.30  ? 162  PRO A C    1 
ATOM   2423 O O    . PRO A 1 162 ? 17.517  14.531  0.882  1.00 12.93  ? 162  PRO A O    1 
ATOM   2424 C CB   . PRO A 1 162 ? 19.438  12.238  -0.265 1.00 13.89  ? 162  PRO A CB   1 
ATOM   2425 C CG   . PRO A 1 162 ? 18.537  11.806  -1.302 1.00 18.45  ? 162  PRO A CG   1 
ATOM   2426 C CD   . PRO A 1 162 ? 17.261  11.382  -0.777 1.00 12.55  ? 162  PRO A CD   1 
ATOM   2427 H HA   . PRO A 1 162 ? 18.997  11.889  1.745  1.00 13.35  ? 162  PRO A HA   1 
ATOM   2428 H HB2  . PRO A 1 162 ? 19.846  13.085  -0.501 1.00 16.67  ? 162  PRO A HB2  1 
ATOM   2429 H HB3  . PRO A 1 162 ? 20.139  11.582  -0.130 1.00 16.67  ? 162  PRO A HB3  1 
ATOM   2430 H HG2  . PRO A 1 162 ? 18.397  12.536  -1.926 1.00 22.15  ? 162  PRO A HG2  1 
ATOM   2431 H HG3  . PRO A 1 162 ? 18.941  11.071  -1.789 1.00 22.15  ? 162  PRO A HG3  1 
ATOM   2432 H HD2  . PRO A 1 162 ? 16.532  11.817  -1.248 1.00 15.06  ? 162  PRO A HD2  1 
ATOM   2433 H HD3  . PRO A 1 162 ? 17.157  10.421  -0.857 1.00 15.06  ? 162  PRO A HD3  1 
ATOM   2434 N N    . GLY A 1 163 ? 19.242  14.313  2.317  1.00 9.86   ? 163  GLY A N    1 
ATOM   2435 C CA   . GLY A 1 163 ? 19.257  15.676  2.809  1.00 9.87   ? 163  GLY A CA   1 
ATOM   2436 C C    . GLY A 1 163 ? 20.644  16.254  2.759  1.00 9.46   ? 163  GLY A C    1 
ATOM   2437 O O    . GLY A 1 163 ? 21.527  15.743  2.074  1.00 10.51  ? 163  GLY A O    1 
ATOM   2438 H H    . GLY A 1 163 ? 19.823  13.762  2.630  1.00 11.83  ? 163  GLY A H    1 
ATOM   2439 H HA2  . GLY A 1 163 ? 18.661  16.220  2.270  1.00 11.85  ? 163  GLY A HA2  1 
ATOM   2440 H HA3  . GLY A 1 163 ? 18.933  15.692  3.723  1.00 11.85  ? 163  GLY A HA3  1 
ATOM   2441 N N    . VAL A 1 164 ? 20.846  17.402  3.459  1.00 9.79   ? 164  VAL A N    1 
ATOM   2442 C CA   . VAL A 1 164 ? 22.126  18.080  3.431  1.00 10.08  ? 164  VAL A CA   1 
ATOM   2443 C C    . VAL A 1 164 ? 22.590  18.532  4.800  1.00 9.72   ? 164  VAL A C    1 
ATOM   2444 O O    . VAL A 1 164 ? 21.789  18.876  5.688  1.00 10.31  ? 164  VAL A O    1 
ATOM   2445 C CB   . VAL A 1 164 ? 22.132  19.331  2.465  1.00 11.33  ? 164  VAL A CB   1 
ATOM   2446 C CG1  . VAL A 1 164 ? 21.830  18.924  1.023  1.00 12.91  ? 164  VAL A CG1  1 
ATOM   2447 C CG2  . VAL A 1 164 ? 21.143  20.420  2.966  1.00 13.07  ? 164  VAL A CG2  1 
ATOM   2448 H H    . VAL A 1 164 ? 20.204  17.731  3.926  1.00 11.75  ? 164  VAL A H    1 
ATOM   2449 H HA   . VAL A 1 164 ? 22.789  17.443  3.091  1.00 12.09  ? 164  VAL A HA   1 
ATOM   2450 H HB   . VAL A 1 164 ? 23.033  19.717  2.483  1.00 13.59  ? 164  VAL A HB   1 
ATOM   2451 H HG11 . VAL A 1 164 ? 22.455  18.251  0.743  1.00 19.37  ? 164  VAL A HG11 1 
ATOM   2452 H HG12 . VAL A 1 164 ? 20.938  18.574  0.969  1.00 19.37  ? 164  VAL A HG12 1 
ATOM   2453 H HG13 . VAL A 1 164 ? 21.907  19.691  0.451  1.00 19.37  ? 164  VAL A HG13 1 
ATOM   2454 H HG21 . VAL A 1 164 ? 20.245  20.080  2.924  1.00 19.61  ? 164  VAL A HG21 1 
ATOM   2455 H HG22 . VAL A 1 164 ? 21.355  20.652  3.873  1.00 19.61  ? 164  VAL A HG22 1 
ATOM   2456 H HG23 . VAL A 1 164 ? 21.216  21.199  2.410  1.00 19.61  ? 164  VAL A HG23 1 
ATOM   2457 N N    . TYR A 1 165 ? 23.914  18.630  4.913  1.00 10.01  ? 165  TYR A N    1 
ATOM   2458 C CA   . TYR A 1 165 ? 24.617  19.476  5.869  1.00 10.25  ? 165  TYR A CA   1 
ATOM   2459 C C    . TYR A 1 165 ? 25.354  20.555  5.009  1.00 10.29  ? 165  TYR A C    1 
ATOM   2460 O O    . TYR A 1 165 ? 26.245  20.208  4.222  1.00 12.42  ? 165  TYR A O    1 
ATOM   2461 C CB   . TYR A 1 165 ? 25.666  18.744  6.712  1.00 11.96  ? 165  TYR A CB   1 
ATOM   2462 C CG   . TYR A 1 165 ? 25.067  17.853  7.791  1.00 11.55  ? 165  TYR A CG   1 
ATOM   2463 C CD1  . TYR A 1 165 ? 24.696  16.561  7.614  1.00 12.09  ? 165  TYR A CD1  1 
ATOM   2464 C CD2  . TYR A 1 165 ? 24.874  18.429  9.087  1.00 13.32  ? 165  TYR A CD2  1 
ATOM   2465 C CE1  . TYR A 1 165 ? 24.088  15.745  8.662  1.00 11.86  ? 165  TYR A CE1  1 
ATOM   2466 C CE2  . TYR A 1 165 ? 24.290  17.684  10.112 1.00 13.60  ? 165  TYR A CE2  1 
ATOM   2467 C CZ   . TYR A 1 165 ? 23.879  16.398  9.897  1.00 12.29  ? 165  TYR A CZ   1 
ATOM   2468 O OH   . TYR A 1 165 ? 23.257  15.731  10.950 1.00 14.45  ? 165  TYR A OH   1 
ATOM   2469 H H    . TYR A 1 165 ? 24.393  18.155  4.379  1.00 12.02  ? 165  TYR A H    1 
ATOM   2470 H HA   . TYR A 1 165 ? 23.969  19.914  6.460  1.00 12.30  ? 165  TYR A HA   1 
ATOM   2471 H HB2  . TYR A 1 165 ? 26.215  18.200  6.125  1.00 14.35  ? 165  TYR A HB2  1 
ATOM   2472 H HB3  . TYR A 1 165 ? 26.244  19.400  7.132  1.00 14.35  ? 165  TYR A HB3  1 
ATOM   2473 H HD1  . TYR A 1 165 ? 24.837  16.173  6.780  1.00 14.50  ? 165  TYR A HD1  1 
ATOM   2474 H HD2  . TYR A 1 165 ? 25.141  19.305  9.248  1.00 15.98  ? 165  TYR A HD2  1 
ATOM   2475 H HE1  . TYR A 1 165 ? 23.854  14.855  8.526  1.00 14.23  ? 165  TYR A HE1  1 
ATOM   2476 H HE2  . TYR A 1 165 ? 24.178  18.068  10.952 1.00 16.32  ? 165  TYR A HE2  1 
ATOM   2477 H HH   . TYR A 1 165 ? 23.069  14.967  10.716 1.00 21.67  ? 165  TYR A HH   1 
ATOM   2478 N N    . ASP A 1 166 ? 24.938  21.801  5.154  1.00 9.95   ? 166  ASP A N    1 
ATOM   2479 C CA   . ASP A 1 166 ? 25.580  22.947  4.503  1.00 9.63   ? 166  ASP A CA   1 
ATOM   2480 C C    . ASP A 1 166 ? 26.661  23.498  5.435  1.00 10.42  ? 166  ASP A C    1 
ATOM   2481 O O    . ASP A 1 166 ? 26.311  23.866  6.583  1.00 13.22  ? 166  ASP A O    1 
ATOM   2482 C CB   . ASP A 1 166 ? 24.535  24.058  4.180  1.00 10.76  ? 166  ASP A CB   1 
ATOM   2483 C CG   . ASP A 1 166 ? 23.482  23.613  3.182  1.00 10.69  ? 166  ASP A CG   1 
ATOM   2484 O OD1  . ASP A 1 166 ? 23.942  22.927  2.173  1.00 11.50  ? 166  ASP A OD1  1 
ATOM   2485 O OD2  . ASP A 1 166 ? 22.309  23.982  3.275  1.00 10.89  ? 166  ASP A OD2  1 
ATOM   2486 H H    . ASP A 1 166 ? 24.256  21.948  5.657  1.00 11.94  ? 166  ASP A H    1 
ATOM   2487 H HA   . ASP A 1 166 ? 25.999  22.648  3.669  1.00 11.56  ? 166  ASP A HA   1 
ATOM   2488 H HB2  . ASP A 1 166 ? 24.096  24.327  5.003  1.00 12.91  ? 166  ASP A HB2  1 
ATOM   2489 H HB3  . ASP A 1 166 ? 24.998  24.833  3.825  1.00 12.91  ? 166  ASP A HB3  1 
ATOM   2490 N N    . PHE A 1 167 ? 27.896  23.531  5.030  1.00 9.38   ? 167  PHE A N    1 
ATOM   2491 C CA   . PHE A 1 167 ? 28.969  24.093  5.824  1.00 9.46   ? 167  PHE A CA   1 
ATOM   2492 C C    . PHE A 1 167 ? 29.391  25.442  5.277  1.00 9.25   ? 167  PHE A C    1 
ATOM   2493 O O    . PHE A 1 167 ? 29.783  25.547  4.091  1.00 10.09  ? 167  PHE A O    1 
ATOM   2494 C CB   . PHE A 1 167 ? 30.209  23.163  5.880  1.00 10.17  ? 167  PHE A CB   1 
ATOM   2495 C CG   . PHE A 1 167 ? 29.985  21.973  6.808  1.00 10.08  ? 167  PHE A CG   1 
ATOM   2496 C CD1  . PHE A 1 167 ? 29.416  20.775  6.341  1.00 11.16  ? 167  PHE A CD1  1 
ATOM   2497 C CD2  . PHE A 1 167 ? 30.304  22.078  8.151  1.00 10.87  ? 167  PHE A CD2  1 
ATOM   2498 C CE1  . PHE A 1 167 ? 29.161  19.729  7.192  1.00 12.13  ? 167  PHE A CE1  1 
ATOM   2499 C CE2  . PHE A 1 167 ? 30.026  21.011  9.046  1.00 12.44  ? 167  PHE A CE2  1 
ATOM   2500 C CZ   . PHE A 1 167 ? 29.476  19.846  8.551  1.00 12.27  ? 167  PHE A CZ   1 
ATOM   2501 H H    . PHE A 1 167 ? 28.085  23.205  4.256  1.00 11.26  ? 167  PHE A H    1 
ATOM   2502 H HA   . PHE A 1 167 ? 28.639  24.222  6.738  1.00 11.35  ? 167  PHE A HA   1 
ATOM   2503 H HB2  . PHE A 1 167 ? 30.407  22.839  4.987  1.00 12.20  ? 167  PHE A HB2  1 
ATOM   2504 H HB3  . PHE A 1 167 ? 30.975  23.670  6.190  1.00 12.20  ? 167  PHE A HB3  1 
ATOM   2505 H HD1  . PHE A 1 167 ? 29.208  20.690  5.438  1.00 13.39  ? 167  PHE A HD1  1 
ATOM   2506 H HD2  . PHE A 1 167 ? 30.705  22.854  8.470  1.00 13.04  ? 167  PHE A HD2  1 
ATOM   2507 H HE1  . PHE A 1 167 ? 28.781  18.945  6.868  1.00 14.55  ? 167  PHE A HE1  1 
ATOM   2508 H HE2  . PHE A 1 167 ? 30.211  21.096  9.953  1.00 14.93  ? 167  PHE A HE2  1 
ATOM   2509 H HZ   . PHE A 1 167 ? 29.314  19.132  9.124  1.00 14.72  ? 167  PHE A HZ   1 
ATOM   2510 N N    . GLY A 1 168 ? 29.343  26.487  6.129  1.00 9.86   ? 168  GLY A N    1 
ATOM   2511 C CA   . GLY A 1 168 ? 29.892  27.791  5.767  1.00 10.46  ? 168  GLY A CA   1 
ATOM   2512 C C    . GLY A 1 168 ? 28.922  28.698  5.031  1.00 10.33  ? 168  GLY A C    1 
ATOM   2513 O O    . GLY A 1 168 ? 29.350  29.840  4.696  1.00 12.19  ? 168  GLY A O    1 
ATOM   2514 H H    . GLY A 1 168 ? 28.981  26.383  6.902  1.00 11.83  ? 168  GLY A H    1 
ATOM   2515 H HA2  . GLY A 1 168 ? 30.183  28.241  6.576  1.00 12.55  ? 168  GLY A HA2  1 
ATOM   2516 H HA3  . GLY A 1 168 ? 30.674  27.655  5.210  1.00 12.55  ? 168  GLY A HA3  1 
ATOM   2517 N N    . PHE A 1 169 ? 27.691  28.295  4.759  1.00 10.61  ? 169  PHE A N    1 
ATOM   2518 C CA   . PHE A 1 169 ? 26.729  29.116  4.047  1.00 11.05  ? 169  PHE A CA   1 
ATOM   2519 C C    . PHE A 1 169 ? 25.323  28.590  4.361  1.00 10.12  ? 169  PHE A C    1 
ATOM   2520 O O    . PHE A 1 169 ? 25.150  27.452  4.794  1.00 11.27  ? 169  PHE A O    1 
ATOM   2521 C CB   . PHE A 1 169 ? 26.969  29.136  2.530  1.00 11.58  ? 169  PHE A CB   1 
ATOM   2522 C CG   . PHE A 1 169 ? 26.449  27.933  1.786  1.00 11.58  ? 169  PHE A CG   1 
ATOM   2523 C CD1  . PHE A 1 169 ? 27.019  26.668  1.931  1.00 11.62  ? 169  PHE A CD1  1 
ATOM   2524 C CD2  . PHE A 1 169 ? 25.376  28.049  0.923  1.00 13.14  ? 169  PHE A CD2  1 
ATOM   2525 C CE1  . PHE A 1 169 ? 26.488  25.543  1.290  1.00 12.71  ? 169  PHE A CE1  1 
ATOM   2526 C CE2  . PHE A 1 169 ? 24.842  26.953  0.275  1.00 14.10  ? 169  PHE A CE2  1 
ATOM   2527 C CZ   . PHE A 1 169 ? 25.409  25.707  0.456  1.00 13.24  ? 169  PHE A CZ   1 
ATOM   2528 H H    . PHE A 1 169 ? 27.450  27.511  5.017  1.00 12.73  ? 169  PHE A H    1 
ATOM   2529 H HA   . PHE A 1 169 ? 26.797  30.034  4.383  1.00 13.26  ? 169  PHE A HA   1 
ATOM   2530 H HB2  . PHE A 1 169 ? 26.551  29.930  2.162  1.00 13.90  ? 169  PHE A HB2  1 
ATOM   2531 H HB3  . PHE A 1 169 ? 27.923  29.207  2.370  1.00 13.90  ? 169  PHE A HB3  1 
ATOM   2532 H HD1  . PHE A 1 169 ? 27.771  26.569  2.468  1.00 13.94  ? 169  PHE A HD1  1 
ATOM   2533 H HD2  . PHE A 1 169 ? 25.003  28.888  0.775  1.00 15.76  ? 169  PHE A HD2  1 
ATOM   2534 H HE1  . PHE A 1 169 ? 26.859  24.701  1.426  1.00 15.26  ? 169  PHE A HE1  1 
ATOM   2535 H HE2  . PHE A 1 169 ? 24.104  27.054  -0.282 1.00 16.92  ? 169  PHE A HE2  1 
ATOM   2536 H HZ   . PHE A 1 169 ? 25.056  24.971  0.009  1.00 15.89  ? 169  PHE A HZ   1 
ATOM   2537 N N    . ILE A 1 170 ? 24.341  29.455  4.110  1.00 10.54  ? 170  ILE A N    1 
ATOM   2538 C CA   . ILE A 1 170 ? 22.925  29.151  4.246  1.00 10.16  ? 170  ILE A CA   1 
ATOM   2539 C C    . ILE A 1 170 ? 22.303  29.008  2.864  1.00 10.74  ? 170  ILE A C    1 
ATOM   2540 O O    . ILE A 1 170 ? 22.465  29.901  1.997  1.00 11.94  ? 170  ILE A O    1 
ATOM   2541 C CB   . ILE A 1 170 ? 22.226  30.291  5.044  1.00 10.56  ? 170  ILE A CB   1 
ATOM   2542 C CG1  . ILE A 1 170 ? 22.734  30.398  6.461  1.00 11.95  ? 170  ILE A CG1  1 
ATOM   2543 C CG2  . ILE A 1 170 ? 20.690  30.161  4.987  1.00 12.19  ? 170  ILE A CG2  1 
ATOM   2544 C CD1  . ILE A 1 170 ? 22.297  31.598  7.243  1.00 12.99  ? 170  ILE A CD1  1 
ATOM   2545 H H    . ILE A 1 170 ? 24.559  30.246  3.850  1.00 12.65  ? 170  ILE A H    1 
ATOM   2546 H HA   . ILE A 1 170 ? 22.822  28.307  4.734  1.00 12.19  ? 170  ILE A HA   1 
ATOM   2547 H HB   . ILE A 1 170 ? 22.457  31.132  4.597  1.00 12.68  ? 170  ILE A HB   1 
ATOM   2548 H HG12 . ILE A 1 170 ? 22.451  29.605  6.943  1.00 14.34  ? 170  ILE A HG12 1 
ATOM   2549 H HG13 . ILE A 1 170 ? 23.703  30.390  6.435  1.00 14.34  ? 170  ILE A HG13 1 
ATOM   2550 H HG21 . ILE A 1 170 ? 20.408  30.097  4.071  1.00 18.29  ? 170  ILE A HG21 1 
ATOM   2551 H HG22 . ILE A 1 170 ? 20.417  29.372  5.461  1.00 18.29  ? 170  ILE A HG22 1 
ATOM   2552 H HG23 . ILE A 1 170 ? 20.287  30.933  5.391  1.00 18.29  ? 170  ILE A HG23 1 
ATOM   2553 H HD11 . ILE A 1 170 ? 22.678  31.562  8.123  1.00 19.49  ? 170  ILE A HD11 1 
ATOM   2554 H HD12 . ILE A 1 170 ? 22.594  32.395  6.798  1.00 19.49  ? 170  ILE A HD12 1 
ATOM   2555 H HD13 . ILE A 1 170 ? 21.339  31.607  7.308  1.00 19.49  ? 170  ILE A HD13 1 
ATOM   2556 N N    . ASP A 1 171 ? 21.580  27.902  2.642  1.00 10.36  ? 171  ASP A N    1 
ATOM   2557 C CA   . ASP A 1 171 ? 20.829  27.668  1.386  1.00 10.43  ? 171  ASP A CA   1 
ATOM   2558 C C    . ASP A 1 171 ? 19.382  28.050  1.586  1.00 10.10  ? 171  ASP A C    1 
ATOM   2559 O O    . ASP A 1 171 ? 18.604  27.312  2.205  1.00 10.76  ? 171  ASP A O    1 
ATOM   2560 C CB   . ASP A 1 171 ? 20.995  26.224  0.959  1.00 11.16  ? 171  ASP A CB   1 
ATOM   2561 C CG   . ASP A 1 171 ? 20.297  25.883  -0.376 1.00 11.07  ? 171  ASP A CG   1 
ATOM   2562 O OD1  . ASP A 1 171 ? 19.530  26.742  -0.888 1.00 10.81  ? 171  ASP A OD1  1 
ATOM   2563 O OD2  . ASP A 1 171 ? 20.547  24.774  -0.858 1.00 12.95  ? 171  ASP A OD2  1 
ATOM   2564 H H    . ASP A 1 171 ? 21.550  27.300  3.256  1.00 12.43  ? 171  ASP A H    1 
ATOM   2565 H HA   . ASP A 1 171 ? 21.207  28.243  0.688  1.00 12.52  ? 171  ASP A HA   1 
ATOM   2566 H HB2  . ASP A 1 171 ? 21.942  26.030  0.875  1.00 13.39  ? 171  ASP A HB2  1 
ATOM   2567 H HB3  . ASP A 1 171 ? 20.637  25.650  1.654  1.00 13.39  ? 171  ASP A HB3  1 
ATOM   2568 N N    . SER A 1 172 ? 18.993  29.264  1.148  1.00 10.39  ? 172  SER A N    1 
ATOM   2569 C CA   . SER A 1 172 ? 17.673  29.797  1.402  1.00 10.52  ? 172  SER A CA   1 
ATOM   2570 C C    . SER A 1 172 ? 16.577  29.061  0.653  1.00 10.15  ? 172  SER A C    1 
ATOM   2571 O O    . SER A 1 172 ? 15.392  29.200  0.966  1.00 11.37  ? 172  SER A O    1 
ATOM   2572 C CB   A SER A 1 172 ? 17.617  31.358  0.870  0.41 14.59  ? 172  SER A CB   1 
ATOM   2573 C CB   B SER A 1 172 ? 17.591  31.252  1.222  0.59 11.02  ? 172  SER A CB   1 
ATOM   2574 O OG   A SER A 1 172 ? 16.391  31.940  1.312  0.41 15.30  ? 172  SER A OG   1 
ATOM   2575 O OG   B SER A 1 172 ? 18.384  31.954  2.175  0.59 11.84  ? 172  SER A OG   1 
ATOM   2576 H H    . SER A 1 172 ? 19.552  29.739  0.700  1.00 12.47  ? 172  SER A H    1 
ATOM   2577 H HA   A SER A 1 172 ? 17.488  29.772  2.364  1.00 12.63  ? 172  SER A HA   1 
ATOM   2578 H HB2  A SER A 1 172 ? 18.369  31.857  1.225  0.41 17.51  ? 172  SER A HB2  1 
ATOM   2579 H HB2  B SER A 1 172 ? 17.889  31.480  0.328  0.59 13.22  ? 172  SER A HB2  1 
ATOM   2580 H HB3  A SER A 1 172 ? 17.665  31.380  -0.099 0.41 17.51  ? 172  SER A HB3  1 
ATOM   2581 H HB3  B SER A 1 172 ? 16.666  31.532  1.309  0.59 13.22  ? 172  SER A HB3  1 
ATOM   2582 H HG   A SER A 1 172 ? 16.358  32.723  1.071  0.41 22.95  ? 172  SER A HG   1 
ATOM   2583 H HG   B SER A 1 172 ? 18.322  32.761  2.042  0.59 17.76  ? 172  SER A HG   1 
ATOM   2584 N N    . SER A 1 173 ? 16.946  28.227  -0.343 1.00 10.09  ? 173  SER A N    1 
ATOM   2585 C CA   . SER A 1 173 ? 15.960  27.388  -1.044 1.00 10.12  ? 173  SER A CA   1 
ATOM   2586 C C    . SER A 1 173 ? 15.532  26.195  -0.184 1.00 10.10  ? 173  SER A C    1 
ATOM   2587 O O    . SER A 1 173 ? 14.594  25.478  -0.585 1.00 11.27  ? 173  SER A O    1 
ATOM   2588 C CB   . SER A 1 173 ? 16.453  26.905  -2.387 1.00 11.11  ? 173  SER A CB   1 
ATOM   2589 O OG   . SER A 1 173 ? 17.409  25.862  -2.306 1.00 11.55  ? 173  SER A OG   1 
ATOM   2590 H H    . SER A 1 173 ? 17.774  28.185  -0.572 1.00 12.10  ? 173  SER A H    1 
ATOM   2591 H HA   . SER A 1 173 ? 15.165  27.938  -1.202 1.00 12.14  ? 173  SER A HA   1 
ATOM   2592 H HB2  . SER A 1 173 ? 15.694  26.594  -2.905 1.00 13.33  ? 173  SER A HB2  1 
ATOM   2593 H HB3  . SER A 1 173 ? 16.847  27.653  -2.863 1.00 13.33  ? 173  SER A HB3  1 
ATOM   2594 H HG   . SER A 1 173 ? 18.064  26.124  -1.888 1.00 17.33  ? 173  SER A HG   1 
ATOM   2595 N N    . LYS A 1 174 ? 16.162  25.940  0.958  1.00 10.09  ? 174  LYS A N    1 
ATOM   2596 C CA   . LYS A 1 174 ? 15.825  24.782  1.803  1.00 10.44  ? 174  LYS A CA   1 
ATOM   2597 C C    . LYS A 1 174 ? 14.708  25.063  2.778  1.00 10.78  ? 174  LYS A C    1 
ATOM   2598 O O    . LYS A 1 174 ? 14.361  24.191  3.591  1.00 12.97  ? 174  LYS A O    1 
ATOM   2599 C CB   . LYS A 1 174 ? 17.126  24.274  2.522  1.00 11.22  ? 174  LYS A CB   1 
ATOM   2600 C CG   . LYS A 1 174 ? 18.164  23.693  1.659  1.00 12.40  ? 174  LYS A CG   1 
ATOM   2601 C CD   . LYS A 1 174 ? 17.810  22.304  1.104  1.00 15.42  ? 174  LYS A CD   1 
ATOM   2602 C CE   A LYS A 1 174 ? 18.807  22.021  0.007  0.52 15.67  ? 174  LYS A CE   1 
ATOM   2603 C CE   B LYS A 1 174 ? 18.822  21.552  0.290  0.48 18.07  ? 174  LYS A CE   1 
ATOM   2604 N NZ   A LYS A 1 174 ? 18.377  20.915  -0.822 0.52 16.17  ? 174  LYS A NZ   1 
ATOM   2605 N NZ   B LYS A 1 174 ? 18.853  22.198  -0.993 0.48 16.35  ? 174  LYS A NZ   1 
ATOM   2606 H H    . LYS A 1 174 ? 16.789  26.470  1.213  1.00 12.11  ? 174  LYS A H    1 
ATOM   2607 H HA   . LYS A 1 174 ? 15.520  24.064  1.209  1.00 12.53  ? 174  LYS A HA   1 
ATOM   2608 H HB2  . LYS A 1 174 ? 17.515  25.020  3.005  1.00 13.47  ? 174  LYS A HB2  1 
ATOM   2609 H HB3  . LYS A 1 174 ? 16.869  23.607  3.178  1.00 13.47  ? 174  LYS A HB3  1 
ATOM   2610 H HG2  . LYS A 1 174 ? 18.324  24.295  0.915  1.00 14.88  ? 174  LYS A HG2  1 
ATOM   2611 H HG3  . LYS A 1 174 ? 18.988  23.626  2.165  1.00 14.88  ? 174  LYS A HG3  1 
ATOM   2612 H HD2  A LYS A 1 174 ? 17.873  21.633  1.801  1.00 18.50  ? 174  LYS A HD2  1 
ATOM   2613 H HD3  A LYS A 1 174 ? 16.906  22.300  0.750  1.00 18.50  ? 174  LYS A HD3  1 
ATOM   2614 H HE2  A LYS A 1 174 ? 18.914  22.813  -0.543 0.52 18.80  ? 174  LYS A HE2  1 
ATOM   2615 H HE2  B LYS A 1 174 ? 19.695  21.591  0.712  0.48 21.69  ? 174  LYS A HE2  1 
ATOM   2616 H HE3  A LYS A 1 174 ? 19.668  21.812  0.402  0.52 18.80  ? 174  LYS A HE3  1 
ATOM   2617 H HE3  B LYS A 1 174 ? 18.562  20.622  0.197  0.48 21.69  ? 174  LYS A HE3  1 
ATOM   2618 H HZ1  A LYS A 1 174 ? 18.300  20.182  -0.323 0.52 24.25  ? 174  LYS A HZ1  1 
ATOM   2619 H HZ1  B LYS A 1 174 ? 18.048  22.148  -1.370 0.48 24.52  ? 174  LYS A HZ1  1 
ATOM   2620 H HZ2  A LYS A 1 174 ? 17.590  21.108  -1.189 0.52 24.25  ? 174  LYS A HZ2  1 
ATOM   2621 H HZ2  B LYS A 1 174 ? 19.080  23.052  -0.890 0.48 24.52  ? 174  LYS A HZ2  1 
ATOM   2622 H HZ3  A LYS A 1 174 ? 18.978  20.774  -1.464 0.52 24.25  ? 174  LYS A HZ3  1 
ATOM   2623 H HZ3  B LYS A 1 174 ? 19.449  21.793  -1.515 0.48 24.52  ? 174  LYS A HZ3  1 
ATOM   2624 N N    . TYR A 1 175 ? 14.125  26.282  2.788  1.00 10.22  ? 175  TYR A N    1 
ATOM   2625 C CA   . TYR A 1 175 ? 13.078  26.600  3.734  1.00 10.32  ? 175  TYR A CA   1 
ATOM   2626 C C    . TYR A 1 175 ? 12.112  27.631  3.118  1.00 10.14  ? 175  TYR A C    1 
ATOM   2627 O O    . TYR A 1 175 ? 12.454  28.321  2.112  1.00 10.91  ? 175  TYR A O    1 
ATOM   2628 C CB   . TYR A 1 175 ? 13.631  27.111  5.076  1.00 10.83  ? 175  TYR A CB   1 
ATOM   2629 C CG   . TYR A 1 175 ? 14.573  28.283  4.993  1.00 10.62  ? 175  TYR A CG   1 
ATOM   2630 C CD1  . TYR A 1 175 ? 15.943  28.069  4.811  1.00 11.06  ? 175  TYR A CD1  1 
ATOM   2631 C CD2  . TYR A 1 175 ? 14.104  29.609  5.079  1.00 10.79  ? 175  TYR A CD2  1 
ATOM   2632 C CE1  . TYR A 1 175 ? 16.843  29.148  4.752  1.00 11.14  ? 175  TYR A CE1  1 
ATOM   2633 C CE2  . TYR A 1 175 ? 14.976  30.689  4.986  1.00 11.57  ? 175  TYR A CE2  1 
ATOM   2634 C CZ   . TYR A 1 175 ? 16.347  30.443  4.827  1.00 11.63  ? 175  TYR A CZ   1 
ATOM   2635 O OH   . TYR A 1 175 ? 17.242  31.487  4.734  1.00 12.76  ? 175  TYR A OH   1 
ATOM   2636 H H    . TYR A 1 175 ? 14.380  26.878  2.223  1.00 12.26  ? 175  TYR A H    1 
ATOM   2637 H HA   . TYR A 1 175 ? 12.571  25.780  3.910  1.00 12.38  ? 175  TYR A HA   1 
ATOM   2638 H HB2  . TYR A 1 175 ? 12.881  27.361  5.639  1.00 12.99  ? 175  TYR A HB2  1 
ATOM   2639 H HB3  . TYR A 1 175 ? 14.092  26.379  5.514  1.00 12.99  ? 175  TYR A HB3  1 
ATOM   2640 H HD1  . TYR A 1 175 ? 16.264  27.201  4.726  1.00 13.28  ? 175  TYR A HD1  1 
ATOM   2641 H HD2  . TYR A 1 175 ? 13.195  29.765  5.200  1.00 12.94  ? 175  TYR A HD2  1 
ATOM   2642 H HE1  . TYR A 1 175 ? 17.757  28.997  4.665  1.00 13.36  ? 175  TYR A HE1  1 
ATOM   2643 H HE2  . TYR A 1 175 ? 14.654  31.560  5.028  1.00 13.88  ? 175  TYR A HE2  1 
ATOM   2644 H HH   . TYR A 1 175 ? 16.838  32.198  4.791  1.00 19.14  ? 175  TYR A HH   1 
ATOM   2645 N N    . THR A 1 176 ? 10.926  27.719  3.701  1.00 10.44  ? 176  THR A N    1 
ATOM   2646 C CA   . THR A 1 176 ? 9.897   28.674  3.349  1.00 10.68  ? 176  THR A CA   1 
ATOM   2647 C C    . THR A 1 176 ? 10.017  29.912  4.250  1.00 10.75  ? 176  THR A C    1 
ATOM   2648 O O    . THR A 1 176 ? 10.213  29.803  5.452  1.00 12.46  ? 176  THR A O    1 
ATOM   2649 C CB   A THR A 1 176 ? 8.473   28.082  3.400  0.41 13.08  ? 176  THR A CB   1 
ATOM   2650 C CB   B THR A 1 176 ? 8.566   28.054  3.600  0.59 12.29  ? 176  THR A CB   1 
ATOM   2651 O OG1  A THR A 1 176 ? 8.039   27.653  4.514  0.41 17.93  ? 176  THR A OG1  1 
ATOM   2652 O OG1  B THR A 1 176 ? 8.514   26.850  2.876  0.59 12.66  ? 176  THR A OG1  1 
ATOM   2653 C CG2  A THR A 1 176 ? 8.478   26.551  2.831  0.41 26.56  ? 176  THR A CG2  1 
ATOM   2654 C CG2  B THR A 1 176 ? 7.418   28.994  3.158  0.59 12.26  ? 176  THR A CG2  1 
ATOM   2655 H H    . THR A 1 176 ? 10.754  27.165  4.336  1.00 12.53  ? 176  THR A H    1 
ATOM   2656 H HA   A THR A 1 176 ? 10.064  28.963  2.428  1.00 12.82  ? 176  THR A HA   1 
ATOM   2657 H HB   A THR A 1 176 ? 7.818   28.648  2.940  0.41 15.70  ? 176  THR A HB   1 
ATOM   2658 H HB   B THR A 1 176 ? 8.475   27.860  4.556  0.59 14.75  ? 176  THR A HB   1 
ATOM   2659 H HG1  A THR A 1 176 ? 7.959   28.281  5.036  0.41 26.89  ? 176  THR A HG1  1 
ATOM   2660 H HG1  B THR A 1 176 ? 7.899   26.883  2.334  0.59 18.99  ? 176  THR A HG1  1 
ATOM   2661 H HG21 A THR A 1 176 ? 7.585   26.199  2.850  0.41 39.84  ? 176  THR A HG21 1 
ATOM   2662 H HG21 B THR A 1 176 ? 6.574   28.576  3.340  0.59 18.40  ? 176  THR A HG21 1 
ATOM   2663 H HG22 A THR A 1 176 ? 8.804   26.546  1.928  0.41 39.84  ? 176  THR A HG22 1 
ATOM   2664 H HG22 B THR A 1 176 ? 7.477   29.821  3.643  0.59 18.40  ? 176  THR A HG22 1 
ATOM   2665 H HG23 A THR A 1 176 ? 9.049   26.007  3.379  0.41 39.84  ? 176  THR A HG23 1 
ATOM   2666 H HG23 B THR A 1 176 ? 7.492   29.170  2.217  0.59 18.40  ? 176  THR A HG23 1 
ATOM   2667 N N    . GLY A 1 177 ? 9.888   31.088  3.640  1.00 12.95  ? 177  GLY A N    1 
ATOM   2668 C CA   . GLY A 1 177 ? 9.925   32.347  4.420  1.00 13.30  ? 177  GLY A CA   1 
ATOM   2669 C C    . GLY A 1 177 ? 11.306  32.683  4.935  1.00 12.01  ? 177  GLY A C    1 
ATOM   2670 O O    . GLY A 1 177 ? 12.332  32.266  4.349  1.00 13.99  ? 177  GLY A O    1 
ATOM   2671 H H    . GLY A 1 177 ? 9.783   31.117  2.787  1.00 15.54  ? 177  GLY A H    1 
ATOM   2672 H HA2  . GLY A 1 177 ? 9.611   33.074  3.861  1.00 15.96  ? 177  GLY A HA2  1 
ATOM   2673 H HA3  . GLY A 1 177 ? 9.318   32.269  5.173  1.00 15.96  ? 177  GLY A HA3  1 
ATOM   2674 N N    . SER A 1 178 ? 11.369  33.464  6.005  1.00 12.40  ? 178  SER A N    1 
ATOM   2675 C CA   . SER A 1 178 ? 12.631  33.895  6.596  1.00 12.25  ? 178  SER A CA   1 
ATOM   2676 C C    . SER A 1 178 ? 12.980  33.135  7.878  1.00 11.26  ? 178  SER A C    1 
ATOM   2677 O O    . SER A 1 178 ? 12.055  32.664  8.593  1.00 12.84  ? 178  SER A O    1 
ATOM   2678 C CB   . SER A 1 178 ? 12.566  35.389  6.947  1.00 14.56  ? 178  SER A CB   1 
ATOM   2679 O OG   . SER A 1 178 ? 12.282  36.180  5.798  1.00 26.00  ? 178  SER A OG   1 
ATOM   2680 H H    . SER A 1 178 ? 10.634  33.727  6.366  1.00 14.88  ? 178  SER A H    1 
ATOM   2681 H HA   . SER A 1 178 ? 13.348  33.756  5.943  1.00 14.70  ? 178  SER A HA   1 
ATOM   2682 H HB2  . SER A 1 178 ? 11.876  35.532  7.614  1.00 17.47  ? 178  SER A HB2  1 
ATOM   2683 H HB3  . SER A 1 178 ? 13.413  35.667  7.327  1.00 17.47  ? 178  SER A HB3  1 
ATOM   2684 H HG   . SER A 1 178 ? 12.874  36.074  5.241  1.00 39.00  ? 178  SER A HG   1 
ATOM   2685 N N    . LEU A 1 179 ? 14.250  32.999  8.186  1.00 11.13  ? 179  LEU A N    1 
ATOM   2686 C CA   . LEU A 1 179 ? 14.692  32.363  9.424  1.00 10.60  ? 179  LEU A CA   1 
ATOM   2687 C C    . LEU A 1 179 ? 14.342  33.227  10.640 1.00 11.00  ? 179  LEU A C    1 
ATOM   2688 O O    . LEU A 1 179 ? 14.384  34.455  10.585 1.00 12.65  ? 179  LEU A O    1 
ATOM   2689 C CB   . LEU A 1 179 ? 16.204  32.153  9.384  1.00 10.98  ? 179  LEU A CB   1 
ATOM   2690 C CG   . LEU A 1 179 ? 16.684  31.075  8.383  1.00 11.64  ? 179  LEU A CG   1 
ATOM   2691 C CD1  . LEU A 1 179 ? 18.170  31.253  8.054  1.00 12.82  ? 179  LEU A CD1  1 
ATOM   2692 C CD2  . LEU A 1 179 ? 16.444  29.685  8.910  1.00 12.37  ? 179  LEU A CD2  1 
ATOM   2693 H H    . LEU A 1 179 ? 14.843  33.296  7.638  1.00 13.36  ? 179  LEU A H    1 
ATOM   2694 H HA   . LEU A 1 179 ? 14.251  31.492  9.512  1.00 12.72  ? 179  LEU A HA   1 
ATOM   2695 H HB2  . LEU A 1 179 ? 16.626  32.996  9.157  1.00 13.18  ? 179  LEU A HB2  1 
ATOM   2696 H HB3  . LEU A 1 179 ? 16.504  31.905  10.273 1.00 13.18  ? 179  LEU A HB3  1 
ATOM   2697 H HG   . LEU A 1 179 ? 16.173  31.179  7.553  1.00 13.97  ? 179  LEU A HG   1 
ATOM   2698 H HD11 . LEU A 1 179 ? 18.319  32.140  7.720  1.00 19.23  ? 179  LEU A HD11 1 
ATOM   2699 H HD12 . LEU A 1 179 ? 18.691  31.118  8.849  1.00 19.23  ? 179  LEU A HD12 1 
ATOM   2700 H HD13 . LEU A 1 179 ? 18.429  30.612  7.389  1.00 19.23  ? 179  LEU A HD13 1 
ATOM   2701 H HD21 . LEU A 1 179 ? 16.965  29.550  9.705  1.00 18.55  ? 179  LEU A HD21 1 
ATOM   2702 H HD22 . LEU A 1 179 ? 15.513  29.577  9.116  1.00 18.55  ? 179  LEU A HD22 1 
ATOM   2703 H HD23 . LEU A 1 179 ? 16.702  29.041  8.246  1.00 18.55  ? 179  LEU A HD23 1 
ATOM   2704 N N    . THR A 1 180 ? 14.062  32.526  11.755 1.00 10.24  ? 180  THR A N    1 
ATOM   2705 C CA   . THR A 1 180 ? 13.931  33.174  13.075 1.00 10.50  ? 180  THR A CA   1 
ATOM   2706 C C    . THR A 1 180 ? 15.013  32.615  13.959 1.00 10.11  ? 180  THR A C    1 
ATOM   2707 O O    . THR A 1 180 ? 15.163  31.379  14.070 1.00 10.63  ? 180  THR A O    1 
ATOM   2708 C CB   . THR A 1 180 ? 12.551  32.910  13.701 1.00 11.18  ? 180  THR A CB   1 
ATOM   2709 O OG1  . THR A 1 180 ? 11.516  33.386  12.842 1.00 12.81  ? 180  THR A OG1  1 
ATOM   2710 C CG2  . THR A 1 180 ? 12.409  33.661  15.050 1.00 12.74  ? 180  THR A CG2  1 
ATOM   2711 H H    . THR A 1 180 ? 13.956  31.675  11.696 1.00 12.29  ? 180  THR A H    1 
ATOM   2712 H HA   . THR A 1 180 ? 14.061  34.141  12.975 1.00 12.60  ? 180  THR A HA   1 
ATOM   2713 H HB   . THR A 1 180 ? 12.437  31.947  13.848 1.00 13.42  ? 180  THR A HB   1 
ATOM   2714 H HG1  . THR A 1 180 ? 11.849  33.714  12.168 1.00 19.22  ? 180  THR A HG1  1 
ATOM   2715 H HG21 . THR A 1 180 ? 11.543  33.484  15.425 1.00 19.11  ? 180  THR A HG21 1 
ATOM   2716 H HG22 . THR A 1 180 ? 13.088  33.359  15.657 1.00 19.11  ? 180  THR A HG22 1 
ATOM   2717 H HG23 . THR A 1 180 ? 12.507  34.604  14.903 1.00 19.11  ? 180  THR A HG23 1 
ATOM   2718 N N    . TYR A 1 181 ? 15.805  33.504  14.567 1.00 10.21  ? 181  TYR A N    1 
ATOM   2719 C CA   . TYR A 1 181 ? 16.918  33.112  15.441 1.00 10.24  ? 181  TYR A CA   1 
ATOM   2720 C C    . TYR A 1 181 ? 16.537  33.200  16.928 1.00 10.33  ? 181  TYR A C    1 
ATOM   2721 O O    . TYR A 1 181 ? 15.737  34.015  17.354 1.00 12.09  ? 181  TYR A O    1 
ATOM   2722 C CB   . TYR A 1 181 ? 18.142  33.957  15.131 1.00 10.97  ? 181  TYR A CB   1 
ATOM   2723 C CG   . TYR A 1 181 ? 18.807  33.628  13.821 1.00 11.06  ? 181  TYR A CG   1 
ATOM   2724 C CD1  . TYR A 1 181 ? 18.378  34.238  12.604 1.00 12.77  ? 181  TYR A CD1  1 
ATOM   2725 C CD2  . TYR A 1 181 ? 19.808  32.663  13.723 1.00 11.12  ? 181  TYR A CD2  1 
ATOM   2726 C CE1  . TYR A 1 181 ? 19.014  33.918  11.376 1.00 13.08  ? 181  TYR A CE1  1 
ATOM   2727 C CE2  . TYR A 1 181 ? 20.395  32.353  12.538 1.00 11.58  ? 181  TYR A CE2  1 
ATOM   2728 C CZ   . TYR A 1 181 ? 20.017  32.990  11.365 1.00 12.20  ? 181  TYR A CZ   1 
ATOM   2729 O OH   . TYR A 1 181 ? 20.699  32.657  10.196 1.00 14.49  ? 181  TYR A OH   1 
ATOM   2730 H H    . TYR A 1 181 ? 15.656  34.341  14.441 1.00 12.25  ? 181  TYR A H    1 
ATOM   2731 H HA   . TYR A 1 181 ? 17.140  32.178  15.243 1.00 12.29  ? 181  TYR A HA   1 
ATOM   2732 H HB2  . TYR A 1 181 ? 17.881  34.891  15.121 1.00 13.16  ? 181  TYR A HB2  1 
ATOM   2733 H HB3  . TYR A 1 181 ? 18.789  33.840  15.845 1.00 13.16  ? 181  TYR A HB3  1 
ATOM   2734 H HD1  . TYR A 1 181 ? 17.678  34.850  12.616 1.00 15.33  ? 181  TYR A HD1  1 
ATOM   2735 H HD2  . TYR A 1 181 ? 20.082  32.218  14.492 1.00 13.34  ? 181  TYR A HD2  1 
ATOM   2736 H HE1  . TYR A 1 181 ? 18.751  34.336  10.588 1.00 15.69  ? 181  TYR A HE1  1 
ATOM   2737 H HE2  . TYR A 1 181 ? 21.061  31.705  12.512 1.00 13.90  ? 181  TYR A HE2  1 
ATOM   2738 H HH   . TYR A 1 181 ? 20.396  33.091  9.570  1.00 21.73  ? 181  TYR A HH   1 
ATOM   2739 N N    . THR A 1 182 ? 17.244  32.358  17.709 1.00 10.00  ? 182  THR A N    1 
ATOM   2740 C CA   . THR A 1 182 ? 17.096  32.306  19.155 1.00 10.37  ? 182  THR A CA   1 
ATOM   2741 C C    . THR A 1 182 ? 18.501  32.087  19.760 1.00 9.96   ? 182  THR A C    1 
ATOM   2742 O O    . THR A 1 182 ? 19.371  31.427  19.153 1.00 10.29  ? 182  THR A O    1 
ATOM   2743 C CB   . THR A 1 182 ? 16.099  31.230  19.563 1.00 10.95  ? 182  THR A CB   1 
ATOM   2744 O OG1  . THR A 1 182 ? 15.632  31.445  20.900 1.00 12.31  ? 182  THR A OG1  1 
ATOM   2745 C CG2  . THR A 1 182 ? 16.646  29.815  19.429 1.00 10.99  ? 182  THR A CG2  1 
ATOM   2746 H H    . THR A 1 182 ? 17.809  31.828  17.336 1.00 12.00  ? 182  THR A H    1 
ATOM   2747 H HA   . THR A 1 182 ? 16.758  33.173  19.463 1.00 12.44  ? 182  THR A HA   1 
ATOM   2748 H HB   . THR A 1 182 ? 15.326  31.304  18.966 1.00 13.14  ? 182  THR A HB   1 
ATOM   2749 H HG1  . THR A 1 182 ? 15.334  32.206  20.967 1.00 18.46  ? 182  THR A HG1  1 
ATOM   2750 H HG21 . THR A 1 182 ? 15.972  29.185  19.696 1.00 16.48  ? 182  THR A HG21 1 
ATOM   2751 H HG22 . THR A 1 182 ? 16.892  29.652  18.516 1.00 16.48  ? 182  THR A HG22 1 
ATOM   2752 H HG23 . THR A 1 182 ? 17.417  29.715  19.992 1.00 16.48  ? 182  THR A HG23 1 
ATOM   2753 N N    . GLY A 1 183 ? 18.692  32.575  20.978 1.00 10.53  ? 183  GLY A N    1 
ATOM   2754 C CA   . GLY A 1 183 ? 19.991  32.440  21.635 1.00 10.41  ? 183  GLY A CA   1 
ATOM   2755 C C    . GLY A 1 183 ? 20.266  31.016  22.106 1.00 10.17  ? 183  GLY A C    1 
ATOM   2756 O O    . GLY A 1 183 ? 19.393  30.310  22.581 1.00 11.96  ? 183  GLY A O    1 
ATOM   2757 H H    . GLY A 1 183 ? 18.047  32.973  21.385 1.00 12.63  ? 183  GLY A H    1 
ATOM   2758 H HA2  . GLY A 1 183 ? 20.688  32.710  21.017 1.00 12.49  ? 183  GLY A HA2  1 
ATOM   2759 H HA3  . GLY A 1 183 ? 20.024  33.038  22.398 1.00 12.49  ? 183  GLY A HA3  1 
ATOM   2760 N N    . VAL A 1 184 ? 21.559  30.631  22.017 1.00 9.83   ? 184  VAL A N    1 
ATOM   2761 C CA   . VAL A 1 184 ? 22.029  29.317  22.455 1.00 9.33   ? 184  VAL A CA   1 
ATOM   2762 C C    . VAL A 1 184 ? 22.801  29.465  23.786 1.00 9.57   ? 184  VAL A C    1 
ATOM   2763 O O    . VAL A 1 184 ? 23.659  30.368  23.934 1.00 10.61  ? 184  VAL A O    1 
ATOM   2764 C CB   . VAL A 1 184 ? 22.920  28.681  21.363 1.00 9.71   ? 184  VAL A CB   1 
ATOM   2765 C CG1  . VAL A 1 184 ? 23.745  27.502  21.888 1.00 10.21  ? 184  VAL A CG1  1 
ATOM   2766 C CG2  . VAL A 1 184 ? 22.040  28.232  20.192 1.00 11.08  ? 184  VAL A CG2  1 
ATOM   2767 H H    . VAL A 1 184 ? 22.131  31.183  21.688 1.00 11.79  ? 184  VAL A H    1 
ATOM   2768 H HA   . VAL A 1 184 ? 21.253  28.739  22.604 1.00 11.19  ? 184  VAL A HA   1 
ATOM   2769 H HB   . VAL A 1 184 ? 23.539  29.366  21.036 1.00 11.65  ? 184  VAL A HB   1 
ATOM   2770 H HG11 . VAL A 1 184 ? 24.290  27.795  22.622 1.00 15.31  ? 184  VAL A HG11 1 
ATOM   2771 H HG12 . VAL A 1 184 ? 23.156  26.805  22.185 1.00 15.31  ? 184  VAL A HG12 1 
ATOM   2772 H HG13 . VAL A 1 184 ? 24.308  27.168  21.186 1.00 15.31  ? 184  VAL A HG13 1 
ATOM   2773 H HG21 . VAL A 1 184 ? 21.446  27.538  20.485 1.00 16.61  ? 184  VAL A HG21 1 
ATOM   2774 H HG22 . VAL A 1 184 ? 21.527  28.979  19.873 1.00 16.61  ? 184  VAL A HG22 1 
ATOM   2775 H HG23 . VAL A 1 184 ? 22.596  27.900  19.483 1.00 16.61  ? 184  VAL A HG23 1 
ATOM   2776 N N    . ASP A 1 185 ? 22.549  28.528  24.683 1.00 9.86   ? 185  ASP A N    1 
ATOM   2777 C CA   . ASP A 1 185 ? 23.298  28.356  25.930 1.00 9.95   ? 185  ASP A CA   1 
ATOM   2778 C C    . ASP A 1 185 ? 24.269  27.167  25.713 1.00 9.67   ? 185  ASP A C    1 
ATOM   2779 O O    . ASP A 1 185 ? 23.834  26.025  25.609 1.00 10.83  ? 185  ASP A O    1 
ATOM   2780 C CB   . ASP A 1 185 ? 22.336  28.070  27.074 1.00 10.95  ? 185  ASP A CB   1 
ATOM   2781 C CG   . ASP A 1 185 ? 23.055  27.847  28.420 1.00 12.70  ? 185  ASP A CG   1 
ATOM   2782 O OD1  . ASP A 1 185 ? 24.269  27.878  28.493 1.00 13.07  ? 185  ASP A OD1  1 
ATOM   2783 O OD2  . ASP A 1 185 ? 22.269  27.749  29.434 1.00 20.31  ? 185  ASP A OD2  1 
ATOM   2784 H H    . ASP A 1 185 ? 21.904  27.983  24.524 1.00 11.83  ? 185  ASP A H    1 
ATOM   2785 H HA   . ASP A 1 185 ? 23.809  29.169  26.124 1.00 11.94  ? 185  ASP A HA   1 
ATOM   2786 H HB2  . ASP A 1 185 ? 21.721  28.815  27.163 1.00 13.14  ? 185  ASP A HB2  1 
ATOM   2787 H HB3  . ASP A 1 185 ? 21.816  27.280  26.859 1.00 13.14  ? 185  ASP A HB3  1 
ATOM   2788 N N    . ASN A 1 186 ? 25.543  27.464  25.597 1.00 10.01  ? 186  ASN A N    1 
ATOM   2789 C CA   . ASN A 1 186 ? 26.570  26.461  25.343 1.00 10.47  ? 186  ASN A CA   1 
ATOM   2790 C C    . ASN A 1 186 ? 27.258  26.011  26.649 1.00 10.02  ? 186  ASN A C    1 
ATOM   2791 O O    . ASN A 1 186 ? 28.302  25.317  26.594 1.00 11.11  ? 186  ASN A O    1 
ATOM   2792 C CB   . ASN A 1 186 ? 27.577  26.858  24.297 1.00 12.70  ? 186  ASN A CB   1 
ATOM   2793 C CG   . ASN A 1 186 ? 28.482  27.971  24.718 1.00 14.92  ? 186  ASN A CG   1 
ATOM   2794 O OD1  . ASN A 1 186 ? 28.414  28.424  25.885 1.00 15.97  ? 186  ASN A OD1  1 
ATOM   2795 N ND2  . ASN A 1 186 ? 29.293  28.458  23.834 1.00 21.13  ? 186  ASN A ND2  1 
ATOM   2796 H H    . ASN A 1 186 ? 25.782  28.286  25.676 1.00 12.01  ? 186  ASN A H    1 
ATOM   2797 H HA   . ASN A 1 186 ? 26.105  25.674  24.991 1.00 12.56  ? 186  ASN A HA   1 
ATOM   2798 H HB2  . ASN A 1 186 ? 28.117  26.084  24.075 1.00 15.24  ? 186  ASN A HB2  1 
ATOM   2799 H HB3  . ASN A 1 186 ? 27.103  27.127  23.495 1.00 15.24  ? 186  ASN A HB3  1 
ATOM   2800 H HD21 . ASN A 1 186 ? 29.316  28.125  23.042 1.00 25.36  ? 186  ASN A HD21 1 
ATOM   2801 H HD22 . ASN A 1 186 ? 29.809  29.114  24.040 1.00 25.36  ? 186  ASN A HD22 1 
ATOM   2802 N N    . SER A 1 187 ? 26.705  26.300  27.827 1.00 10.39  ? 187  SER A N    1 
ATOM   2803 C CA   . SER A 1 187 ? 27.400  26.029  29.092 1.00 11.41  ? 187  SER A CA   1 
ATOM   2804 C C    . SER A 1 187 ? 27.541  24.558  29.419 1.00 10.95  ? 187  SER A C    1 
ATOM   2805 O O    . SER A 1 187 ? 28.399  24.216  30.266 1.00 14.28  ? 187  SER A O    1 
ATOM   2806 C CB   . SER A 1 187 ? 26.734  26.760  30.225 1.00 14.24  ? 187  SER A CB   1 
ATOM   2807 O OG   . SER A 1 187 ? 25.460  26.346  30.497 1.00 16.14  ? 187  SER A OG   1 
ATOM   2808 H H    . SER A 1 187 ? 25.921  26.655  27.847 1.00 12.46  ? 187  SER A H    1 
ATOM   2809 H HA   . SER A 1 187 ? 28.306  26.393  29.007 1.00 13.70  ? 187  SER A HA   1 
ATOM   2810 H HB2  . SER A 1 187 ? 27.273  26.649  31.024 1.00 17.09  ? 187  SER A HB2  1 
ATOM   2811 H HB3  . SER A 1 187 ? 26.714  27.706  30.014 1.00 17.09  ? 187  SER A HB3  1 
ATOM   2812 H HG   . SER A 1 187 ? 24.991  26.452  29.833 1.00 24.21  ? 187  SER A HG   1 
ATOM   2813 N N    . GLN A 1 188 ? 26.785  23.673  28.795 1.00 9.63   ? 188  GLN A N    1 
ATOM   2814 C CA   . GLN A 1 188 ? 26.932  22.227  28.922 1.00 9.56   ? 188  GLN A CA   1 
ATOM   2815 C C    . GLN A 1 188 ? 27.413  21.587  27.593 1.00 9.22   ? 188  GLN A C    1 
ATOM   2816 O O    . GLN A 1 188 ? 27.357  20.371  27.404 1.00 10.16  ? 188  GLN A O    1 
ATOM   2817 C CB   . GLN A 1 188 ? 25.652  21.569  29.461 1.00 9.98   ? 188  GLN A CB   1 
ATOM   2818 C CG   . GLN A 1 188 ? 25.502  21.831  30.957 1.00 10.85  ? 188  GLN A CG   1 
ATOM   2819 C CD   . GLN A 1 188 ? 26.508  21.059  31.773 1.00 10.38  ? 188  GLN A CD   1 
ATOM   2820 O OE1  . GLN A 1 188 ? 26.968  19.960  31.388 1.00 10.86  ? 188  GLN A OE1  1 
ATOM   2821 N NE2  . GLN A 1 188 ? 26.838  21.611  32.949 1.00 14.24  ? 188  GLN A NE2  1 
ATOM   2822 H H    . GLN A 1 188 ? 26.164  23.970  28.280 1.00 11.56  ? 188  GLN A H    1 
ATOM   2823 H HA   . GLN A 1 188 ? 27.635  22.068  29.586 1.00 11.47  ? 188  GLN A HA   1 
ATOM   2824 H HB2  . GLN A 1 188 ? 24.882  21.926  28.990 1.00 11.98  ? 188  GLN A HB2  1 
ATOM   2825 H HB3  . GLN A 1 188 ? 25.687  20.613  29.301 1.00 11.98  ? 188  GLN A HB3  1 
ATOM   2826 H HG2  . GLN A 1 188 ? 25.614  22.780  31.128 1.00 13.02  ? 188  GLN A HG2  1 
ATOM   2827 H HG3  . GLN A 1 188 ? 24.607  21.582  31.236 1.00 13.02  ? 188  GLN A HG3  1 
ATOM   2828 H HE21 . GLN A 1 188 ? 26.500  22.368  33.178 1.00 17.09  ? 188  GLN A HE21 1 
ATOM   2829 H HE22 . GLN A 1 188 ? 27.386  21.208  33.475 1.00 17.09  ? 188  GLN A HE22 1 
ATOM   2830 N N    . GLY A 1 189 ? 27.910  22.425  26.682 1.00 9.13   ? 189  GLY A N    1 
ATOM   2831 C CA   . GLY A 1 189 ? 28.460  21.961  25.420 1.00 8.99   ? 189  GLY A CA   1 
ATOM   2832 C C    . GLY A 1 189 ? 27.445  21.653  24.321 1.00 8.52   ? 189  GLY A C    1 
ATOM   2833 O O    . GLY A 1 189 ? 27.872  21.245  23.230 1.00 9.45   ? 189  GLY A O    1 
ATOM   2834 H H    . GLY A 1 189 ? 27.905  23.269  26.848 1.00 10.96  ? 189  GLY A H    1 
ATOM   2835 H HA2  . GLY A 1 189 ? 29.073  22.636  25.088 1.00 10.79  ? 189  GLY A HA2  1 
ATOM   2836 H HA3  . GLY A 1 189 ? 28.977  21.158  25.590 1.00 10.79  ? 189  GLY A HA3  1 
ATOM   2837 N N    . PHE A 1 190 ? 26.160  21.827  24.606 1.00 8.76   ? 190  PHE A N    1 
ATOM   2838 C CA   . PHE A 1 190 ? 25.108  21.499  23.652 1.00 8.52   ? 190  PHE A CA   1 
ATOM   2839 C C    . PHE A 1 190 ? 24.593  22.771  22.953 1.00 8.56   ? 190  PHE A C    1 
ATOM   2840 O O    . PHE A 1 190 ? 24.744  23.887  23.418 1.00 9.43   ? 190  PHE A O    1 
ATOM   2841 C CB   . PHE A 1 190 ? 23.913  20.842  24.349 1.00 9.37   ? 190  PHE A CB   1 
ATOM   2842 C CG   . PHE A 1 190 ? 24.248  19.565  25.116 1.00 9.07   ? 190  PHE A CG   1 
ATOM   2843 C CD1  . PHE A 1 190 ? 24.816  18.455  24.473 1.00 9.84   ? 190  PHE A CD1  1 
ATOM   2844 C CD2  . PHE A 1 190 ? 23.926  19.464  26.480 1.00 9.96   ? 190  PHE A CD2  1 
ATOM   2845 C CE1  . PHE A 1 190 ? 25.086  17.289  25.187 1.00 10.54  ? 190  PHE A CE1  1 
ATOM   2846 C CE2  . PHE A 1 190 ? 24.175  18.282  27.179 1.00 11.33  ? 190  PHE A CE2  1 
ATOM   2847 C CZ   . PHE A 1 190 ? 24.745  17.216  26.546 1.00 11.27  ? 190  PHE A CZ   1 
ATOM   2848 H H    . PHE A 1 190 ? 25.941  22.141  25.376 1.00 10.52  ? 190  PHE A H    1 
ATOM   2849 H HA   . PHE A 1 190 ? 25.466  20.883  22.978 1.00 10.22  ? 190  PHE A HA   1 
ATOM   2850 H HB2  . PHE A 1 190 ? 23.526  21.482  24.967 1.00 11.24  ? 190  PHE A HB2  1 
ATOM   2851 H HB3  . PHE A 1 190 ? 23.241  20.636  23.682 1.00 11.24  ? 190  PHE A HB3  1 
ATOM   2852 H HD1  . PHE A 1 190 ? 25.014  18.498  23.565 1.00 11.81  ? 190  PHE A HD1  1 
ATOM   2853 H HD2  . PHE A 1 190 ? 23.546  20.190  26.920 1.00 11.96  ? 190  PHE A HD2  1 
ATOM   2854 H HE1  . PHE A 1 190 ? 25.490  16.565  24.765 1.00 12.65  ? 190  PHE A HE1  1 
ATOM   2855 H HE2  . PHE A 1 190 ? 23.952  18.220  28.080 1.00 13.60  ? 190  PHE A HE2  1 
ATOM   2856 H HZ   . PHE A 1 190 ? 24.908  16.433  27.020 1.00 13.52  ? 190  PHE A HZ   1 
ATOM   2857 N N    . TRP A 1 191 ? 23.912  22.511  21.812 1.00 8.59   ? 191  TRP A N    1 
ATOM   2858 C CA   . TRP A 1 191 ? 23.124  23.559  21.138 1.00 8.41   ? 191  TRP A CA   1 
ATOM   2859 C C    . TRP A 1 191 ? 21.750  23.634  21.841 1.00 8.51   ? 191  TRP A C    1 
ATOM   2860 O O    . TRP A 1 191 ? 20.711  23.167  21.364 1.00 9.08   ? 191  TRP A O    1 
ATOM   2861 C CB   . TRP A 1 191 ? 22.998  23.232  19.639 1.00 8.80   ? 191  TRP A CB   1 
ATOM   2862 C CG   . TRP A 1 191 ? 24.301  23.315  18.903 1.00 8.71   ? 191  TRP A CG   1 
ATOM   2863 C CD1  . TRP A 1 191 ? 25.199  22.321  18.649 1.00 8.77   ? 191  TRP A CD1  1 
ATOM   2864 C CD2  . TRP A 1 191 ? 24.881  24.513  18.317 1.00 9.15   ? 191  TRP A CD2  1 
ATOM   2865 N NE1  . TRP A 1 191 ? 26.281  22.802  17.938 1.00 9.36   ? 191  TRP A NE1  1 
ATOM   2866 C CE2  . TRP A 1 191 ? 26.109  24.138  17.729 1.00 9.46   ? 191  TRP A CE2  1 
ATOM   2867 C CE3  . TRP A 1 191 ? 24.421  25.861  18.199 1.00 9.84   ? 191  TRP A CE3  1 
ATOM   2868 C CZ2  . TRP A 1 191 ? 26.893  25.068  17.025 1.00 10.10  ? 191  TRP A CZ2  1 
ATOM   2869 C CZ3  . TRP A 1 191 ? 25.226  26.752  17.526 1.00 10.71  ? 191  TRP A CZ3  1 
ATOM   2870 C CH2  . TRP A 1 191 ? 26.433  26.377  16.943 1.00 10.75  ? 191  TRP A CH2  1 
ATOM   2871 H H    . TRP A 1 191 ? 23.940  21.721  21.474 1.00 10.31  ? 191  TRP A H    1 
ATOM   2872 H HA   . TRP A 1 191 ? 23.583  24.419  21.240 1.00 10.09  ? 191  TRP A HA   1 
ATOM   2873 H HB2  . TRP A 1 191 ? 22.638  22.337  19.542 1.00 10.56  ? 191  TRP A HB2  1 
ATOM   2874 H HB3  . TRP A 1 191 ? 22.368  23.849  19.235 1.00 10.56  ? 191  TRP A HB3  1 
ATOM   2875 H HD1  . TRP A 1 191 ? 25.096  21.437  18.918 1.00 10.53  ? 191  TRP A HD1  1 
ATOM   2876 H HE1  . TRP A 1 191 ? 26.953  22.335  17.671 1.00 11.24  ? 191  TRP A HE1  1 
ATOM   2877 H HE3  . TRP A 1 191 ? 23.607  26.127  18.564 1.00 11.81  ? 191  TRP A HE3  1 
ATOM   2878 H HZ2  . TRP A 1 191 ? 27.694  24.815  16.626 1.00 12.12  ? 191  TRP A HZ2  1 
ATOM   2879 H HZ3  . TRP A 1 191 ? 24.953  27.639  17.458 1.00 12.85  ? 191  TRP A HZ3  1 
ATOM   2880 H HH2  . TRP A 1 191 ? 26.940  27.012  16.491 1.00 12.90  ? 191  TRP A HH2  1 
ATOM   2881 N N    . SER A 1 192 ? 21.793  24.221  23.079 1.00 9.07   ? 192  SER A N    1 
ATOM   2882 C CA   . SER A 1 192 ? 20.593  24.342  23.930 1.00 8.78   ? 192  SER A CA   1 
ATOM   2883 C C    . SER A 1 192 ? 19.882  25.659  23.670 1.00 8.89   ? 192  SER A C    1 
ATOM   2884 O O    . SER A 1 192 ? 20.526  26.736  23.562 1.00 10.00  ? 192  SER A O    1 
ATOM   2885 C CB   . SER A 1 192 ? 21.003  24.261  25.414 1.00 9.84   ? 192  SER A CB   1 
ATOM   2886 O OG   . SER A 1 192 ? 19.872  24.402  26.257 1.00 11.50  ? 192  SER A OG   1 
ATOM   2887 H H    . SER A 1 192 ? 22.542  24.528  23.369 1.00 10.88  ? 192  SER A H    1 
ATOM   2888 H HA   . SER A 1 192 ? 19.982  23.604  23.727 1.00 10.54  ? 192  SER A HA   1 
ATOM   2889 H HB2  . SER A 1 192 ? 21.429  23.406  25.585 1.00 11.81  ? 192  SER A HB2  1 
ATOM   2890 H HB3  . SER A 1 192 ? 21.644  24.962  25.612 1.00 11.81  ? 192  SER A HB3  1 
ATOM   2891 H HG   . SER A 1 192 ? 19.519  25.130  26.121 1.00 17.26  ? 192  SER A HG   1 
ATOM   2892 N N    . PHE A 1 193 ? 18.556  25.602  23.591 1.00 9.38   ? 193  PHE A N    1 
ATOM   2893 C CA   . PHE A 1 193 ? 17.711  26.770  23.381 1.00 9.32   ? 193  PHE A CA   1 
ATOM   2894 C C    . PHE A 1 193 ? 16.473  26.674  24.232 1.00 9.30   ? 193  PHE A C    1 
ATOM   2895 O O    . PHE A 1 193 ? 16.109  25.590  24.788 1.00 10.23  ? 193  PHE A O    1 
ATOM   2896 C CB   . PHE A 1 193 ? 17.378  26.951  21.881 1.00 9.96   ? 193  PHE A CB   1 
ATOM   2897 C CG   . PHE A 1 193 ? 16.515  25.847  21.278 1.00 9.66   ? 193  PHE A CG   1 
ATOM   2898 C CD1  . PHE A 1 193 ? 17.129  24.607  20.889 1.00 10.07  ? 193  PHE A CD1  1 
ATOM   2899 C CD2  . PHE A 1 193 ? 15.155  25.988  21.093 1.00 10.51  ? 193  PHE A CD2  1 
ATOM   2900 C CE1  . PHE A 1 193 ? 16.337  23.624  20.337 1.00 10.40  ? 193  PHE A CE1  1 
ATOM   2901 C CE2  . PHE A 1 193 ? 14.393  24.997  20.545 1.00 11.55  ? 193  PHE A CE2  1 
ATOM   2902 C CZ   . PHE A 1 193 ? 14.978  23.793  20.161 1.00 11.20  ? 193  PHE A CZ   1 
ATOM   2903 H H    . PHE A 1 193 ? 18.177  24.834  23.668 1.00 11.26  ? 193  PHE A H    1 
ATOM   2904 H HA   . PHE A 1 193 ? 18.214  27.558  23.673 1.00 11.19  ? 193  PHE A HA   1 
ATOM   2905 H HB2  . PHE A 1 193 ? 16.919  27.798  21.766 1.00 11.95  ? 193  PHE A HB2  1 
ATOM   2906 H HB3  . PHE A 1 193 ? 18.209  27.000  21.383 1.00 11.95  ? 193  PHE A HB3  1 
ATOM   2907 H HD1  . PHE A 1 193 ? 18.041  24.471  21.008 1.00 12.08  ? 193  PHE A HD1  1 
ATOM   2908 H HD2  . PHE A 1 193 ? 14.745  26.782  21.350 1.00 12.61  ? 193  PHE A HD2  1 
ATOM   2909 H HE1  . PHE A 1 193 ? 16.730  22.822  20.075 1.00 12.48  ? 193  PHE A HE1  1 
ATOM   2910 H HE2  . PHE A 1 193 ? 13.480  25.127  20.427 1.00 13.86  ? 193  PHE A HE2  1 
ATOM   2911 H HZ   . PHE A 1 193 ? 14.461  23.114  19.792 1.00 13.44  ? 193  PHE A HZ   1 
ATOM   2912 N N    . ASN A 1 194 ? 15.748  27.809  24.345 1.00 9.51   ? 194  ASN A N    1 
ATOM   2913 C CA   . ASN A 1 194 ? 14.517  27.883  25.134 1.00 10.24  ? 194  ASN A CA   1 
ATOM   2914 C C    . ASN A 1 194 ? 13.320  27.956  24.241 1.00 9.99   ? 194  ASN A C    1 
ATOM   2915 O O    . ASN A 1 194 ? 13.317  28.620  23.197 1.00 11.54  ? 194  ASN A O    1 
ATOM   2916 C CB   . ASN A 1 194 ? 14.587  29.064  26.060 1.00 13.84  ? 194  ASN A CB   1 
ATOM   2917 C CG   . ASN A 1 194 ? 15.684  28.941  27.114 1.00 15.77  ? 194  ASN A CG   1 
ATOM   2918 O OD1  . ASN A 1 194 ? 16.184  30.044  27.534 1.00 25.74  ? 194  ASN A OD1  1 
ATOM   2919 N ND2  . ASN A 1 194 ? 16.073  27.792  27.534 1.00 15.32  ? 194  ASN A ND2  1 
ATOM   2920 H H    . ASN A 1 194 ? 16.020  28.516  23.937 1.00 11.41  ? 194  ASN A H    1 
ATOM   2921 H HA   . ASN A 1 194 ? 14.449  27.069  25.676 1.00 12.29  ? 194  ASN A HA   1 
ATOM   2922 H HB2  . ASN A 1 194 ? 14.743  29.865  25.536 1.00 16.61  ? 194  ASN A HB2  1 
ATOM   2923 H HB3  . ASN A 1 194 ? 13.732  29.164  26.507 1.00 16.61  ? 194  ASN A HB3  1 
ATOM   2924 H HD21 . ASN A 1 194 ? 15.711  27.076  27.225 1.00 18.38  ? 194  ASN A HD21 1 
ATOM   2925 H HD22 . ASN A 1 194 ? 16.697  27.738  28.124 1.00 18.38  ? 194  ASN A HD22 1 
ATOM   2926 N N    . VAL A 1 195 ? 12.227  27.301  24.702 1.00 10.75  ? 195  VAL A N    1 
ATOM   2927 C CA   . VAL A 1 195 ? 10.921  27.440  24.076 1.00 12.51  ? 195  VAL A CA   1 
ATOM   2928 C C    . VAL A 1 195 ? 9.998   28.105  25.162 1.00 10.79  ? 195  VAL A C    1 
ATOM   2929 O O    . VAL A 1 195 ? 10.063  27.816  26.356 1.00 11.95  ? 195  VAL A O    1 
ATOM   2930 C CB   . VAL A 1 195 ? 10.289  26.255  23.376 1.00 13.22  ? 195  VAL A CB   1 
ATOM   2931 C CG1  . VAL A 1 195 ? 11.312  25.495  22.538 1.00 15.33  ? 195  VAL A CG1  1 
ATOM   2932 C CG2  . VAL A 1 195 ? 9.827   25.339  24.369 1.00 17.25  ? 195  VAL A CG2  1 
ATOM   2933 H H    . VAL A 1 195 ? 12.309  26.787  25.386 1.00 12.90  ? 195  VAL A H    1 
ATOM   2934 H HA   . VAL A 1 195 ? 11.037  28.122  23.381 1.00 15.02  ? 195  VAL A HA   1 
ATOM   2935 H HB   . VAL A 1 195 ? 9.543   26.551  22.814 1.00 15.86  ? 195  VAL A HB   1 
ATOM   2936 H HG11 . VAL A 1 195 ? 12.027  25.191  23.103 1.00 23.00  ? 195  VAL A HG11 1 
ATOM   2937 H HG12 . VAL A 1 195 ? 10.889  24.739  22.124 1.00 23.00  ? 195  VAL A HG12 1 
ATOM   2938 H HG13 . VAL A 1 195 ? 11.665  26.075  21.859 1.00 23.00  ? 195  VAL A HG13 1 
ATOM   2939 H HG21 . VAL A 1 195 ? 9.427   24.578  23.942 1.00 25.87  ? 195  VAL A HG21 1 
ATOM   2940 H HG22 . VAL A 1 195 ? 10.567  25.051  24.908 1.00 25.87  ? 195  VAL A HG22 1 
ATOM   2941 H HG23 . VAL A 1 195 ? 9.175   25.773  24.926 1.00 25.87  ? 195  VAL A HG23 1 
ATOM   2942 N N    . ASP A 1 196 ? 9.124   28.981  24.653 1.00 10.73  ? 196  ASP A N    1 
ATOM   2943 C CA   . ASP A 1 196 ? 8.235   29.756  25.523 1.00 10.64  ? 196  ASP A CA   1 
ATOM   2944 C C    . ASP A 1 196 ? 6.904   29.072  25.832 1.00 11.00  ? 196  ASP A C    1 
ATOM   2945 O O    . ASP A 1 196 ? 6.269   29.432  26.820 1.00 13.40  ? 196  ASP A O    1 
ATOM   2946 C CB   . ASP A 1 196 ? 7.960   31.142  24.897 1.00 11.35  ? 196  ASP A CB   1 
ATOM   2947 C CG   . ASP A 1 196 ? 9.124   32.068  25.045 1.00 12.73  ? 196  ASP A CG   1 
ATOM   2948 O OD1  . ASP A 1 196 ? 9.704   32.118  26.203 1.00 15.43  ? 196  ASP A OD1  1 
ATOM   2949 O OD2  . ASP A 1 196 ? 9.409   32.859  24.142 1.00 18.63  ? 196  ASP A OD2  1 
ATOM   2950 H H    . ASP A 1 196 ? 9.083   29.091  23.801 1.00 12.88  ? 196  ASP A H    1 
ATOM   2951 H HA   . ASP A 1 196 ? 8.701   29.900  26.373 1.00 12.77  ? 196  ASP A HA   1 
ATOM   2952 H HB2  . ASP A 1 196 ? 7.758   31.032  23.955 1.00 13.62  ? 196  ASP A HB2  1 
ATOM   2953 H HB3  . ASP A 1 196 ? 7.183   31.536  25.325 1.00 13.62  ? 196  ASP A HB3  1 
ATOM   2954 N N    . SER A 1 197 ? 6.522   28.092  25.022 1.00 10.92  ? 197  SER A N    1 
ATOM   2955 C CA   . SER A 1 197 ? 5.290   27.377  25.180 1.00 11.98  ? 197  SER A CA   1 
ATOM   2956 C C    . SER A 1 197 ? 5.295   26.195  24.188 1.00 10.95  ? 197  SER A C    1 
ATOM   2957 O O    . SER A 1 197 ? 6.106   26.162  23.257 1.00 11.31  ? 197  SER A O    1 
ATOM   2958 C CB   . SER A 1 197 ? 4.091   28.196  25.092 1.00 15.98  ? 197  SER A CB   1 
ATOM   2959 O OG   . SER A 1 197 ? 3.914   28.594  23.822 1.00 19.27  ? 197  SER A OG   1 
ATOM   2960 H H    . SER A 1 197 ? 7.039   27.876  24.370 1.00 13.10  ? 197  SER A H    1 
ATOM   2961 H HA   . SER A 1 197 ? 5.302   26.990  26.080 1.00 14.37  ? 197  SER A HA   1 
ATOM   2962 H HB2  . SER A 1 197 ? 3.321   27.685  25.386 1.00 19.18  ? 197  SER A HB2  1 
ATOM   2963 H HB3  . SER A 1 197 ? 4.179   28.971  25.669 1.00 19.18  ? 197  SER A HB3  1 
ATOM   2964 H HG   . SER A 1 197 ? 3.239   29.057  23.772 1.00 28.91  ? 197  SER A HG   1 
ATOM   2965 N N    . TYR A 1 198 ? 4.374   25.229  24.378 1.00 11.06  ? 198  TYR A N    1 
ATOM   2966 C CA   . TYR A 1 198 ? 4.177   24.154  23.434 1.00 10.98  ? 198  TYR A CA   1 
ATOM   2967 C C    . TYR A 1 198 ? 2.676   23.956  23.217 1.00 10.34  ? 198  TYR A C    1 
ATOM   2968 O O    . TYR A 1 198 ? 1.843   24.275  24.065 1.00 10.93  ? 198  TYR A O    1 
ATOM   2969 C CB   . TYR A 1 198 ? 4.846   22.861  23.863 1.00 11.48  ? 198  TYR A CB   1 
ATOM   2970 C CG   . TYR A 1 198 ? 4.139   22.191  25.031 1.00 11.14  ? 198  TYR A CG   1 
ATOM   2971 C CD1  . TYR A 1 198 ? 4.495   22.525  26.370 1.00 11.83  ? 198  TYR A CD1  1 
ATOM   2972 C CD2  . TYR A 1 198 ? 3.077   21.249  24.875 1.00 11.37  ? 198  TYR A CD2  1 
ATOM   2973 C CE1  . TYR A 1 198 ? 3.811   21.969  27.431 1.00 13.10  ? 198  TYR A CE1  1 
ATOM   2974 C CE2  . TYR A 1 198 ? 2.417   20.747  25.921 1.00 12.52  ? 198  TYR A CE2  1 
ATOM   2975 C CZ   . TYR A 1 198 ? 2.813   21.094  27.231 1.00 13.18  ? 198  TYR A CZ   1 
ATOM   2976 O OH   . TYR A 1 198 ? 2.133   20.576  28.329 1.00 16.50  ? 198  TYR A OH   1 
ATOM   2977 H H    . TYR A 1 198 ? 3.887   25.253  25.087 1.00 13.27  ? 198  TYR A H    1 
ATOM   2978 H HA   . TYR A 1 198 ? 4.571   24.427  22.579 1.00 13.17  ? 198  TYR A HA   1 
ATOM   2979 H HB2  . TYR A 1 198 ? 4.863   22.249  23.110 1.00 13.78  ? 198  TYR A HB2  1 
ATOM   2980 H HB3  . TYR A 1 198 ? 5.764   23.048  24.113 1.00 13.78  ? 198  TYR A HB3  1 
ATOM   2981 H HD1  . TYR A 1 198 ? 5.191   23.121  26.529 1.00 14.19  ? 198  TYR A HD1  1 
ATOM   2982 H HD2  . TYR A 1 198 ? 2.838   20.977  24.019 1.00 13.65  ? 198  TYR A HD2  1 
ATOM   2983 H HE1  . TYR A 1 198 ? 4.045   22.205  28.300 1.00 15.72  ? 198  TYR A HE1  1 
ATOM   2984 H HE2  . TYR A 1 198 ? 1.699   20.172  25.787 1.00 15.03  ? 198  TYR A HE2  1 
ATOM   2985 H HH   . TYR A 1 198 ? 1.551   20.059  28.072 1.00 24.75  ? 198  TYR A HH   1 
ATOM   2986 N N    . THR A 1 199 ? 2.359   23.326  22.072 1.00 10.58  ? 199  THR A N    1 
ATOM   2987 C CA   . THR A 1 199 ? 1.044   22.871  21.749 1.00 10.75  ? 199  THR A CA   1 
ATOM   2988 C C    . THR A 1 199 ? 1.102   21.411  21.343 1.00 11.21  ? 199  THR A C    1 
ATOM   2989 O O    . THR A 1 199 ? 1.720   21.084  20.314 1.00 12.92  ? 199  THR A O    1 
ATOM   2990 C CB   . THR A 1 199 ? 0.400   23.731  20.611 1.00 12.03  ? 199  THR A CB   1 
ATOM   2991 O OG1  . THR A 1 199 ? 0.238   25.034  21.144 1.00 15.37  ? 199  THR A OG1  1 
ATOM   2992 C CG2  . THR A 1 199 ? -0.997  23.193  20.253 1.00 14.67  ? 199  THR A CG2  1 
ATOM   2993 H H    . THR A 1 199 ? 2.986   23.188  21.499 1.00 12.70  ? 199  THR A H    1 
ATOM   2994 H HA   . THR A 1 199 ? 0.485   22.949  22.550 1.00 12.90  ? 199  THR A HA   1 
ATOM   2995 H HB   . THR A 1 199 ? 0.978   23.749  19.820 1.00 14.43  ? 199  THR A HB   1 
ATOM   2996 H HG1  . THR A 1 199 ? 0.971   25.340  21.346 1.00 23.06  ? 199  THR A HG1  1 
ATOM   2997 H HG21 . THR A 1 199 ? -1.377  23.729  19.553 1.00 22.00  ? 199  THR A HG21 1 
ATOM   2998 H HG22 . THR A 1 199 ? -0.923  22.283  19.955 1.00 22.00  ? 199  THR A HG22 1 
ATOM   2999 H HG23 . THR A 1 199 ? -1.563  23.231  21.028 1.00 22.00  ? 199  THR A HG23 1 
ATOM   3000 N N    . ALA A 1 200 ? 0.499   20.521  22.114 1.00 11.21  ? 200  ALA A N    1 
ATOM   3001 C CA   . ALA A 1 200 ? 0.434   19.080  21.813 1.00 11.06  ? 200  ALA A CA   1 
ATOM   3002 C C    . ALA A 1 200 ? -1.034  18.813  21.389 1.00 11.05  ? 200  ALA A C    1 
ATOM   3003 O O    . ALA A 1 200 ? -1.899  18.633  22.259 1.00 11.08  ? 200  ALA A O    1 
ATOM   3004 C CB   . ALA A 1 200 ? 0.790   18.289  23.070 1.00 12.56  ? 200  ALA A CB   1 
ATOM   3005 H H    . ALA A 1 200 ? 0.122   20.800  22.835 1.00 13.46  ? 200  ALA A H    1 
ATOM   3006 H HA   . ALA A 1 200 ? 1.048   18.855  21.082 1.00 13.28  ? 200  ALA A HA   1 
ATOM   3007 H HB1  . ALA A 1 200 ? 1.701   18.469  23.314 1.00 18.84  ? 200  ALA A HB1  1 
ATOM   3008 H HB2  . ALA A 1 200 ? 0.208   18.550  23.787 1.00 18.84  ? 200  ALA A HB2  1 
ATOM   3009 H HB3  . ALA A 1 200 ? 0.685   17.350  22.898 1.00 18.84  ? 200  ALA A HB3  1 
ATOM   3010 N N    . GLY A 1 201 ? -1.300  18.870  20.113 1.00 11.66  ? 201  GLY A N    1 
ATOM   3011 C CA   . GLY A 1 201 ? -2.657  18.693  19.649 1.00 11.31  ? 201  GLY A CA   1 
ATOM   3012 C C    . GLY A 1 201 ? -3.604  19.751  20.164 1.00 10.74  ? 201  GLY A C    1 
ATOM   3013 O O    . GLY A 1 201 ? -3.447  20.980  19.902 1.00 11.73  ? 201  GLY A O    1 
ATOM   3014 H H    . GLY A 1 201 ? -0.668  19.013  19.548 1.00 13.99  ? 201  GLY A H    1 
ATOM   3015 H HA2  . GLY A 1 201 ? -2.663  18.711  18.679 1.00 13.57  ? 201  GLY A HA2  1 
ATOM   3016 H HA3  . GLY A 1 201 ? -2.975  17.821  19.930 1.00 13.57  ? 201  GLY A HA3  1 
ATOM   3017 N N    . SER A 1 202 ? -4.605  19.309  20.885 1.00 10.64  ? 202  SER A N    1 
ATOM   3018 C CA   . SER A 1 202 ? -5.640  20.160  21.480 1.00 11.59  ? 202  SER A CA   1 
ATOM   3019 C C    . SER A 1 202 ? -5.312  20.735  22.836 1.00 11.55  ? 202  SER A C    1 
ATOM   3020 O O    . SER A 1 202 ? -6.220  21.332  23.437 1.00 13.98  ? 202  SER A O    1 
ATOM   3021 C CB   A SER A 1 202 ? -6.894  19.363  21.615 0.56 12.70  ? 202  SER A CB   1 
ATOM   3022 C CB   B SER A 1 202 ? -7.044  19.338  21.460 0.44 13.41  ? 202  SER A CB   1 
ATOM   3023 O OG   A SER A 1 202 ? -6.750  18.242  22.535 0.56 14.05  ? 202  SER A OG   1 
ATOM   3024 O OG   B SER A 1 202 ? -7.304  18.864  20.186 0.44 13.31  ? 202  SER A OG   1 
ATOM   3025 H H    . SER A 1 202 ? -4.659  18.461  21.018 1.00 12.77  ? 202  SER A H    1 
ATOM   3026 H HA   A SER A 1 202 ? -5.814  20.904  20.866 1.00 13.91  ? 202  SER A HA   1 
ATOM   3027 H HB2  A SER A 1 202 ? -7.605  19.943  21.931 0.56 15.25  ? 202  SER A HB2  1 
ATOM   3028 H HB2  B SER A 1 202 ? -6.994  18.593  22.080 0.44 16.10  ? 202  SER A HB2  1 
ATOM   3029 H HB3  A SER A 1 202 ? -7.151  19.027  20.743 0.56 15.25  ? 202  SER A HB3  1 
ATOM   3030 H HB3  B SER A 1 202 ? -7.766  19.920  21.745 0.44 16.10  ? 202  SER A HB3  1 
ATOM   3031 H HG   A SER A 1 202 ? -6.145  17.753  22.276 0.56 21.07  ? 202  SER A HG   1 
ATOM   3032 H HG   B SER A 1 202 ? -7.352  19.495  19.664 0.44 19.96  ? 202  SER A HG   1 
ATOM   3033 N N    . GLN A 1 203 ? -4.093  20.504  23.351 1.00 11.57  ? 203  GLN A N    1 
ATOM   3034 C CA   . GLN A 1 203 ? -3.637  20.954  24.686 1.00 13.03  ? 203  GLN A CA   1 
ATOM   3035 C C    . GLN A 1 203 ? -2.374  21.744  24.537 1.00 12.93  ? 203  GLN A C    1 
ATOM   3036 O O    . GLN A 1 203 ? -1.502  21.422  23.749 1.00 20.70  ? 203  GLN A O    1 
ATOM   3037 C CB   . GLN A 1 203 ? -3.386  19.692  25.566 1.00 14.76  ? 203  GLN A CB   1 
ATOM   3038 C CG   A GLN A 1 203 ? -4.664  18.840  25.831 0.51 17.68  ? 203  GLN A CG   1 
ATOM   3039 C CG   B GLN A 1 203 ? -4.664  19.019  25.735 0.49 19.51  ? 203  GLN A CG   1 
ATOM   3040 C CD   A GLN A 1 203 ? -5.678  19.449  26.495 0.51 19.72  ? 203  GLN A CD   1 
ATOM   3041 C CD   B GLN A 1 203 ? -4.834  17.822  26.779 0.49 30.50  ? 203  GLN A CD   1 
ATOM   3042 O OE1  A GLN A 1 203 ? -6.859  19.074  26.185 0.51 33.04  ? 203  GLN A OE1  1 
ATOM   3043 O OE1  B GLN A 1 203 ? -4.876  16.733  26.559 0.49 39.40  ? 203  GLN A OE1  1 
ATOM   3044 N NE2  A GLN A 1 203 ? -5.401  20.245  27.606 0.51 22.86  ? 203  GLN A NE2  1 
ATOM   3045 N NE2  B GLN A 1 203 ? -4.366  18.387  28.031 0.49 37.62  ? 203  GLN A NE2  1 
ATOM   3046 H H    . GLN A 1 203 ? -3.535  20.062  22.868 1.00 13.89  ? 203  GLN A H    1 
ATOM   3047 H HA   . GLN A 1 203 ? -4.328  21.513  25.100 1.00 15.63  ? 203  GLN A HA   1 
ATOM   3048 H HB2  . GLN A 1 203 ? -2.724  19.134  25.130 1.00 17.71  ? 203  GLN A HB2  1 
ATOM   3049 H HB3  . GLN A 1 203 ? -3.018  19.974  26.418 1.00 17.71  ? 203  GLN A HB3  1 
ATOM   3050 H HG2  A GLN A 1 203 ? -5.005  18.534  24.976 0.51 21.22  ? 203  GLN A HG2  1 
ATOM   3051 H HG2  B GLN A 1 203 ? -5.314  19.698  25.973 0.49 23.41  ? 203  GLN A HG2  1 
ATOM   3052 H HG3  A GLN A 1 203 ? -4.403  18.053  26.335 0.51 21.22  ? 203  GLN A HG3  1 
ATOM   3053 H HG3  B GLN A 1 203 ? -4.922  18.676  24.865 0.49 23.41  ? 203  GLN A HG3  1 
ATOM   3054 H HE21 A GLN A 1 203 ? -4.591  20.475  27.779 0.51 27.43  ? 203  GLN A HE21 1 
ATOM   3055 H HE21 B GLN A 1 203 ? -4.357  19.240  28.141 0.49 45.14  ? 203  GLN A HE21 1 
ATOM   3056 H HE22 A GLN A 1 203 ? -6.041  20.506  28.118 0.51 27.43  ? 203  GLN A HE22 1 
ATOM   3057 H HE22 B GLN A 1 203 ? -4.097  17.869  28.663 0.49 45.14  ? 203  GLN A HE22 1 
ATOM   3058 N N    . SER A 1 204 ? -2.179  22.766  25.351 1.00 13.82  ? 204  SER A N    1 
ATOM   3059 C CA   . SER A 1 204 ? -0.975  23.558  25.373 1.00 13.08  ? 204  SER A CA   1 
ATOM   3060 C C    . SER A 1 204 ? -0.394  23.662  26.771 1.00 13.75  ? 204  SER A C    1 
ATOM   3061 O O    . SER A 1 204 ? -1.099  23.440  27.738 1.00 18.92  ? 204  SER A O    1 
ATOM   3062 C CB   . SER A 1 204 ? -1.217  24.959  24.779 1.00 14.24  ? 204  SER A CB   1 
ATOM   3063 O OG   . SER A 1 204 ? -1.688  24.921  23.415 1.00 15.84  ? 204  SER A OG   1 
ATOM   3064 H H    . SER A 1 204 ? -2.808  22.971  25.901 1.00 16.58  ? 204  SER A H    1 
ATOM   3065 H HA   . SER A 1 204 ? -0.313  23.107  24.809 1.00 15.70  ? 204  SER A HA   1 
ATOM   3066 H HB2  . SER A 1 204 ? -1.869  25.425  25.325 1.00 17.09  ? 204  SER A HB2  1 
ATOM   3067 H HB3  . SER A 1 204 ? -0.389  25.464  24.812 1.00 17.09  ? 204  SER A HB3  1 
ATOM   3068 H HG   . SER A 1 204 ? -1.807  25.687  23.145 1.00 23.76  ? 204  SER A HG   1 
ATOM   3069 N N    . GLY A 1 205 ? 0.858   24.083  26.876 1.00 12.42  ? 205  GLY A N    1 
ATOM   3070 C CA   . GLY A 1 205 ? 1.473   24.266  28.201 1.00 12.68  ? 205  GLY A CA   1 
ATOM   3071 C C    . GLY A 1 205 ? 2.712   25.104  28.167 1.00 12.68  ? 205  GLY A C    1 
ATOM   3072 O O    . GLY A 1 205 ? 3.076   25.664  27.145 1.00 12.97  ? 205  GLY A O    1 
ATOM   3073 H H    . GLY A 1 205 ? 1.314   24.251  26.167 1.00 14.90  ? 205  GLY A H    1 
ATOM   3074 H HA2  . GLY A 1 205 ? 0.828   24.682  28.793 1.00 15.22  ? 205  GLY A HA2  1 
ATOM   3075 H HA3  . GLY A 1 205 ? 1.692   23.395  28.569 1.00 15.22  ? 205  GLY A HA3  1 
ATOM   3076 N N    . ASP A 1 206 ? 3.341   25.205  29.325 1.00 14.37  ? 206  ASP A N    1 
ATOM   3077 C CA   . ASP A 1 206 ? 4.446   26.100  29.571 1.00 15.11  ? 206  ASP A CA   1 
ATOM   3078 C C    . ASP A 1 206 ? 5.725   25.610  28.887 1.00 12.69  ? 206  ASP A C    1 
ATOM   3079 O O    . ASP A 1 206 ? 5.922   24.417  28.569 1.00 13.62  ? 206  ASP A O    1 
ATOM   3080 C CB   . ASP A 1 206 ? 4.685   26.238  31.085 1.00 23.16  ? 206  ASP A CB   1 
ATOM   3081 C CG   . ASP A 1 206 ? 3.490   26.655  31.957 1.00 31.52  ? 206  ASP A CG   1 
ATOM   3082 O OD1  . ASP A 1 206 ? 2.810   27.672  31.145 1.00 49.20  ? 206  ASP A OD1  1 
ATOM   3083 O OD2  . ASP A 1 206 ? 3.502   26.298  33.197 1.00 49.82  ? 206  ASP A OD2  1 
ATOM   3084 H H    . ASP A 1 206 ? 3.075   24.706  29.973 1.00 17.25  ? 206  ASP A H    1 
ATOM   3085 H HA   . ASP A 1 206 ? 4.218   26.983  29.210 1.00 18.13  ? 206  ASP A HA   1 
ATOM   3086 H HB2  . ASP A 1 206 ? 5.012   25.386  31.415 1.00 27.80  ? 206  ASP A HB2  1 
ATOM   3087 H HB3  . ASP A 1 206 ? 5.393   26.888  31.218 1.00 27.80  ? 206  ASP A HB3  1 
ATOM   3088 N N    . GLY A 1 207 ? 6.628   26.543  28.698 1.00 12.87  ? 207  GLY A N    1 
ATOM   3089 C CA   . GLY A 1 207 ? 7.907   26.336  28.036 1.00 13.70  ? 207  GLY A CA   1 
ATOM   3090 C C    . GLY A 1 207 ? 8.918   25.568  28.946 1.00 11.81  ? 207  GLY A C    1 
ATOM   3091 O O    . GLY A 1 207 ? 8.659   25.146  30.062 1.00 12.15  ? 207  GLY A O    1 
ATOM   3092 H H    . GLY A 1 207 ? 6.452   27.333  28.987 1.00 15.45  ? 207  GLY A H    1 
ATOM   3093 H HA2  . GLY A 1 207 ? 7.766   25.831  27.219 1.00 16.44  ? 207  GLY A HA2  1 
ATOM   3094 H HA3  . GLY A 1 207 ? 8.284   27.196  27.794 1.00 16.44  ? 207  GLY A HA3  1 
ATOM   3095 N N    . PHE A 1 208 ? 10.096  25.408  28.314 1.00 11.30  ? 208  PHE A N    1 
ATOM   3096 C CA   . PHE A 1 208 ? 11.144  24.520  28.804 1.00 10.48  ? 208  PHE A CA   1 
ATOM   3097 C C    . PHE A 1 208 ? 12.379  24.760  27.914 1.00 10.35  ? 208  PHE A C    1 
ATOM   3098 O O    . PHE A 1 208 ? 12.340  25.525  26.969 1.00 12.54  ? 208  PHE A O    1 
ATOM   3099 C CB   . PHE A 1 208 ? 10.686  23.054  28.805 1.00 10.81  ? 208  PHE A CB   1 
ATOM   3100 C CG   . PHE A 1 208 ? 10.127  22.535  27.453 1.00 10.31  ? 208  PHE A CG   1 
ATOM   3101 C CD1  . PHE A 1 208 ? 10.952  21.978  26.481 1.00 10.57  ? 208  PHE A CD1  1 
ATOM   3102 C CD2  . PHE A 1 208 ? 8.782   22.567  27.183 1.00 11.73  ? 208  PHE A CD2  1 
ATOM   3103 C CE1  . PHE A 1 208 ? 10.446  21.502  25.295 1.00 11.02  ? 208  PHE A CE1  1 
ATOM   3104 C CE2  . PHE A 1 208 ? 8.253   22.089  26.014 1.00 12.58  ? 208  PHE A CE2  1 
ATOM   3105 C CZ   . PHE A 1 208 ? 9.103   21.551  25.042 1.00 11.31  ? 208  PHE A CZ   1 
ATOM   3106 H H    . PHE A 1 208 ? 10.237  25.848  27.589 1.00 13.56  ? 208  PHE A H    1 
ATOM   3107 H HA   . PHE A 1 208 ? 11.367  24.777  29.723 1.00 12.58  ? 208  PHE A HA   1 
ATOM   3108 H HB2  . PHE A 1 208 ? 11.437  22.497  29.060 1.00 12.97  ? 208  PHE A HB2  1 
ATOM   3109 H HB3  . PHE A 1 208 ? 10.000  22.947  29.482 1.00 12.97  ? 208  PHE A HB3  1 
ATOM   3110 H HD1  . PHE A 1 208 ? 11.867  21.926  26.637 1.00 12.69  ? 208  PHE A HD1  1 
ATOM   3111 H HD2  . PHE A 1 208 ? 8.207   22.928  27.819 1.00 14.08  ? 208  PHE A HD2  1 
ATOM   3112 H HE1  . PHE A 1 208 ? 11.021  21.142  24.659 1.00 13.22  ? 208  PHE A HE1  1 
ATOM   3113 H HE2  . PHE A 1 208 ? 7.335   22.121  25.867 1.00 15.10  ? 208  PHE A HE2  1 
ATOM   3114 H HZ   . PHE A 1 208 ? 8.761   21.233  24.238 1.00 13.57  ? 208  PHE A HZ   1 
ATOM   3115 N N    . SER A 1 209 ? 13.475  24.080  28.197 1.00 9.96   ? 209  SER A N    1 
ATOM   3116 C CA   . SER A 1 209 ? 14.682  24.128  27.342 1.00 10.00  ? 209  SER A CA   1 
ATOM   3117 C C    . SER A 1 209 ? 14.881  22.770  26.668 1.00 8.94   ? 209  SER A C    1 
ATOM   3118 O O    . SER A 1 209 ? 14.392  21.724  27.123 1.00 9.07   ? 209  SER A O    1 
ATOM   3119 C CB   . SER A 1 209 ? 15.894  24.448  28.160 1.00 11.12  ? 209  SER A CB   1 
ATOM   3120 O OG   . SER A 1 209 ? 16.315  23.427  29.017 1.00 13.24  ? 209  SER A OG   1 
ATOM   3121 H H    . SER A 1 209 ? 13.488  23.591  28.904 1.00 11.95  ? 209  SER A H    1 
ATOM   3122 H HA   . SER A 1 209 ? 14.565  24.816  26.654 1.00 12.00  ? 209  SER A HA   1 
ATOM   3123 H HB2  . SER A 1 209 ? 16.624  24.666  27.559 1.00 13.35  ? 209  SER A HB2  1 
ATOM   3124 H HB3  . SER A 1 209 ? 15.708  25.239  28.691 1.00 13.35  ? 209  SER A HB3  1 
ATOM   3125 H HG   . SER A 1 209 ? 15.715  23.250  29.547 1.00 19.86  ? 209  SER A HG   1 
ATOM   3126 N N    . GLY A 1 210 ? 15.668  22.791  25.588 1.00 9.35   ? 210  GLY A N    1 
ATOM   3127 C CA   . GLY A 1 210 ? 16.080  21.506  25.013 1.00 9.71   ? 210  GLY A CA   1 
ATOM   3128 C C    . GLY A 1 210 ? 17.236  21.741  24.061 1.00 8.64   ? 210  GLY A C    1 
ATOM   3129 O O    . GLY A 1 210 ? 17.728  22.849  23.861 1.00 9.91   ? 210  GLY A O    1 
ATOM   3130 H H    . GLY A 1 210 ? 15.925  23.535  25.241 1.00 11.22  ? 210  GLY A H    1 
ATOM   3131 H HA2  . GLY A 1 210 ? 16.353  20.900  25.719 1.00 11.65  ? 210  GLY A HA2  1 
ATOM   3132 H HA3  . GLY A 1 210 ? 15.337  21.104  24.536 1.00 11.65  ? 210  GLY A HA3  1 
ATOM   3133 N N    . ILE A 1 211 ? 17.727  20.604  23.507 1.00 8.52   ? 211  ILE A N    1 
ATOM   3134 C CA   . ILE A 1 211 ? 18.931  20.626  22.680 1.00 8.63   ? 211  ILE A CA   1 
ATOM   3135 C C    . ILE A 1 211 ? 18.605  20.141  21.276 1.00 8.40   ? 211  ILE A C    1 
ATOM   3136 O O    . ILE A 1 211 ? 17.832  19.191  21.045 1.00 9.27   ? 211  ILE A O    1 
ATOM   3137 C CB   . ILE A 1 211 ? 20.094  19.784  23.311 1.00 8.96   ? 211  ILE A CB   1 
ATOM   3138 C CG1  . ILE A 1 211 ? 19.810  18.299  23.397 1.00 9.29   ? 211  ILE A CG1  1 
ATOM   3139 C CG2  . ILE A 1 211 ? 20.439  20.376  24.698 1.00 9.59   ? 211  ILE A CG2  1 
ATOM   3140 C CD1  . ILE A 1 211 ? 21.030  17.453  23.698 1.00 10.32  ? 211  ILE A CD1  1 
ATOM   3141 H H    . ILE A 1 211 ? 17.323  19.858  23.645 1.00 10.22  ? 211  ILE A H    1 
ATOM   3142 H HA   . ILE A 1 211 ? 19.234  21.556  22.614 1.00 10.35  ? 211  ILE A HA   1 
ATOM   3143 H HB   . ILE A 1 211 ? 20.881  19.898  22.740 1.00 10.75  ? 211  ILE A HB   1 
ATOM   3144 H HG12 . ILE A 1 211 ? 19.148  18.148  24.090 1.00 11.15  ? 211  ILE A HG12 1 
ATOM   3145 H HG13 . ILE A 1 211 ? 19.426  18.006  22.556 1.00 11.15  ? 211  ILE A HG13 1 
ATOM   3146 H HG21 . ILE A 1 211 ? 20.611  21.316  24.611 1.00 14.38  ? 211  ILE A HG21 1 
ATOM   3147 H HG22 . ILE A 1 211 ? 19.701  20.240  25.297 1.00 14.38  ? 211  ILE A HG22 1 
ATOM   3148 H HG23 . ILE A 1 211 ? 21.219  19.939  25.047 1.00 14.38  ? 211  ILE A HG23 1 
ATOM   3149 H HD11 . ILE A 1 211 ? 20.776  16.528  23.736 1.00 15.48  ? 211  ILE A HD11 1 
ATOM   3150 H HD12 . ILE A 1 211 ? 21.684  17.577  23.006 1.00 15.48  ? 211  ILE A HD12 1 
ATOM   3151 H HD13 . ILE A 1 211 ? 21.403  17.718  24.542 1.00 15.48  ? 211  ILE A HD13 1 
ATOM   3152 N N    . ALA A 1 212 ? 19.224  20.810  20.271 1.00 8.43   ? 212  ALA A N    1 
ATOM   3153 C CA   . ALA A 1 212 ? 19.089  20.377  18.871 1.00 8.61   ? 212  ALA A CA   1 
ATOM   3154 C C    . ALA A 1 212 ? 20.120  19.253  18.634 1.00 8.65   ? 212  ALA A C    1 
ATOM   3155 O O    . ALA A 1 212 ? 21.336  19.499  18.710 1.00 9.42   ? 212  ALA A O    1 
ATOM   3156 C CB   . ALA A 1 212 ? 19.346  21.567  17.952 1.00 9.68   ? 212  ALA A CB   1 
ATOM   3157 H H    . ALA A 1 212 ? 19.704  21.500  20.456 1.00 10.11  ? 212  ALA A H    1 
ATOM   3158 H HA   . ALA A 1 212 ? 18.184  20.033  18.718 1.00 10.33  ? 212  ALA A HA   1 
ATOM   3159 H HB1  . ALA A 1 212 ? 18.693  22.250  18.121 1.00 14.52  ? 212  ALA A HB1  1 
ATOM   3160 H HB2  . ALA A 1 212 ? 20.225  21.917  18.119 1.00 14.52  ? 212  ALA A HB2  1 
ATOM   3161 H HB3  . ALA A 1 212 ? 19.283  21.285  17.037 1.00 14.52  ? 212  ALA A HB3  1 
ATOM   3162 N N    . ASP A 1 213 ? 19.619  18.021  18.422 1.00 8.74   ? 213  ASP A N    1 
ATOM   3163 C CA   . ASP A 1 213 ? 20.466  16.792  18.545 1.00 8.29   ? 213  ASP A CA   1 
ATOM   3164 C C    . ASP A 1 213 ? 20.188  15.835  17.380 1.00 8.37   ? 213  ASP A C    1 
ATOM   3165 O O    . ASP A 1 213 ? 19.305  14.966  17.443 1.00 8.84   ? 213  ASP A O    1 
ATOM   3166 C CB   . ASP A 1 213 ? 20.152  16.144  19.881 1.00 9.22   ? 213  ASP A CB   1 
ATOM   3167 C CG   . ASP A 1 213 ? 20.866  14.862  20.186 1.00 9.26   ? 213  ASP A CG   1 
ATOM   3168 O OD1  . ASP A 1 213 ? 21.879  14.573  19.439 1.00 9.56   ? 213  ASP A OD1  1 
ATOM   3169 O OD2  . ASP A 1 213 ? 20.440  14.137  21.110 1.00 10.48  ? 213  ASP A OD2  1 
ATOM   3170 H H    . ASP A 1 213 ? 18.790  17.938  18.211 1.00 10.49  ? 213  ASP A H    1 
ATOM   3171 H HA   . ASP A 1 213 ? 21.411  17.051  18.528 1.00 9.95   ? 213  ASP A HA   1 
ATOM   3172 H HB2  . ASP A 1 213 ? 20.362  16.781  20.583 1.00 11.06  ? 213  ASP A HB2  1 
ATOM   3173 H HB3  . ASP A 1 213 ? 19.198  15.975  19.920 1.00 11.06  ? 213  ASP A HB3  1 
ATOM   3174 N N    . THR A 1 214 ? 21.001  15.964  16.308 1.00 8.39   ? 214  THR A N    1 
ATOM   3175 C CA   . THR A 1 214 ? 20.830  15.109  15.125 1.00 8.46   ? 214  THR A CA   1 
ATOM   3176 C C    . THR A 1 214 ? 21.096  13.634  15.445 1.00 8.37   ? 214  THR A C    1 
ATOM   3177 O O    . THR A 1 214 ? 20.651  12.771  14.656 1.00 9.19   ? 214  THR A O    1 
ATOM   3178 C CB   . THR A 1 214 ? 21.736  15.567  13.967 1.00 8.83   ? 214  THR A CB   1 
ATOM   3179 O OG1  . THR A 1 214 ? 23.094  15.538  14.433 1.00 8.80   ? 214  THR A OG1  1 
ATOM   3180 C CG2  . THR A 1 214 ? 21.395  16.961  13.477 1.00 9.44   ? 214  THR A CG2  1 
ATOM   3181 H H    . THR A 1 214 ? 21.627  16.554  16.319 1.00 10.07  ? 214  THR A H    1 
ATOM   3182 H HA   . THR A 1 214 ? 19.900  15.189  14.828 1.00 10.15  ? 214  THR A HA   1 
ATOM   3183 H HB   . THR A 1 214 ? 21.642  14.937  13.223 1.00 10.60  ? 214  THR A HB   1 
ATOM   3184 H HG1  . THR A 1 214 ? 23.277  14.783  14.697 1.00 13.20  ? 214  THR A HG1  1 
ATOM   3185 H HG21 . THR A 1 214 ? 21.984  17.199  12.757 1.00 14.16  ? 214  THR A HG21 1 
ATOM   3186 H HG22 . THR A 1 214 ? 20.487  16.977  13.166 1.00 14.16  ? 214  THR A HG22 1 
ATOM   3187 H HG23 . THR A 1 214 ? 21.499  17.587  14.196 1.00 14.16  ? 214  THR A HG23 1 
ATOM   3188 N N    . GLY A 1 215 ? 21.825  13.315  16.516 1.00 8.51   ? 215  GLY A N    1 
ATOM   3189 C CA   . GLY A 1 215 ? 22.152  11.958  16.884 1.00 8.77   ? 215  GLY A CA   1 
ATOM   3190 C C    . GLY A 1 215 ? 21.127  11.200  17.681 1.00 8.30   ? 215  GLY A C    1 
ATOM   3191 O O    . GLY A 1 215 ? 21.386  10.039  18.061 1.00 9.03   ? 215  GLY A O    1 
ATOM   3192 H H    . GLY A 1 215 ? 22.115  13.953  17.015 1.00 10.21  ? 215  GLY A H    1 
ATOM   3193 H HA2  . GLY A 1 215 ? 22.328  11.461  16.070 1.00 10.53  ? 215  GLY A HA2  1 
ATOM   3194 H HA3  . GLY A 1 215 ? 22.976  11.976  17.395 1.00 10.53  ? 215  GLY A HA3  1 
ATOM   3195 N N    . THR A 1 216 ? 19.954  11.819  17.970 1.00 8.30   ? 216  THR A N    1 
ATOM   3196 C CA   . THR A 1 216 ? 18.845  11.123  18.617 1.00 8.25   ? 216  THR A CA   1 
ATOM   3197 C C    . THR A 1 216 ? 17.709  10.976  17.597 1.00 8.14   ? 216  THR A C    1 
ATOM   3198 O O    . THR A 1 216 ? 17.314  11.940  16.942 1.00 8.46   ? 216  THR A O    1 
ATOM   3199 C CB   . THR A 1 216 ? 18.393  11.839  19.917 1.00 8.55   ? 216  THR A CB   1 
ATOM   3200 O OG1  . THR A 1 216 ? 19.450  11.653  20.885 1.00 9.41   ? 216  THR A OG1  1 
ATOM   3201 C CG2  . THR A 1 216 ? 17.084  11.336  20.459 1.00 9.69   ? 216  THR A CG2  1 
ATOM   3202 H H    . THR A 1 216 ? 19.860  12.649  17.765 1.00 9.96   ? 216  THR A H    1 
ATOM   3203 H HA   . THR A 1 216 ? 19.152  10.225  18.859 1.00 9.90   ? 216  THR A HA   1 
ATOM   3204 H HB   . THR A 1 216 ? 18.306  12.798  19.731 1.00 10.26  ? 216  THR A HB   1 
ATOM   3205 H HG1  . THR A 1 216 ? 19.143  11.304  21.561 1.00 14.11  ? 216  THR A HG1  1 
ATOM   3206 H HG21 . THR A 1 216 ? 16.863  11.818  21.260 1.00 14.53  ? 216  THR A HG21 1 
ATOM   3207 H HG22 . THR A 1 216 ? 16.394  11.469  19.805 1.00 14.53  ? 216  THR A HG22 1 
ATOM   3208 H HG23 . THR A 1 216 ? 17.159  10.400  20.660 1.00 14.53  ? 216  THR A HG23 1 
ATOM   3209 N N    . THR A 1 217 ? 17.163  9.754   17.499 1.00 8.07   ? 217  THR A N    1 
ATOM   3210 C CA   . THR A 1 217 ? 16.143  9.438   16.484 1.00 8.28   ? 217  THR A CA   1 
ATOM   3211 C C    . THR A 1 217 ? 14.837  10.226  16.732 1.00 8.30   ? 217  THR A C    1 
ATOM   3212 O O    . THR A 1 217 ? 14.212  10.713  15.761 1.00 8.64   ? 217  THR A O    1 
ATOM   3213 C CB   . THR A 1 217 ? 15.859  7.924   16.536 1.00 8.80   ? 217  THR A CB   1 
ATOM   3214 O OG1  . THR A 1 217 ? 17.071  7.202   16.399 1.00 9.06   ? 217  THR A OG1  1 
ATOM   3215 C CG2  . THR A 1 217 ? 14.852  7.521   15.472 1.00 10.04  ? 217  THR A CG2  1 
ATOM   3216 H H    . THR A 1 217 ? 17.416  9.139   18.045 1.00 9.69   ? 217  THR A H    1 
ATOM   3217 H HA   . THR A 1 217 ? 16.492  9.668   15.597 1.00 9.93   ? 217  THR A HA   1 
ATOM   3218 H HB   . THR A 1 217 ? 15.477  7.715   17.414 1.00 10.56  ? 217  THR A HB   1 
ATOM   3219 H HG1  . THR A 1 217 ? 17.596  7.437   16.983 1.00 13.59  ? 217  THR A HG1  1 
ATOM   3220 H HG21 . THR A 1 217 ? 14.691  6.576   15.525 1.00 15.06  ? 217  THR A HG21 1 
ATOM   3221 H HG22 . THR A 1 217 ? 14.029  7.994   15.614 1.00 15.06  ? 217  THR A HG22 1 
ATOM   3222 H HG23 . THR A 1 217 ? 15.199  7.737   14.604 1.00 15.06  ? 217  THR A HG23 1 
ATOM   3223 N N    . LEU A 1 218 ? 14.403  10.254  17.984 1.00 8.33   ? 218  LEU A N    1 
ATOM   3224 C CA   . LEU A 1 218 ? 13.052  10.688  18.351 1.00 8.49   ? 218  LEU A CA   1 
ATOM   3225 C C    . LEU A 1 218 ? 13.064  12.099  18.979 1.00 8.59   ? 218  LEU A C    1 
ATOM   3226 O O    . LEU A 1 218 ? 14.092  12.703  19.239 1.00 9.50   ? 218  LEU A O    1 
ATOM   3227 C CB   . LEU A 1 218 ? 12.420  9.635   19.292 1.00 9.77   ? 218  LEU A CB   1 
ATOM   3228 C CG   . LEU A 1 218 ? 12.349  8.200   18.737 1.00 10.14  ? 218  LEU A CG   1 
ATOM   3229 C CD1  . LEU A 1 218 ? 11.716  7.283   19.787 1.00 13.69  ? 218  LEU A CD1  1 
ATOM   3230 C CD2  . LEU A 1 218 ? 11.586  8.124   17.388 1.00 11.75  ? 218  LEU A CD2  1 
ATOM   3231 H H    . LEU A 1 218 ? 14.938  10.007  18.610 1.00 9.99   ? 218  LEU A H    1 
ATOM   3232 H HA   . LEU A 1 218 ? 12.513  10.726  17.533 1.00 10.19  ? 218  LEU A HA   1 
ATOM   3233 H HB2  . LEU A 1 218 ? 12.929  9.619   20.118 1.00 11.72  ? 218  LEU A HB2  1 
ATOM   3234 H HB3  . LEU A 1 218 ? 11.519  9.922   19.512 1.00 11.72  ? 218  LEU A HB3  1 
ATOM   3235 H HG   . LEU A 1 218 ? 13.266  7.891   18.582 1.00 12.16  ? 218  LEU A HG   1 
ATOM   3236 H HD11 . LEU A 1 218 ? 10.831  7.594   19.992 1.00 20.53  ? 218  LEU A HD11 1 
ATOM   3237 H HD12 . LEU A 1 218 ? 11.669  6.388   19.444 1.00 20.53  ? 218  LEU A HD12 1 
ATOM   3238 H HD13 . LEU A 1 218 ? 12.250  7.293   20.584 1.00 20.53  ? 218  LEU A HD13 1 
ATOM   3239 H HD21 . LEU A 1 218 ? 10.674  8.394   17.520 1.00 17.63  ? 218  LEU A HD21 1 
ATOM   3240 H HD22 . LEU A 1 218 ? 12.004  8.708   16.751 1.00 17.63  ? 218  LEU A HD22 1 
ATOM   3241 H HD23 . LEU A 1 218 ? 11.608  7.222   17.058 1.00 17.63  ? 218  LEU A HD23 1 
ATOM   3242 N N    . LEU A 1 219 ? 11.833  12.611  19.195 1.00 8.40   ? 219  LEU A N    1 
ATOM   3243 C CA   . LEU A 1 219 ? 11.564  13.850  19.912 1.00 8.48   ? 219  LEU A CA   1 
ATOM   3244 C C    . LEU A 1 219 ? 11.248  13.464  21.391 1.00 8.59   ? 219  LEU A C    1 
ATOM   3245 O O    . LEU A 1 219 ? 10.191  12.839  21.619 1.00 9.16   ? 219  LEU A O    1 
ATOM   3246 C CB   . LEU A 1 219 ? 10.433  14.609  19.244 1.00 8.68   ? 219  LEU A CB   1 
ATOM   3247 C CG   . LEU A 1 219 ? 9.926   15.869  19.970 1.00 9.07   ? 219  LEU A CG   1 
ATOM   3248 C CD1  . LEU A 1 219 ? 11.052  16.874  20.244 1.00 9.43   ? 219  LEU A CD1  1 
ATOM   3249 C CD2  . LEU A 1 219 ? 8.818   16.525  19.109 1.00 10.03  ? 219  LEU A CD2  1 
ATOM   3250 H H    . LEU A 1 219 ? 11.160  12.174  18.886 1.00 10.08  ? 219  LEU A H    1 
ATOM   3251 H HA   . LEU A 1 219 ? 12.371  14.406  19.896 1.00 10.17  ? 219  LEU A HA   1 
ATOM   3252 H HB2  . LEU A 1 219 ? 10.726  14.868  18.356 1.00 10.42  ? 219  LEU A HB2  1 
ATOM   3253 H HB3  . LEU A 1 219 ? 9.685   14.001  19.134 1.00 10.42  ? 219  LEU A HB3  1 
ATOM   3254 H HG   . LEU A 1 219 ? 9.535   15.599  20.827 1.00 10.88  ? 219  LEU A HG   1 
ATOM   3255 H HD11 . LEU A 1 219 ? 11.448  17.145  19.413 1.00 14.15  ? 219  LEU A HD11 1 
ATOM   3256 H HD12 . LEU A 1 219 ? 10.692  17.643  20.692 1.00 14.15  ? 219  LEU A HD12 1 
ATOM   3257 H HD13 . LEU A 1 219 ? 11.719  16.463  20.798 1.00 14.15  ? 219  LEU A HD13 1 
ATOM   3258 H HD21 . LEU A 1 219 ? 9.191   16.816  18.274 1.00 15.04  ? 219  LEU A HD21 1 
ATOM   3259 H HD22 . LEU A 1 219 ? 8.121   15.886  18.943 1.00 15.04  ? 219  LEU A HD22 1 
ATOM   3260 H HD23 . LEU A 1 219 ? 8.454   17.280  19.577 1.00 15.04  ? 219  LEU A HD23 1 
ATOM   3261 N N    . LEU A 1 220 ? 12.177  13.760  22.302 1.00 8.34   ? 220  LEU A N    1 
ATOM   3262 C CA   . LEU A 1 220 ? 12.037  13.277  23.684 1.00 8.64   ? 220  LEU A CA   1 
ATOM   3263 C C    . LEU A 1 220 ? 11.646  14.437  24.602 1.00 8.98   ? 220  LEU A C    1 
ATOM   3264 O O    . LEU A 1 220 ? 12.367  15.464  24.674 1.00 9.66   ? 220  LEU A O    1 
ATOM   3265 C CB   . LEU A 1 220 ? 13.331  12.615  24.173 1.00 9.03   ? 220  LEU A CB   1 
ATOM   3266 C CG   . LEU A 1 220 ? 13.840  11.446  23.321 1.00 9.37   ? 220  LEU A CG   1 
ATOM   3267 C CD1  . LEU A 1 220 ? 15.077  10.830  23.933 1.00 10.62  ? 220  LEU A CD1  1 
ATOM   3268 C CD2  . LEU A 1 220 ? 12.750  10.371  23.096 1.00 9.49   ? 220  LEU A CD2  1 
ATOM   3269 H H    . LEU A 1 220 ? 12.859  14.235  22.081 1.00 10.01  ? 220  LEU A H    1 
ATOM   3270 H HA   . LEU A 1 220 ? 11.320  12.610  23.707 1.00 10.37  ? 220  LEU A HA   1 
ATOM   3271 H HB2  . LEU A 1 220 ? 14.025  13.291  24.211 1.00 10.84  ? 220  LEU A HB2  1 
ATOM   3272 H HB3  . LEU A 1 220 ? 13.187  12.294  25.077 1.00 10.84  ? 220  LEU A HB3  1 
ATOM   3273 H HG   . LEU A 1 220 ? 14.090  11.805  22.443 1.00 11.25  ? 220  LEU A HG   1 
ATOM   3274 H HD11 . LEU A 1 220 ? 15.769  11.493  23.993 1.00 15.93  ? 220  LEU A HD11 1 
ATOM   3275 H HD12 . LEU A 1 220 ? 14.870  10.503  24.812 1.00 15.93  ? 220  LEU A HD12 1 
ATOM   3276 H HD13 . LEU A 1 220 ? 15.377  10.102  23.384 1.00 15.93  ? 220  LEU A HD13 1 
ATOM   3277 H HD21 . LEU A 1 220 ? 12.514  9.973   23.938 1.00 14.23  ? 220  LEU A HD21 1 
ATOM   3278 H HD22 . LEU A 1 220 ? 11.973  10.779  22.707 1.00 14.23  ? 220  LEU A HD22 1 
ATOM   3279 H HD23 . LEU A 1 220 ? 13.085  9.693   22.505 1.00 14.23  ? 220  LEU A HD23 1 
ATOM   3280 N N    . LEU A 1 221 ? 10.518  14.285  25.271 1.00 9.38   ? 221  LEU A N    1 
ATOM   3281 C CA   . LEU A 1 221 ? 9.857   15.343  26.041 1.00 9.68   ? 221  LEU A CA   1 
ATOM   3282 C C    . LEU A 1 221 ? 9.618   14.866  27.451 1.00 9.99   ? 221  LEU A C    1 
ATOM   3283 O O    . LEU A 1 221 ? 9.705   13.675  27.793 1.00 10.54  ? 221  LEU A O    1 
ATOM   3284 C CB   . LEU A 1 221 ? 8.527   15.718  25.368 1.00 10.04  ? 221  LEU A CB   1 
ATOM   3285 C CG   . LEU A 1 221 ? 8.666   16.217  23.883 1.00 10.41  ? 221  LEU A CG   1 
ATOM   3286 C CD1  . LEU A 1 221 ? 7.287   16.364  23.229 1.00 11.66  ? 221  LEU A CD1  1 
ATOM   3287 C CD2  . LEU A 1 221 ? 9.420   17.498  23.796 1.00 13.97  ? 221  LEU A CD2  1 
ATOM   3288 H H    . LEU A 1 221 ? 10.145  13.510  25.254 1.00 11.25  ? 221  LEU A H    1 
ATOM   3289 H HA   . LEU A 1 221 ? 10.437  16.132  26.065 1.00 11.61  ? 221  LEU A HA   1 
ATOM   3290 H HB2  . LEU A 1 221 ? 7.943   14.943  25.382 1.00 12.05  ? 221  LEU A HB2  1 
ATOM   3291 H HB3  . LEU A 1 221 ? 8.101   16.415  25.891 1.00 12.05  ? 221  LEU A HB3  1 
ATOM   3292 H HG   . LEU A 1 221 ? 9.166   15.539  23.383 1.00 12.50  ? 221  LEU A HG   1 
ATOM   3293 H HD11 . LEU A 1 221 ? 6.812   15.532  23.292 1.00 17.50  ? 221  LEU A HD11 1 
ATOM   3294 H HD12 . LEU A 1 221 ? 6.791   17.051  23.680 1.00 17.50  ? 221  LEU A HD12 1 
ATOM   3295 H HD13 . LEU A 1 221 ? 7.395   16.601  22.305 1.00 17.50  ? 221  LEU A HD13 1 
ATOM   3296 H HD21 . LEU A 1 221 ? 8.931   18.189  24.248 1.00 20.96  ? 221  LEU A HD21 1 
ATOM   3297 H HD22 . LEU A 1 221 ? 10.280  17.392  24.210 1.00 20.96  ? 221  LEU A HD22 1 
ATOM   3298 H HD23 . LEU A 1 221 ? 9.537   17.739  22.875 1.00 20.96  ? 221  LEU A HD23 1 
ATOM   3299 N N    . ASP A 1 222 ? 9.202   15.815  28.344 1.00 10.31  ? 222  ASP A N    1 
ATOM   3300 C CA   . ASP A 1 222 ? 8.832   15.393  29.725 1.00 10.75  ? 222  ASP A CA   1 
ATOM   3301 C C    . ASP A 1 222 ? 7.665   14.417  29.671 1.00 10.76  ? 222  ASP A C    1 
ATOM   3302 O O    . ASP A 1 222 ? 6.752   14.523  28.832 1.00 10.64  ? 222  ASP A O    1 
ATOM   3303 C CB   . ASP A 1 222 ? 8.415   16.634  30.549 1.00 11.39  ? 222  ASP A CB   1 
ATOM   3304 C CG   . ASP A 1 222 ? 9.549   17.408  31.086 1.00 13.23  ? 222  ASP A CG   1 
ATOM   3305 O OD1  . ASP A 1 222 ? 10.720  16.992  31.068 1.00 14.49  ? 222  ASP A OD1  1 
ATOM   3306 O OD2  . ASP A 1 222 ? 9.243   18.495  31.716 1.00 14.66  ? 222  ASP A OD2  1 
ATOM   3307 H H    . ASP A 1 222 ? 9.153   16.642  28.113 1.00 12.37  ? 222  ASP A H    1 
ATOM   3308 H HA   . ASP A 1 222 ? 9.601   14.960  30.152 1.00 12.90  ? 222  ASP A HA   1 
ATOM   3309 H HB2  . ASP A 1 222 ? 7.880   17.216  29.987 1.00 13.67  ? 222  ASP A HB2  1 
ATOM   3310 H HB3  . ASP A 1 222 ? 7.857   16.345  31.288 1.00 13.67  ? 222  ASP A HB3  1 
ATOM   3311 N N    . ASP A 1 223 ? 7.624   13.513  30.661 1.00 11.40  ? 223  ASP A N    1 
ATOM   3312 C CA   . ASP A 1 223 ? 6.560   12.533  30.758 1.00 11.87  ? 223  ASP A CA   1 
ATOM   3313 C C    . ASP A 1 223 ? 5.175   13.223  30.804 1.00 11.90  ? 223  ASP A C    1 
ATOM   3314 O O    . ASP A 1 223 ? 4.238   12.644  30.220 1.00 12.48  ? 223  ASP A O    1 
ATOM   3315 C CB   . ASP A 1 223 ? 6.761   11.678  32.011 1.00 13.15  ? 223  ASP A CB   1 
ATOM   3316 C CG   . ASP A 1 223 ? 7.941   10.791  31.985 1.00 14.46  ? 223  ASP A CG   1 
ATOM   3317 O OD1  . ASP A 1 223 ? 8.470   10.507  30.872 1.00 22.60  ? 223  ASP A OD1  1 
ATOM   3318 O OD2  . ASP A 1 223 ? 8.404   10.347  33.033 1.00 18.62  ? 223  ASP A OD2  1 
ATOM   3319 H H    . ASP A 1 223 ? 8.246   13.515  31.255 1.00 13.68  ? 223  ASP A H    1 
ATOM   3320 H HA   . ASP A 1 223 ? 6.595   11.951  29.970 1.00 14.25  ? 223  ASP A HA   1 
ATOM   3321 H HB2  . ASP A 1 223 ? 6.838   12.268  32.777 1.00 15.78  ? 223  ASP A HB2  1 
ATOM   3322 H HB3  . ASP A 1 223 ? 5.970   11.132  32.141 1.00 15.78  ? 223  ASP A HB3  1 
ATOM   3323 N N    . SER A 1 224 ? 5.034   14.367  31.437 1.00 12.14  ? 224  SER A N    1 
ATOM   3324 C CA   . SER A 1 224 ? 3.731   15.025  31.492 1.00 13.16  ? 224  SER A CA   1 
ATOM   3325 C C    . SER A 1 224 ? 3.248   15.404  30.084 1.00 11.93  ? 224  SER A C    1 
ATOM   3326 O O    . SER A 1 224 ? 2.036   15.305  29.766 1.00 13.16  ? 224  SER A O    1 
ATOM   3327 C CB   . SER A 1 224 ? 3.809   16.277  32.363 1.00 15.61  ? 224  SER A CB   1 
ATOM   3328 O OG   . SER A 1 224 ? 4.723   17.264  31.881 1.00 18.12  ? 224  SER A OG   1 
ATOM   3329 H H    . SER A 1 224 ? 5.712   14.729  31.821 1.00 14.57  ? 224  SER A H    1 
ATOM   3330 H HA   . SER A 1 224 ? 3.084   14.406  31.890 1.00 15.79  ? 224  SER A HA   1 
ATOM   3331 H HB2  . SER A 1 224 ? 2.925   16.672  32.421 1.00 18.73  ? 224  SER A HB2  1 
ATOM   3332 H HB3  . SER A 1 224 ? 4.074   16.017  33.260 1.00 18.73  ? 224  SER A HB3  1 
ATOM   3333 H HG   . SER A 1 224 ? 4.493   17.506  31.132 1.00 27.18  ? 224  SER A HG   1 
ATOM   3334 N N    . VAL A 1 225 ? 4.151   15.865  29.222 1.00 11.15  ? 225  VAL A N    1 
ATOM   3335 C CA   . VAL A 1 225 ? 3.832   16.241  27.848 1.00 11.00  ? 225  VAL A CA   1 
ATOM   3336 C C    . VAL A 1 225 ? 3.521   15.014  26.979 1.00 10.32  ? 225  VAL A C    1 
ATOM   3337 O O    . VAL A 1 225 ? 2.567   15.009  26.204 1.00 11.09  ? 225  VAL A O    1 
ATOM   3338 C CB   . VAL A 1 225 ? 4.983   17.132  27.248 1.00 11.50  ? 225  VAL A CB   1 
ATOM   3339 C CG1  . VAL A 1 225 ? 4.616   17.527  25.811 1.00 12.44  ? 225  VAL A CG1  1 
ATOM   3340 C CG2  . VAL A 1 225 ? 5.270   18.349  28.097 1.00 13.22  ? 225  VAL A CG2  1 
ATOM   3341 H H    . VAL A 1 225 ? 4.965   15.945  29.488 1.00 13.38  ? 225  VAL A H    1 
ATOM   3342 H HA   . VAL A 1 225 ? 3.022   16.792  27.877 1.00 13.20  ? 225  VAL A HA   1 
ATOM   3343 H HB   . VAL A 1 225 ? 5.798   16.589  27.213 1.00 13.80  ? 225  VAL A HB   1 
ATOM   3344 H HG11 . VAL A 1 225 ? 4.439   16.735  25.297 1.00 18.67  ? 225  VAL A HG11 1 
ATOM   3345 H HG12 . VAL A 1 225 ? 3.833   18.082  25.822 1.00 18.67  ? 225  VAL A HG12 1 
ATOM   3346 H HG13 . VAL A 1 225 ? 5.345   18.009  25.416 1.00 18.67  ? 225  VAL A HG13 1 
ATOM   3347 H HG21 . VAL A 1 225 ? 4.492   18.912  28.122 1.00 19.83  ? 225  VAL A HG21 1 
ATOM   3348 H HG22 . VAL A 1 225 ? 5.493   18.072  28.988 1.00 19.83  ? 225  VAL A HG22 1 
ATOM   3349 H HG23 . VAL A 1 225 ? 6.005   18.836  27.719 1.00 19.83  ? 225  VAL A HG23 1 
ATOM   3350 N N    . VAL A 1 226 ? 4.351   13.965  27.143 1.00 10.38  ? 226  VAL A N    1 
ATOM   3351 C CA   . VAL A 1 226 ? 4.124   12.715  26.433 1.00 10.77  ? 226  VAL A CA   1 
ATOM   3352 C C    . VAL A 1 226 ? 2.714   12.181  26.767 1.00 10.79  ? 226  VAL A C    1 
ATOM   3353 O O    . VAL A 1 226 ? 1.955   11.774  25.868 1.00 11.02  ? 226  VAL A O    1 
ATOM   3354 C CB   . VAL A 1 226 ? 5.225   11.713  26.808 1.00 10.82  ? 226  VAL A CB   1 
ATOM   3355 C CG1  . VAL A 1 226 ? 4.927   10.327  26.202 1.00 12.14  ? 226  VAL A CG1  1 
ATOM   3356 C CG2  . VAL A 1 226 ? 6.600   12.196  26.394 1.00 11.32  ? 226  VAL A CG2  1 
ATOM   3357 H H    . VAL A 1 226 ? 5.023   14.035  27.675 1.00 12.45  ? 226  VAL A H    1 
ATOM   3358 H HA   . VAL A 1 226 ? 4.174   12.888  25.470 1.00 12.93  ? 226  VAL A HA   1 
ATOM   3359 H HB   . VAL A 1 226 ? 5.223   11.619  27.783 1.00 12.99  ? 226  VAL A HB   1 
ATOM   3360 H HG11 . VAL A 1 226 ? 4.054   10.038  26.476 1.00 18.22  ? 226  VAL A HG11 1 
ATOM   3361 H HG12 . VAL A 1 226 ? 4.959   10.383  25.244 1.00 18.22  ? 226  VAL A HG12 1 
ATOM   3362 H HG13 . VAL A 1 226 ? 5.584   9.697   26.507 1.00 18.22  ? 226  VAL A HG13 1 
ATOM   3363 H HG21 . VAL A 1 226 ? 7.258   11.543  26.645 1.00 16.98  ? 226  VAL A HG21 1 
ATOM   3364 H HG22 . VAL A 1 226 ? 6.622   12.324  25.443 1.00 16.98  ? 226  VAL A HG22 1 
ATOM   3365 H HG23 . VAL A 1 226 ? 6.792   13.028  26.833 1.00 16.98  ? 226  VAL A HG23 1 
ATOM   3366 N N    . SER A 1 227 ? 2.346   12.186  28.063 1.00 12.24  ? 227  SER A N    1 
ATOM   3367 C CA   . SER A 1 227 ? 1.043   11.715  28.458 1.00 13.38  ? 227  SER A CA   1 
ATOM   3368 C C    . SER A 1 227 ? -0.077  12.549  27.873 1.00 12.52  ? 227  SER A C    1 
ATOM   3369 O O    . SER A 1 227 ? -1.108  12.032  27.401 1.00 13.56  ? 227  SER A O    1 
ATOM   3370 C CB   A SER A 1 227 ? 0.951   11.812  30.004 0.44 15.71  ? 227  SER A CB   1 
ATOM   3371 C CB   B SER A 1 227 ? 0.951   11.666  30.068 0.56 16.84  ? 227  SER A CB   1 
ATOM   3372 O OG   A SER A 1 227 ? -0.365  11.506  30.481 0.44 19.86  ? 227  SER A OG   1 
ATOM   3373 O OG   B SER A 1 227 ? 1.803   10.632  30.531 0.56 17.31  ? 227  SER A OG   1 
ATOM   3374 H H    . SER A 1 227 ? 2.894   12.473  28.660 1.00 14.68  ? 227  SER A H    1 
ATOM   3375 H HA   A SER A 1 227 ? 0.935   10.781  28.181 1.00 16.05  ? 227  SER A HA   1 
ATOM   3376 H HB2  A SER A 1 227 ? 1.587   11.197  30.402 0.44 18.85  ? 227  SER A HB2  1 
ATOM   3377 H HB2  B SER A 1 227 ? 1.228   12.517  30.443 0.56 20.20  ? 227  SER A HB2  1 
ATOM   3378 H HB3  A SER A 1 227 ? 1.191   12.710  30.283 0.44 18.85  ? 227  SER A HB3  1 
ATOM   3379 H HB3  B SER A 1 227 ? 0.037   11.493  30.344 0.56 20.20  ? 227  SER A HB3  1 
ATOM   3380 H HG   A SER A 1 227 ? -0.897  12.056  30.187 0.44 29.79  ? 227  SER A HG   1 
ATOM   3381 H HG   B SER A 1 227 ? 2.573   10.784  30.293 0.56 25.97  ? 227  SER A HG   1 
ATOM   3382 N N    . GLN A 1 228 ? 0.096   13.870  27.878 1.00 12.85  ? 228  GLN A N    1 
ATOM   3383 C CA   . GLN A 1 228 ? -0.907  14.753  27.282 1.00 12.83  ? 228  GLN A CA   1 
ATOM   3384 C C    . GLN A 1 228 ? -1.105  14.462  25.814 1.00 11.31  ? 228  GLN A C    1 
ATOM   3385 O O    . GLN A 1 228 ? -2.231  14.405  25.301 1.00 12.44  ? 228  GLN A O    1 
ATOM   3386 C CB   A GLN A 1 228 ? -0.365  16.150  27.599 0.51 15.50  ? 228  GLN A CB   1 
ATOM   3387 C CB   B GLN A 1 228 ? -0.645  16.261  27.386 0.49 13.08  ? 228  GLN A CB   1 
ATOM   3388 C CG   A GLN A 1 228 ? -1.474  17.084  27.287 0.51 17.02  ? 228  GLN A CG   1 
ATOM   3389 C CG   B GLN A 1 228 ? -0.736  16.923  28.721 0.49 12.25  ? 228  GLN A CG   1 
ATOM   3390 C CD   A GLN A 1 228 ? -0.872  18.416  27.660 0.51 16.10  ? 228  GLN A CD   1 
ATOM   3391 C CD   B GLN A 1 228 ? -0.257  18.333  28.778 0.49 13.36  ? 228  GLN A CD   1 
ATOM   3392 O OE1  A GLN A 1 228 ? 0.132   18.863  27.157 0.51 19.16  ? 228  GLN A OE1  1 
ATOM   3393 O OE1  B GLN A 1 228 ? 0.564   18.756  27.948 0.49 17.14  ? 228  GLN A OE1  1 
ATOM   3394 N NE2  A GLN A 1 228 ? -1.588  19.178  28.469 0.51 20.79  ? 228  GLN A NE2  1 
ATOM   3395 N NE2  B GLN A 1 228 ? -0.750  19.085  29.731 0.49 23.22  ? 228  GLN A NE2  1 
ATOM   3396 H H    . GLN A 1 228 ? 0.802   14.207  28.235 1.00 15.42  ? 228  GLN A H    1 
ATOM   3397 H HA   A GLN A 1 228 ? -1.759  14.628  27.749 1.00 15.39  ? 228  GLN A HA   1 
ATOM   3398 H HB2  A GLN A 1 228 ? -0.116  16.216  28.534 0.51 18.60  ? 228  GLN A HB2  1 
ATOM   3399 H HB2  B GLN A 1 228 ? 0.245   16.428  27.037 0.49 15.69  ? 228  GLN A HB2  1 
ATOM   3400 H HB3  A GLN A 1 228 ? 0.413   16.347  27.054 0.51 18.60  ? 228  GLN A HB3  1 
ATOM   3401 H HB3  B GLN A 1 228 ? -1.270  16.708  26.795 0.49 15.69  ? 228  GLN A HB3  1 
ATOM   3402 H HG2  A GLN A 1 228 ? -1.708  17.053  26.346 0.51 20.42  ? 228  GLN A HG2  1 
ATOM   3403 H HG2  B GLN A 1 228 ? -1.662  16.902  29.009 0.49 14.70  ? 228  GLN A HG2  1 
ATOM   3404 H HG3  A GLN A 1 228 ? -2.261  16.890  27.819 0.51 20.42  ? 228  GLN A HG3  1 
ATOM   3405 H HG3  B GLN A 1 228 ? -0.222  16.400  29.356 0.49 14.70  ? 228  GLN A HG3  1 
ATOM   3406 H HE21 A GLN A 1 228 ? -2.303  18.867  28.831 0.51 24.95  ? 228  GLN A HE21 1 
ATOM   3407 H HE21 B GLN A 1 228 ? -1.317  18.757  30.288 0.49 27.87  ? 228  GLN A HE21 1 
ATOM   3408 H HE22 A GLN A 1 228 ? -1.337  19.984  28.634 0.51 24.95  ? 228  GLN A HE22 1 
ATOM   3409 H HE22 B GLN A 1 228 ? -0.505  19.907  29.800 0.49 27.87  ? 228  GLN A HE22 1 
ATOM   3410 N N    . TYR A 1 229 ? -0.015  14.249  25.067 1.00 10.89  ? 229  TYR A N    1 
ATOM   3411 C CA   . TYR A 1 229 ? -0.082  13.977  23.647 1.00 10.44  ? 229  TYR A CA   1 
ATOM   3412 C C    . TYR A 1 229 ? -0.846  12.660  23.370 1.00 9.97   ? 229  TYR A C    1 
ATOM   3413 O O    . TYR A 1 229 ? -1.812  12.611  22.619 1.00 11.16  ? 229  TYR A O    1 
ATOM   3414 C CB   . TYR A 1 229 ? 1.370   13.940  23.029 1.00 10.10  ? 229  TYR A CB   1 
ATOM   3415 C CG   . TYR A 1 229 ? 1.340   13.756  21.529 1.00 9.96   ? 229  TYR A CG   1 
ATOM   3416 C CD1  . TYR A 1 229 ? 1.106   14.831  20.673 1.00 10.15  ? 229  TYR A CD1  1 
ATOM   3417 C CD2  . TYR A 1 229 ? 1.496   12.492  20.952 1.00 10.36  ? 229  TYR A CD2  1 
ATOM   3418 C CE1  . TYR A 1 229 ? 1.054   14.668  19.306 1.00 10.65  ? 229  TYR A CE1  1 
ATOM   3419 C CE2  . TYR A 1 229 ? 1.401   12.326  19.579 1.00 10.62  ? 229  TYR A CE2  1 
ATOM   3420 C CZ   . TYR A 1 229 ? 1.194   13.402  18.739 1.00 10.43  ? 229  TYR A CZ   1 
ATOM   3421 O OH   . TYR A 1 229 ? 1.080   13.145  17.391 1.00 11.19  ? 229  TYR A OH   1 
ATOM   3422 H H    . TYR A 1 229 ? 0.757   14.275  25.447 1.00 13.06  ? 229  TYR A H    1 
ATOM   3423 H HA   . TYR A 1 229 ? -0.575  14.709  23.221 1.00 12.52  ? 229  TYR A HA   1 
ATOM   3424 H HB2  . TYR A 1 229 ? 1.828   14.769  23.240 1.00 12.12  ? 229  TYR A HB2  1 
ATOM   3425 H HB3  . TYR A 1 229 ? 1.870   13.212  23.431 1.00 12.12  ? 229  TYR A HB3  1 
ATOM   3426 H HD1  . TYR A 1 229 ? 0.983   15.679  21.033 1.00 12.18  ? 229  TYR A HD1  1 
ATOM   3427 H HD2  . TYR A 1 229 ? 1.664   11.755  21.494 1.00 12.43  ? 229  TYR A HD2  1 
ATOM   3428 H HE1  . TYR A 1 229 ? 0.924   15.407  18.758 1.00 12.78  ? 229  TYR A HE1  1 
ATOM   3429 H HE2  . TYR A 1 229 ? 1.479   11.473  19.216 1.00 12.74  ? 229  TYR A HE2  1 
ATOM   3430 H HH   . TYR A 1 229 ? 0.960   13.849  16.988 1.00 16.79  ? 229  TYR A HH   1 
ATOM   3431 N N    . TYR A 1 230 ? -0.385  11.557  24.022 1.00 10.49  ? 230  TYR A N    1 
ATOM   3432 C CA   . TYR A 1 230 ? -0.995  10.246  23.717 1.00 11.09  ? 230  TYR A CA   1 
ATOM   3433 C C    . TYR A 1 230 ? -2.376  10.092  24.313 1.00 11.28  ? 230  TYR A C    1 
ATOM   3434 O O    . TYR A 1 230 ? -3.147  9.227   23.830 1.00 12.07  ? 230  TYR A O    1 
ATOM   3435 C CB   . TYR A 1 230 ? -0.053  9.075   24.070 1.00 11.22  ? 230  TYR A CB   1 
ATOM   3436 C CG   . TYR A 1 230 ? 1.138   9.057   23.128 1.00 10.61  ? 230  TYR A CG   1 
ATOM   3437 C CD1  . TYR A 1 230 ? 1.009   8.734   21.788 1.00 10.90  ? 230  TYR A CD1  1 
ATOM   3438 C CD2  . TYR A 1 230 ? 2.416   9.408   23.595 1.00 10.50  ? 230  TYR A CD2  1 
ATOM   3439 C CE1  . TYR A 1 230 ? 2.068   8.765   20.901 1.00 10.53  ? 230  TYR A CE1  1 
ATOM   3440 C CE2  . TYR A 1 230 ? 3.502   9.429   22.711 1.00 10.10  ? 230  TYR A CE2  1 
ATOM   3441 C CZ   . TYR A 1 230 ? 3.329   9.115   21.380 1.00 10.01  ? 230  TYR A CZ   1 
ATOM   3442 O OH   . TYR A 1 230 ? 4.384   9.146   20.451 1.00 10.46  ? 230  TYR A OH   1 
ATOM   3443 H H    . TYR A 1 230 ? 0.249   11.622  24.599 1.00 12.58  ? 230  TYR A H    1 
ATOM   3444 H HA   . TYR A 1 230 ? -1.112  10.219  22.744 1.00 13.31  ? 230  TYR A HA   1 
ATOM   3445 H HB2  . TYR A 1 230 ? 0.256   9.170   24.984 1.00 13.46  ? 230  TYR A HB2  1 
ATOM   3446 H HB3  . TYR A 1 230 ? -0.536  8.236   24.000 1.00 13.46  ? 230  TYR A HB3  1 
ATOM   3447 H HD1  . TYR A 1 230 ? 0.171   8.484   21.471 1.00 13.08  ? 230  TYR A HD1  1 
ATOM   3448 H HD2  . TYR A 1 230 ? 2.540   9.625   24.490 1.00 12.60  ? 230  TYR A HD2  1 
ATOM   3449 H HE1  . TYR A 1 230 ? 1.941   8.558   20.003 1.00 12.64  ? 230  TYR A HE1  1 
ATOM   3450 H HE2  . TYR A 1 230 ? 4.347   9.656   23.025 1.00 12.12  ? 230  TYR A HE2  1 
ATOM   3451 H HH   . TYR A 1 230 ? 5.076   9.370   20.830 1.00 15.68  ? 230  TYR A HH   1 
ATOM   3452 N N    . SER A 1 231 ? -2.801  10.912  25.279 1.00 12.07  ? 231  SER A N    1 
ATOM   3453 C CA   . SER A 1 231 ? -4.199  10.903  25.719 1.00 13.06  ? 231  SER A CA   1 
ATOM   3454 C C    . SER A 1 231 ? -5.150  11.221  24.585 1.00 13.10  ? 231  SER A C    1 
ATOM   3455 O O    . SER A 1 231 ? -6.343  10.904  24.682 1.00 15.60  ? 231  SER A O    1 
ATOM   3456 C CB   . SER A 1 231 ? -4.393  11.875  26.877 1.00 14.98  ? 231  SER A CB   1 
ATOM   3457 O OG   . SER A 1 231 ? -4.457  13.273  26.447 1.00 16.14  ? 231  SER A OG   1 
ATOM   3458 H H    . SER A 1 231 ? -2.244  11.454  25.649 1.00 14.49  ? 231  SER A H    1 
ATOM   3459 H HA   . SER A 1 231 ? -4.407  10.002  26.043 1.00 15.67  ? 231  SER A HA   1 
ATOM   3460 H HB2  . SER A 1 231 ? -5.214  11.651  27.344 1.00 17.98  ? 231  SER A HB2  1 
ATOM   3461 H HB3  . SER A 1 231 ? -3.659  11.771  27.503 1.00 17.98  ? 231  SER A HB3  1 
ATOM   3462 H HG   . SER A 1 231 ? -3.758  13.475  26.069 1.00 24.20  ? 231  SER A HG   1 
ATOM   3463 N N    . GLN A 1 232 ? -4.673  11.850  23.528 1.00 12.09  ? 232  GLN A N    1 
ATOM   3464 C CA   . GLN A 1 232 ? -5.468  12.242  22.353 1.00 12.89  ? 232  GLN A CA   1 
ATOM   3465 C C    . GLN A 1 232 ? -5.396  11.237  21.235 1.00 14.59  ? 232  GLN A C    1 
ATOM   3466 O O    . GLN A 1 232 ? -5.985  11.484  20.139 1.00 21.94  ? 232  GLN A O    1 
ATOM   3467 C CB   . GLN A 1 232 ? -4.959  13.609  21.879 1.00 12.11  ? 232  GLN A CB   1 
ATOM   3468 C CG   . GLN A 1 232 ? -5.090  14.671  22.913 1.00 13.08  ? 232  GLN A CG   1 
ATOM   3469 C CD   . GLN A 1 232 ? -4.346  15.908  22.476 1.00 12.58  ? 232  GLN A CD   1 
ATOM   3470 O OE1  . GLN A 1 232 ? -4.605  16.459  21.368 1.00 16.08  ? 232  GLN A OE1  1 
ATOM   3471 N NE2  . GLN A 1 232 ? -3.359  16.352  23.209 1.00 12.22  ? 232  GLN A NE2  1 
ATOM   3472 H H    . GLN A 1 232 ? -3.835  12.046  23.525 1.00 14.50  ? 232  GLN A H    1 
ATOM   3473 H HA   . GLN A 1 232 ? -6.404  12.336  22.628 1.00 15.47  ? 232  GLN A HA   1 
ATOM   3474 H HB2  . GLN A 1 232 ? -4.026  13.528  21.626 1.00 14.53  ? 232  GLN A HB2  1 
ATOM   3475 H HB3  . GLN A 1 232 ? -5.457  13.874  21.090 1.00 14.53  ? 232  GLN A HB3  1 
ATOM   3476 H HG2  . GLN A 1 232 ? -6.027  14.883  23.047 1.00 15.70  ? 232  GLN A HG2  1 
ATOM   3477 H HG3  . GLN A 1 232 ? -4.729  14.353  23.756 1.00 15.70  ? 232  GLN A HG3  1 
ATOM   3478 H HE21 . GLN A 1 232 ? -3.181  15.978  23.963 1.00 14.67  ? 232  GLN A HE21 1 
ATOM   3479 H HE22 . GLN A 1 232 ? -2.887  17.017  22.938 1.00 14.67  ? 232  GLN A HE22 1 
ATOM   3480 N N    . VAL A 1 233 ? -4.668  10.167  21.412 1.00 13.41  ? 233  VAL A N    1 
ATOM   3481 C CA   . VAL A 1 233 ? -4.417  9.191   20.366 1.00 13.67  ? 233  VAL A CA   1 
ATOM   3482 C C    . VAL A 1 233 ? -5.168  7.868   20.749 1.00 14.93  ? 233  VAL A C    1 
ATOM   3483 O O    . VAL A 1 233 ? -4.820  7.203   21.686 1.00 15.26  ? 233  VAL A O    1 
ATOM   3484 C CB   . VAL A 1 233 ? -2.923  8.914   20.181 1.00 13.31  ? 233  VAL A CB   1 
ATOM   3485 C CG1  . VAL A 1 233 ? -2.628  7.817   19.136 1.00 15.02  ? 233  VAL A CG1  1 
ATOM   3486 C CG2  . VAL A 1 233 ? -2.160  10.199  19.780 1.00 13.59  ? 233  VAL A CG2  1 
ATOM   3487 H H    . VAL A 1 233 ? -4.319  10.033  22.187 1.00 16.10  ? 233  VAL A H    1 
ATOM   3488 H HA   . VAL A 1 233 ? -4.783  9.530   19.523 1.00 16.41  ? 233  VAL A HA   1 
ATOM   3489 H HB   . VAL A 1 233 ? -2.566  8.610   21.042 1.00 15.97  ? 233  VAL A HB   1 
ATOM   3490 H HG11 . VAL A 1 233 ? -2.985  8.081   18.285 1.00 22.53  ? 233  VAL A HG11 1 
ATOM   3491 H HG12 . VAL A 1 233 ? -1.679  7.694   19.061 1.00 22.53  ? 233  VAL A HG12 1 
ATOM   3492 H HG13 . VAL A 1 233 ? -3.037  6.993   19.413 1.00 22.53  ? 233  VAL A HG13 1 
ATOM   3493 H HG21 . VAL A 1 233 ? -1.228  9.997   19.669 1.00 20.38  ? 233  VAL A HG21 1 
ATOM   3494 H HG22 . VAL A 1 233 ? -2.514  10.537  18.954 1.00 20.38  ? 233  VAL A HG22 1 
ATOM   3495 H HG23 . VAL A 1 233 ? -2.264  10.861  20.467 1.00 20.38  ? 233  VAL A HG23 1 
ATOM   3496 N N    . SER A 1 234 ? -6.269  7.592   20.041 1.00 17.37  ? 234  SER A N    1 
ATOM   3497 C CA   . SER A 1 234 ? -7.119  6.462   20.483 1.00 19.33  ? 234  SER A CA   1 
ATOM   3498 C C    . SER A 1 234 ? -6.349  5.145   20.467 1.00 15.72  ? 234  SER A C    1 
ATOM   3499 O O    . SER A 1 234 ? -5.646  4.895   19.504 1.00 16.75  ? 234  SER A O    1 
ATOM   3500 C CB   A SER A 1 234 ? -8.294  6.360   19.331 0.63 25.32  ? 234  SER A CB   1 
ATOM   3501 C CB   B SER A 1 234 ? -8.410  6.202   19.704 0.37 18.65  ? 234  SER A CB   1 
ATOM   3502 O OG   A SER A 1 234 ? -8.155  7.055   18.300 0.63 46.52  ? 234  SER A OG   1 
ATOM   3503 O OG   B SER A 1 234 ? -9.190  5.311   20.028 0.37 21.03  ? 234  SER A OG   1 
ATOM   3504 H H    . SER A 1 234 ? -6.478  8.058   19.348 1.00 20.84  ? 234  SER A H    1 
ATOM   3505 H HA   A SER A 1 234 ? -7.505  6.635   21.367 1.00 23.19  ? 234  SER A HA   1 
ATOM   3506 H HB2  A SER A 1 234 ? -8.365  5.432   19.059 0.63 30.38  ? 234  SER A HB2  1 
ATOM   3507 H HB2  B SER A 1 234 ? -8.913  7.031   19.707 0.37 22.38  ? 234  SER A HB2  1 
ATOM   3508 H HB3  A SER A 1 234 ? -9.137  6.604   19.744 0.63 30.38  ? 234  SER A HB3  1 
ATOM   3509 H HB3  B SER A 1 234 ? -8.155  6.033   18.784 0.37 22.38  ? 234  SER A HB3  1 
ATOM   3510 H HG   A SER A 1 234 ? -7.500  6.794   17.881 0.63 69.79  ? 234  SER A HG   1 
ATOM   3511 H HG   B SER A 1 234 ? -8.789  4.596   20.065 0.37 31.55  ? 234  SER A HG   1 
ATOM   3512 N N    . GLY A 1 235 ? -6.445  4.414   21.561 1.00 17.05  ? 235  GLY A N    1 
ATOM   3513 C CA   . GLY A 1 235 ? -5.796  3.080   21.614 1.00 18.49  ? 235  GLY A CA   1 
ATOM   3514 C C    . GLY A 1 235 ? -4.334  3.131   21.890 1.00 16.08  ? 235  GLY A C    1 
ATOM   3515 O O    . GLY A 1 235 ? -3.685  2.037   21.982 1.00 17.51  ? 235  GLY A O    1 
ATOM   3516 H H    . GLY A 1 235 ? -6.882  4.710   22.241 1.00 20.47  ? 235  GLY A H    1 
ATOM   3517 H HA2  . GLY A 1 235 ? -6.225  2.550   22.304 1.00 22.19  ? 235  GLY A HA2  1 
ATOM   3518 H HA3  . GLY A 1 235 ? -5.938  2.629   20.767 1.00 22.19  ? 235  GLY A HA3  1 
ATOM   3519 N N    . ALA A 1 236 ? -3.696  4.277   22.080 1.00 14.24  ? 236  ALA A N    1 
ATOM   3520 C CA   . ALA A 1 236 ? -2.252  4.290   22.361 1.00 13.08  ? 236  ALA A CA   1 
ATOM   3521 C C    . ALA A 1 236 ? -1.949  3.557   23.649 1.00 13.18  ? 236  ALA A C    1 
ATOM   3522 O O    . ALA A 1 236 ? -2.653  3.714   24.646 1.00 15.35  ? 236  ALA A O    1 
ATOM   3523 C CB   . ALA A 1 236 ? -1.724  5.703   22.378 1.00 14.76  ? 236  ALA A CB   1 
ATOM   3524 H H    . ALA A 1 236 ? -4.129  5.019   22.039 1.00 17.09  ? 236  ALA A H    1 
ATOM   3525 H HA   . ALA A 1 236 ? -1.803  3.812   21.633 1.00 15.70  ? 236  ALA A HA   1 
ATOM   3526 H HB1  . ALA A 1 236 ? -0.771  5.686   22.498 1.00 22.14  ? 236  ALA A HB1  1 
ATOM   3527 H HB2  . ALA A 1 236 ? -1.934  6.133   21.547 1.00 22.14  ? 236  ALA A HB2  1 
ATOM   3528 H HB3  . ALA A 1 236 ? -2.129  6.187   23.101 1.00 22.14  ? 236  ALA A HB3  1 
ATOM   3529 N N    . GLN A 1 237 ? -0.827  2.800   23.627 1.00 13.50  ? 237  GLN A N    1 
ATOM   3530 C CA   . GLN A 1 237 ? -0.383  2.027   24.795 1.00 15.12  ? 237  GLN A CA   1 
ATOM   3531 C C    . GLN A 1 237 ? 1.131   1.934   24.738 1.00 12.61  ? 237  GLN A C    1 
ATOM   3532 O O    . GLN A 1 237 ? 1.709   1.926   23.630 1.00 12.62  ? 237  GLN A O    1 
ATOM   3533 C CB   A GLN A 1 237 ? -0.933  0.700   25.160 0.54 12.79  ? 237  GLN A CB   1 
ATOM   3534 C CB   B GLN A 1 237 ? -1.093  0.516   24.230 0.46 21.01  ? 237  GLN A CB   1 
ATOM   3535 C CG   A GLN A 1 237 ? -2.480  0.643   25.342 0.54 13.46  ? 237  GLN A CG   1 
ATOM   3536 C CG   B GLN A 1 237 ? -2.555  0.195   24.150 0.46 20.08  ? 237  GLN A CG   1 
ATOM   3537 C CD   A GLN A 1 237 ? -3.082  1.331   26.543 0.54 12.46  ? 237  GLN A CD   1 
ATOM   3538 C CD   B GLN A 1 237 ? -3.049  -1.297  23.863 0.46 23.91  ? 237  GLN A CD   1 
ATOM   3539 O OE1  A GLN A 1 237 ? -4.306  1.632   26.566 0.54 14.44  ? 237  GLN A OE1  1 
ATOM   3540 O OE1  B GLN A 1 237 ? -4.370  -1.756  23.698 0.46 32.21  ? 237  GLN A OE1  1 
ATOM   3541 N NE2  A GLN A 1 237 ? -2.307  1.675   27.503 0.54 13.28  ? 237  GLN A NE2  1 
ATOM   3542 N NE2  B GLN A 1 237 ? -2.284  -2.142  23.377 0.46 21.13  ? 237  GLN A NE2  1 
ATOM   3543 H H    . GLN A 1 237 ? -0.358  2.772   22.906 1.00 16.21  ? 237  GLN A H    1 
ATOM   3544 H HA   A GLN A 1 237 ? -0.574  2.600   25.566 1.00 18.14  ? 237  GLN A HA   1 
ATOM   3545 H HB2  A GLN A 1 237 ? -0.682  0.064   24.471 0.54 15.34  ? 237  GLN A HB2  1 
ATOM   3546 H HB2  B GLN A 1 237 ? -0.744  0.380   23.335 0.46 25.21  ? 237  GLN A HB2  1 
ATOM   3547 H HB3  A GLN A 1 237 ? -0.516  0.412   25.987 0.54 15.34  ? 237  GLN A HB3  1 
ATOM   3548 H HB3  B GLN A 1 237 ? -0.701  -0.180  24.781 0.46 25.21  ? 237  GLN A HB3  1 
ATOM   3549 H HG2  A GLN A 1 237 ? -2.886  1.025   24.548 0.54 16.15  ? 237  GLN A HG2  1 
ATOM   3550 H HG2  B GLN A 1 237 ? -2.955  0.473   24.989 0.46 24.10  ? 237  GLN A HG2  1 
ATOM   3551 H HG3  A GLN A 1 237 ? -2.740  -0.290  25.375 0.54 16.15  ? 237  GLN A HG3  1 
ATOM   3552 H HG3  B GLN A 1 237 ? -2.934  0.760   23.458 0.46 24.10  ? 237  GLN A HG3  1 
ATOM   3553 H HE21 A GLN A 1 237 ? -1.473  1.465   27.479 0.54 15.94  ? 237  GLN A HE21 1 
ATOM   3554 H HE21 B GLN A 1 237 ? -1.434  -2.014  23.396 0.46 25.35  ? 237  GLN A HE21 1 
ATOM   3555 H HE22 A GLN A 1 237 ? -2.619  2.116   28.172 0.54 15.94  ? 237  GLN A HE22 1 
ATOM   3556 H HE22 B GLN A 1 237 ? -2.604  -2.857  23.022 0.46 25.35  ? 237  GLN A HE22 1 
ATOM   3557 N N    . GLN A 1 238 ? 1.804   1.834   25.891 1.00 14.21  ? 238  GLN A N    1 
ATOM   3558 C CA   . GLN A 1 238 ? 3.201   1.542   25.891 1.00 13.14  ? 238  GLN A CA   1 
ATOM   3559 C C    . GLN A 1 238 ? 3.509   0.065   25.463 1.00 11.88  ? 238  GLN A C    1 
ATOM   3560 O O    . GLN A 1 238 ? 2.818   -0.843  25.915 1.00 13.33  ? 238  GLN A O    1 
ATOM   3561 C CB   . GLN A 1 238 ? 3.766   1.857   27.271 1.00 17.28  ? 238  GLN A CB   1 
ATOM   3562 C CG   A GLN A 1 238 ? 3.904   3.237   27.919 0.54 16.89  ? 238  GLN A CG   1 
ATOM   3563 C CG   B GLN A 1 238 ? 3.523   3.407   27.224 0.46 18.00  ? 238  GLN A CG   1 
ATOM   3564 C CD   A GLN A 1 238 ? 5.402   3.602   28.152 0.54 15.74  ? 238  GLN A CD   1 
ATOM   3565 C CD   B GLN A 1 238 ? 4.099   3.927   28.495 0.46 17.05  ? 238  GLN A CD   1 
ATOM   3566 O OE1  A GLN A 1 238 ? 5.422   4.299   29.172 0.54 23.90  ? 238  GLN A OE1  1 
ATOM   3567 O OE1  B GLN A 1 238 ? 3.298   4.299   29.358 0.46 19.53  ? 238  GLN A OE1  1 
ATOM   3568 N NE2  A GLN A 1 238 ? 6.293   3.317   27.225 0.54 22.12  ? 238  GLN A NE2  1 
ATOM   3569 N NE2  B GLN A 1 238 ? 5.371   3.863   28.476 0.46 21.23  ? 238  GLN A NE2  1 
ATOM   3570 H H    . GLN A 1 238 ? 1.392   1.946   26.637 1.00 17.05  ? 238  GLN A H    1 
ATOM   3571 H HA   . GLN A 1 238 ? 3.634   2.140   25.245 1.00 15.77  ? 238  GLN A HA   1 
ATOM   3572 H HB2  . GLN A 1 238 ? 3.241   1.329   27.893 1.00 20.73  ? 238  GLN A HB2  1 
ATOM   3573 H HB3  . GLN A 1 238 ? 4.657   1.475   27.280 1.00 20.73  ? 238  GLN A HB3  1 
ATOM   3574 H HG2  A GLN A 1 238 ? 3.495   3.905   27.346 0.54 20.26  ? 238  GLN A HG2  1 
ATOM   3575 H HG2  B GLN A 1 238 ? 3.969   3.802   26.459 0.46 21.60  ? 238  GLN A HG2  1 
ATOM   3576 H HG3  A GLN A 1 238 ? 3.435   3.243   28.768 0.54 20.26  ? 238  GLN A HG3  1 
ATOM   3577 H HG3  B GLN A 1 238 ? 2.575   3.605   27.171 0.46 21.60  ? 238  GLN A HG3  1 
ATOM   3578 H HE21 A GLN A 1 238 ? 6.085   2.797   26.573 0.54 26.55  ? 238  GLN A HE21 1 
ATOM   3579 H HE21 B GLN A 1 238 ? 5.776   3.572   27.776 0.46 25.47  ? 238  GLN A HE21 1 
ATOM   3580 H HE22 A GLN A 1 238 ? 7.084   3.651   27.273 0.54 26.55  ? 238  GLN A HE22 1 
ATOM   3581 H HE22 B GLN A 1 238 ? 5.825   4.110   29.164 0.46 25.47  ? 238  GLN A HE22 1 
ATOM   3582 N N    . ASP A 1 239 ? 4.541   -0.122  24.679 1.00 11.77  ? 239  ASP A N    1 
ATOM   3583 C CA   . ASP A 1 239 ? 5.060   -1.420  24.277 1.00 11.31  ? 239  ASP A CA   1 
ATOM   3584 C C    . ASP A 1 239 ? 6.584   -1.365  24.388 1.00 11.43  ? 239  ASP A C    1 
ATOM   3585 O O    . ASP A 1 239 ? 7.250   -0.740  23.541 1.00 11.92  ? 239  ASP A O    1 
ATOM   3586 C CB   . ASP A 1 239 ? 4.574   -1.743  22.861 1.00 13.89  ? 239  ASP A CB   1 
ATOM   3587 C CG   . ASP A 1 239 ? 5.067   -3.031  22.333 1.00 16.75  ? 239  ASP A CG   1 
ATOM   3588 O OD1  . ASP A 1 239 ? 5.961   -3.691  22.939 1.00 18.61  ? 239  ASP A OD1  1 
ATOM   3589 O OD2  . ASP A 1 239 ? 4.537   -3.513  21.259 1.00 27.44  ? 239  ASP A OD2  1 
ATOM   3590 H H    . ASP A 1 239 ? 4.943   0.576   24.378 1.00 14.12  ? 239  ASP A H    1 
ATOM   3591 H HA   . ASP A 1 239 ? 4.720   -2.103  24.892 1.00 13.57  ? 239  ASP A HA   1 
ATOM   3592 H HB2  . ASP A 1 239 ? 3.604   -1.757  22.860 1.00 16.66  ? 239  ASP A HB2  1 
ATOM   3593 H HB3  . ASP A 1 239 ? 4.859   -1.032  22.265 1.00 16.66  ? 239  ASP A HB3  1 
ATOM   3594 N N    . SER A 1 240 ? 7.106   -2.020  25.410 1.00 12.14  ? 240  SER A N    1 
ATOM   3595 C CA   . SER A 1 240 ? 8.494   -2.003  25.648 1.00 14.10  ? 240  SER A CA   1 
ATOM   3596 C C    . SER A 1 240 ? 9.362   -2.840  24.597 1.00 14.95  ? 240  SER A C    1 
ATOM   3597 O O    . SER A 1 240 ? 10.530  -2.659  24.547 1.00 21.27  ? 240  SER A O    1 
ATOM   3598 C CB   . SER A 1 240 ? 8.816   -2.499  27.116 1.00 15.07  ? 240  SER A CB   1 
ATOM   3599 O OG   . SER A 1 240 ? 8.360   -3.809  27.309 1.00 16.96  ? 240  SER A OG   1 
ATOM   3600 H H    . SER A 1 240 ? 6.591   -2.463  25.937 1.00 14.57  ? 240  SER A H    1 
ATOM   3601 H HA   . SER A 1 240 ? 8.787   -1.070  25.587 1.00 16.92  ? 240  SER A HA   1 
ATOM   3602 H HB2  . SER A 1 240 ? 9.774   -2.465  27.267 1.00 18.08  ? 240  SER A HB2  1 
ATOM   3603 H HB3  . SER A 1 240 ? 8.389   -1.910  27.758 1.00 18.08  ? 240  SER A HB3  1 
ATOM   3604 H HG   . SER A 1 240 ? 7.549   -3.837  27.190 1.00 25.44  ? 240  SER A HG   1 
ATOM   3605 N N    . ASN A 1 241 ? 8.642   -3.731  23.828 1.00 15.53  ? 241  ASN A N    1 
ATOM   3606 C CA   . ASN A 1 241 ? 9.363   -4.386  22.754 1.00 18.22  ? 241  ASN A CA   1 
ATOM   3607 C C    . ASN A 1 241 ? 9.695   -3.355  21.651 1.00 16.87  ? 241  ASN A C    1 
ATOM   3608 O O    . ASN A 1 241 ? 10.627  -3.531  20.917 1.00 23.88  ? 241  ASN A O    1 
ATOM   3609 C CB   . ASN A 1 241 ? 8.428   -5.517  22.087 1.00 20.55  ? 241  ASN A CB   1 
ATOM   3610 C CG   . ASN A 1 241 ? 7.918   -6.612  23.004 1.00 20.41  ? 241  ASN A CG   1 
ATOM   3611 O OD1  . ASN A 1 241 ? 8.789   -7.012  23.844 1.00 24.85  ? 241  ASN A OD1  1 
ATOM   3612 N ND2  . ASN A 1 241 ? 6.680   -7.047  23.076 1.00 23.42  ? 241  ASN A ND2  1 
ATOM   3613 H H    . ASN A 1 241 ? 7.811   -3.889  23.978 1.00 18.64  ? 241  ASN A H    1 
ATOM   3614 H HA   . ASN A 1 241 ? 10.188  -4.789  23.097 1.00 21.87  ? 241  ASN A HA   1 
ATOM   3615 H HB2  . ASN A 1 241 ? 7.661   -5.076  21.689 1.00 24.66  ? 241  ASN A HB2  1 
ATOM   3616 H HB3  . ASN A 1 241 ? 8.926   -5.934  21.368 1.00 24.66  ? 241  ASN A HB3  1 
ATOM   3617 H HD21 . ASN A 1 241 ? 6.095   -6.776  22.508 1.00 28.10  ? 241  ASN A HD21 1 
ATOM   3618 H HD22 . ASN A 1 241 ? 6.455   -7.604  23.692 1.00 28.10  ? 241  ASN A HD22 1 
ATOM   3619 N N    . ALA A 1 242 ? 8.843   -2.332  21.498 1.00 15.31  ? 242  ALA A N    1 
ATOM   3620 C CA   . ALA A 1 242 ? 8.986   -1.347  20.445 1.00 14.76  ? 242  ALA A CA   1 
ATOM   3621 C C    . ALA A 1 242 ? 9.788   -0.102  20.882 1.00 15.23  ? 242  ALA A C    1 
ATOM   3622 O O    . ALA A 1 242 ? 10.362  0.589   20.022 1.00 19.24  ? 242  ALA A O    1 
ATOM   3623 C CB   . ALA A 1 242 ? 7.626   -0.861  20.027 1.00 16.00  ? 242  ALA A CB   1 
ATOM   3624 H H    . ALA A 1 242 ? 8.185   -2.257  22.047 1.00 18.37  ? 242  ALA A H    1 
ATOM   3625 H HA   . ALA A 1 242 ? 9.430   -1.762  19.675 1.00 17.71  ? 242  ALA A HA   1 
ATOM   3626 H HB1  . ALA A 1 242 ? 7.716   -0.245  19.297 1.00 23.99  ? 242  ALA A HB1  1 
ATOM   3627 H HB2  . ALA A 1 242 ? 7.090   -1.608  19.751 1.00 23.99  ? 242  ALA A HB2  1 
ATOM   3628 H HB3  . ALA A 1 242 ? 7.203   -0.420  20.768 1.00 23.99  ? 242  ALA A HB3  1 
ATOM   3629 N N    . GLY A 1 243 ? 9.747   0.262   22.126 1.00 17.13  ? 243  GLY A N    1 
ATOM   3630 C CA   . GLY A 1 243 ? 10.438  1.378   22.656 1.00 23.47  ? 243  GLY A CA   1 
ATOM   3631 C C    . GLY A 1 243 ? 9.535   2.564   23.173 1.00 16.67  ? 243  GLY A C    1 
ATOM   3632 O O    . GLY A 1 243 ? 10.081  3.682   23.424 1.00 20.09  ? 243  GLY A O    1 
ATOM   3633 H H    . GLY A 1 243 ? 9.269   -0.206  22.666 1.00 20.56  ? 243  GLY A H    1 
ATOM   3634 H HA2  . GLY A 1 243 ? 10.992  1.073   23.391 1.00 28.17  ? 243  GLY A HA2  1 
ATOM   3635 H HA3  . GLY A 1 243 ? 11.031  1.723   21.970 1.00 28.17  ? 243  GLY A HA3  1 
ATOM   3636 N N    . GLY A 1 244 ? 8.285   2.306   23.452 1.00 11.76  ? 244  GLY A N    1 
ATOM   3637 C CA   . GLY A 1 244 ? 7.450   3.327   24.038 1.00 11.04  ? 244  GLY A CA   1 
ATOM   3638 C C    . GLY A 1 244 ? 6.016   3.244   23.529 1.00 10.50  ? 244  GLY A C    1 
ATOM   3639 O O    . GLY A 1 244 ? 5.520   2.143   23.219 1.00 10.84  ? 244  GLY A O    1 
ATOM   3640 H H    . GLY A 1 244 ? 7.959   1.527   23.286 1.00 14.11  ? 244  GLY A H    1 
ATOM   3641 H HA2  . GLY A 1 244 ? 7.454   3.229   25.003 1.00 13.25  ? 244  GLY A HA2  1 
ATOM   3642 H HA3  . GLY A 1 244 ? 7.816   4.200   23.824 1.00 13.25  ? 244  GLY A HA3  1 
ATOM   3643 N N    . TYR A 1 245 ? 5.332   4.391   23.493 1.00 10.41  ? 245  TYR A N    1 
ATOM   3644 C CA   . TYR A 1 245 ? 3.937   4.429   23.037 1.00 10.64  ? 245  TYR A CA   1 
ATOM   3645 C C    . TYR A 1 245 ? 3.851   4.035   21.582 1.00 10.62  ? 245  TYR A C    1 
ATOM   3646 O O    . TYR A 1 245 ? 4.596   4.585   20.710 1.00 11.29  ? 245  TYR A O    1 
ATOM   3647 C CB   . TYR A 1 245 ? 3.314   5.816   23.264 1.00 11.66  ? 245  TYR A CB   1 
ATOM   3648 C CG   . TYR A 1 245 ? 2.957   6.121   24.739 1.00 12.59  ? 245  TYR A CG   1 
ATOM   3649 C CD1  . TYR A 1 245 ? 1.701   5.702   25.274 1.00 14.25  ? 245  TYR A CD1  1 
ATOM   3650 C CD2  . TYR A 1 245 ? 3.849   6.710   25.625 1.00 14.69  ? 245  TYR A CD2  1 
ATOM   3651 C CE1  . TYR A 1 245 ? 1.379   5.951   26.606 1.00 17.63  ? 245  TYR A CE1  1 
ATOM   3652 C CE2  . TYR A 1 245 ? 3.517   6.916   27.012 1.00 15.70  ? 245  TYR A CE2  1 
ATOM   3653 C CZ   . TYR A 1 245 ? 2.289   6.463   27.445 1.00 19.41  ? 245  TYR A CZ   1 
ATOM   3654 O OH   . TYR A 1 245 ? 1.997   6.651   28.831 1.00 27.63  ? 245  TYR A OH   1 
ATOM   3655 H H    . TYR A 1 245 ? 5.716   5.120   23.740 1.00 12.49  ? 245  TYR A H    1 
ATOM   3656 H HA   . TYR A 1 245 ? 3.427   3.776   23.560 1.00 12.77  ? 245  TYR A HA   1 
ATOM   3657 H HB2  . TYR A 1 245 ? 3.936   6.491   22.949 1.00 13.99  ? 245  TYR A HB2  1 
ATOM   3658 H HB3  . TYR A 1 245 ? 2.509   5.886   22.728 1.00 13.99  ? 245  TYR A HB3  1 
ATOM   3659 H HD1  . TYR A 1 245 ? 1.092   5.259   24.729 1.00 17.10  ? 245  TYR A HD1  1 
ATOM   3660 H HD2  . TYR A 1 245 ? 4.683   6.979   25.314 1.00 17.63  ? 245  TYR A HD2  1 
ATOM   3661 H HE1  . TYR A 1 245 ? 0.524   5.760   26.916 1.00 21.16  ? 245  TYR A HE1  1 
ATOM   3662 H HE2  . TYR A 1 245 ? 4.108   7.339   27.592 1.00 18.84  ? 245  TYR A HE2  1 
ATOM   3663 H HH   . TYR A 1 245 ? 1.238   6.382   28.989 1.00 41.45  ? 245  TYR A HH   1 
ATOM   3664 N N    . VAL A 1 246 ? 2.906   3.140   21.287 1.00 10.65  ? 246  VAL A N    1 
ATOM   3665 C CA   . VAL A 1 246 ? 2.568   2.651   19.965 1.00 11.30  ? 246  VAL A CA   1 
ATOM   3666 C C    . VAL A 1 246 ? 1.053   2.831   19.760 1.00 11.73  ? 246  VAL A C    1 
ATOM   3667 O O    . VAL A 1 246 ? 0.267   2.989   20.700 1.00 13.56  ? 246  VAL A O    1 
ATOM   3668 C CB   . VAL A 1 246 ? 2.966   1.169   19.737 1.00 11.41  ? 246  VAL A CB   1 
ATOM   3669 C CG1  . VAL A 1 246 ? 4.466   0.965   19.937 1.00 11.61  ? 246  VAL A CG1  1 
ATOM   3670 C CG2  . VAL A 1 246 ? 2.154   0.208   20.622 1.00 12.76  ? 246  VAL A CG2  1 
ATOM   3671 H H    . VAL A 1 246 ? 2.453   2.822   21.946 1.00 12.78  ? 246  VAL A H    1 
ATOM   3672 H HA   . VAL A 1 246 ? 3.036   3.202   19.303 1.00 13.56  ? 246  VAL A HA   1 
ATOM   3673 H HB   . VAL A 1 246 ? 2.762   0.951   18.803 1.00 13.69  ? 246  VAL A HB   1 
ATOM   3674 H HG11 . VAL A 1 246 ? 4.950   1.575   19.375 1.00 17.42  ? 246  VAL A HG11 1 
ATOM   3675 H HG12 . VAL A 1 246 ? 4.692   1.128   20.855 1.00 17.42  ? 246  VAL A HG12 1 
ATOM   3676 H HG13 . VAL A 1 246 ? 4.700   0.063   19.705 1.00 17.42  ? 246  VAL A HG13 1 
ATOM   3677 H HG21 . VAL A 1 246 ? 2.366   0.366   21.545 1.00 19.14  ? 246  VAL A HG21 1 
ATOM   3678 H HG22 . VAL A 1 246 ? 1.216   0.356   20.479 1.00 19.14  ? 246  VAL A HG22 1 
ATOM   3679 H HG23 . VAL A 1 246 ? 2.373   -0.699  20.395 1.00 19.14  ? 246  VAL A HG23 1 
ATOM   3680 N N    . PHE A 1 247 ? 0.664   2.735   18.464 1.00 11.94  ? 247  PHE A N    1 
ATOM   3681 C CA   . PHE A 1 247 ? -0.726  2.914   18.079 1.00 12.78  ? 247  PHE A CA   1 
ATOM   3682 C C    . PHE A 1 247 ? -0.978  2.310   16.732 1.00 12.63  ? 247  PHE A C    1 
ATOM   3683 O O    . PHE A 1 247 ? -0.043  1.954   15.989 1.00 13.08  ? 247  PHE A O    1 
ATOM   3684 C CB   . PHE A 1 247 ? -1.130  4.459   18.060 1.00 12.94  ? 247  PHE A CB   1 
ATOM   3685 C CG   . PHE A 1 247 ? -0.071  5.279   17.428 1.00 12.56  ? 247  PHE A CG   1 
ATOM   3686 C CD1  . PHE A 1 247 ? 0.115   5.334   16.084 1.00 12.88  ? 247  PHE A CD1  1 
ATOM   3687 C CD2  . PHE A 1 247 ? 0.885   5.941   18.253 1.00 12.40  ? 247  PHE A CD2  1 
ATOM   3688 C CE1  . PHE A 1 247 ? 1.197   5.999   15.494 1.00 12.20  ? 247  PHE A CE1  1 
ATOM   3689 C CE2  . PHE A 1 247 ? 1.975   6.599   17.676 1.00 12.19  ? 247  PHE A CE2  1 
ATOM   3690 C CZ   . PHE A 1 247 ? 2.131   6.604   16.302 1.00 11.98  ? 247  PHE A CZ   1 
ATOM   3691 H H    . PHE A 1 247 ? 1.251   2.565   17.859 1.00 14.33  ? 247  PHE A H    1 
ATOM   3692 H HA   . PHE A 1 247 ? -1.290  2.454   18.735 1.00 15.34  ? 247  PHE A HA   1 
ATOM   3693 H HB2  . PHE A 1 247 ? -1.960  4.569   17.569 1.00 15.53  ? 247  PHE A HB2  1 
ATOM   3694 H HB3  . PHE A 1 247 ? -1.276  4.765   18.969 1.00 15.53  ? 247  PHE A HB3  1 
ATOM   3695 H HD1  . PHE A 1 247 ? -0.503  4.912   15.532 1.00 15.46  ? 247  PHE A HD1  1 
ATOM   3696 H HD2  . PHE A 1 247 ? 0.784   5.934   19.178 1.00 14.89  ? 247  PHE A HD2  1 
ATOM   3697 H HE1  . PHE A 1 247 ? 1.283   6.030   14.569 1.00 14.64  ? 247  PHE A HE1  1 
ATOM   3698 H HE2  . PHE A 1 247 ? 2.596   7.033   18.216 1.00 14.63  ? 247  PHE A HE2  1 
ATOM   3699 H HZ   . PHE A 1 247 ? 2.872   7.019   15.921 1.00 14.37  ? 247  PHE A HZ   1 
ATOM   3700 N N    . ASP A 1 248 ? -2.226  2.196   16.317 1.00 14.28  ? 248  ASP A N    1 
ATOM   3701 C CA   . ASP A 1 248 ? -2.516  1.606   15.026 1.00 15.38  ? 248  ASP A CA   1 
ATOM   3702 C C    . ASP A 1 248 ? -1.934  2.512   13.948 1.00 14.11  ? 248  ASP A C    1 
ATOM   3703 O O    . ASP A 1 248 ? -1.956  3.736   13.959 1.00 14.74  ? 248  ASP A O    1 
ATOM   3704 C CB   A ASP A 1 248 ? -3.954  1.464   14.678 0.34 20.81  ? 248  ASP A CB   1 
ATOM   3705 C CB   B ASP A 1 248 ? -4.030  1.611   14.813 0.66 23.02  ? 248  ASP A CB   1 
ATOM   3706 C CG   A ASP A 1 248 ? -4.552  0.202   15.435 0.34 21.49  ? 248  ASP A CG   1 
ATOM   3707 C CG   B ASP A 1 248 ? -4.478  1.045   13.459 0.66 28.14  ? 248  ASP A CG   1 
ATOM   3708 O OD1  A ASP A 1 248 ? -3.808  -0.531  16.086 0.34 16.88  ? 248  ASP A OD1  1 
ATOM   3709 O OD1  B ASP A 1 248 ? -4.255  1.427   12.436 0.66 46.33  ? 248  ASP A OD1  1 
ATOM   3710 O OD2  A ASP A 1 248 ? -5.809  0.217   15.406 0.34 22.57  ? 248  ASP A OD2  1 
ATOM   3711 O OD2  B ASP A 1 248 ? -5.381  0.210   13.698 0.66 46.93  ? 248  ASP A OD2  1 
ATOM   3712 H H    . ASP A 1 248 ? -2.870  2.474   16.814 1.00 17.13  ? 248  ASP A H    1 
ATOM   3713 H HA   A ASP A 1 248 ? -2.085  0.727   14.973 1.00 18.45  ? 248  ASP A HA   1 
ATOM   3714 H HB2  A ASP A 1 248 ? -4.436  2.264   14.940 0.34 24.97  ? 248  ASP A HB2  1 
ATOM   3715 H HB2  B ASP A 1 248 ? -4.445  1.092   15.519 0.66 27.62  ? 248  ASP A HB2  1 
ATOM   3716 H HB3  A ASP A 1 248 ? -4.051  1.350   13.720 0.34 24.97  ? 248  ASP A HB3  1 
ATOM   3717 H HB3  B ASP A 1 248 ? -4.352  2.523   14.891 0.66 27.62  ? 248  ASP A HB3  1 
ATOM   3718 N N    . CYS A 1 249 ? -1.374  1.858   12.930 1.00 14.80  ? 249  CYS A N    1 
ATOM   3719 C CA   . CYS A 1 249 ? -0.654  2.613   11.887 1.00 15.62  ? 249  CYS A CA   1 
ATOM   3720 C C    . CYS A 1 249 ? -1.542  3.593   11.085 1.00 15.64  ? 249  CYS A C    1 
ATOM   3721 O O    . CYS A 1 249 ? -0.938  4.554   10.520 1.00 17.22  ? 249  CYS A O    1 
ATOM   3722 C CB   A CYS A 1 249 ? -0.051  1.581   10.900 0.46 22.11  ? 249  CYS A CB   1 
ATOM   3723 C CB   B CYS A 1 249 ? 0.216   1.726   10.933 0.54 14.87  ? 249  CYS A CB   1 
ATOM   3724 S SG   A CYS A 1 249 ? 0.750   0.033   11.342 0.46 45.19  ? 249  CYS A SG   1 
ATOM   3725 S SG   B CYS A 1 249 ? 1.526   0.863   11.798 0.54 14.23  ? 249  CYS A SG   1 
ATOM   3726 H H    . CYS A 1 249 ? -1.433  1.001   12.882 1.00 17.76  ? 249  CYS A H    1 
ATOM   3727 H HA   A CYS A 1 249 ? 0.076   3.115   12.305 1.00 18.74  ? 249  CYS A HA   1 
ATOM   3728 H HB2  A CYS A 1 249 ? -0.771  1.342   10.295 0.46 26.54  ? 249  CYS A HB2  1 
ATOM   3729 H HB2  B CYS A 1 249 ? -0.356  1.076   10.496 0.54 17.84  ? 249  CYS A HB2  1 
ATOM   3730 H HB3  A CYS A 1 249 ? 0.597   2.070   10.369 0.46 26.54  ? 249  CYS A HB3  1 
ATOM   3731 H HB3  B CYS A 1 249 ? 0.606   2.288   10.246 0.54 17.84  ? 249  CYS A HB3  1 
ATOM   3732 N N    . SER A 1 250 ? -2.824  3.381   11.033 1.00 14.77  ? 250  SER A N    1 
ATOM   3733 C CA   . SER A 1 250 ? -3.724  4.246   10.316 1.00 15.89  ? 250  SER A CA   1 
ATOM   3734 C C    . SER A 1 250 ? -4.157  5.479   11.142 1.00 15.25  ? 250  SER A C    1 
ATOM   3735 O O    . SER A 1 250 ? -4.973  6.287   10.655 1.00 19.33  ? 250  SER A O    1 
ATOM   3736 C CB   . SER A 1 250 ? -4.969  3.506   9.894  1.00 18.38  ? 250  SER A CB   1 
ATOM   3737 O OG   . SER A 1 250 ? -5.688  2.914   10.990 1.00 23.20  ? 250  SER A OG   1 
ATOM   3738 H H    . SER A 1 250 ? -3.147  2.697   11.443 1.00 17.73  ? 250  SER A H    1 
ATOM   3739 H HA   . SER A 1 250 ? -3.267  4.563   9.509  1.00 19.07  ? 250  SER A HA   1 
ATOM   3740 H HB2  . SER A 1 250 ? -5.557  4.122   9.430  1.00 22.05  ? 250  SER A HB2  1 
ATOM   3741 H HB3  . SER A 1 250 ? -4.721  2.807   9.269  1.00 22.05  ? 250  SER A HB3  1 
ATOM   3742 H HG   . SER A 1 250 ? -5.204  2.377   11.377 1.00 34.80  ? 250  SER A HG   1 
ATOM   3743 N N    . THR A 1 251 ? -3.719  5.610   12.366 1.00 14.35  ? 251  THR A N    1 
ATOM   3744 C CA   . THR A 1 251 ? -4.157  6.702   13.269 1.00 15.04  ? 251  THR A CA   1 
ATOM   3745 C C    . THR A 1 251 ? -3.867  8.049   12.675 1.00 15.29  ? 251  THR A C    1 
ATOM   3746 O O    . THR A 1 251 ? -2.739  8.316   12.185 1.00 16.53  ? 251  THR A O    1 
ATOM   3747 C CB   . THR A 1 251 ? -3.444  6.641   14.606 1.00 16.95  ? 251  THR A CB   1 
ATOM   3748 O OG1  . THR A 1 251 ? -3.741  5.406   15.244 1.00 19.49  ? 251  THR A OG1  1 
ATOM   3749 C CG2  . THR A 1 251 ? -3.948  7.650   15.509 1.00 27.93  ? 251  THR A CG2  1 
ATOM   3750 H H    . THR A 1 251 ? -3.151  5.037   12.662 1.00 17.22  ? 251  THR A H    1 
ATOM   3751 H HA   . THR A 1 251 ? -5.122  6.622   13.419 1.00 18.05  ? 251  THR A HA   1 
ATOM   3752 H HB   . THR A 1 251 ? -2.477  6.741   14.484 1.00 20.34  ? 251  THR A HB   1 
ATOM   3753 H HG1  . THR A 1 251 ? -3.470  4.786   14.781 1.00 29.24  ? 251  THR A HG1  1 
ATOM   3754 H HG21 . THR A 1 251 ? -3.806  8.520   15.129 1.00 41.89  ? 251  THR A HG21 1 
ATOM   3755 H HG22 . THR A 1 251 ? -4.888  7.512   15.650 1.00 41.89  ? 251  THR A HG22 1 
ATOM   3756 H HG23 . THR A 1 251 ? -3.486  7.587   16.348 1.00 41.89  ? 251  THR A HG23 1 
ATOM   3757 N N    . ASN A 1 252 ? -4.849  8.949   12.801 1.00 16.56  ? 252  ASN A N    1 
ATOM   3758 C CA   . ASN A 1 252 ? -4.601  10.354  12.470 1.00 18.89  ? 252  ASN A CA   1 
ATOM   3759 C C    . ASN A 1 252 ? -3.986  11.119  13.604 1.00 18.61  ? 252  ASN A C    1 
ATOM   3760 O O    . ASN A 1 252 ? -4.805  11.539  14.450 1.00 20.36  ? 252  ASN A O    1 
ATOM   3761 C CB   . ASN A 1 252 ? -5.918  10.982  12.104 1.00 26.53  ? 252  ASN A CB   1 
ATOM   3762 C CG   . ASN A 1 252 ? -6.409  10.581  10.807 1.00 31.79  ? 252  ASN A CG   1 
ATOM   3763 O OD1  . ASN A 1 252 ? -7.690  10.363  10.609 1.00 48.90  ? 252  ASN A OD1  1 
ATOM   3764 N ND2  . ASN A 1 252 ? -5.559  10.667  9.702  1.00 44.72  ? 252  ASN A ND2  1 
ATOM   3765 H H    . ASN A 1 252 ? -5.625  8.703   13.077 1.00 19.87  ? 252  ASN A H    1 
ATOM   3766 H HA   . ASN A 1 252 ? -4.002  10.398  11.695 1.00 22.67  ? 252  ASN A HA   1 
ATOM   3767 H HB2  . ASN A 1 252 ? -6.576  10.743  12.775 1.00 31.84  ? 252  ASN A HB2  1 
ATOM   3768 H HB3  . ASN A 1 252 ? -5.820  11.947  12.117 1.00 31.84  ? 252  ASN A HB3  1 
ATOM   3769 H HD21 . ASN A 1 252 ? -4.719  10.809  9.816  1.00 53.66  ? 252  ASN A HD21 1 
ATOM   3770 H HD22 . ASN A 1 252 ? -5.876  10.577  8.908  1.00 53.66  ? 252  ASN A HD22 1 
ATOM   3771 N N    . LEU A 1 253 ? -2.720  11.356  13.667 1.00 13.33  ? 253  LEU A N    1 
ATOM   3772 C CA   . LEU A 1 253 ? -1.974  11.884  14.826 1.00 11.99  ? 253  LEU A CA   1 
ATOM   3773 C C    . LEU A 1 253 ? -2.078  13.410  14.886 1.00 11.66  ? 253  LEU A C    1 
ATOM   3774 O O    . LEU A 1 253 ? -1.996  14.106  13.852 1.00 12.66  ? 253  LEU A O    1 
ATOM   3775 C CB   . LEU A 1 253 ? -0.512  11.526  14.723 1.00 11.70  ? 253  LEU A CB   1 
ATOM   3776 C CG   . LEU A 1 253 ? -0.202  10.013  14.844 1.00 12.96  ? 253  LEU A CG   1 
ATOM   3777 C CD1  . LEU A 1 253 ? 1.261   9.784   14.531 1.00 14.44  ? 253  LEU A CD1  1 
ATOM   3778 C CD2  . LEU A 1 253 ? -0.567  9.503   16.218 1.00 14.53  ? 253  LEU A CD2  1 
ATOM   3779 H H    . LEU A 1 253 ? -2.261  11.189  12.959 1.00 15.99  ? 253  LEU A H    1 
ATOM   3780 H HA   . LEU A 1 253 ? -2.343  11.503  15.650 1.00 14.38  ? 253  LEU A HA   1 
ATOM   3781 H HB2  . LEU A 1 253 ? -0.176  11.842  13.870 1.00 14.04  ? 253  LEU A HB2  1 
ATOM   3782 H HB3  . LEU A 1 253 ? -0.029  11.997  15.420 1.00 14.04  ? 253  LEU A HB3  1 
ATOM   3783 H HG   . LEU A 1 253 ? -0.740  9.532   14.182 1.00 15.55  ? 253  LEU A HG   1 
ATOM   3784 H HD11 . LEU A 1 253 ? 1.457   10.121  13.654 1.00 21.66  ? 253  LEU A HD11 1 
ATOM   3785 H HD12 . LEU A 1 253 ? 1.803   10.241  15.178 1.00 21.66  ? 253  LEU A HD12 1 
ATOM   3786 H HD13 . LEU A 1 253 ? 1.452   8.843   14.562 1.00 21.66  ? 253  LEU A HD13 1 
ATOM   3787 H HD21 . LEU A 1 253 ? -0.040  9.957   16.879 1.00 21.79  ? 253  LEU A HD21 1 
ATOM   3788 H HD22 . LEU A 1 253 ? -1.498  9.668   16.384 1.00 21.79  ? 253  LEU A HD22 1 
ATOM   3789 H HD23 . LEU A 1 253 ? -0.396  8.559   16.265 1.00 21.79  ? 253  LEU A HD23 1 
ATOM   3790 N N    . PRO A 1 254 ? -2.221  13.961  16.073 1.00 11.56  ? 254  PRO A N    1 
ATOM   3791 C CA   . PRO A 1 254 ? -2.191  15.419  16.216 1.00 10.99  ? 254  PRO A CA   1 
ATOM   3792 C C    . PRO A 1 254 ? -0.827  16.016  15.909 1.00 10.05  ? 254  PRO A C    1 
ATOM   3793 O O    . PRO A 1 254 ? 0.218   15.338  16.008 1.00 10.54  ? 254  PRO A O    1 
ATOM   3794 C CB   . PRO A 1 254 ? -2.545  15.656  17.735 1.00 13.32  ? 254  PRO A CB   1 
ATOM   3795 C CG   . PRO A 1 254 ? -2.973  14.366  18.247 1.00 17.36  ? 254  PRO A CG   1 
ATOM   3796 C CD   . PRO A 1 254 ? -2.488  13.281  17.346 1.00 13.15  ? 254  PRO A CD   1 
ATOM   3797 H HA   . PRO A 1 254 ? -2.874  15.827  15.643 1.00 13.19  ? 254  PRO A HA   1 
ATOM   3798 H HB2  . PRO A 1 254 ? -1.767  15.975  18.220 1.00 15.99  ? 254  PRO A HB2  1 
ATOM   3799 H HB3  . PRO A 1 254 ? -3.256  16.311  17.822 1.00 15.99  ? 254  PRO A HB3  1 
ATOM   3800 H HG2  . PRO A 1 254 ? -2.618  14.234  19.140 1.00 20.83  ? 254  PRO A HG2  1 
ATOM   3801 H HG3  . PRO A 1 254 ? -3.942  14.340  18.299 1.00 20.83  ? 254  PRO A HG3  1 
ATOM   3802 H HD2  . PRO A 1 254 ? -1.680  12.874  17.697 1.00 15.78  ? 254  PRO A HD2  1 
ATOM   3803 H HD3  . PRO A 1 254 ? -3.164  12.594  17.236 1.00 15.78  ? 254  PRO A HD3  1 
ATOM   3804 N N    . ASP A 1 255 ? -0.801  17.302  15.557 1.00 10.54  ? 255  ASP A N    1 
ATOM   3805 C CA   . ASP A 1 255 ? 0.456   18.012  15.389 1.00 9.99   ? 255  ASP A CA   1 
ATOM   3806 C C    . ASP A 1 255 ? 1.077   18.321  16.783 1.00 9.91   ? 255  ASP A C    1 
ATOM   3807 O O    . ASP A 1 255 ? 0.379   18.312  17.811 1.00 11.02  ? 255  ASP A O    1 
ATOM   3808 C CB   . ASP A 1 255 ? 0.210   19.351  14.635 1.00 11.09  ? 255  ASP A CB   1 
ATOM   3809 C CG   . ASP A 1 255 ? -0.460  19.150  13.279 1.00 12.86  ? 255  ASP A CG   1 
ATOM   3810 O OD1  . ASP A 1 255 ? -0.244  18.121  12.580 1.00 12.62  ? 255  ASP A OD1  1 
ATOM   3811 O OD2  . ASP A 1 255 ? -1.241  20.060  12.877 1.00 20.36  ? 255  ASP A OD2  1 
ATOM   3812 H H    . ASP A 1 255 ? -1.542  17.719  15.428 1.00 12.65  ? 255  ASP A H    1 
ATOM   3813 H HA   . ASP A 1 255 ? 1.076   17.457  14.872 1.00 11.98  ? 255  ASP A HA   1 
ATOM   3814 H HB2  . ASP A 1 255 ? -0.349  19.924  15.182 1.00 13.31  ? 255  ASP A HB2  1 
ATOM   3815 H HB3  . ASP A 1 255 ? 1.059   19.801  14.504 1.00 13.31  ? 255  ASP A HB3  1 
ATOM   3816 N N    . PHE A 1 256 ? 2.374   18.651  16.774 1.00 9.81   ? 256  PHE A N    1 
ATOM   3817 C CA   . PHE A 1 256 ? 3.084   19.142  17.958 1.00 9.72   ? 256  PHE A CA   1 
ATOM   3818 C C    . PHE A 1 256 ? 3.878   20.367  17.570 1.00 9.83   ? 256  PHE A C    1 
ATOM   3819 O O    . PHE A 1 256 ? 4.638   20.287  16.596 1.00 11.68  ? 256  PHE A O    1 
ATOM   3820 C CB   . PHE A 1 256 ? 4.008   18.038  18.522 1.00 10.36  ? 256  PHE A CB   1 
ATOM   3821 C CG   . PHE A 1 256 ? 4.772   18.517  19.736 1.00 10.50  ? 256  PHE A CG   1 
ATOM   3822 C CD1  . PHE A 1 256 ? 4.194   18.459  20.996 1.00 11.89  ? 256  PHE A CD1  1 
ATOM   3823 C CD2  . PHE A 1 256 ? 6.035   19.054  19.651 1.00 11.91  ? 256  PHE A CD2  1 
ATOM   3824 C CE1  . PHE A 1 256 ? 4.872   18.996  22.134 1.00 13.99  ? 256  PHE A CE1  1 
ATOM   3825 C CE2  . PHE A 1 256 ? 6.735   19.549  20.732 1.00 13.86  ? 256  PHE A CE2  1 
ATOM   3826 C CZ   . PHE A 1 256 ? 6.095   19.540  21.967 1.00 14.58  ? 256  PHE A CZ   1 
ATOM   3827 H H    . PHE A 1 256 ? 2.812   18.571  16.038 1.00 11.77  ? 256  PHE A H    1 
ATOM   3828 H HA   . PHE A 1 256 ? 2.429   19.390  18.644 1.00 11.66  ? 256  PHE A HA   1 
ATOM   3829 H HB2  . PHE A 1 256 ? 3.475   17.265  18.763 1.00 12.44  ? 256  PHE A HB2  1 
ATOM   3830 H HB3  . PHE A 1 256 ? 4.637   17.765  17.835 1.00 12.44  ? 256  PHE A HB3  1 
ATOM   3831 H HD1  . PHE A 1 256 ? 3.358   18.066  21.102 1.00 14.27  ? 256  PHE A HD1  1 
ATOM   3832 H HD2  . PHE A 1 256 ? 6.442   19.084  18.815 1.00 14.29  ? 256  PHE A HD2  1 
ATOM   3833 H HE1  . PHE A 1 256 ? 4.477   18.971  22.975 1.00 16.78  ? 256  PHE A HE1  1 
ATOM   3834 H HE2  . PHE A 1 256 ? 7.600   19.876  20.638 1.00 16.63  ? 256  PHE A HE2  1 
ATOM   3835 H HZ   . PHE A 1 256 ? 6.523   19.921  22.700 1.00 17.50  ? 256  PHE A HZ   1 
ATOM   3836 N N    . SER A 1 257 ? 3.776   21.437  18.353 1.00 9.58   ? 257  SER A N    1 
ATOM   3837 C CA   . SER A 1 257 ? 4.535   22.666  18.018 1.00 10.12  ? 257  SER A CA   1 
ATOM   3838 C C    . SER A 1 257 ? 5.148   23.277  19.286 1.00 9.73   ? 257  SER A C    1 
ATOM   3839 O O    . SER A 1 257 ? 4.658   23.072  20.410 1.00 10.39  ? 257  SER A O    1 
ATOM   3840 C CB   A SER A 1 257 ? 3.496   23.693  17.496 0.49 10.79  ? 257  SER A CB   1 
ATOM   3841 C CB   B SER A 1 257 ? 3.718   23.715  17.209 0.51 11.80  ? 257  SER A CB   1 
ATOM   3842 O OG   A SER A 1 257 ? 2.766   23.206  16.375 0.49 11.59  ? 257  SER A OG   1 
ATOM   3843 O OG   B SER A 1 257 ? 2.752   24.193  18.002 0.51 12.05  ? 257  SER A OG   1 
ATOM   3844 H H    . SER A 1 257 ? 3.273   21.416  19.051 1.00 11.49  ? 257  SER A H    1 
ATOM   3845 H HA   A SER A 1 257 ? 5.223   22.485  17.344 1.00 12.14  ? 257  SER A HA   1 
ATOM   3846 H HB2  A SER A 1 257 ? 2.876   23.908  18.210 0.49 12.95  ? 257  SER A HB2  1 
ATOM   3847 H HB2  B SER A 1 257 ? 4.298   24.437  16.919 0.51 14.16  ? 257  SER A HB2  1 
ATOM   3848 H HB3  A SER A 1 257 ? 3.955   24.510  17.245 0.49 12.95  ? 257  SER A HB3  1 
ATOM   3849 H HB3  B SER A 1 257 ? 3.329   23.300  16.424 0.51 14.16  ? 257  SER A HB3  1 
ATOM   3850 H HG   A SER A 1 257 ? 2.359   22.527  16.588 0.49 17.39  ? 257  SER A HG   1 
ATOM   3851 H HG   B SER A 1 257 ? 3.088   24.547  18.661 0.51 18.07  ? 257  SER A HG   1 
ATOM   3852 N N    . VAL A 1 258 ? 6.190   24.075  19.055 1.00 10.02  ? 258  VAL A N    1 
ATOM   3853 C CA   . VAL A 1 258 ? 6.831   24.892  20.104 1.00 9.54   ? 258  VAL A CA   1 
ATOM   3854 C C    . VAL A 1 258 ? 6.970   26.314  19.623 1.00 9.90   ? 258  VAL A C    1 
ATOM   3855 O O    . VAL A 1 258 ? 7.173   26.568  18.433 1.00 11.26  ? 258  VAL A O    1 
ATOM   3856 C CB   . VAL A 1 258 ? 8.167   24.324  20.582 1.00 9.74   ? 258  VAL A CB   1 
ATOM   3857 C CG1  . VAL A 1 258 ? 7.978   23.002  21.363 1.00 10.90  ? 258  VAL A CG1  1 
ATOM   3858 C CG2  . VAL A 1 258 ? 9.148   24.125  19.441 1.00 10.80  ? 258  VAL A CG2  1 
ATOM   3859 H H    . VAL A 1 258 ? 6.505   24.115  18.255 1.00 12.03  ? 258  VAL A H    1 
ATOM   3860 H HA   . VAL A 1 258 ? 6.226   24.903  20.874 1.00 11.45  ? 258  VAL A HA   1 
ATOM   3861 H HB   . VAL A 1 258 ? 8.560   24.976  21.199 1.00 11.69  ? 258  VAL A HB   1 
ATOM   3862 H HG11 . VAL A 1 258 ? 7.355   23.141  22.081 1.00 16.36  ? 258  VAL A HG11 1 
ATOM   3863 H HG12 . VAL A 1 258 ? 7.638   22.327  20.771 1.00 16.36  ? 258  VAL A HG12 1 
ATOM   3864 H HG13 . VAL A 1 258 ? 8.822   22.719  21.722 1.00 16.36  ? 258  VAL A HG13 1 
ATOM   3865 H HG21 . VAL A 1 258 ? 8.776   23.512  18.802 1.00 16.19  ? 258  VAL A HG21 1 
ATOM   3866 H HG22 . VAL A 1 258 ? 9.318   24.968  19.015 1.00 16.19  ? 258  VAL A HG22 1 
ATOM   3867 H HG23 . VAL A 1 258 ? 9.970   23.768  19.784 1.00 16.19  ? 258  VAL A HG23 1 
ATOM   3868 N N    . SER A 1 259 ? 6.935   27.266  20.586 1.00 10.17  ? 259  SER A N    1 
ATOM   3869 C CA   . SER A 1 259 ? 7.166   28.679  20.336 1.00 11.12  ? 259  SER A CA   1 
ATOM   3870 C C    . SER A 1 259 ? 8.623   29.068  20.664 1.00 10.44  ? 259  SER A C    1 
ATOM   3871 O O    . SER A 1 259 ? 9.048   28.940  21.815 1.00 11.78  ? 259  SER A O    1 
ATOM   3872 C CB   . SER A 1 259 ? 6.237   29.488  21.230 1.00 14.34  ? 259  SER A CB   1 
ATOM   3873 O OG   . SER A 1 259 ? 6.392   30.890  21.042 1.00 19.30  ? 259  SER A OG   1 
ATOM   3874 H H    . SER A 1 259 ? 6.766   27.021  21.393 1.00 12.20  ? 259  SER A H    1 
ATOM   3875 H HA   . SER A 1 259 ? 6.976   28.881  19.396 1.00 13.35  ? 259  SER A HA   1 
ATOM   3876 H HB2  . SER A 1 259 ? 5.319   29.241  21.041 1.00 17.21  ? 259  SER A HB2  1 
ATOM   3877 H HB3  . SER A 1 259 ? 6.419   29.269  22.157 1.00 17.21  ? 259  SER A HB3  1 
ATOM   3878 H HG   . SER A 1 259 ? 6.223   31.082  20.263 1.00 28.95  ? 259  SER A HG   1 
ATOM   3879 N N    . ILE A 1 260 ? 9.367   29.463  19.608 1.00 10.89  ? 260  ILE A N    1 
ATOM   3880 C CA   . ILE A 1 260 ? 10.805  29.747  19.691 1.00 11.35  ? 260  ILE A CA   1 
ATOM   3881 C C    . ILE A 1 260 ? 11.015  31.216  19.330 1.00 11.30  ? 260  ILE A C    1 
ATOM   3882 O O    . ILE A 1 260 ? 10.908  31.530  18.115 1.00 11.80  ? 260  ILE A O    1 
ATOM   3883 C CB   . ILE A 1 260 ? 11.626  28.838  18.796 1.00 12.08  ? 260  ILE A CB   1 
ATOM   3884 C CG1  . ILE A 1 260 ? 11.314  27.351  18.991 1.00 13.88  ? 260  ILE A CG1  1 
ATOM   3885 C CG2  . ILE A 1 260 ? 13.120  29.112  19.064 1.00 14.23  ? 260  ILE A CG2  1 
ATOM   3886 C CD1  . ILE A 1 260 ? 11.981  26.439  17.968 1.00 12.89  ? 260  ILE A CD1  1 
ATOM   3887 H H    . ILE A 1 260 ? 8.978   29.554  18.847 1.00 13.06  ? 260  ILE A H    1 
ATOM   3888 H HA   . ILE A 1 260 ? 11.094  29.612  20.617 1.00 13.62  ? 260  ILE A HA   1 
ATOM   3889 H HB   . ILE A 1 260 ? 11.434  29.072  17.864 1.00 14.50  ? 260  ILE A HB   1 
ATOM   3890 H HG12 . ILE A 1 260 ? 11.600  27.085  19.879 1.00 16.65  ? 260  ILE A HG12 1 
ATOM   3891 H HG13 . ILE A 1 260 ? 10.353  27.224  18.943 1.00 16.65  ? 260  ILE A HG13 1 
ATOM   3892 H HG21 . ILE A 1 260 ? 13.318  28.933  19.986 1.00 21.35  ? 260  ILE A HG21 1 
ATOM   3893 H HG22 . ILE A 1 260 ? 13.654  28.544  18.505 1.00 21.35  ? 260  ILE A HG22 1 
ATOM   3894 H HG23 . ILE A 1 260 ? 13.317  30.031  18.867 1.00 21.35  ? 260  ILE A HG23 1 
ATOM   3895 H HD11 . ILE A 1 260 ? 11.740  25.527  18.147 1.00 19.34  ? 260  ILE A HD11 1 
ATOM   3896 H HD12 . ILE A 1 260 ? 11.688  26.680  17.086 1.00 19.34  ? 260  ILE A HD12 1 
ATOM   3897 H HD13 . ILE A 1 260 ? 12.934  26.535  18.026 1.00 19.34  ? 260  ILE A HD13 1 
ATOM   3898 N N    . SER A 1 261 ? 11.230  32.106  20.282 1.00 11.90  ? 261  SER A N    1 
ATOM   3899 C CA   . SER A 1 261 ? 11.461  33.512  19.980 1.00 12.40  ? 261  SER A CA   1 
ATOM   3900 C C    . SER A 1 261 ? 10.439  34.076  19.000 1.00 12.11  ? 261  SER A C    1 
ATOM   3901 O O    . SER A 1 261 ? 10.771  34.793  18.023 1.00 13.53  ? 261  SER A O    1 
ATOM   3902 C CB   . SER A 1 261 ? 12.897  33.765  19.499 1.00 14.19  ? 261  SER A CB   1 
ATOM   3903 O OG   . SER A 1 261 ? 13.829  33.442  20.564 1.00 15.60  ? 261  SER A OG   1 
ATOM   3904 H H    . SER A 1 261 ? 11.234  31.848  21.102 1.00 14.28  ? 261  SER A H    1 
ATOM   3905 H HA   . SER A 1 261 ? 11.351  34.005  20.820 1.00 14.88  ? 261  SER A HA   1 
ATOM   3906 H HB2  . SER A 1 261 ? 13.084  33.217  18.721 1.00 17.03  ? 261  SER A HB2  1 
ATOM   3907 H HB3  . SER A 1 261 ? 12.999  34.696  19.245 1.00 17.03  ? 261  SER A HB3  1 
ATOM   3908 H HG   . SER A 1 261 ? 13.673  33.915  21.215 1.00 23.40  ? 261  SER A HG   1 
ATOM   3909 N N    . GLY A 1 262 ? 9.147   33.755  19.242 1.00 12.02  ? 262  GLY A N    1 
ATOM   3910 C CA   . GLY A 1 262 ? 8.051   34.291  18.439 1.00 13.34  ? 262  GLY A CA   1 
ATOM   3911 C C    . GLY A 1 262 ? 7.688   33.466  17.173 1.00 13.27  ? 262  GLY A C    1 
ATOM   3912 O O    . GLY A 1 262 ? 6.664   33.785  16.506 1.00 16.87  ? 262  GLY A O    1 
ATOM   3913 H H    . GLY A 1 262 ? 8.965   33.219  19.890 1.00 14.43  ? 262  GLY A H    1 
ATOM   3914 H HA2  . GLY A 1 262 ? 7.262   34.355  18.999 1.00 16.01  ? 262  GLY A HA2  1 
ATOM   3915 H HA3  . GLY A 1 262 ? 8.285   35.191  18.162 1.00 16.01  ? 262  GLY A HA3  1 
ATOM   3916 N N    . TYR A 1 263 ? 8.459   32.440  16.821 1.00 12.19  ? 263  TYR A N    1 
ATOM   3917 C CA   . TYR A 1 263 ? 8.235   31.550  15.699 1.00 12.40  ? 263  TYR A CA   1 
ATOM   3918 C C    . TYR A 1 263 ? 7.614   30.261  16.150 1.00 11.74  ? 263  TYR A C    1 
ATOM   3919 O O    . TYR A 1 263 ? 8.061   29.634  17.122 1.00 13.82  ? 263  TYR A O    1 
ATOM   3920 C CB   . TYR A 1 263 ? 9.580   31.271  14.988 1.00 12.98  ? 263  TYR A CB   1 
ATOM   3921 C CG   . TYR A 1 263 ? 9.573   30.083  13.997 1.00 12.15  ? 263  TYR A CG   1 
ATOM   3922 C CD1  . TYR A 1 263 ? 8.868   30.156  12.804 1.00 12.94  ? 263  TYR A CD1  1 
ATOM   3923 C CD2  . TYR A 1 263 ? 10.247  28.924  14.325 1.00 12.05  ? 263  TYR A CD2  1 
ATOM   3924 C CE1  . TYR A 1 263 ? 8.824   29.084  11.947 1.00 12.88  ? 263  TYR A CE1  1 
ATOM   3925 C CE2  . TYR A 1 263 ? 10.255  27.842  13.414 1.00 11.15  ? 263  TYR A CE2  1 
ATOM   3926 C CZ   . TYR A 1 263 ? 9.544   27.916  12.254 1.00 11.23  ? 263  TYR A CZ   1 
ATOM   3927 O OH   . TYR A 1 263 ? 9.482   26.860  11.358 1.00 11.91  ? 263  TYR A OH   1 
ATOM   3928 H H    . TYR A 1 263 ? 9.154   32.291  17.304 1.00 14.62  ? 263  TYR A H    1 
ATOM   3929 H HA   . TYR A 1 263 ? 7.629   31.987  15.065 1.00 14.88  ? 263  TYR A HA   1 
ATOM   3930 H HB2  . TYR A 1 263 ? 9.843   32.071  14.506 1.00 15.57  ? 263  TYR A HB2  1 
ATOM   3931 H HB3  . TYR A 1 263 ? 10.255  31.103  15.664 1.00 15.57  ? 263  TYR A HB3  1 
ATOM   3932 H HD1  . TYR A 1 263 ? 8.420   30.941  12.582 1.00 15.53  ? 263  TYR A HD1  1 
ATOM   3933 H HD2  . TYR A 1 263 ? 10.693  28.856  15.138 1.00 14.47  ? 263  TYR A HD2  1 
ATOM   3934 H HE1  . TYR A 1 263 ? 8.320   29.130  11.167 1.00 15.46  ? 263  TYR A HE1  1 
ATOM   3935 H HE2  . TYR A 1 263 ? 10.747  27.077  13.608 1.00 13.38  ? 263  TYR A HE2  1 
ATOM   3936 H HH   . TYR A 1 263 ? 9.924   26.232  11.645 1.00 17.87  ? 263  TYR A HH   1 
ATOM   3937 N N    . THR A 1 264 ? 6.579   29.775  15.423 1.00 11.95  ? 264  THR A N    1 
ATOM   3938 C CA   . THR A 1 264 ? 5.937   28.476  15.757 1.00 11.94  ? 264  THR A CA   1 
ATOM   3939 C C    . THR A 1 264 ? 6.620   27.375  14.897 1.00 11.79  ? 264  THR A C    1 
ATOM   3940 O O    . THR A 1 264 ? 6.471   27.363  13.661 1.00 12.38  ? 264  THR A O    1 
ATOM   3941 C CB   . THR A 1 264 ? 4.441   28.473  15.487 1.00 12.90  ? 264  THR A CB   1 
ATOM   3942 O OG1  . THR A 1 264 ? 3.811   29.559  16.106 1.00 14.19  ? 264  THR A OG1  1 
ATOM   3943 C CG2  . THR A 1 264 ? 3.851   27.144  15.941 1.00 15.03  ? 264  THR A CG2  1 
ATOM   3944 H H    . THR A 1 264 ? 6.287   30.229  14.753 1.00 14.34  ? 264  THR A H    1 
ATOM   3945 H HA   . THR A 1 264 ? 6.090   28.280  16.705 1.00 14.33  ? 264  THR A HA   1 
ATOM   3946 H HB   . THR A 1 264 ? 4.306   28.552  14.520 1.00 15.48  ? 264  THR A HB   1 
ATOM   3947 H HG1  . THR A 1 264 ? 3.232   29.284  16.617 1.00 21.29  ? 264  THR A HG1  1 
ATOM   3948 H HG21 . THR A 1 264 ? 2.906   27.138  15.770 1.00 22.54  ? 264  THR A HG21 1 
ATOM   3949 H HG22 . THR A 1 264 ? 4.268   26.427  15.458 1.00 22.54  ? 264  THR A HG22 1 
ATOM   3950 H HG23 . THR A 1 264 ? 4.006   27.030  16.882 1.00 22.54  ? 264  THR A HG23 1 
ATOM   3951 N N    . ALA A 1 265 ? 7.378   26.500  15.533 1.00 10.58  ? 265  ALA A N    1 
ATOM   3952 C CA   . ALA A 1 265 ? 7.959   25.341  14.876 1.00 10.35  ? 265  ALA A CA   1 
ATOM   3953 C C    . ALA A 1 265 ? 6.996   24.187  15.016 1.00 10.26  ? 265  ALA A C    1 
ATOM   3954 O O    . ALA A 1 265 ? 6.782   23.672  16.131 1.00 11.47  ? 265  ALA A O    1 
ATOM   3955 C CB   . ALA A 1 265 ? 9.309   24.982  15.525 1.00 11.14  ? 265  ALA A CB   1 
ATOM   3956 H H    . ALA A 1 265 ? 7.534   26.620  16.370 1.00 12.69  ? 265  ALA A H    1 
ATOM   3957 H HA   . ALA A 1 265 ? 8.096   25.539  13.926 1.00 12.42  ? 265  ALA A HA   1 
ATOM   3958 H HB1  . ALA A 1 265 ? 9.915   25.720  15.432 1.00 16.71  ? 265  ALA A HB1  1 
ATOM   3959 H HB2  . ALA A 1 265 ? 9.176   24.792  16.456 1.00 16.71  ? 265  ALA A HB2  1 
ATOM   3960 H HB3  . ALA A 1 265 ? 9.678   24.209  15.090 1.00 16.71  ? 265  ALA A HB3  1 
ATOM   3961 N N    . THR A 1 266 ? 6.346   23.778  13.911 1.00 9.83   ? 266  THR A N    1 
ATOM   3962 C CA   . THR A 1 266 ? 5.334   22.754  13.908 1.00 9.96   ? 266  THR A CA   1 
ATOM   3963 C C    . THR A 1 266 ? 5.877   21.453  13.277 1.00 9.88   ? 266  THR A C    1 
ATOM   3964 O O    . THR A 1 266 ? 6.356   21.438  12.154 1.00 10.85  ? 266  THR A O    1 
ATOM   3965 C CB   . THR A 1 266 ? 4.064   23.191  13.165 1.00 11.27  ? 266  THR A CB   1 
ATOM   3966 O OG1  . THR A 1 266 ? 3.505   24.317  13.843 1.00 13.30  ? 266  THR A OG1  1 
ATOM   3967 C CG2  . THR A 1 266 ? 3.031   22.073  13.074 1.00 13.49  ? 266  THR A CG2  1 
ATOM   3968 H H    . THR A 1 266 ? 6.547   24.150  13.163 1.00 11.79  ? 266  THR A H    1 
ATOM   3969 H HA   . THR A 1 266 ? 5.092   22.563  14.838 1.00 11.95  ? 266  THR A HA   1 
ATOM   3970 H HB   . THR A 1 266 ? 4.311   23.463  12.256 1.00 13.52  ? 266  THR A HB   1 
ATOM   3971 H HG1  . THR A 1 266 ? 4.064   24.915  13.886 1.00 19.95  ? 266  THR A HG1  1 
ATOM   3972 H HG21 . THR A 1 266 ? 2.257   22.390  12.603 1.00 20.23  ? 266  THR A HG21 1 
ATOM   3973 H HG22 . THR A 1 266 ? 3.409   21.326  12.604 1.00 20.23  ? 266  THR A HG22 1 
ATOM   3974 H HG23 . THR A 1 266 ? 2.778   21.800  13.959 1.00 20.23  ? 266  THR A HG23 1 
ATOM   3975 N N    . VAL A 1 267 ? 5.685   20.347  14.049 1.00 9.79   ? 267  VAL A N    1 
ATOM   3976 C CA   . VAL A 1 267 ? 5.903   18.997  13.559 1.00 10.06  ? 267  VAL A CA   1 
ATOM   3977 C C    . VAL A 1 267 ? 4.549   18.454  13.151 1.00 10.03  ? 267  VAL A C    1 
ATOM   3978 O O    . VAL A 1 267 ? 3.674   18.221  14.015 1.00 10.66  ? 267  VAL A O    1 
ATOM   3979 C CB   . VAL A 1 267 ? 6.535   18.093  14.637 1.00 10.11  ? 267  VAL A CB   1 
ATOM   3980 C CG1  . VAL A 1 267 ? 6.889   16.746  14.013 1.00 11.50  ? 267  VAL A CG1  1 
ATOM   3981 C CG2  . VAL A 1 267 ? 7.757   18.733  15.252 1.00 10.76  ? 267  VAL A CG2  1 
ATOM   3982 H H    . VAL A 1 267 ? 5.424   20.452  14.861 1.00 11.75  ? 267  VAL A H    1 
ATOM   3983 H HA   . VAL A 1 267 ? 6.490   19.027  12.775 1.00 12.07  ? 267  VAL A HA   1 
ATOM   3984 H HB   . VAL A 1 267 ? 5.873   17.943  15.344 1.00 12.14  ? 267  VAL A HB   1 
ATOM   3985 H HG11 . VAL A 1 267 ? 6.102   16.356  13.626 1.00 17.25  ? 267  VAL A HG11 1 
ATOM   3986 H HG12 . VAL A 1 267 ? 7.551   16.874  13.329 1.00 17.25  ? 267  VAL A HG12 1 
ATOM   3987 H HG13 . VAL A 1 267 ? 7.237   16.161  14.690 1.00 17.25  ? 267  VAL A HG13 1 
ATOM   3988 H HG21 . VAL A 1 267 ? 8.422   18.869  14.574 1.00 16.15  ? 267  VAL A HG21 1 
ATOM   3989 H HG22 . VAL A 1 267 ? 7.515   19.578  15.638 1.00 16.15  ? 267  VAL A HG22 1 
ATOM   3990 H HG23 . VAL A 1 267 ? 8.110   18.159  15.935 1.00 16.15  ? 267  VAL A HG23 1 
ATOM   3991 N N    . PRO A 1 268 ? 4.270   18.245  11.839 1.00 10.75  ? 268  PRO A N    1 
ATOM   3992 C CA   . PRO A 1 268 ? 2.988   17.674  11.438 1.00 11.50  ? 268  PRO A CA   1 
ATOM   3993 C C    . PRO A 1 268 ? 2.833   16.256  12.000 1.00 10.62  ? 268  PRO A C    1 
ATOM   3994 O O    . PRO A 1 268 ? 3.807   15.501  12.096 1.00 11.09  ? 268  PRO A O    1 
ATOM   3995 C CB   . PRO A 1 268 ? 3.038   17.665  9.929  1.00 12.88  ? 268  PRO A CB   1 
ATOM   3996 C CG   . PRO A 1 268 ? 4.351   18.082  9.567  1.00 26.07  ? 268  PRO A CG   1 
ATOM   3997 C CD   . PRO A 1 268 ? 5.135   18.498  10.681 1.00 12.05  ? 268  PRO A CD   1 
ATOM   3998 H HA   . PRO A 1 268 ? 2.253   18.243  11.748 1.00 13.80  ? 268  PRO A HA   1 
ATOM   3999 H HB2  . PRO A 1 268 ? 2.860   16.774  9.589  1.00 15.46  ? 268  PRO A HB2  1 
ATOM   4000 H HB3  . PRO A 1 268 ? 2.376   18.274  9.564  1.00 15.46  ? 268  PRO A HB3  1 
ATOM   4001 H HG2  . PRO A 1 268 ? 4.802   17.348  9.121  1.00 31.29  ? 268  PRO A HG2  1 
ATOM   4002 H HG3  . PRO A 1 268 ? 4.286   18.816  8.937  1.00 31.29  ? 268  PRO A HG3  1 
ATOM   4003 H HD2  . PRO A 1 268 ? 5.954   17.981  10.741 1.00 14.46  ? 268  PRO A HD2  1 
ATOM   4004 H HD3  . PRO A 1 268 ? 5.360   19.439  10.615 1.00 14.46  ? 268  PRO A HD3  1 
ATOM   4005 N N    . GLY A 1 269 ? 1.592   15.882  12.283 1.00 11.28  ? 269  GLY A N    1 
ATOM   4006 C CA   . GLY A 1 269 ? 1.303   14.547  12.819 1.00 11.41  ? 269  GLY A CA   1 
ATOM   4007 C C    . GLY A 1 269 ? 1.858   13.458  11.935 1.00 11.08  ? 269  GLY A C    1 
ATOM   4008 O O    . GLY A 1 269 ? 2.274   12.390  12.433 1.00 11.63  ? 269  GLY A O    1 
ATOM   4009 H H    . GLY A 1 269 ? 0.944   16.433  12.150 1.00 13.53  ? 269  GLY A H    1 
ATOM   4010 H HA2  . GLY A 1 269 ? 1.688   14.467  13.706 1.00 13.69  ? 269  GLY A HA2  1 
ATOM   4011 H HA3  . GLY A 1 269 ? 0.343   14.435  12.900 1.00 13.69  ? 269  GLY A HA3  1 
ATOM   4012 N N    . SER A 1 270 ? 1.887   13.650  10.586 1.00 11.14  ? 270  SER A N    1 
ATOM   4013 C CA   . SER A 1 270 ? 2.453   12.622  9.696  1.00 12.73  ? 270  SER A CA   1 
ATOM   4014 C C    . SER A 1 270 ? 3.875   12.227  10.079 1.00 11.96  ? 270  SER A C    1 
ATOM   4015 O O    . SER A 1 270 ? 4.260   11.030  9.972  1.00 14.73  ? 270  SER A O    1 
ATOM   4016 C CB   . SER A 1 270 ? 2.391   13.116  8.237  1.00 15.51  ? 270  SER A CB   1 
ATOM   4017 O OG   . SER A 1 270 ? 3.066   14.361  8.061  1.00 19.46  ? 270  SER A OG   1 
ATOM   4018 H H    . SER A 1 270 ? 1.573   14.378  10.252 1.00 13.36  ? 270  SER A H    1 
ATOM   4019 H HA   . SER A 1 270 ? 1.890   11.822  9.765  1.00 15.28  ? 270  SER A HA   1 
ATOM   4020 H HB2  . SER A 1 270 ? 2.795   12.450  7.658  1.00 18.61  ? 270  SER A HB2  1 
ATOM   4021 H HB3  . SER A 1 270 ? 1.463   13.216  7.973  1.00 18.61  ? 270  SER A HB3  1 
ATOM   4022 H HG   . SER A 1 270 ? 2.716   14.930  8.536  1.00 29.19  ? 270  SER A HG   1 
ATOM   4023 N N    . LEU A 1 271 ? 4.703   13.193  10.535 1.00 11.20  ? 271  LEU A N    1 
ATOM   4024 C CA   . LEU A 1 271 ? 6.068   12.920  10.920 1.00 11.06  ? 271  LEU A CA   1 
ATOM   4025 C C    . LEU A 1 271 ? 6.187   12.230  12.285 1.00 10.91  ? 271  LEU A C    1 
ATOM   4026 O O    . LEU A 1 271 ? 7.244   11.725  12.652 1.00 13.12  ? 271  LEU A O    1 
ATOM   4027 C CB   . LEU A 1 271 ? 6.933   14.174  10.911 1.00 13.00  ? 271  LEU A CB   1 
ATOM   4028 C CG   . LEU A 1 271 ? 7.281   14.749  9.523  1.00 14.59  ? 271  LEU A CG   1 
ATOM   4029 C CD1  . LEU A 1 271 ? 8.086   16.051  9.671  1.00 17.77  ? 271  LEU A CD1  1 
ATOM   4030 C CD2  . LEU A 1 271 ? 8.029   13.737  8.639  1.00 16.61  ? 271  LEU A CD2  1 
ATOM   4031 H H    . LEU A 1 271 ? 4.406   13.998  10.598 1.00 13.44  ? 271  LEU A H    1 
ATOM   4032 H HA   . LEU A 1 271 ? 6.440   12.307  10.252 1.00 13.27  ? 271  LEU A HA   1 
ATOM   4033 H HB2  . LEU A 1 271 ? 6.475   14.863  11.419 1.00 15.60  ? 271  LEU A HB2  1 
ATOM   4034 H HB3  . LEU A 1 271 ? 7.761   13.975  11.374 1.00 15.60  ? 271  LEU A HB3  1 
ATOM   4035 H HG   . LEU A 1 271 ? 6.439   14.971  9.074  1.00 17.51  ? 271  LEU A HG   1 
ATOM   4036 H HD11 . LEU A 1 271 ? 7.601   16.666  10.225 1.00 26.66  ? 271  LEU A HD11 1 
ATOM   4037 H HD12 . LEU A 1 271 ? 8.936   15.857  10.075 1.00 26.66  ? 271  LEU A HD12 1 
ATOM   4038 H HD13 . LEU A 1 271 ? 8.225   16.441  8.805  1.00 26.66  ? 271  LEU A HD13 1 
ATOM   4039 H HD21 . LEU A 1 271 ? 8.878   13.532  9.037  1.00 24.92  ? 271  LEU A HD21 1 
ATOM   4040 H HD22 . LEU A 1 271 ? 7.509   12.934  8.563  1.00 24.92  ? 271  LEU A HD22 1 
ATOM   4041 H HD23 . LEU A 1 271 ? 8.166   14.115  7.767  1.00 24.92  ? 271  LEU A HD23 1 
ATOM   4042 N N    . ILE A 1 272 ? 5.110   12.229  13.075 1.00 11.01  ? 272  ILE A N    1 
ATOM   4043 C CA   . ILE A 1 272 ? 5.092   11.599  14.418 1.00 10.75  ? 272  ILE A CA   1 
ATOM   4044 C C    . ILE A 1 272 ? 4.768   10.133  14.336 1.00 10.78  ? 272  ILE A C    1 
ATOM   4045 O O    . ILE A 1 272 ? 4.883   9.388   15.328 1.00 12.12  ? 272  ILE A O    1 
ATOM   4046 C CB   . ILE A 1 272 ? 4.228   12.457  15.375 1.00 10.58  ? 272  ILE A CB   1 
ATOM   4047 C CG1  . ILE A 1 272 ? 4.726   13.927  15.381 1.00 11.92  ? 272  ILE A CG1  1 
ATOM   4048 C CG2  . ILE A 1 272 ? 4.222   11.875  16.809 1.00 12.60  ? 272  ILE A CG2  1 
ATOM   4049 C CD1  . ILE A 1 272 ? 3.863   14.919  16.137 1.00 12.21  ? 272  ILE A CD1  1 
ATOM   4050 H H    . ILE A 1 272 ? 4.393   12.611  12.792 1.00 13.21  ? 272  ILE A H    1 
ATOM   4051 H HA   . ILE A 1 272 ? 6.010   11.656  14.757 1.00 12.90  ? 272  ILE A HA   1 
ATOM   4052 H HB   . ILE A 1 272 ? 3.307   12.449  15.040 1.00 12.69  ? 272  ILE A HB   1 
ATOM   4053 H HG12 . ILE A 1 272 ? 5.617   13.946  15.764 1.00 14.30  ? 272  ILE A HG12 1 
ATOM   4054 H HG13 . ILE A 1 272 ? 4.799   14.227  14.461 1.00 14.30  ? 272  ILE A HG13 1 
ATOM   4055 H HG21 . ILE A 1 272 ? 3.914   10.966  16.785 1.00 18.90  ? 272  ILE A HG21 1 
ATOM   4056 H HG22 . ILE A 1 272 ? 5.111   11.902  17.169 1.00 18.90  ? 272  ILE A HG22 1 
ATOM   4057 H HG23 . ILE A 1 272 ? 3.636   12.397  17.363 1.00 18.90  ? 272  ILE A HG23 1 
ATOM   4058 H HD11 . ILE A 1 272 ? 4.254   15.794  16.078 1.00 18.32  ? 272  ILE A HD11 1 
ATOM   4059 H HD12 . ILE A 1 272 ? 2.983   14.936  15.753 1.00 18.32  ? 272  ILE A HD12 1 
ATOM   4060 H HD13 . ILE A 1 272 ? 3.805   14.655  17.058 1.00 18.32  ? 272  ILE A HD13 1 
ATOM   4061 N N    . ASN A 1 273 ? 4.423   9.603   13.140 1.00 11.46  ? 273  ASN A N    1 
ATOM   4062 C CA   . ASN A 1 273 ? 4.398   8.160   12.933 1.00 11.39  ? 273  ASN A CA   1 
ATOM   4063 C C    . ASN A 1 273 ? 5.779   7.732   12.518 1.00 11.12  ? 273  ASN A C    1 
ATOM   4064 O O    . ASN A 1 273 ? 6.193   7.924   11.355 1.00 12.69  ? 273  ASN A O    1 
ATOM   4065 C CB   . ASN A 1 273 ? 3.344   7.791   11.901 1.00 12.82  ? 273  ASN A CB   1 
ATOM   4066 C CG   . ASN A 1 273 ? 3.209   6.262   11.750 1.00 14.59  ? 273  ASN A CG   1 
ATOM   4067 O OD1  . ASN A 1 273 ? 4.170   5.542   12.049 1.00 15.00  ? 273  ASN A OD1  1 
ATOM   4068 N ND2  . ASN A 1 273 ? 2.015   5.816   11.348 1.00 20.43  ? 273  ASN A ND2  1 
ATOM   4069 H H    . ASN A 1 273 ? 4.214   10.126  12.490 1.00 13.75  ? 273  ASN A H    1 
ATOM   4070 H HA   . ASN A 1 273 ? 4.175   7.724   13.782 1.00 13.67  ? 273  ASN A HA   1 
ATOM   4071 H HB2  . ASN A 1 273 ? 2.489   8.164   12.168 1.00 15.38  ? 273  ASN A HB2  1 
ATOM   4072 H HB3  . ASN A 1 273 ? 3.584   8.178   11.045 1.00 15.38  ? 273  ASN A HB3  1 
ATOM   4073 H HD21 . ASN A 1 273 ? 1.389   6.374   11.156 1.00 24.52  ? 273  ASN A HD21 1 
ATOM   4074 H HD22 . ASN A 1 273 ? 1.872   4.971   11.282 1.00 24.52  ? 273  ASN A HD22 1 
ATOM   4075 N N    . TYR A 1 274 ? 6.624   7.246   13.457 1.00 11.36  ? 274  TYR A N    1 
ATOM   4076 C CA   . TYR A 1 274 ? 8.009   6.881   13.166 1.00 11.55  ? 274  TYR A CA   1 
ATOM   4077 C C    . TYR A 1 274 ? 8.106   5.755   12.172 1.00 13.08  ? 274  TYR A C    1 
ATOM   4078 O O    . TYR A 1 274 ? 8.930   5.764   11.255 1.00 14.08  ? 274  TYR A O    1 
ATOM   4079 C CB   . TYR A 1 274 ? 8.762   6.566   14.446 1.00 11.71  ? 274  TYR A CB   1 
ATOM   4080 C CG   . TYR A 1 274 ? 10.124  5.927   14.245 1.00 11.94  ? 274  TYR A CG   1 
ATOM   4081 C CD1  . TYR A 1 274 ? 11.212  6.710   13.811 1.00 11.50  ? 274  TYR A CD1  1 
ATOM   4082 C CD2  . TYR A 1 274 ? 10.365  4.586   14.453 1.00 13.74  ? 274  TYR A CD2  1 
ATOM   4083 C CE1  . TYR A 1 274 ? 12.443  6.161   13.635 1.00 11.57  ? 274  TYR A CE1  1 
ATOM   4084 C CE2  . TYR A 1 274 ? 11.615  4.015   14.304 1.00 14.02  ? 274  TYR A CE2  1 
ATOM   4085 C CZ   . TYR A 1 274 ? 12.691  4.853   13.909 1.00 12.20  ? 274  TYR A CZ   1 
ATOM   4086 O OH   . TYR A 1 274 ? 13.945  4.331   13.768 1.00 14.43  ? 274  TYR A OH   1 
ATOM   4087 H H    . TYR A 1 274 ? 6.333   7.148   14.260 1.00 13.63  ? 274  TYR A H    1 
ATOM   4088 H HA   . TYR A 1 274 ? 8.437   7.664   12.761 1.00 13.86  ? 274  TYR A HA   1 
ATOM   4089 H HB2  . TYR A 1 274 ? 8.879   7.389   14.946 1.00 14.05  ? 274  TYR A HB2  1 
ATOM   4090 H HB3  . TYR A 1 274 ? 8.219   5.971   14.986 1.00 14.05  ? 274  TYR A HB3  1 
ATOM   4091 H HD1  . TYR A 1 274 ? 11.085  7.615   13.641 1.00 13.80  ? 274  TYR A HD1  1 
ATOM   4092 H HD2  . TYR A 1 274 ? 9.655   4.041   14.705 1.00 16.49  ? 274  TYR A HD2  1 
ATOM   4093 H HE1  . TYR A 1 274 ? 13.135  6.696   13.319 1.00 13.88  ? 274  TYR A HE1  1 
ATOM   4094 H HE2  . TYR A 1 274 ? 11.748  3.108   14.458 1.00 16.83  ? 274  TYR A HE2  1 
ATOM   4095 H HH   . TYR A 1 274 ? 13.933  3.534   13.964 1.00 21.64  ? 274  TYR A HH   1 
ATOM   4096 N N    . GLY A 1 275 ? 7.315   4.736   12.345 1.00 16.65  ? 275  GLY A N    1 
ATOM   4097 C CA   . GLY A 1 275 ? 7.353   3.600   11.454 1.00 20.17  ? 275  GLY A CA   1 
ATOM   4098 C C    . GLY A 1 275 ? 6.827   2.350   12.168 1.00 16.25  ? 275  GLY A C    1 
ATOM   4099 O O    . GLY A 1 275 ? 6.459   2.397   13.327 1.00 15.55  ? 275  GLY A O    1 
ATOM   4100 H H    . GLY A 1 275 ? 6.759   4.740   13.002 1.00 19.99  ? 275  GLY A H    1 
ATOM   4101 H HA2  . GLY A 1 275 ? 6.809   3.781   10.672 1.00 24.20  ? 275  GLY A HA2  1 
ATOM   4102 H HA3  . GLY A 1 275 ? 8.264   3.447   11.160 1.00 24.20  ? 275  GLY A HA3  1 
ATOM   4103 N N    . PRO A 1 276 ? 6.855   1.261   11.466 1.00 19.17  ? 276  PRO A N    1 
ATOM   4104 C CA   . PRO A 1 276 ? 6.373   -0.039  12.059 1.00 18.47  ? 276  PRO A CA   1 
ATOM   4105 C C    . PRO A 1 276 ? 7.090   -0.317  13.298 1.00 20.70  ? 276  PRO A C    1 
ATOM   4106 O O    . PRO A 1 276 ? 8.317   -0.192  13.331 1.00 26.68  ? 276  PRO A O    1 
ATOM   4107 C CB   . PRO A 1 276 ? 6.681   -1.003  10.898 1.00 28.34  ? 276  PRO A CB   1 
ATOM   4108 C CG   . PRO A 1 276 ? 6.597   -0.237  9.651  1.00 29.48  ? 276  PRO A CG   1 
ATOM   4109 C CD   . PRO A 1 276 ? 7.355   1.079   10.046 1.00 25.40  ? 276  PRO A CD   1 
ATOM   4110 H HA   . PRO A 1 276 ? 5.407   -0.001  12.224 1.00 22.17  ? 276  PRO A HA   1 
ATOM   4111 H HB2  . PRO A 1 276 ? 7.570   -1.378  11.001 1.00 34.00  ? 276  PRO A HB2  1 
ATOM   4112 H HB3  . PRO A 1 276 ? 6.040   -1.731  10.888 1.00 34.00  ? 276  PRO A HB3  1 
ATOM   4113 H HG2  . PRO A 1 276 ? 7.040   -0.697  8.920  1.00 35.37  ? 276  PRO A HG2  1 
ATOM   4114 H HG3  . PRO A 1 276 ? 5.676   -0.057  9.405  1.00 35.37  ? 276  PRO A HG3  1 
ATOM   4115 H HD2  . PRO A 1 276 ? 8.318   0.962   10.017 1.00 30.48  ? 276  PRO A HD2  1 
ATOM   4116 H HD3  . PRO A 1 276 ? 7.103   1.824   9.478  1.00 30.48  ? 276  PRO A HD3  1 
ATOM   4117 N N    . SER A 1 277 ? 6.446   -0.744  14.298 1.00 19.63  ? 277  SER A N    1 
ATOM   4118 C CA   . SER A 1 277 ? 7.104   -0.900  15.638 1.00 26.74  ? 277  SER A CA   1 
ATOM   4119 C C    . SER A 1 277 ? 7.920   -2.091  15.831 1.00 35.36  ? 277  SER A C    1 
ATOM   4120 O O    . SER A 1 277 ? 8.740   -2.250  16.747 1.00 34.06  ? 277  SER A O    1 
ATOM   4121 C CB   . SER A 1 277 ? 5.883   -0.711  16.742 1.00 27.67  ? 277  SER A CB   1 
ATOM   4122 O OG   . SER A 1 277 ? 5.533   -2.154  16.594 1.00 31.07  ? 277  SER A OG   1 
ATOM   4123 H H    . SER A 1 277 ? 5.615   -0.948  14.210 1.00 23.55  ? 277  SER A H    1 
ATOM   4124 H HA   . SER A 1 277 ? 7.702   -0.131  15.747 1.00 32.09  ? 277  SER A HA   1 
ATOM   4125 H HB2  . SER A 1 277 ? 6.194   -0.474  17.629 1.00 33.20  ? 277  SER A HB2  1 
ATOM   4126 H HB3  . SER A 1 277 ? 5.183   -0.108  16.448 1.00 33.20  ? 277  SER A HB3  1 
ATOM   4127 H HG   . SER A 1 277 ? 4.910   -2.337  17.095 1.00 46.60  ? 277  SER A HG   1 
ATOM   4128 N N    . GLY A 1 278 ? 7.876   -2.983  14.848 1.00 36.59  ? 278  GLY A N    1 
ATOM   4129 C CA   . GLY A 1 278 ? 8.833   -4.166  15.226 1.00 47.17  ? 278  GLY A CA   1 
ATOM   4130 C C    . GLY A 1 278 ? 8.212   -5.263  15.722 1.00 63.95  ? 278  GLY A C    1 
ATOM   4131 O O    . GLY A 1 278 ? 8.812   -6.762  14.472 1.00 82.39  ? 278  GLY A O    1 
ATOM   4132 H H    . GLY A 1 278 ? 7.406   -2.922  14.131 1.00 43.91  ? 278  GLY A H    1 
ATOM   4133 H HA2  . GLY A 1 278 ? 9.331   -4.425  14.434 1.00 56.60  ? 278  GLY A HA2  1 
ATOM   4134 H HA3  . GLY A 1 278 ? 9.472   -3.850  15.883 1.00 56.60  ? 278  GLY A HA3  1 
ATOM   4135 N N    . ASP A 1 279 ? 7.875   -6.026  16.485 1.00 73.95  ? 279  ASP A N    1 
ATOM   4136 C CA   . ASP A 1 279 ? 6.817   -7.812  16.201 1.00 72.36  ? 279  ASP A CA   1 
ATOM   4137 C C    . ASP A 1 279 ? 5.626   -6.873  14.843 1.00 69.89  ? 279  ASP A C    1 
ATOM   4138 O O    . ASP A 1 279 ? 6.353   -9.486  15.325 1.00 84.99  ? 279  ASP A O    1 
ATOM   4139 C CB   . ASP A 1 279 ? 7.110   -7.390  17.913 1.00 83.96  ? 279  ASP A CB   1 
ATOM   4140 C CG   . ASP A 1 279 ? 8.116   -8.400  18.203 1.00 87.71  ? 279  ASP A CG   1 
ATOM   4141 O OD1  . ASP A 1 279 ? 8.646   -9.948  17.983 1.00 102.04 ? 279  ASP A OD1  1 
ATOM   4142 O OD2  . ASP A 1 279 ? 8.068   -8.415  20.031 1.00 92.40  ? 279  ASP A OD2  1 
ATOM   4143 H H    . ASP A 1 279 ? 8.082   -5.847  17.300 1.00 88.74  ? 279  ASP A H    1 
ATOM   4144 H HA   . ASP A 1 279 ? 7.342   -8.563  15.854 1.00 86.84  ? 279  ASP A HA   1 
ATOM   4145 H HB2  . ASP A 1 279 ? 7.457   -6.490  18.014 1.00 100.75 ? 279  ASP A HB2  1 
ATOM   4146 H HB3  . ASP A 1 279 ? 6.315   -7.499  18.458 1.00 100.75 ? 279  ASP A HB3  1 
ATOM   4147 N N    . GLY A 1 280 ? 4.606   -6.478  15.861 1.00 68.12  ? 280  GLY A N    1 
ATOM   4148 C CA   . GLY A 1 280 ? 3.677   -6.822  15.073 1.00 56.38  ? 280  GLY A CA   1 
ATOM   4149 C C    . GLY A 1 280 ? 2.782   -6.064  14.213 1.00 54.23  ? 280  GLY A C    1 
ATOM   4150 O O    . GLY A 1 280 ? 3.239   -6.132  12.784 1.00 69.30  ? 280  GLY A O    1 
ATOM   4151 H H    . GLY A 1 280 ? 4.637   -6.152  16.656 1.00 81.75  ? 280  GLY A H    1 
ATOM   4152 H HA2  . GLY A 1 280 ? 4.100   -7.455  14.472 1.00 67.66  ? 280  GLY A HA2  1 
ATOM   4153 H HA3  . GLY A 1 280 ? 3.081   -7.349  15.627 1.00 67.66  ? 280  GLY A HA3  1 
ATOM   4154 N N    . SER A 1 281 ? 1.761   -5.426  14.516 1.00 47.30  ? 281  SER A N    1 
ATOM   4155 C CA   . SER A 1 281 ? 1.117   -4.615  13.572 1.00 40.93  ? 281  SER A CA   1 
ATOM   4156 C C    . SER A 1 281 ? 0.706   -3.352  14.368 1.00 31.47  ? 281  SER A C    1 
ATOM   4157 O O    . SER A 1 281 ? -0.498  -3.020  14.167 1.00 44.59  ? 281  SER A O    1 
ATOM   4158 C CB   . SER A 1 281 ? 0.314   -5.345  12.784 1.00 47.00  ? 281  SER A CB   1 
ATOM   4159 O OG   . SER A 1 281 ? 1.023   -6.250  12.015 1.00 58.68  ? 281  SER A OG   1 
ATOM   4160 H H    . SER A 1 281 ? 1.446   -5.482  15.314 1.00 56.76  ? 281  SER A H    1 
ATOM   4161 H HA   . SER A 1 281 ? 1.834   -4.310  12.978 1.00 49.11  ? 281  SER A HA   1 
ATOM   4162 H HB2  . SER A 1 281 ? -0.323  -5.826  13.336 1.00 56.39  ? 281  SER A HB2  1 
ATOM   4163 H HB3  . SER A 1 281 ? -0.185  -4.752  12.201 1.00 56.39  ? 281  SER A HB3  1 
ATOM   4164 H HG   . SER A 1 281 ? 0.503   -6.684  11.554 1.00 88.02  ? 281  SER A HG   1 
ATOM   4165 N N    . THR A 1 282 ? 1.583   -2.621  14.947 1.00 25.37  ? 282  THR A N    1 
ATOM   4166 C CA   . THR A 1 282 ? 1.456   -1.205  15.409 1.00 18.24  ? 282  THR A CA   1 
ATOM   4167 C C    . THR A 1 282 ? 2.610   -0.381  14.797 1.00 15.17  ? 282  THR A C    1 
ATOM   4168 O O    . THR A 1 282 ? 3.541   -0.936  14.225 1.00 17.00  ? 282  THR A O    1 
ATOM   4169 C CB   . THR A 1 282 ? 1.357   -1.072  16.957 1.00 18.92  ? 282  THR A CB   1 
ATOM   4170 O OG1  . THR A 1 282 ? 2.533   -1.594  17.463 1.00 21.77  ? 282  THR A OG1  1 
ATOM   4171 C CG2  . THR A 1 282 ? 0.104   -1.691  17.559 1.00 26.60  ? 282  THR A CG2  1 
ATOM   4172 H H    . THR A 1 282 ? 2.345   -2.993  15.088 1.00 30.45  ? 282  THR A H    1 
ATOM   4173 H HA   . THR A 1 282 ? 0.621   -0.854  15.036 1.00 21.89  ? 282  THR A HA   1 
ATOM   4174 H HB   . THR A 1 282 ? 1.344   -0.115  17.169 1.00 22.70  ? 282  THR A HB   1 
ATOM   4175 H HG1  . THR A 1 282 ? 3.172   -1.212  17.119 1.00 32.65  ? 282  THR A HG1  1 
ATOM   4176 H HG21 . THR A 1 282 ? 0.106   -1.556  18.510 1.00 39.90  ? 282  THR A HG21 1 
ATOM   4177 H HG22 . THR A 1 282 ? -0.673  -1.275  17.178 1.00 39.90  ? 282  THR A HG22 1 
ATOM   4178 H HG23 . THR A 1 282 ? 0.089   -2.632  17.370 1.00 39.90  ? 282  THR A HG23 1 
ATOM   4179 N N    . CYS A 1 283 ? 2.506   0.908   15.047 1.00 14.10  ? 283  CYS A N    1 
ATOM   4180 C CA   . CYS A 1 283 ? 3.556   1.904   14.696 1.00 12.35  ? 283  CYS A CA   1 
ATOM   4181 C C    . CYS A 1 283 ? 4.036   2.587   16.002 1.00 11.54  ? 283  CYS A C    1 
ATOM   4182 O O    . CYS A 1 283 ? 3.230   2.872   16.901 1.00 12.76  ? 283  CYS A O    1 
ATOM   4183 C CB   . CYS A 1 283 ? 3.025   2.910   13.674 1.00 12.85  ? 283  CYS A CB   1 
ATOM   4184 S SG   . CYS A 1 283 ? 2.976   2.326   11.981 1.00 15.88  ? 283  CYS A SG   1 
ATOM   4185 H H    . CYS A 1 283 ? 1.791   1.191   15.434 1.00 16.92  ? 283  CYS A H    1 
ATOM   4186 H HA   . CYS A 1 283 ? 4.315   1.428   14.298 1.00 14.82  ? 283  CYS A HA   1 
ATOM   4187 H HB2  . CYS A 1 283 ? 2.128   3.169   13.936 1.00 15.42  ? 283  CYS A HB2  1 
ATOM   4188 H HB3  . CYS A 1 283 ? 3.580   3.705   13.709 1.00 15.42  ? 283  CYS A HB3  1 
ATOM   4189 N N    . LEU A 1 284 ? 5.342   2.881   16.050 1.00 12.10  ? 284  LEU A N    1 
ATOM   4190 C CA   . LEU A 1 284 ? 5.962   3.574   17.158 1.00 10.95  ? 284  LEU A CA   1 
ATOM   4191 C C    . LEU A 1 284 ? 5.765   5.096   16.988 1.00 10.26  ? 284  LEU A C    1 
ATOM   4192 O O    . LEU A 1 284 ? 5.986   5.661   15.918 1.00 10.69  ? 284  LEU A O    1 
ATOM   4193 C CB   . LEU A 1 284 ? 7.438   3.244   17.215 1.00 11.69  ? 284  LEU A CB   1 
ATOM   4194 C CG   . LEU A 1 284 ? 8.237   3.880   18.386 1.00 11.65  ? 284  LEU A CG   1 
ATOM   4195 C CD1  . LEU A 1 284 ? 7.809   3.309   19.756 1.00 12.69  ? 284  LEU A CD1  1 
ATOM   4196 C CD2  . LEU A 1 284 ? 9.734   3.682   18.190 1.00 13.28  ? 284  LEU A CD2  1 
ATOM   4197 H H    . LEU A 1 284 ? 5.838   2.646   15.387 1.00 14.53  ? 284  LEU A H    1 
ATOM   4198 H HA   . LEU A 1 284 ? 5.537   3.287   17.993 1.00 13.14  ? 284  LEU A HA   1 
ATOM   4199 H HB2  . LEU A 1 284 ? 7.532   2.280   17.271 1.00 14.03  ? 284  LEU A HB2  1 
ATOM   4200 H HB3  . LEU A 1 284 ? 7.845   3.527   16.381 1.00 14.03  ? 284  LEU A HB3  1 
ATOM   4201 H HG   . LEU A 1 284 ? 8.056   4.843   18.389 1.00 13.98  ? 284  LEU A HG   1 
ATOM   4202 H HD11 . LEU A 1 284 ? 6.865   3.435   19.874 1.00 19.04  ? 284  LEU A HD11 1 
ATOM   4203 H HD12 . LEU A 1 284 ? 8.014   2.372   19.791 1.00 19.04  ? 284  LEU A HD12 1 
ATOM   4204 H HD13 . LEU A 1 284 ? 8.283   3.766   20.455 1.00 19.04  ? 284  LEU A HD13 1 
ATOM   4205 H HD21 . LEU A 1 284 ? 9.940   2.745   18.221 1.00 19.92  ? 284  LEU A HD21 1 
ATOM   4206 H HD22 . LEU A 1 284 ? 9.995   4.039   17.338 1.00 19.92  ? 284  LEU A HD22 1 
ATOM   4207 H HD23 . LEU A 1 284 ? 10.211  4.138   18.887 1.00 19.92  ? 284  LEU A HD23 1 
ATOM   4208 N N    . GLY A 1 285 ? 5.428   5.765   18.094 1.00 9.96   ? 285  GLY A N    1 
ATOM   4209 C CA   . GLY A 1 285 ? 5.332   7.206   18.086 1.00 9.65   ? 285  GLY A CA   1 
ATOM   4210 C C    . GLY A 1 285 ? 6.663   7.895   18.070 1.00 9.11   ? 285  GLY A C    1 
ATOM   4211 O O    . GLY A 1 285 ? 7.648   7.495   18.696 1.00 9.76   ? 285  GLY A O    1 
ATOM   4212 H H    . GLY A 1 285 ? 5.266   5.332   18.819 1.00 11.95  ? 285  GLY A H    1 
ATOM   4213 H HA2  . GLY A 1 285 ? 4.826   7.482   17.305 1.00 11.58  ? 285  GLY A HA2  1 
ATOM   4214 H HA3  . GLY A 1 285 ? 4.840   7.492   18.872 1.00 11.58  ? 285  GLY A HA3  1 
ATOM   4215 N N    . GLY A 1 286 ? 6.692   9.063   17.365 1.00 9.35   ? 286  GLY A N    1 
ATOM   4216 C CA   . GLY A 1 286 ? 7.911   9.839   17.294 1.00 9.27   ? 286  GLY A CA   1 
ATOM   4217 C C    . GLY A 1 286 ? 8.211   10.696  18.525 1.00 8.96   ? 286  GLY A C    1 
ATOM   4218 O O    . GLY A 1 286 ? 9.328   11.198  18.646 1.00 9.95   ? 286  GLY A O    1 
ATOM   4219 H H    . GLY A 1 286 ? 5.984   9.338   16.961 1.00 11.22  ? 286  GLY A H    1 
ATOM   4220 H HA2  . GLY A 1 286 ? 8.655   9.232   17.154 1.00 11.12  ? 286  GLY A HA2  1 
ATOM   4221 H HA3  . GLY A 1 286 ? 7.861   10.421  16.519 1.00 11.12  ? 286  GLY A HA3  1 
ATOM   4222 N N    . ILE A 1 287 ? 7.208   10.883  19.393 1.00 9.17   ? 287  ILE A N    1 
ATOM   4223 C CA   . ILE A 1 287 ? 7.357   11.542  20.698 1.00 9.08   ? 287  ILE A CA   1 
ATOM   4224 C C    . ILE A 1 287 ? 7.480   10.454  21.776 1.00 9.27   ? 287  ILE A C    1 
ATOM   4225 O O    . ILE A 1 287 ? 6.609   9.541   21.839 1.00 9.84   ? 287  ILE A O    1 
ATOM   4226 C CB   . ILE A 1 287 ? 6.138   12.465  20.980 1.00 9.74   ? 287  ILE A CB   1 
ATOM   4227 C CG1  . ILE A 1 287 ? 6.246   13.715  20.080 1.00 10.35  ? 287  ILE A CG1  1 
ATOM   4228 C CG2  . ILE A 1 287 ? 6.065   12.816  22.484 1.00 11.15  ? 287  ILE A CG2  1 
ATOM   4229 C CD1  . ILE A 1 287 ? 5.010   14.600  20.097 1.00 11.52  ? 287  ILE A CD1  1 
ATOM   4230 H H    . ILE A 1 287 ? 6.427   10.599  19.173 1.00 11.00  ? 287  ILE A H    1 
ATOM   4231 H HA   . ILE A 1 287 ? 8.174   12.082  20.692 1.00 10.90  ? 287  ILE A HA   1 
ATOM   4232 H HB   . ILE A 1 287 ? 5.321   11.980  20.737 1.00 11.69  ? 287  ILE A HB   1 
ATOM   4233 H HG12 . ILE A 1 287 ? 7.009   14.241  20.367 1.00 12.42  ? 287  ILE A HG12 1 
ATOM   4234 H HG13 . ILE A 1 287 ? 6.412   13.429  19.168 1.00 12.42  ? 287  ILE A HG13 1 
ATOM   4235 H HG21 . ILE A 1 287 ? 6.006   12.007  22.999 1.00 16.73  ? 287  ILE A HG21 1 
ATOM   4236 H HG22 . ILE A 1 287 ? 6.855   13.299  22.738 1.00 16.73  ? 287  ILE A HG22 1 
ATOM   4237 H HG23 . ILE A 1 287 ? 5.291   13.358  22.650 1.00 16.73  ? 287  ILE A HG23 1 
ATOM   4238 H HD11 . ILE A 1 287 ? 5.146   15.351  19.515 1.00 17.28  ? 287  ILE A HD11 1 
ATOM   4239 H HD12 . ILE A 1 287 ? 4.251   14.095  19.796 1.00 17.28  ? 287  ILE A HD12 1 
ATOM   4240 H HD13 . ILE A 1 287 ? 4.852   14.912  20.991 1.00 17.28  ? 287  ILE A HD13 1 
ATOM   4241 N N    . GLN A 1 288 ? 8.510   10.520  22.601 1.00 9.43   ? 288  GLN A N    1 
ATOM   4242 C CA   . GLN A 1 288 ? 8.671   9.560   23.718 1.00 9.61   ? 288  GLN A CA   1 
ATOM   4243 C C    . GLN A 1 288 ? 9.309   10.297  24.919 1.00 9.81   ? 288  GLN A C    1 
ATOM   4244 O O    . GLN A 1 288 ? 9.707   11.465  24.818 1.00 10.16  ? 288  GLN A O    1 
ATOM   4245 C CB   . GLN A 1 288 ? 9.471   8.338   23.316 1.00 9.40   ? 288  GLN A CB   1 
ATOM   4246 C CG   . GLN A 1 288 ? 8.924   7.527   22.169 1.00 9.82   ? 288  GLN A CG   1 
ATOM   4247 C CD   . GLN A 1 288 ? 7.597   6.839   22.415 1.00 10.20  ? 288  GLN A CD   1 
ATOM   4248 O OE1  . GLN A 1 288 ? 7.144   6.624   23.559 1.00 11.19  ? 288  GLN A OE1  1 
ATOM   4249 N NE2  . GLN A 1 288 ? 6.961   6.378   21.326 1.00 10.45  ? 288  GLN A NE2  1 
ATOM   4250 H H    . GLN A 1 288 ? 9.101   11.135  22.487 1.00 11.32  ? 288  GLN A H    1 
ATOM   4251 H HA   . GLN A 1 288 ? 7.778   9.259   23.989 1.00 11.53  ? 288  GLN A HA   1 
ATOM   4252 H HB2  . GLN A 1 288 ? 10.367  8.626   23.083 1.00 11.28  ? 288  GLN A HB2  1 
ATOM   4253 H HB3  . GLN A 1 288 ? 9.546   7.757   24.089 1.00 11.28  ? 288  GLN A HB3  1 
ATOM   4254 H HG2  . GLN A 1 288 ? 8.825   8.113   21.402 1.00 11.79  ? 288  GLN A HG2  1 
ATOM   4255 H HG3  . GLN A 1 288 ? 9.579   6.851   21.935 1.00 11.79  ? 288  GLN A HG3  1 
ATOM   4256 H HE21 . GLN A 1 288 ? 7.282   6.531   20.543 1.00 12.54  ? 288  GLN A HE21 1 
ATOM   4257 H HE22 . GLN A 1 288 ? 6.232   5.928   21.411 1.00 12.54  ? 288  GLN A HE22 1 
ATOM   4258 N N    . SER A 1 289 ? 9.380   9.598   26.064 1.00 10.54  ? 289  SER A N    1 
ATOM   4259 C CA   . SER A 1 289 ? 9.924   10.174  27.312 1.00 10.94  ? 289  SER A CA   1 
ATOM   4260 C C    . SER A 1 289 ? 11.396  10.485  27.192 1.00 10.30  ? 289  SER A C    1 
ATOM   4261 O O    . SER A 1 289 ? 12.207  9.749   26.635 1.00 10.51  ? 289  SER A O    1 
ATOM   4262 C CB   . SER A 1 289 ? 9.802   9.024   28.402 1.00 12.20  ? 289  SER A CB   1 
ATOM   4263 O OG   . SER A 1 289 ? 10.365  9.333   29.588 1.00 13.64  ? 289  SER A OG   1 
ATOM   4264 H H    . SER A 1 289 ? 9.098   8.786   26.071 1.00 12.65  ? 289  SER A H    1 
ATOM   4265 H HA   . SER A 1 289 ? 9.419   10.969  27.582 1.00 13.13  ? 289  SER A HA   1 
ATOM   4266 H HB2  . SER A 1 289 ? 8.863   8.827   28.544 1.00 14.64  ? 289  SER A HB2  1 
ATOM   4267 H HB3  . SER A 1 289 ? 10.223  8.221   28.057 1.00 14.64  ? 289  SER A HB3  1 
ATOM   4268 H HG   . SER A 1 289 ? 11.166  9.473   29.482 1.00 20.46  ? 289  SER A HG   1 
ATOM   4269 N N    . ASN A 1 290 ? 11.789  11.575  27.901 1.00 10.43  ? 290  ASN A N    1 
ATOM   4270 C CA   . ASN A 1 290 ? 13.140  11.981  28.150 1.00 9.88   ? 290  ASN A CA   1 
ATOM   4271 C C    . ASN A 1 290 ? 13.777  11.366  29.448 1.00 10.11  ? 290  ASN A C    1 
ATOM   4272 O O    . ASN A 1 290 ? 14.853  11.793  29.844 1.00 10.56  ? 290  ASN A O    1 
ATOM   4273 C CB   . ASN A 1 290 ? 13.310  13.498  28.181 1.00 10.36  ? 290  ASN A CB   1 
ATOM   4274 C CG   . ASN A 1 290 ? 12.565  14.099  29.359 1.00 10.83  ? 290  ASN A CG   1 
ATOM   4275 O OD1  . ASN A 1 290 ? 12.011  13.418  30.223 1.00 11.80  ? 290  ASN A OD1  1 
ATOM   4276 N ND2  . ASN A 1 290 ? 12.555  15.444  29.372 1.00 13.14  ? 290  ASN A ND2  1 
ATOM   4277 H H    . ASN A 1 290 ? 11.168  12.069  28.232 1.00 12.52  ? 290  ASN A H    1 
ATOM   4278 H HA   . ASN A 1 290 ? 13.674  11.655  27.395 1.00 11.86  ? 290  ASN A HA   1 
ATOM   4279 H HB2  . ASN A 1 290 ? 14.253  13.717  28.249 1.00 12.43  ? 290  ASN A HB2  1 
ATOM   4280 H HB3  . ASN A 1 290 ? 12.972  13.879  27.355 1.00 12.43  ? 290  ASN A HB3  1 
ATOM   4281 H HD21 . ASN A 1 290 ? 12.955  15.883  28.750 1.00 15.77  ? 290  ASN A HD21 1 
ATOM   4282 H HD22 . ASN A 1 290 ? 12.150  15.865  30.003 1.00 15.77  ? 290  ASN A HD22 1 
ATOM   4283 N N    . SER A 1 291 ? 13.210  10.371  30.037 1.00 11.53  ? 291  SER A N    1 
ATOM   4284 C CA   . SER A 1 291 ? 13.692  9.618   31.188 1.00 11.69  ? 291  SER A CA   1 
ATOM   4285 C C    . SER A 1 291 ? 13.839  10.503  32.437 1.00 11.60  ? 291  SER A C    1 
ATOM   4286 O O    . SER A 1 291 ? 14.557  10.132  33.376 1.00 12.59  ? 291  SER A O    1 
ATOM   4287 C CB   . SER A 1 291 ? 14.969  8.896   30.872 1.00 13.11  ? 291  SER A CB   1 
ATOM   4288 O OG   . SER A 1 291 ? 14.871  7.966   29.795 1.00 15.75  ? 291  SER A OG   1 
ATOM   4289 H H    . SER A 1 291 ? 12.455  10.120  29.711 1.00 13.83  ? 291  SER A H    1 
ATOM   4290 H HA   . SER A 1 291 ? 13.017  8.937   31.393 1.00 14.02  ? 291  SER A HA   1 
ATOM   4291 H HB2  . SER A 1 291 ? 15.650  9.551   30.654 1.00 15.73  ? 291  SER A HB2  1 
ATOM   4292 H HB3  . SER A 1 291 ? 15.262  8.421   31.665 1.00 15.73  ? 291  SER A HB3  1 
ATOM   4293 H HG   . SER A 1 291 ? 14.641  8.360   29.113 1.00 23.62  ? 291  SER A HG   1 
ATOM   4294 N N    . GLY A 1 292 ? 13.169  11.640  32.466 1.00 12.30  ? 292  GLY A N    1 
ATOM   4295 C CA   . GLY A 1 292 ? 13.132  12.506  33.673 1.00 13.14  ? 292  GLY A CA   1 
ATOM   4296 C C    . GLY A 1 292 ? 14.330  13.406  33.814 1.00 12.13  ? 292  GLY A C    1 
ATOM   4297 O O    . GLY A 1 292 ? 14.557  13.960  34.908 1.00 14.32  ? 292  GLY A O    1 
ATOM   4298 H H    . GLY A 1 292 ? 12.740  11.888  31.763 1.00 14.76  ? 292  GLY A H    1 
ATOM   4299 H HA2  . GLY A 1 292 ? 12.332  13.053  33.640 1.00 15.77  ? 292  GLY A HA2  1 
ATOM   4300 H HA3  . GLY A 1 292 ? 13.071  11.942  34.460 1.00 15.77  ? 292  GLY A HA3  1 
ATOM   4301 N N    . ILE A 1 293 ? 15.100  13.660  32.742 1.00 11.46  ? 293  ILE A N    1 
ATOM   4302 C CA   . ILE A 1 293 ? 16.351  14.454  32.827 1.00 12.54  ? 293  ILE A CA   1 
ATOM   4303 C C    . ILE A 1 293 ? 16.163  15.948  32.961 1.00 13.28  ? 293  ILE A C    1 
ATOM   4304 O O    . ILE A 1 293 ? 17.106  16.689  33.250 1.00 16.40  ? 293  ILE A O    1 
ATOM   4305 C CB   . ILE A 1 293 ? 17.307  14.165  31.649 1.00 12.22  ? 293  ILE A CB   1 
ATOM   4306 C CG1  . ILE A 1 293 ? 16.680  14.613  30.310 1.00 11.50  ? 293  ILE A CG1  1 
ATOM   4307 C CG2  . ILE A 1 293 ? 17.794  12.724  31.643 1.00 13.42  ? 293  ILE A CG2  1 
ATOM   4308 C CD1  . ILE A 1 293 ? 17.582  14.391  29.096 1.00 13.26  ? 293  ILE A CD1  1 
ATOM   4309 H H    . ILE A 1 293 ? 14.858  13.350  31.977 1.00 13.75  ? 293  ILE A H    1 
ATOM   4310 H HA   . ILE A 1 293 ? 16.813  14.158  33.639 1.00 15.05  ? 293  ILE A HA   1 
ATOM   4311 H HB   . ILE A 1 293 ? 18.098  14.726  31.788 1.00 14.67  ? 293  ILE A HB   1 
ATOM   4312 H HG12 . ILE A 1 293 ? 15.852  14.127  30.175 1.00 13.80  ? 293  ILE A HG12 1 
ATOM   4313 H HG13 . ILE A 1 293 ? 16.462  15.556  30.368 1.00 13.80  ? 293  ILE A HG13 1 
ATOM   4314 H HG21 . ILE A 1 293 ? 18.167  12.509  32.501 1.00 20.13  ? 293  ILE A HG21 1 
ATOM   4315 H HG22 . ILE A 1 293 ? 17.056  12.138  31.459 1.00 20.13  ? 293  ILE A HG22 1 
ATOM   4316 H HG23 . ILE A 1 293 ? 18.465  12.616  30.966 1.00 20.13  ? 293  ILE A HG23 1 
ATOM   4317 H HD11 . ILE A 1 293 ? 18.396  14.888  29.208 1.00 19.89  ? 293  ILE A HD11 1 
ATOM   4318 H HD12 . ILE A 1 293 ? 17.786  13.457  29.016 1.00 19.89  ? 293  ILE A HD12 1 
ATOM   4319 H HD13 . ILE A 1 293 ? 17.132  14.690  28.303 1.00 19.89  ? 293  ILE A HD13 1 
ATOM   4320 N N    . GLY A 1 294 ? 14.945  16.454  32.783 1.00 13.78  ? 294  GLY A N    1 
ATOM   4321 C CA   . GLY A 1 294 ? 14.703  17.888  33.051 1.00 15.28  ? 294  GLY A CA   1 
ATOM   4322 C C    . GLY A 1 294 ? 14.932  18.850  31.884 1.00 11.96  ? 294  GLY A C    1 
ATOM   4323 O O    . GLY A 1 294 ? 14.856  20.071  32.087 1.00 11.88  ? 294  GLY A O    1 
ATOM   4324 H H    . GLY A 1 294 ? 14.303  15.950  32.514 1.00 16.54  ? 294  GLY A H    1 
ATOM   4325 H HA2  . GLY A 1 294 ? 13.786  17.989  33.351 1.00 18.33  ? 294  GLY A HA2  1 
ATOM   4326 H HA3  . GLY A 1 294 ? 15.278  18.159  33.784 1.00 18.33  ? 294  GLY A HA3  1 
ATOM   4327 N N    . PHE A 1 295 ? 15.125  18.340  30.666 1.00 10.66  ? 295  PHE A N    1 
ATOM   4328 C CA   . PHE A 1 295 ? 15.199  19.140  29.452 1.00 9.80   ? 295  PHE A CA   1 
ATOM   4329 C C    . PHE A 1 295 ? 14.827  18.194  28.294 1.00 9.47   ? 295  PHE A C    1 
ATOM   4330 O O    . PHE A 1 295 ? 14.839  16.946  28.465 1.00 9.92   ? 295  PHE A O    1 
ATOM   4331 C CB   . PHE A 1 295 ? 16.551  19.817  29.253 1.00 10.20  ? 295  PHE A CB   1 
ATOM   4332 C CG   . PHE A 1 295 ? 17.728  18.912  29.079 1.00 10.07  ? 295  PHE A CG   1 
ATOM   4333 C CD1  . PHE A 1 295 ? 18.420  18.400  30.221 1.00 11.27  ? 295  PHE A CD1  1 
ATOM   4334 C CD2  . PHE A 1 295 ? 18.198  18.546  27.837 1.00 10.83  ? 295  PHE A CD2  1 
ATOM   4335 C CE1  . PHE A 1 295 ? 19.497  17.590  30.070 1.00 12.17  ? 295  PHE A CE1  1 
ATOM   4336 C CE2  . PHE A 1 295 ? 19.336  17.741  27.689 1.00 11.55  ? 295  PHE A CE2  1 
ATOM   4337 C CZ   . PHE A 1 295 ? 19.992  17.289  28.831 1.00 12.17  ? 295  PHE A CZ   1 
ATOM   4338 H H    . PHE A 1 295 ? 15.210  17.487  30.593 1.00 12.79  ? 295  PHE A H    1 
ATOM   4339 H HA   . PHE A 1 295 ? 14.514  19.838  29.506 1.00 11.76  ? 295  PHE A HA   1 
ATOM   4340 H HB2  . PHE A 1 295 ? 16.491  20.389  28.472 1.00 12.24  ? 295  PHE A HB2  1 
ATOM   4341 H HB3  . PHE A 1 295 ? 16.719  20.389  30.018 1.00 12.24  ? 295  PHE A HB3  1 
ATOM   4342 H HD1  . PHE A 1 295 ? 18.128  18.624  31.075 1.00 13.52  ? 295  PHE A HD1  1 
ATOM   4343 H HD2  . PHE A 1 295 ? 17.750  18.840  27.078 1.00 13.00  ? 295  PHE A HD2  1 
ATOM   4344 H HE1  . PHE A 1 295 ? 19.908  17.233  30.824 1.00 14.60  ? 295  PHE A HE1  1 
ATOM   4345 H HE2  . PHE A 1 295 ? 19.647  17.513  26.842 1.00 13.86  ? 295  PHE A HE2  1 
ATOM   4346 H HZ   . PHE A 1 295 ? 20.768  16.782  28.752 1.00 14.60  ? 295  PHE A HZ   1 
ATOM   4347 N N    . SER A 1 296 ? 14.488  18.781  27.157 1.00 9.03   ? 296  SER A N    1 
ATOM   4348 C CA   . SER A 1 296 ? 13.989  17.997  26.011 1.00 8.90   ? 296  SER A CA   1 
ATOM   4349 C C    . SER A 1 296 ? 15.049  17.831  24.942 1.00 8.39   ? 296  SER A C    1 
ATOM   4350 O O    . SER A 1 296 ? 16.044  18.567  24.853 1.00 9.32   ? 296  SER A O    1 
ATOM   4351 C CB   . SER A 1 296 ? 12.705  18.683  25.504 1.00 9.27   ? 296  SER A CB   1 
ATOM   4352 O OG   . SER A 1 296 ? 11.651  18.545  26.451 1.00 10.37  ? 296  SER A OG   1 
ATOM   4353 H H    . SER A 1 296 ? 14.560  19.635  27.085 1.00 10.84  ? 296  SER A H    1 
ATOM   4354 H HA   . SER A 1 296 ? 13.746  17.106  26.338 1.00 10.67  ? 296  SER A HA   1 
ATOM   4355 H HB2  . SER A 1 296 ? 12.880  19.624  25.349 1.00 11.13  ? 296  SER A HB2  1 
ATOM   4356 H HB3  . SER A 1 296 ? 12.436  18.285  24.661 1.00 11.13  ? 296  SER A HB3  1 
ATOM   4357 H HG   . SER A 1 296 ? 11.873  18.892  27.160 1.00 15.55  ? 296  SER A HG   1 
ATOM   4358 N N    . ILE A 1 297 ? 14.822  16.777  24.115 1.00 8.15   ? 297  ILE A N    1 
ATOM   4359 C CA   . ILE A 1 297 ? 15.785  16.414  23.076 1.00 8.20   ? 297  ILE A CA   1 
ATOM   4360 C C    . ILE A 1 297 ? 15.097  16.539  21.726 1.00 8.07   ? 297  ILE A C    1 
ATOM   4361 O O    . ILE A 1 297 ? 14.202  15.743  21.368 1.00 8.51   ? 297  ILE A O    1 
ATOM   4362 C CB   . ILE A 1 297 ? 16.363  14.982  23.271 1.00 8.96   ? 297  ILE A CB   1 
ATOM   4363 C CG1  . ILE A 1 297 ? 16.822  14.738  24.738 1.00 10.29  ? 297  ILE A CG1  1 
ATOM   4364 C CG2  . ILE A 1 297 ? 17.464  14.748  22.244 1.00 9.84   ? 297  ILE A CG2  1 
ATOM   4365 C CD1  . ILE A 1 297 ? 17.909  15.568  25.221 1.00 11.44  ? 297  ILE A CD1  1 
ATOM   4366 H H    . ILE A 1 297 ? 14.101  16.317  24.204 1.00 9.78   ? 297  ILE A H    1 
ATOM   4367 H HA   . ILE A 1 297 ? 16.527  17.054  23.105 1.00 9.83   ? 297  ILE A HA   1 
ATOM   4368 H HB   . ILE A 1 297 ? 15.643  14.346  23.079 1.00 10.75  ? 297  ILE A HB   1 
ATOM   4369 H HG12 . ILE A 1 297 ? 16.058  14.870  25.320 1.00 12.35  ? 297  ILE A HG12 1 
ATOM   4370 H HG13 . ILE A 1 297 ? 17.091  13.809  24.821 1.00 12.35  ? 297  ILE A HG13 1 
ATOM   4371 H HG21 . ILE A 1 297 ? 17.122  14.918  21.363 1.00 14.75  ? 297  ILE A HG21 1 
ATOM   4372 H HG22 . ILE A 1 297 ? 18.199  15.340  22.422 1.00 14.75  ? 297  ILE A HG22 1 
ATOM   4373 H HG23 . ILE A 1 297 ? 17.766  13.838  22.300 1.00 14.75  ? 297  ILE A HG23 1 
ATOM   4374 H HD11 . ILE A 1 297 ? 18.111  15.334  26.130 1.00 17.15  ? 297  ILE A HD11 1 
ATOM   4375 H HD12 . ILE A 1 297 ? 18.686  15.427  24.675 1.00 17.15  ? 297  ILE A HD12 1 
ATOM   4376 H HD13 . ILE A 1 297 ? 17.650  16.491  25.177 1.00 17.15  ? 297  ILE A HD13 1 
ATOM   4377 N N    . PHE A 1 298 ? 15.479  17.591  20.984 1.00 8.34   ? 298  PHE A N    1 
ATOM   4378 C CA   . PHE A 1 298 ? 14.915  17.891  19.662 1.00 8.44   ? 298  PHE A CA   1 
ATOM   4379 C C    . PHE A 1 298 ? 15.718  17.074  18.639 1.00 8.14   ? 298  PHE A C    1 
ATOM   4380 O O    . PHE A 1 298 ? 16.665  17.560  17.996 1.00 8.82   ? 298  PHE A O    1 
ATOM   4381 C CB   . PHE A 1 298 ? 14.901  19.387  19.385 1.00 8.73   ? 298  PHE A CB   1 
ATOM   4382 C CG   . PHE A 1 298 ? 13.920  20.140  20.278 1.00 9.14   ? 298  PHE A CG   1 
ATOM   4383 C CD1  . PHE A 1 298 ? 14.237  20.625  21.509 1.00 11.11  ? 298  PHE A CD1  1 
ATOM   4384 C CD2  . PHE A 1 298 ? 12.616  20.353  19.812 1.00 9.79   ? 298  PHE A CD2  1 
ATOM   4385 C CE1  . PHE A 1 298 ? 13.318  21.327  22.274 1.00 12.61  ? 298  PHE A CE1  1 
ATOM   4386 C CE2  . PHE A 1 298 ? 11.695  21.038  20.579 1.00 11.20  ? 298  PHE A CE2  1 
ATOM   4387 C CZ   . PHE A 1 298 ? 12.039  21.510  21.796 1.00 11.66  ? 298  PHE A CZ   1 
ATOM   4388 H H    . PHE A 1 298 ? 16.084  18.115  21.299 1.00 10.01  ? 298  PHE A H    1 
ATOM   4389 H HA   . PHE A 1 298 ? 13.989  17.571  19.647 1.00 10.13  ? 298  PHE A HA   1 
ATOM   4390 H HB2  . PHE A 1 298 ? 15.793  19.743  19.523 1.00 10.48  ? 298  PHE A HB2  1 
ATOM   4391 H HB3  . PHE A 1 298 ? 14.663  19.535  18.456 1.00 10.48  ? 298  PHE A HB3  1 
ATOM   4392 H HD1  . PHE A 1 298 ? 15.092  20.481  21.847 1.00 13.33  ? 298  PHE A HD1  1 
ATOM   4393 H HD2  . PHE A 1 298 ? 12.368  20.029  18.976 1.00 11.75  ? 298  PHE A HD2  1 
ATOM   4394 H HE1  . PHE A 1 298 ? 13.563  21.671  23.103 1.00 15.13  ? 298  PHE A HE1  1 
ATOM   4395 H HE2  . PHE A 1 298 ? 10.834  21.175  20.256 1.00 13.44  ? 298  PHE A HE2  1 
ATOM   4396 H HZ   . PHE A 1 298 ? 11.411  21.960  22.313 1.00 13.99  ? 298  PHE A HZ   1 
ATOM   4397 N N    . GLY A 1 299 ? 15.336  15.788  18.546 1.00 8.31   ? 299  GLY A N    1 
ATOM   4398 C CA   . GLY A 1 299 ? 15.980  14.826  17.662 1.00 8.16   ? 299  GLY A CA   1 
ATOM   4399 C C    . GLY A 1 299 ? 15.329  14.817  16.279 1.00 8.29   ? 299  GLY A C    1 
ATOM   4400 O O    . GLY A 1 299 ? 14.644  15.760  15.839 1.00 8.43   ? 299  GLY A O    1 
ATOM   4401 H H    . GLY A 1 299 ? 14.679  15.521  19.032 1.00 9.97   ? 299  GLY A H    1 
ATOM   4402 H HA2  . GLY A 1 299 ? 16.920  15.049  17.573 1.00 9.80   ? 299  GLY A HA2  1 
ATOM   4403 H HA3  . GLY A 1 299 ? 15.918  13.940  18.052 1.00 9.80   ? 299  GLY A HA3  1 
ATOM   4404 N N    . ASP A 1 300 ? 15.612  13.711  15.531 1.00 8.08   ? 300  ASP A N    1 
ATOM   4405 C CA   . ASP A 1 300 ? 15.369  13.732  14.091 1.00 8.35   ? 300  ASP A CA   1 
ATOM   4406 C C    . ASP A 1 300 ? 13.898  13.911  13.744 1.00 8.27   ? 300  ASP A C    1 
ATOM   4407 O O    . ASP A 1 300 ? 13.574  14.560  12.711 1.00 8.92   ? 300  ASP A O    1 
ATOM   4408 C CB   . ASP A 1 300 ? 15.924  12.463  13.436 1.00 8.71   ? 300  ASP A CB   1 
ATOM   4409 C CG   . ASP A 1 300 ? 17.390  12.187  13.657 1.00 8.66   ? 300  ASP A CG   1 
ATOM   4410 O OD1  . ASP A 1 300 ? 18.124  13.274  13.906 1.00 9.13   ? 300  ASP A OD1  1 
ATOM   4411 O OD2  . ASP A 1 300 ? 17.869  11.071  13.568 1.00 9.81   ? 300  ASP A OD2  1 
ATOM   4412 H H    . ASP A 1 300 ? 15.932  13.006  15.905 1.00 9.70   ? 300  ASP A H    1 
ATOM   4413 H HA   . ASP A 1 300 ? 15.857  14.495  13.719 1.00 10.02  ? 300  ASP A HA   1 
ATOM   4414 H HB2  . ASP A 1 300 ? 15.419  11.704  13.767 1.00 10.46  ? 300  ASP A HB2  1 
ATOM   4415 H HB3  . ASP A 1 300 ? 15.767  12.521  12.480 1.00 10.46  ? 300  ASP A HB3  1 
ATOM   4416 N N    . ILE A 1 301 ? 12.965  13.360  14.537 1.00 8.28   ? 301  ILE A N    1 
ATOM   4417 C CA   . ILE A 1 301 ? 11.533  13.567  14.275 1.00 9.02   ? 301  ILE A CA   1 
ATOM   4418 C C    . ILE A 1 301 ? 11.188  15.038  14.131 1.00 8.62   ? 301  ILE A C    1 
ATOM   4419 O O    . ILE A 1 301 ? 10.437  15.451  13.248 1.00 9.48   ? 301  ILE A O    1 
ATOM   4420 C CB   . ILE A 1 301 ? 10.709  12.898  15.411 1.00 8.82   ? 301  ILE A CB   1 
ATOM   4421 C CG1  . ILE A 1 301 ? 10.804  11.368  15.354 1.00 9.43   ? 301  ILE A CG1  1 
ATOM   4422 C CG2  . ILE A 1 301 ? 9.245   13.380  15.437 1.00 9.76   ? 301  ILE A CG2  1 
ATOM   4423 C CD1  . ILE A 1 301 ? 10.039  10.723  14.206 1.00 10.07  ? 301  ILE A CD1  1 
ATOM   4424 H H    . ILE A 1 301 ? 13.209  12.879  15.208 1.00 9.94   ? 301  ILE A H    1 
ATOM   4425 H HA   . ILE A 1 301 ? 11.310  13.119  13.432 1.00 10.83  ? 301  ILE A HA   1 
ATOM   4426 H HB   . ILE A 1 301 ? 11.114  13.177  16.259 1.00 10.58  ? 301  ILE A HB   1 
ATOM   4427 H HG12 . ILE A 1 301 ? 11.739  11.119  15.281 1.00 11.31  ? 301  ILE A HG12 1 
ATOM   4428 H HG13 . ILE A 1 301 ? 10.470  11.006  16.190 1.00 11.31  ? 301  ILE A HG13 1 
ATOM   4429 H HG21 . ILE A 1 301 ? 9.224   14.339  15.473 1.00 14.63  ? 301  ILE A HG21 1 
ATOM   4430 H HG22 . ILE A 1 301 ? 8.795   13.079  14.644 1.00 14.63  ? 301  ILE A HG22 1 
ATOM   4431 H HG23 . ILE A 1 301 ? 8.803   13.021  16.211 1.00 14.63  ? 301  ILE A HG23 1 
ATOM   4432 H HD11 . ILE A 1 301 ? 9.106   10.939  14.281 1.00 15.10  ? 301  ILE A HD11 1 
ATOM   4433 H HD12 . ILE A 1 301 ? 10.377  11.054  13.370 1.00 15.10  ? 301  ILE A HD12 1 
ATOM   4434 H HD13 . ILE A 1 301 ? 10.150  9.770   14.242 1.00 15.10  ? 301  ILE A HD13 1 
ATOM   4435 N N    . PHE A 1 302 ? 11.717  15.870  15.091 1.00 8.57   ? 302  PHE A N    1 
ATOM   4436 C CA   . PHE A 1 302 ? 11.512  17.311  15.017 1.00 8.52   ? 302  PHE A CA   1 
ATOM   4437 C C    . PHE A 1 302 ? 12.280  17.949  13.830 1.00 8.35   ? 302  PHE A C    1 
ATOM   4438 O O    . PHE A 1 302 ? 11.748  18.800  13.090 1.00 8.97   ? 302  PHE A O    1 
ATOM   4439 C CB   . PHE A 1 302 ? 11.957  17.960  16.351 1.00 9.30   ? 302  PHE A CB   1 
ATOM   4440 C CG   . PHE A 1 302 ? 11.965  19.482  16.303 1.00 9.15   ? 302  PHE A CG   1 
ATOM   4441 C CD1  . PHE A 1 302 ? 10.829  20.223  16.555 1.00 9.80   ? 302  PHE A CD1  1 
ATOM   4442 C CD2  . PHE A 1 302 ? 13.179  20.166  16.039 1.00 9.88   ? 302  PHE A CD2  1 
ATOM   4443 C CE1  . PHE A 1 302 ? 10.882  21.619  16.546 1.00 10.95  ? 302  PHE A CE1  1 
ATOM   4444 C CE2  . PHE A 1 302 ? 13.234  21.547  16.009 1.00 11.11  ? 302  PHE A CE2  1 
ATOM   4445 C CZ   . PHE A 1 302 ? 12.085  22.273  16.269 1.00 11.59  ? 302  PHE A CZ   1 
ATOM   4446 H H    . PHE A 1 302 ? 12.172  15.536  15.739 1.00 10.29  ? 302  PHE A H    1 
ATOM   4447 H HA   . PHE A 1 302 ? 10.555  17.481  14.894 1.00 10.22  ? 302  PHE A HA   1 
ATOM   4448 H HB2  . PHE A 1 302 ? 11.359  17.670  17.057 1.00 11.16  ? 302  PHE A HB2  1 
ATOM   4449 H HB3  . PHE A 1 302 ? 12.849  17.648  16.571 1.00 11.16  ? 302  PHE A HB3  1 
ATOM   4450 H HD1  . PHE A 1 302 ? 10.024  19.791  16.731 1.00 11.76  ? 302  PHE A HD1  1 
ATOM   4451 H HD2  . PHE A 1 302 ? 13.954  19.675  15.883 1.00 11.86  ? 302  PHE A HD2  1 
ATOM   4452 H HE1  . PHE A 1 302 ? 10.115  22.114  16.725 1.00 13.14  ? 302  PHE A HE1  1 
ATOM   4453 H HE2  . PHE A 1 302 ? 14.033  21.983  15.816 1.00 13.33  ? 302  PHE A HE2  1 
ATOM   4454 H HZ   . PHE A 1 302 ? 12.113  23.202  16.259 1.00 13.91  ? 302  PHE A HZ   1 
ATOM   4455 N N    . LEU A 1 303 ? 13.545  17.560  13.700 1.00 8.59   ? 303  LEU A N    1 
ATOM   4456 C CA   . LEU A 1 303 ? 14.418  18.219  12.708 1.00 9.26   ? 303  LEU A CA   1 
ATOM   4457 C C    . LEU A 1 303 ? 13.906  17.986  11.271 1.00 8.91   ? 303  LEU A C    1 
ATOM   4458 O O    . LEU A 1 303 ? 14.125  18.858  10.413 1.00 10.06  ? 303  LEU A O    1 
ATOM   4459 C CB   . LEU A 1 303 ? 15.843  17.708  12.888 1.00 9.55   ? 303  LEU A CB   1 
ATOM   4460 C CG   . LEU A 1 303 ? 16.477  18.113  14.252 1.00 9.73   ? 303  LEU A CG   1 
ATOM   4461 C CD1  . LEU A 1 303 ? 17.743  17.308  14.501 1.00 11.19  ? 303  LEU A CD1  1 
ATOM   4462 C CD2  . LEU A 1 303 ? 16.763  19.613  14.332 1.00 12.05  ? 303  LEU A CD2  1 
ATOM   4463 H H    . LEU A 1 303 ? 13.854  16.927  14.193 1.00 10.31  ? 303  LEU A H    1 
ATOM   4464 H HA   . LEU A 1 303 ? 14.412  19.183  12.885 1.00 11.12  ? 303  LEU A HA   1 
ATOM   4465 H HB2  . LEU A 1 303 ? 15.842  16.740  12.817 1.00 11.46  ? 303  LEU A HB2  1 
ATOM   4466 H HB3  . LEU A 1 303 ? 16.395  18.055  12.169 1.00 11.46  ? 303  LEU A HB3  1 
ATOM   4467 H HG   . LEU A 1 303 ? 15.836  17.891  14.959 1.00 11.68  ? 303  LEU A HG   1 
ATOM   4468 H HD11 . LEU A 1 303 ? 17.543  16.370  14.445 1.00 16.78  ? 303  LEU A HD11 1 
ATOM   4469 H HD12 . LEU A 1 303 ? 18.401  17.534  13.839 1.00 16.78  ? 303  LEU A HD12 1 
ATOM   4470 H HD13 . LEU A 1 303 ? 18.085  17.511  15.374 1.00 16.78  ? 303  LEU A HD13 1 
ATOM   4471 H HD21 . LEU A 1 303 ? 17.417  19.850  13.670 1.00 18.07  ? 303  LEU A HD21 1 
ATOM   4472 H HD22 . LEU A 1 303 ? 15.952  20.102  14.170 1.00 18.07  ? 303  LEU A HD22 1 
ATOM   4473 H HD23 . LEU A 1 303 ? 17.098  19.829  15.205 1.00 18.07  ? 303  LEU A HD23 1 
ATOM   4474 N N    . LYS A 1 304 ? 13.210  16.885  11.003 1.00 9.23   ? 304  LYS A N    1 
ATOM   4475 C CA   . LYS A 1 304 ? 12.635  16.646  9.668  1.00 9.87   ? 304  LYS A CA   1 
ATOM   4476 C C    . LYS A 1 304 ? 11.607  17.700  9.255  1.00 9.76   ? 304  LYS A C    1 
ATOM   4477 O O    . LYS A 1 304 ? 11.264  17.779  8.059  1.00 11.64  ? 304  LYS A O    1 
ATOM   4478 C CB   . LYS A 1 304 ? 11.971  15.206  9.607  1.00 9.92   ? 304  LYS A CB   1 
ATOM   4479 C CG   . LYS A 1 304 ? 12.982  14.118  9.339  1.00 10.61  ? 304  LYS A CG   1 
ATOM   4480 C CD   . LYS A 1 304 ? 12.392  12.725  9.326  1.00 10.50  ? 304  LYS A CD   1 
ATOM   4481 C CE   . LYS A 1 304 ? 12.617  12.024  10.663 1.00 10.87  ? 304  LYS A CE   1 
ATOM   4482 N NZ   . LYS A 1 304 ? 11.935  10.718  10.762 1.00 10.84  ? 304  LYS A NZ   1 
ATOM   4483 H H    . LYS A 1 304 ? 13.092  16.299  11.622 1.00 11.08  ? 304  LYS A H    1 
ATOM   4484 H HA   . LYS A 1 304 ? 13.367  16.668  9.017  1.00 11.84  ? 304  LYS A HA   1 
ATOM   4485 H HB2  . LYS A 1 304 ? 11.525  15.026  10.449 1.00 11.91  ? 304  LYS A HB2  1 
ATOM   4486 H HB3  . LYS A 1 304 ? 11.300  15.196  8.906  1.00 11.91  ? 304  LYS A HB3  1 
ATOM   4487 H HG2  . LYS A 1 304 ? 13.403  14.287  8.482  1.00 12.73  ? 304  LYS A HG2  1 
ATOM   4488 H HG3  . LYS A 1 304 ? 13.672  14.159  10.019 1.00 12.73  ? 304  LYS A HG3  1 
ATOM   4489 H HD2  . LYS A 1 304 ? 11.441  12.779  9.146  1.00 12.60  ? 304  LYS A HD2  1 
ATOM   4490 H HD3  . LYS A 1 304 ? 12.803  12.207  8.617  1.00 12.60  ? 304  LYS A HD3  1 
ATOM   4491 H HE2  . LYS A 1 304 ? 13.569  11.891  10.792 1.00 13.04  ? 304  LYS A HE2  1 
ATOM   4492 H HE3  . LYS A 1 304 ? 12.299  12.599  11.377 1.00 13.04  ? 304  LYS A HE3  1 
ATOM   4493 H HZ1  . LYS A 1 304 ? 12.098  10.358  11.559 1.00 16.27  ? 304  LYS A HZ1  1 
ATOM   4494 H HZ2  . LYS A 1 304 ? 11.058  10.833  10.663 1.00 16.27  ? 304  LYS A HZ2  1 
ATOM   4495 H HZ3  . LYS A 1 304 ? 12.237  10.177  10.123 1.00 16.27  ? 304  LYS A HZ3  1 
ATOM   4496 N N    . SER A 1 305 ? 11.090  18.493  10.189 1.00 8.90   ? 305  SER A N    1 
ATOM   4497 C CA   . SER A 1 305 ? 10.139  19.542  9.850  1.00 9.07   ? 305  SER A CA   1 
ATOM   4498 C C    . SER A 1 305 ? 10.797  20.906  9.569  1.00 9.12   ? 305  SER A C    1 
ATOM   4499 O O    . SER A 1 305 ? 10.092  21.818  9.059  1.00 9.75   ? 305  SER A O    1 
ATOM   4500 C CB   . SER A 1 305 ? 9.082   19.693  10.970 1.00 9.48   ? 305  SER A CB   1 
ATOM   4501 O OG   . SER A 1 305 ? 9.594   20.271  12.166 1.00 9.71   ? 305  SER A OG   1 
ATOM   4502 H H    . SER A 1 305 ? 11.322  18.384  11.010 1.00 10.68  ? 305  SER A H    1 
ATOM   4503 H HA   . SER A 1 305 ? 9.670   19.265  9.035  1.00 10.89  ? 305  SER A HA   1 
ATOM   4504 H HB2  . SER A 1 305 ? 8.355   20.245  10.642 1.00 11.37  ? 305  SER A HB2  1 
ATOM   4505 H HB3  . SER A 1 305 ? 8.718   18.818  11.177 1.00 11.37  ? 305  SER A HB3  1 
ATOM   4506 H HG   . SER A 1 305 ? 10.197  19.800  12.461 1.00 14.57  ? 305  SER A HG   1 
ATOM   4507 N N    . GLN A 1 306 ? 12.080  21.081  9.885  1.00 8.84   ? 306  GLN A N    1 
ATOM   4508 C CA   . GLN A 1 306 ? 12.746  22.387  9.872  1.00 8.92   ? 306  GLN A CA   1 
ATOM   4509 C C    . GLN A 1 306 ? 13.996  22.376  9.048  1.00 8.72   ? 306  GLN A C    1 
ATOM   4510 O O    . GLN A 1 306 ? 14.675  21.344  8.905  1.00 10.34  ? 306  GLN A O    1 
ATOM   4511 C CB   . GLN A 1 306 ? 13.159  22.796  11.337 1.00 9.47   ? 306  GLN A CB   1 
ATOM   4512 C CG   . GLN A 1 306 ? 12.048  22.710  12.373 1.00 9.81   ? 306  GLN A CG   1 
ATOM   4513 C CD   . GLN A 1 306 ? 10.918  23.695  12.124 1.00 10.21  ? 306  GLN A CD   1 
ATOM   4514 O OE1  . GLN A 1 306 ? 11.199  24.904  11.948 1.00 11.27  ? 306  GLN A OE1  1 
ATOM   4515 N NE2  . GLN A 1 306 ? 9.681   23.208  12.078 1.00 10.80  ? 306  GLN A NE2  1 
ATOM   4516 H H    . GLN A 1 306 ? 12.542  20.391  10.108 1.00 10.60  ? 306  GLN A H    1 
ATOM   4517 H HA   . GLN A 1 306 ? 12.130  23.059  9.512  1.00 10.70  ? 306  GLN A HA   1 
ATOM   4518 H HB2  . GLN A 1 306 ? 13.889  22.224  11.621 1.00 11.37  ? 306  GLN A HB2  1 
ATOM   4519 H HB3  . GLN A 1 306 ? 13.492  23.706  11.319 1.00 11.37  ? 306  GLN A HB3  1 
ATOM   4520 H HG2  . GLN A 1 306 ? 11.687  21.810  12.372 1.00 11.78  ? 306  GLN A HG2  1 
ATOM   4521 H HG3  . GLN A 1 306 ? 12.424  22.877  13.251 1.00 11.78  ? 306  GLN A HG3  1 
ATOM   4522 H HE21 . GLN A 1 306 ? 9.544   22.369  12.206 1.00 12.96  ? 306  GLN A HE21 1 
ATOM   4523 H HE22 . GLN A 1 306 ? 9.018   23.733  11.919 1.00 12.96  ? 306  GLN A HE22 1 
ATOM   4524 N N    . TYR A 1 307 ? 14.433  23.560  8.575  1.00 8.82   ? 307  TYR A N    1 
ATOM   4525 C CA   . TYR A 1 307 ? 15.819  23.831  8.246  1.00 8.44   ? 307  TYR A CA   1 
ATOM   4526 C C    . TYR A 1 307 ? 16.408  24.536  9.495  1.00 8.74   ? 307  TYR A C    1 
ATOM   4527 O O    . TYR A 1 307 ? 15.787  25.485  9.984  1.00 9.51   ? 307  TYR A O    1 
ATOM   4528 C CB   . TYR A 1 307 ? 15.970  24.723  7.018  1.00 9.32   ? 307  TYR A CB   1 
ATOM   4529 C CG   . TYR A 1 307 ? 17.359  24.941  6.529  1.00 9.41   ? 307  TYR A CG   1 
ATOM   4530 C CD1  . TYR A 1 307 ? 18.100  23.948  5.883  1.00 9.92   ? 307  TYR A CD1  1 
ATOM   4531 C CD2  . TYR A 1 307 ? 18.016  26.172  6.646  1.00 10.20  ? 307  TYR A CD2  1 
ATOM   4532 C CE1  . TYR A 1 307 ? 19.350  24.204  5.292  1.00 10.33  ? 307  TYR A CE1  1 
ATOM   4533 C CE2  . TYR A 1 307 ? 19.241  26.461  6.108  1.00 10.36  ? 307  TYR A CE2  1 
ATOM   4534 C CZ   . TYR A 1 307 ? 19.893  25.484  5.382  1.00 9.70   ? 307  TYR A CZ   1 
ATOM   4535 O OH   . TYR A 1 307 ? 21.092  25.830  4.775  1.00 10.92  ? 307  TYR A OH   1 
ATOM   4536 H H    . TYR A 1 307 ? 13.858  24.190  8.463  1.00 10.59  ? 307  TYR A H    1 
ATOM   4537 H HA   . TYR A 1 307 ? 16.291  22.985  8.096  1.00 10.12  ? 307  TYR A HA   1 
ATOM   4538 H HB2  . TYR A 1 307 ? 15.452  24.335  6.296  1.00 11.18  ? 307  TYR A HB2  1 
ATOM   4539 H HB3  . TYR A 1 307 ? 15.581  25.587  7.222  1.00 11.18  ? 307  TYR A HB3  1 
ATOM   4540 H HD1  . TYR A 1 307 ? 17.754  23.086  5.842  1.00 11.90  ? 307  TYR A HD1  1 
ATOM   4541 H HD2  . TYR A 1 307 ? 17.587  26.845  7.124  1.00 12.24  ? 307  TYR A HD2  1 
ATOM   4542 H HE1  . TYR A 1 307 ? 19.808  23.528  4.846  1.00 12.40  ? 307  TYR A HE1  1 
ATOM   4543 H HE2  . TYR A 1 307 ? 19.627  27.298  6.229  1.00 12.43  ? 307  TYR A HE2  1 
ATOM   4544 H HH   . TYR A 1 307 ? 21.395  25.181  4.376  1.00 16.39  ? 307  TYR A HH   1 
ATOM   4545 N N    . VAL A 1 308 ? 17.541  24.060  9.972  1.00 8.48   ? 308  VAL A N    1 
ATOM   4546 C CA   . VAL A 1 308 ? 18.148  24.583  11.227 1.00 8.60   ? 308  VAL A CA   1 
ATOM   4547 C C    . VAL A 1 308 ? 19.560  25.041  10.969 1.00 8.52   ? 308  VAL A C    1 
ATOM   4548 O O    . VAL A 1 308 ? 20.407  24.271  10.498 1.00 9.17   ? 308  VAL A O    1 
ATOM   4549 C CB   . VAL A 1 308 ? 18.101  23.524  12.376 1.00 9.14   ? 308  VAL A CB   1 
ATOM   4550 C CG1  . VAL A 1 308 ? 18.614  24.196  13.672 1.00 10.19  ? 308  VAL A CG1  1 
ATOM   4551 C CG2  . VAL A 1 308 ? 16.694  22.984  12.534 1.00 10.23  ? 308  VAL A CG2  1 
ATOM   4552 H H    . VAL A 1 308 ? 17.941  23.429  9.545  1.00 10.18  ? 308  VAL A H    1 
ATOM   4553 H HA   . VAL A 1 308 ? 17.626  25.361  11.513 1.00 10.32  ? 308  VAL A HA   1 
ATOM   4554 H HB   . VAL A 1 308 ? 18.699  22.783  12.147 1.00 10.96  ? 308  VAL A HB   1 
ATOM   4555 H HG11 . VAL A 1 308 ? 19.504  24.526  13.530 1.00 15.28  ? 308  VAL A HG11 1 
ATOM   4556 H HG12 . VAL A 1 308 ? 18.035  24.926  13.904 1.00 15.28  ? 308  VAL A HG12 1 
ATOM   4557 H HG13 . VAL A 1 308 ? 18.620  23.553  14.385 1.00 15.28  ? 308  VAL A HG13 1 
ATOM   4558 H HG21 . VAL A 1 308 ? 16.098  23.704  12.758 1.00 15.35  ? 308  VAL A HG21 1 
ATOM   4559 H HG22 . VAL A 1 308 ? 16.412  22.580  11.711 1.00 15.35  ? 308  VAL A HG22 1 
ATOM   4560 H HG23 . VAL A 1 308 ? 16.680  22.328  13.235 1.00 15.35  ? 308  VAL A HG23 1 
ATOM   4561 N N    . VAL A 1 309 ? 19.809  26.323  11.293 1.00 8.77   ? 309  VAL A N    1 
ATOM   4562 C CA   . VAL A 1 309 ? 21.139  26.958  11.197 1.00 8.85   ? 309  VAL A CA   1 
ATOM   4563 C C    . VAL A 1 309 ? 21.805  26.970  12.556 1.00 8.79   ? 309  VAL A C    1 
ATOM   4564 O O    . VAL A 1 309 ? 21.239  27.518  13.529 1.00 9.61   ? 309  VAL A O    1 
ATOM   4565 C CB   . VAL A 1 309 ? 21.017  28.380  10.613 1.00 9.34   ? 309  VAL A CB   1 
ATOM   4566 C CG1  . VAL A 1 309 ? 22.376  29.044  10.592 1.00 10.10  ? 309  VAL A CG1  1 
ATOM   4567 C CG2  . VAL A 1 309 ? 20.361  28.369  9.245  1.00 10.61  ? 309  VAL A CG2  1 
ATOM   4568 H H    . VAL A 1 309 ? 19.153  26.802  11.574 1.00 10.52  ? 309  VAL A H    1 
ATOM   4569 H HA   . VAL A 1 309 ? 21.692  26.423  10.589 1.00 10.62  ? 309  VAL A HA   1 
ATOM   4570 H HB   . VAL A 1 309 ? 20.442  28.899  11.214 1.00 11.21  ? 309  VAL A HB   1 
ATOM   4571 H HG11 . VAL A 1 309 ? 22.753  29.030  11.474 1.00 15.16  ? 309  VAL A HG11 1 
ATOM   4572 H HG12 . VAL A 1 309 ? 22.954  28.570  9.989  1.00 15.16  ? 309  VAL A HG12 1 
ATOM   4573 H HG13 . VAL A 1 309 ? 22.283  29.953  10.298 1.00 15.16  ? 309  VAL A HG13 1 
ATOM   4574 H HG21 . VAL A 1 309 ? 20.918  27.889  8.628  1.00 15.91  ? 309  VAL A HG21 1 
ATOM   4575 H HG22 . VAL A 1 309 ? 19.504  27.941  9.304  1.00 15.91  ? 309  VAL A HG22 1 
ATOM   4576 H HG23 . VAL A 1 309 ? 20.248  29.272  8.938  1.00 15.91  ? 309  VAL A HG23 1 
ATOM   4577 N N    . PHE A 1 310 ? 22.993  26.371  12.642 1.00 8.64   ? 310  PHE A N    1 
ATOM   4578 C CA   . PHE A 1 310 ? 23.820  26.285  13.874 1.00 8.63   ? 310  PHE A CA   1 
ATOM   4579 C C    . PHE A 1 310 ? 24.957  27.316  13.678 1.00 8.86   ? 310  PHE A C    1 
ATOM   4580 O O    . PHE A 1 310 ? 25.934  27.089  12.960 1.00 9.54   ? 310  PHE A O    1 
ATOM   4581 C CB   . PHE A 1 310 ? 24.402  24.855  13.997 1.00 8.80   ? 310  PHE A CB   1 
ATOM   4582 C CG   . PHE A 1 310 ? 23.396  23.772  14.207 1.00 8.88   ? 310  PHE A CG   1 
ATOM   4583 C CD1  . PHE A 1 310 ? 22.524  23.318  13.229 1.00 9.34   ? 310  PHE A CD1  1 
ATOM   4584 C CD2  . PHE A 1 310 ? 23.306  23.151  15.479 1.00 8.94   ? 310  PHE A CD2  1 
ATOM   4585 C CE1  . PHE A 1 310 ? 21.612  22.301  13.476 1.00 10.34  ? 310  PHE A CE1  1 
ATOM   4586 C CE2  . PHE A 1 310 ? 22.406  22.116  15.698 1.00 9.44   ? 310  PHE A CE2  1 
ATOM   4587 C CZ   . PHE A 1 310 ? 21.545  21.694  14.707 1.00 9.77   ? 310  PHE A CZ   1 
ATOM   4588 H H    . PHE A 1 310 ? 23.306  26.007  11.928 1.00 10.37  ? 310  PHE A H    1 
ATOM   4589 H HA   . PHE A 1 310 ? 23.285  26.508  14.664 1.00 10.35  ? 310  PHE A HA   1 
ATOM   4590 H HB2  . PHE A 1 310 ? 24.902  24.657  13.189 1.00 10.56  ? 310  PHE A HB2  1 
ATOM   4591 H HB3  . PHE A 1 310 ? 25.028  24.841  14.738 1.00 10.56  ? 310  PHE A HB3  1 
ATOM   4592 H HD1  . PHE A 1 310 ? 22.552  23.705  12.384 1.00 11.21  ? 310  PHE A HD1  1 
ATOM   4593 H HD2  . PHE A 1 310 ? 23.854  23.439  16.172 1.00 10.73  ? 310  PHE A HD2  1 
ATOM   4594 H HE1  . PHE A 1 310 ? 21.038  22.026  12.797 1.00 12.41  ? 310  PHE A HE1  1 
ATOM   4595 H HE2  . PHE A 1 310 ? 22.384  21.700  16.529 1.00 11.33  ? 310  PHE A HE2  1 
ATOM   4596 H HZ   . PHE A 1 310 ? 20.931  21.013  14.868 1.00 11.73  ? 310  PHE A HZ   1 
ATOM   4597 N N    . ASP A 1 311 ? 24.759  28.492  14.297 1.00 9.63   ? 311  ASP A N    1 
ATOM   4598 C CA   . ASP A 1 311 ? 25.642  29.645  14.074 1.00 9.81   ? 311  ASP A CA   1 
ATOM   4599 C C    . ASP A 1 311 ? 26.524  29.864  15.312 1.00 10.05  ? 311  ASP A C    1 
ATOM   4600 O O    . ASP A 1 311 ? 26.052  30.145  16.423 1.00 10.47  ? 311  ASP A O    1 
ATOM   4601 C CB   . ASP A 1 311 ? 24.783  30.893  13.754 1.00 10.99  ? 311  ASP A CB   1 
ATOM   4602 C CG   . ASP A 1 311 ? 25.569  32.089  13.278 1.00 12.11  ? 311  ASP A CG   1 
ATOM   4603 O OD1  . ASP A 1 311 ? 26.820  32.077  13.266 1.00 12.21  ? 311  ASP A OD1  1 
ATOM   4604 O OD2  . ASP A 1 311 ? 24.849  33.114  12.916 1.00 13.54  ? 311  ASP A OD2  1 
ATOM   4605 H H    . ASP A 1 311 ? 24.097  28.572  14.839 1.00 11.56  ? 311  ASP A H    1 
ATOM   4606 H HA   . ASP A 1 311 ? 26.219  29.456  13.305 1.00 11.77  ? 311  ASP A HA   1 
ATOM   4607 H HB2  . ASP A 1 311 ? 24.135  30.656  13.073 1.00 13.19  ? 311  ASP A HB2  1 
ATOM   4608 H HB3  . ASP A 1 311 ? 24.291  31.143  14.552 1.00 13.19  ? 311  ASP A HB3  1 
ATOM   4609 N N    . SER A 1 312 ? 27.850  29.776  15.096 1.00 10.17  ? 312  SER A N    1 
ATOM   4610 C CA   . SER A 1 312 ? 28.784  30.012  16.194 1.00 11.33  ? 312  SER A CA   1 
ATOM   4611 C C    . SER A 1 312 ? 28.799  31.504  16.648 1.00 11.37  ? 312  SER A C    1 
ATOM   4612 O O    . SER A 1 312 ? 29.265  31.767  17.753 1.00 13.25  ? 312  SER A O    1 
ATOM   4613 C CB   . SER A 1 312 ? 30.167  29.541  15.859 1.00 12.36  ? 312  SER A CB   1 
ATOM   4614 O OG   . SER A 1 312 ? 30.791  30.331  14.900 1.00 14.78  ? 312  SER A OG   1 
ATOM   4615 H H    . SER A 1 312 ? 28.147  29.582  14.312 1.00 12.20  ? 312  SER A H    1 
ATOM   4616 H HA   . SER A 1 312 ? 28.474  29.480  16.957 1.00 13.60  ? 312  SER A HA   1 
ATOM   4617 H HB2  . SER A 1 312 ? 30.705  29.541  16.666 1.00 14.84  ? 312  SER A HB2  1 
ATOM   4618 H HB3  . SER A 1 312 ? 30.120  28.628  15.535 1.00 14.84  ? 312  SER A HB3  1 
ATOM   4619 H HG   . SER A 1 312 ? 30.350  30.321  14.209 1.00 22.16  ? 312  SER A HG   1 
ATOM   4620 N N    . ASP A 1 313 ? 28.380  32.412  15.788 1.00 11.98  ? 313  ASP A N    1 
ATOM   4621 C CA   . ASP A 1 313 ? 28.281  33.830  16.178 1.00 13.63  ? 313  ASP A CA   1 
ATOM   4622 C C    . ASP A 1 313 ? 27.028  34.009  17.050 1.00 13.66  ? 313  ASP A C    1 
ATOM   4623 O O    . ASP A 1 313 ? 25.888  33.845  16.583 1.00 16.57  ? 313  ASP A O    1 
ATOM   4624 C CB   A ASP A 1 313 ? 28.520  34.744  14.966 0.43 16.70  ? 313  ASP A CB   1 
ATOM   4625 C CB   B ASP A 1 313 ? 28.000  34.640  14.839 0.57 15.86  ? 313  ASP A CB   1 
ATOM   4626 C CG   A ASP A 1 313 ? 29.996  34.921  14.500 0.43 16.02  ? 313  ASP A CG   1 
ATOM   4627 C CG   B ASP A 1 313 ? 27.850  36.132  15.044 0.57 21.77  ? 313  ASP A CG   1 
ATOM   4628 O OD1  A ASP A 1 313 ? 31.168  34.803  15.192 0.43 18.17  ? 313  ASP A OD1  1 
ATOM   4629 O OD1  B ASP A 1 313 ? 28.461  36.631  16.062 0.57 30.68  ? 313  ASP A OD1  1 
ATOM   4630 O OD2  A ASP A 1 313 ? 30.162  35.159  13.220 0.43 18.42  ? 313  ASP A OD2  1 
ATOM   4631 O OD2  B ASP A 1 313 ? 27.186  36.865  14.279 0.57 31.02  ? 313  ASP A OD2  1 
ATOM   4632 H H    . ASP A 1 313 ? 28.163  32.174  14.991 1.00 14.38  ? 313  ASP A H    1 
ATOM   4633 H HA   A ASP A 1 313 ? 29.040  33.990  16.778 1.00 16.36  ? 313  ASP A HA   1 
ATOM   4634 H HB2  A ASP A 1 313 ? 28.008  34.394  14.220 0.43 20.04  ? 313  ASP A HB2  1 
ATOM   4635 H HB2  B ASP A 1 313 ? 28.729  34.482  14.220 0.57 19.03  ? 313  ASP A HB2  1 
ATOM   4636 H HB3  A ASP A 1 313 ? 28.162  35.621  15.174 0.43 20.04  ? 313  ASP A HB3  1 
ATOM   4637 H HB3  B ASP A 1 313 ? 27.189  34.298  14.432 0.57 19.03  ? 313  ASP A HB3  1 
ATOM   4638 N N    . GLY A 1 314 ? 27.236  34.284  18.357 1.00 13.62  ? 314  GLY A N    1 
ATOM   4639 C CA   . GLY A 1 314 ? 26.183  34.381  19.311 1.00 13.99  ? 314  GLY A CA   1 
ATOM   4640 C C    . GLY A 1 314 ? 26.571  33.640  20.547 1.00 14.02  ? 314  GLY A C    1 
ATOM   4641 O O    . GLY A 1 314 ? 27.000  34.269  21.556 1.00 18.33  ? 314  GLY A O    1 
ATOM   4642 H H    . GLY A 1 314 ? 28.043  34.407  18.626 1.00 16.34  ? 314  GLY A H    1 
ATOM   4643 H HA2  . GLY A 1 314 ? 26.016  35.313  19.524 1.00 16.79  ? 314  GLY A HA2  1 
ATOM   4644 H HA3  . GLY A 1 314 ? 25.369  34.003  18.942 1.00 16.79  ? 314  GLY A HA3  1 
ATOM   4645 N N    . PRO A 1 315 ? 26.495  32.305  20.562 1.00 12.11  ? 315  PRO A N    1 
ATOM   4646 C CA   . PRO A 1 315 ? 25.963  31.459  19.457 1.00 10.98  ? 315  PRO A CA   1 
ATOM   4647 C C    . PRO A 1 315 ? 24.431  31.557  19.383 1.00 10.25  ? 315  PRO A C    1 
ATOM   4648 O O    . PRO A 1 315 ? 23.760  32.025  20.330 1.00 10.58  ? 315  PRO A O    1 
ATOM   4649 C CB   . PRO A 1 315 ? 26.439  30.057  19.827 1.00 11.83  ? 315  PRO A CB   1 
ATOM   4650 C CG   . PRO A 1 315 ? 26.507  30.091  21.377 1.00 13.17  ? 315  PRO A CG   1 
ATOM   4651 C CD   . PRO A 1 315 ? 26.928  31.496  21.734 1.00 14.02  ? 315  PRO A CD   1 
ATOM   4652 H HA   . PRO A 1 315 ? 26.359  31.734  18.604 1.00 13.18  ? 315  PRO A HA   1 
ATOM   4653 H HB2  . PRO A 1 315 ? 25.810  29.384  19.521 1.00 14.20  ? 315  PRO A HB2  1 
ATOM   4654 H HB3  . PRO A 1 315 ? 27.310  29.873  19.444 1.00 14.20  ? 315  PRO A HB3  1 
ATOM   4655 H HG2  . PRO A 1 315 ? 25.641  29.885  21.761 1.00 15.81  ? 315  PRO A HG2  1 
ATOM   4656 H HG3  . PRO A 1 315 ? 27.154  29.446  21.704 1.00 15.81  ? 315  PRO A HG3  1 
ATOM   4657 H HD2  . PRO A 1 315 ? 26.487  31.795  22.545 1.00 16.82  ? 315  PRO A HD2  1 
ATOM   4658 H HD3  . PRO A 1 315 ? 27.888  31.550  21.859 1.00 16.82  ? 315  PRO A HD3  1 
ATOM   4659 N N    . GLN A 1 316 ? 23.889  31.049  18.279 1.00 10.20  ? 316  GLN A N    1 
ATOM   4660 C CA   . GLN A 1 316 ? 22.450  31.133  18.031 1.00 10.13  ? 316  GLN A CA   1 
ATOM   4661 C C    . GLN A 1 316 ? 22.028  30.006  17.075 1.00 9.48   ? 316  GLN A C    1 
ATOM   4662 O O    . GLN A 1 316 ? 22.842  29.452  16.355 1.00 10.28  ? 316  GLN A O    1 
ATOM   4663 C CB   . GLN A 1 316 ? 22.000  32.504  17.464 1.00 11.04  ? 316  GLN A CB   1 
ATOM   4664 C CG   . GLN A 1 316 ? 22.674  32.876  16.173 1.00 11.74  ? 316  GLN A CG   1 
ATOM   4665 C CD   . GLN A 1 316 ? 22.239  34.214  15.613 1.00 13.74  ? 316  GLN A CD   1 
ATOM   4666 O OE1  . GLN A 1 316 ? 21.328  34.893  16.122 1.00 14.19  ? 316  GLN A OE1  1 
ATOM   4667 N NE2  . GLN A 1 316 ? 22.837  34.575  14.469 1.00 15.30  ? 316  GLN A NE2  1 
ATOM   4668 H H    . GLN A 1 316 ? 24.395  30.663  17.700 1.00 12.24  ? 316  GLN A H    1 
ATOM   4669 H HA   . GLN A 1 316 ? 21.988  30.993  18.884 1.00 12.16  ? 316  GLN A HA   1 
ATOM   4670 H HB2  . GLN A 1 316 ? 21.041  32.484  17.322 1.00 13.25  ? 316  GLN A HB2  1 
ATOM   4671 H HB3  . GLN A 1 316 ? 22.186  33.191  18.124 1.00 13.25  ? 316  GLN A HB3  1 
ATOM   4672 H HG2  . GLN A 1 316 ? 23.633  32.895  16.316 1.00 14.09  ? 316  GLN A HG2  1 
ATOM   4673 H HG3  . GLN A 1 316 ? 22.489  32.188  15.515 1.00 14.09  ? 316  GLN A HG3  1 
ATOM   4674 H HE21 . GLN A 1 316 ? 23.464  34.086  14.140 1.00 18.37  ? 316  GLN A HE21 1 
ATOM   4675 H HE22 . GLN A 1 316 ? 22.595  35.294  14.065 1.00 18.37  ? 316  GLN A HE22 1 
ATOM   4676 N N    . LEU A 1 317 ? 20.726  29.701  17.124 1.00 9.39   ? 317  LEU A N    1 
ATOM   4677 C CA   . LEU A 1 317 ? 20.080  28.738  16.202 1.00 9.12   ? 317  LEU A CA   1 
ATOM   4678 C C    . LEU A 1 317 ? 19.005  29.487  15.414 1.00 9.23   ? 317  LEU A C    1 
ATOM   4679 O O    . LEU A 1 317 ? 18.234  30.282  15.969 1.00 10.44  ? 317  LEU A O    1 
ATOM   4680 C CB   . LEU A 1 317 ? 19.359  27.611  16.972 1.00 9.44   ? 317  LEU A CB   1 
ATOM   4681 C CG   . LEU A 1 317 ? 20.296  26.533  17.553 1.00 9.36   ? 317  LEU A CG   1 
ATOM   4682 C CD1  . LEU A 1 317 ? 19.595  25.765  18.683 1.00 10.75  ? 317  LEU A CD1  1 
ATOM   4683 C CD2  . LEU A 1 317 ? 20.783  25.585  16.462 1.00 10.57  ? 317  LEU A CD2  1 
ATOM   4684 H H    . LEU A 1 317 ? 20.239  30.083  17.721 1.00 11.26  ? 317  LEU A H    1 
ATOM   4685 H HA   . LEU A 1 317 ? 20.745  28.358  15.591 1.00 10.94  ? 317  LEU A HA   1 
ATOM   4686 H HB2  . LEU A 1 317 ? 18.853  28.006  17.699 1.00 11.33  ? 317  LEU A HB2  1 
ATOM   4687 H HB3  . LEU A 1 317 ? 18.727  27.182  16.374 1.00 11.33  ? 317  LEU A HB3  1 
ATOM   4688 H HG   . LEU A 1 317 ? 21.078  26.985  17.934 1.00 11.24  ? 317  LEU A HG   1 
ATOM   4689 H HD11 . LEU A 1 317 ? 19.298  26.384  19.355 1.00 16.12  ? 317  LEU A HD11 1 
ATOM   4690 H HD12 . LEU A 1 317 ? 18.839  25.292  18.328 1.00 16.12  ? 317  LEU A HD12 1 
ATOM   4691 H HD13 . LEU A 1 317 ? 20.209  25.139  19.074 1.00 16.12  ? 317  LEU A HD13 1 
ATOM   4692 H HD21 . LEU A 1 317 ? 20.035  25.110  16.093 1.00 15.86  ? 317  LEU A HD21 1 
ATOM   4693 H HD22 . LEU A 1 317 ? 21.216  26.089  15.770 1.00 15.86  ? 317  LEU A HD22 1 
ATOM   4694 H HD23 . LEU A 1 317 ? 21.406  24.957  16.838 1.00 15.86  ? 317  LEU A HD23 1 
ATOM   4695 N N    . GLY A 1 318 ? 18.976  29.218  14.100 1.00 9.39   ? 318  GLY A N    1 
ATOM   4696 C CA   . GLY A 1 318 ? 17.916  29.750  13.211 1.00 9.54   ? 318  GLY A CA   1 
ATOM   4697 C C    . GLY A 1 318 ? 17.003  28.624  12.737 1.00 9.51   ? 318  GLY A C    1 
ATOM   4698 O O    . GLY A 1 318 ? 17.507  27.525  12.391 1.00 10.18  ? 318  GLY A O    1 
ATOM   4699 H H    . GLY A 1 318 ? 19.591  28.721  13.763 1.00 11.27  ? 318  GLY A H    1 
ATOM   4700 H HA2  . GLY A 1 318 ? 17.393  30.412  13.690 1.00 11.44  ? 318  GLY A HA2  1 
ATOM   4701 H HA3  . GLY A 1 318 ? 18.322  30.183  12.445 1.00 11.44  ? 318  GLY A HA3  1 
ATOM   4702 N N    . PHE A 1 319 ? 15.717  28.915  12.650 1.00 9.34   ? 319  PHE A N    1 
ATOM   4703 C CA   . PHE A 1 319 ? 14.702  27.937  12.257 1.00 9.26   ? 319  PHE A CA   1 
ATOM   4704 C C    . PHE A 1 319 ? 13.769  28.487  11.208 1.00 9.23   ? 319  PHE A C    1 
ATOM   4705 O O    . PHE A 1 319 ? 13.346  29.675  11.282 1.00 9.89   ? 319  PHE A O    1 
ATOM   4706 C CB   . PHE A 1 319 ? 13.823  27.500  13.435 1.00 10.18  ? 319  PHE A CB   1 
ATOM   4707 C CG   . PHE A 1 319 ? 14.546  26.881  14.617 1.00 9.65   ? 319  PHE A CG   1 
ATOM   4708 C CD1  . PHE A 1 319 ? 15.131  27.713  15.617 1.00 10.34  ? 319  PHE A CD1  1 
ATOM   4709 C CD2  . PHE A 1 319 ? 14.639  25.503  14.740 1.00 10.94  ? 319  PHE A CD2  1 
ATOM   4710 C CE1  . PHE A 1 319 ? 15.757  27.116  16.710 1.00 10.67  ? 319  PHE A CE1  1 
ATOM   4711 C CE2  . PHE A 1 319 ? 15.279  24.958  15.865 1.00 12.25  ? 319  PHE A CE2  1 
ATOM   4712 C CZ   . PHE A 1 319 ? 15.802  25.747  16.815 1.00 11.97  ? 319  PHE A CZ   1 
ATOM   4713 H H    . PHE A 1 319 ? 15.464  29.717  12.833 1.00 11.21  ? 319  PHE A H    1 
ATOM   4714 H HA   . PHE A 1 319 ? 15.153  27.146  11.893 1.00 11.11  ? 319  PHE A HA   1 
ATOM   4715 H HB2  . PHE A 1 319 ? 13.333  28.275  13.752 1.00 12.21  ? 319  PHE A HB2  1 
ATOM   4716 H HB3  . PHE A 1 319 ? 13.172  26.860  13.108 1.00 12.21  ? 319  PHE A HB3  1 
ATOM   4717 H HD1  . PHE A 1 319 ? 15.096  28.639  15.541 1.00 12.41  ? 319  PHE A HD1  1 
ATOM   4718 H HD2  . PHE A 1 319 ? 14.281  24.947  14.086 1.00 13.13  ? 319  PHE A HD2  1 
ATOM   4719 H HE1  . PHE A 1 319 ? 16.145  27.645  17.369 1.00 12.81  ? 319  PHE A HE1  1 
ATOM   4720 H HE2  . PHE A 1 319 ? 15.343  24.034  15.952 1.00 14.70  ? 319  PHE A HE2  1 
ATOM   4721 H HZ   . PHE A 1 319 ? 16.202  25.360  17.560 1.00 14.37  ? 319  PHE A HZ   1 
ATOM   4722 N N    . ALA A 1 320 ? 13.322  27.629  10.276 1.00 9.41   ? 320  ALA A N    1 
ATOM   4723 C CA   . ALA A 1 320 ? 12.211  27.926  9.366  1.00 9.47   ? 320  ALA A CA   1 
ATOM   4724 C C    . ALA A 1 320 ? 11.657  26.601  8.845  1.00 9.23   ? 320  ALA A C    1 
ATOM   4725 O O    . ALA A 1 320 ? 12.360  25.574  8.870  1.00 9.63   ? 320  ALA A O    1 
ATOM   4726 C CB   . ALA A 1 320 ? 12.666  28.832  8.202  1.00 10.18  ? 320  ALA A CB   1 
ATOM   4727 H H    . ALA A 1 320 ? 13.709  26.863  10.210 1.00 11.29  ? 320  ALA A H    1 
ATOM   4728 H HA   . ALA A 1 320 ? 11.507  28.386  9.869  1.00 11.36  ? 320  ALA A HA   1 
ATOM   4729 H HB1  . ALA A 1 320 ? 11.917  29.016  7.629  1.00 15.27  ? 320  ALA A HB1  1 
ATOM   4730 H HB2  . ALA A 1 320 ? 13.010  29.656  8.554  1.00 15.27  ? 320  ALA A HB2  1 
ATOM   4731 H HB3  . ALA A 1 320 ? 13.351  28.387  7.699  1.00 15.27  ? 320  ALA A HB3  1 
ATOM   4732 N N    . PRO A 1 321 ? 10.418  26.591  8.332  1.00 9.49   ? 321  PRO A N    1 
ATOM   4733 C CA   . PRO A 1 321 ? 9.833   25.326  7.854  1.00 9.88   ? 321  PRO A CA   1 
ATOM   4734 C C    . PRO A 1 321 ? 10.611  24.790  6.646  1.00 9.24   ? 321  PRO A C    1 
ATOM   4735 O O    . PRO A 1 321 ? 10.916  25.549  5.724  1.00 10.21  ? 321  PRO A O    1 
ATOM   4736 C CB   . PRO A 1 321 ? 8.397   25.718  7.481  1.00 11.04  ? 321  PRO A CB   1 
ATOM   4737 C CG   . PRO A 1 321 ? 8.118   27.011  8.213  1.00 11.19  ? 321  PRO A CG   1 
ATOM   4738 C CD   . PRO A 1 321 ? 9.453   27.702  8.226  1.00 10.30  ? 321  PRO A CD   1 
ATOM   4739 H HA   . PRO A 1 321 ? 9.827   24.662  8.575  1.00 11.86  ? 321  PRO A HA   1 
ATOM   4740 H HB2  . PRO A 1 321 ? 8.317   25.845  6.523  1.00 13.25  ? 321  PRO A HB2  1 
ATOM   4741 H HB3  . PRO A 1 321 ? 7.773   25.029  7.758  1.00 13.25  ? 321  PRO A HB3  1 
ATOM   4742 H HG2  . PRO A 1 321 ? 7.455   27.542  7.743  1.00 13.43  ? 321  PRO A HG2  1 
ATOM   4743 H HG3  . PRO A 1 321 ? 7.805   26.841  9.115  1.00 13.43  ? 321  PRO A HG3  1 
ATOM   4744 H HD2  . PRO A 1 321 ? 9.591   28.207  7.409  1.00 12.36  ? 321  PRO A HD2  1 
ATOM   4745 H HD3  . PRO A 1 321 ? 9.527   28.301  8.985  1.00 12.36  ? 321  PRO A HD3  1 
ATOM   4746 N N    . GLN A 1 322 ? 10.882  23.493  6.621  1.00 9.86   ? 322  GLN A N    1 
ATOM   4747 C CA   . GLN A 1 322 ? 11.680  22.933  5.549  1.00 10.96  ? 322  GLN A CA   1 
ATOM   4748 C C    . GLN A 1 322 ? 10.938  22.970  4.217  1.00 12.12  ? 322  GLN A C    1 
ATOM   4749 O O    . GLN A 1 322 ? 9.728   22.718  4.167  1.00 13.39  ? 322  GLN A O    1 
ATOM   4750 C CB   . GLN A 1 322 ? 12.148  21.508  5.907  1.00 12.81  ? 322  GLN A CB   1 
ATOM   4751 C CG   . GLN A 1 322 ? 13.537  21.180  5.455  1.00 14.28  ? 322  GLN A CG   1 
ATOM   4752 C CD   . GLN A 1 322 ? 13.830  19.726  5.669  1.00 13.62  ? 322  GLN A CD   1 
ATOM   4753 O OE1  . GLN A 1 322 ? 13.673  18.968  4.719  1.00 16.16  ? 322  GLN A OE1  1 
ATOM   4754 N NE2  . GLN A 1 322 ? 14.273  19.295  6.846  1.00 12.06  ? 322  GLN A NE2  1 
ATOM   4755 H H    . GLN A 1 322 ? 10.584  22.982  7.245  1.00 11.84  ? 322  GLN A H    1 
ATOM   4756 H HA   . GLN A 1 322 ? 12.481  23.490  5.456  1.00 13.15  ? 322  GLN A HA   1 
ATOM   4757 H HB2  . GLN A 1 322 ? 12.102  21.399  6.870  1.00 15.37  ? 322  GLN A HB2  1 
ATOM   4758 H HB3  . GLN A 1 322 ? 11.534  20.871  5.511  1.00 15.37  ? 322  GLN A HB3  1 
ATOM   4759 H HG2  . GLN A 1 322 ? 13.631  21.395  4.514  1.00 17.13  ? 322  GLN A HG2  1 
ATOM   4760 H HG3  . GLN A 1 322 ? 14.175  21.716  5.951  1.00 17.13  ? 322  GLN A HG3  1 
ATOM   4761 H HE21 . GLN A 1 322 ? 14.374  19.849  7.496  1.00 14.47  ? 322  GLN A HE21 1 
ATOM   4762 H HE22 . GLN A 1 322 ? 14.460  18.463  6.956  1.00 14.47  ? 322  GLN A HE22 1 
ATOM   4763 N N    A ALA A 1 323 ? 11.739  23.170  3.166  0.64 12.49  ? 323  ALA A N    1 
ATOM   4764 N N    B ALA A 1 323 ? 11.490  23.352  3.116  0.36 14.69  ? 323  ALA A N    1 
ATOM   4765 C CA   A ALA A 1 323 ? 11.311  23.167  1.750  0.64 14.84  ? 323  ALA A CA   1 
ATOM   4766 C CA   B ALA A 1 323 ? 10.743  23.481  1.839  0.36 13.68  ? 323  ALA A CA   1 
ATOM   4767 C C    A ALA A 1 323 ? 12.345  22.525  0.847  0.64 16.83  ? 323  ALA A C    1 
ATOM   4768 C C    B ALA A 1 323 ? 10.621  22.134  1.252  0.36 19.07  ? 323  ALA A C    1 
ATOM   4769 O O    A ALA A 1 323 ? 13.525  22.084  1.293  0.64 18.82  ? 323  ALA A O    1 
ATOM   4770 O O    B ALA A 1 323 ? 11.330  21.193  1.478  0.36 32.79  ? 323  ALA A O    1 
ATOM   4771 C CB   A ALA A 1 323 ? 11.092  24.603  1.300  0.64 14.04  ? 323  ALA A CB   1 
ATOM   4772 C CB   B ALA A 1 323 ? 11.546  24.304  0.802  0.36 15.71  ? 323  ALA A CB   1 
ATOM   4773 O OXT  A ALA A 1 323 ? 12.073  22.501  -0.378 0.64 25.09  ? 323  ALA A OXT  1 
ATOM   4774 O OXT  B ALA A 1 323 ? 9.525   21.981  0.601  0.36 35.46  ? 323  ALA A OXT  1 
ATOM   4775 H H    A ALA A 1 323 ? 12.572  23.313  3.326  0.64 14.99  ? 323  ALA A H    1 
ATOM   4776 H H    B ALA A 1 323 ? 12.329  23.540  3.122  0.36 17.62  ? 323  ALA A H    1 
ATOM   4777 H HA   A ALA A 1 323 ? 10.467  22.675  1.672  0.64 17.81  ? 323  ALA A HA   1 
ATOM   4778 H HA   B ALA A 1 323 ? 9.860   23.878  1.990  0.36 16.42  ? 323  ALA A HA   1 
ATOM   4779 H HB1  A ALA A 1 323 ? 10.785  24.610  0.390  0.64 21.06  ? 323  ALA A HB1  1 
ATOM   4780 H HB1  B ALA A 1 323 ? 11.704  25.186  1.147  0.36 23.57  ? 323  ALA A HB1  1 
ATOM   4781 H HB2  A ALA A 1 323 ? 10.433  25.018  1.862  0.64 21.06  ? 323  ALA A HB2  1 
ATOM   4782 H HB2  B ALA A 1 323 ? 12.386  23.872  0.632  0.36 23.57  ? 323  ALA A HB2  1 
ATOM   4783 H HB3  A ALA A 1 323 ? 11.918  25.088  1.363  0.64 21.06  ? 323  ALA A HB3  1 
ATOM   4784 H HB3  B ALA A 1 323 ? 11.046  24.365  -0.015 0.36 23.57  ? 323  ALA A HB3  1 
HETATM 4785 C C1   . MAN B 2 .   ? 29.997  27.879  -0.523 1.00 13.16  ? 328  MAN A C1   1 
HETATM 4786 C C2   . MAN B 2 .   ? 29.974  27.479  -1.947 1.00 14.40  ? 328  MAN A C2   1 
HETATM 4787 C C3   . MAN B 2 .   ? 31.375  27.687  -2.625 1.00 13.37  ? 328  MAN A C3   1 
HETATM 4788 C C4   . MAN B 2 .   ? 31.844  29.133  -2.409 1.00 12.74  ? 328  MAN A C4   1 
HETATM 4789 C C5   . MAN B 2 .   ? 31.770  29.486  -0.961 1.00 12.86  ? 328  MAN A C5   1 
HETATM 4790 C C6   . MAN B 2 .   ? 32.054  30.937  -0.605 1.00 15.31  ? 328  MAN A C6   1 
HETATM 4791 O O2   . MAN B 2 .   ? 28.959  28.212  -2.645 1.00 18.97  ? 328  MAN A O2   1 
HETATM 4792 O O3   . MAN B 2 .   ? 31.354  27.400  -4.018 1.00 15.22  ? 328  MAN A O3   1 
HETATM 4793 O O4   . MAN B 2 .   ? 33.182  29.324  -2.843 1.00 13.96  ? 328  MAN A O4   1 
HETATM 4794 O O5   . MAN B 2 .   ? 30.452  29.249  -0.380 1.00 13.99  ? 328  MAN A O5   1 
HETATM 4795 O O6   . MAN B 2 .   ? 31.286  31.918  -1.291 1.00 16.85  ? 328  MAN A O6   1 
HETATM 4796 H H1   . MAN B 2 .   ? 29.103  27.780  -0.133 1.00 15.79  ? 328  MAN A H1   1 
HETATM 4797 H H2   . MAN B 2 .   ? 29.750  26.526  -1.994 1.00 17.28  ? 328  MAN A H2   1 
HETATM 4798 H H3   . MAN B 2 .   ? 32.019  27.086  -2.195 1.00 16.04  ? 328  MAN A H3   1 
HETATM 4799 H H4   . MAN B 2 .   ? 31.258  29.735  -2.913 1.00 15.29  ? 328  MAN A H4   1 
HETATM 4800 H H5   . MAN B 2 .   ? 32.416  28.926  -0.482 1.00 15.43  ? 328  MAN A H5   1 
HETATM 4801 H H61  . MAN B 2 .   ? 31.907  31.049  0.347  1.00 18.37  ? 328  MAN A H61  1 
HETATM 4802 H H62  . MAN B 2 .   ? 32.992  31.113  -0.776 1.00 18.37  ? 328  MAN A H62  1 
HETATM 4803 H HO2  . MAN B 2 .   ? 28.953  27.988  -3.434 1.00 28.46  ? 328  MAN A HO2  1 
HETATM 4804 H HO3  . MAN B 2 .   ? 31.100  26.629  -4.134 1.00 22.83  ? 328  MAN A HO3  1 
HETATM 4805 H HO4  . MAN B 2 .   ? 33.241  29.132  -3.638 1.00 20.94  ? 328  MAN A HO4  1 
HETATM 4806 H HO6  . MAN B 2 .   ? 31.511  32.666  -1.040 1.00 25.28  ? 328  MAN A HO6  1 
HETATM 4807 C C1   . MAN C 2 .   ? 25.668  15.262  -1.908 1.00 18.36  ? 329  MAN A C1   1 
HETATM 4808 C C2   . MAN C 2 .   ? 26.282  16.448  -2.402 1.00 24.60  ? 329  MAN A C2   1 
HETATM 4809 C C3   . MAN C 2 .   ? 25.073  17.404  -2.820 1.00 23.44  ? 329  MAN A C3   1 
HETATM 4810 C C4   . MAN C 2 .   ? 24.248  16.764  -3.858 1.00 25.32  ? 329  MAN A C4   1 
HETATM 4811 C C5   . MAN C 2 .   ? 23.890  15.393  -3.334 1.00 25.01  ? 329  MAN A C5   1 
HETATM 4812 C C6   . MAN C 2 .   ? 23.483  14.607  -4.679 1.00 26.16  ? 329  MAN A C6   1 
HETATM 4813 O O2   . MAN C 2 .   ? 27.106  16.012  -3.530 1.00 43.33  ? 329  MAN A O2   1 
HETATM 4814 O O3   . MAN C 2 .   ? 25.699  18.613  -3.300 1.00 35.30  ? 329  MAN A O3   1 
HETATM 4815 O O4   . MAN C 2 .   ? 23.203  17.462  -4.252 1.00 28.72  ? 329  MAN A O4   1 
HETATM 4816 O O5   . MAN C 2 .   ? 25.055  14.572  -2.936 1.00 25.30  ? 329  MAN A O5   1 
HETATM 4817 O O6   . MAN C 2 .   ? 23.344  13.192  -4.336 1.00 35.50  ? 329  MAN A O6   1 
HETATM 4818 H H1   . MAN C 2 .   ? 26.417  14.690  -1.638 1.00 22.03  ? 329  MAN A H1   1 
HETATM 4819 H H2   . MAN C 2 .   ? 26.834  16.869  -1.710 1.00 29.51  ? 329  MAN A H2   1 
HETATM 4820 H H3   . MAN C 2 .   ? 24.521  17.605  -2.035 1.00 28.12  ? 329  MAN A H3   1 
HETATM 4821 H H4   . MAN C 2 .   ? 24.821  16.634  -4.642 1.00 30.38  ? 329  MAN A H4   1 
HETATM 4822 H H5   . MAN C 2 .   ? 23.177  15.408  -2.661 1.00 30.01  ? 329  MAN A H5   1 
HETATM 4823 H H61  . MAN C 2 .   ? 22.646  14.951  -5.028 1.00 31.39  ? 329  MAN A H61  1 
HETATM 4824 H H62  . MAN C 2 .   ? 24.169  14.722  -5.355 1.00 31.39  ? 329  MAN A H62  1 
HETATM 4825 H HO2  . MAN C 2 .   ? 27.038  15.200  -3.620 1.00 65.00  ? 329  MAN A HO2  1 
HETATM 4826 H HO3  . MAN C 2 .   ? 26.144  18.948  -2.697 1.00 52.96  ? 329  MAN A HO3  1 
HETATM 4827 H HO4  . MAN C 2 .   ? 22.796  17.043  -4.828 1.00 43.08  ? 329  MAN A HO4  1 
HETATM 4828 H HO6  . MAN C 2 .   ? 23.132  12.768  -5.006 1.00 53.24  ? 329  MAN A HO6  1 
HETATM 4829 S S    . SO4 D 3 .   ? 16.485  34.924  5.575  1.00 28.87  ? 327  SO4 A S    1 
HETATM 4830 O O1   . SO4 D 3 .   ? 17.741  34.891  4.826  1.00 46.45  ? 327  SO4 A O1   1 
HETATM 4831 O O2   . SO4 D 3 .   ? 16.787  35.826  6.733  1.00 59.07  ? 327  SO4 A O2   1 
HETATM 4832 O O3   . SO4 D 3 .   ? 15.440  35.551  4.401  1.00 52.82  ? 327  SO4 A O3   1 
HETATM 4833 O O4   . SO4 D 3 .   ? 16.141  33.720  5.930  1.00 22.75  ? 327  SO4 A O4   1 
HETATM 4834 N NV2  . PP7 E 4 .   ? 18.051  5.317   18.432 1.00 9.89   ? 324  PP7 A NV2  1 
HETATM 4835 C CV1  . PP7 E 4 .   ? 16.092  4.057   17.730 1.00 12.51  ? 324  PP7 A CV1  1 
HETATM 4836 C CV6  . PP7 E 4 .   ? 19.306  5.599   19.125 1.00 9.99   ? 324  PP7 A CV6  1 
HETATM 4837 C CV2  . PP7 E 4 .   ? 14.841  3.890   18.546 1.00 15.78  ? 324  PP7 A CV2  1 
HETATM 4838 C CV7  . PP7 E 4 .   ? 20.523  5.492   18.214 1.00 10.48  ? 324  PP7 A CV7  1 
HETATM 4839 C CV3  . PP7 E 4 .   ? 14.689  4.922   19.553 1.00 19.17  ? 324  PP7 A CV3  1 
HETATM 4840 C CV8  . PP7 E 4 .   ? 20.678  4.116   17.637 1.00 12.23  ? 324  PP7 A CV8  1 
HETATM 4841 C CV4  . PP7 E 4 .   ? 13.618  3.775   17.578 1.00 20.68  ? 324  PP7 A CV4  1 
HETATM 4842 C CV9  . PP7 E 4 .   ? 20.527  6.581   17.157 0.87 10.10  ? 324  PP7 A CV9  1 
HETATM 4843 C CV5  . PP7 E 4 .   ? 17.328  4.224   18.580 1.00 11.71  ? 324  PP7 A CV5  1 
HETATM 4844 C CR   . PP7 E 4 .   ? 19.197  6.964   19.849 1.00 9.25   ? 324  PP7 A CR   1 
HETATM 4845 O OV1  . PP7 E 4 .   ? 17.706  3.288   19.350 1.00 15.67  ? 324  PP7 A OV1  1 
HETATM 4846 O OV2  . PP7 E 4 .   ? 18.367  7.817   19.517 1.00 9.45   ? 324  PP7 A OV2  1 
HETATM 4847 N N1   . PP7 E 4 .   ? 20.109  7.141   20.805 1.00 9.32   ? 324  PP7 A N1   1 
HETATM 4848 C C1   . PP7 E 4 .   ? 20.115  8.328   21.685 1.00 8.96   ? 324  PP7 A C1   1 
HETATM 4849 C C2   . PP7 E 4 .   ? 19.371  8.026   22.974 1.00 9.59   ? 324  PP7 A C2   1 
HETATM 4850 C C4   . PP7 E 4 .   ? 19.190  9.129   23.984 1.00 9.49   ? 324  PP7 A C4   1 
HETATM 4851 O O2   . PP7 E 4 .   ? 19.064  8.836   25.200 1.00 11.49  ? 324  PP7 A O2   1 
HETATM 4852 N N2   . PP7 E 4 .   ? 19.077  10.360  23.581 1.00 9.87   ? 324  PP7 A N2   1 
HETATM 4853 C CB   . PP7 E 4 .   ? 18.664  11.477  24.442 1.00 9.76   ? 324  PP7 A CB   1 
HETATM 4854 C C3   . PP7 E 4 .   ? 21.555  8.734   21.925 1.00 8.70   ? 324  PP7 A C3   1 
HETATM 4855 O O1   . PP7 E 4 .   ? 22.180  8.360   22.942 1.00 10.05  ? 324  PP7 A O1   1 
HETATM 4856 N NL   . PP7 E 4 .   ? 22.139  9.488   20.972 1.00 9.06   ? 324  PP7 A NL   1 
HETATM 4857 C CAL  . PP7 E 4 .   ? 23.553  9.847   20.935 1.00 8.80   ? 324  PP7 A CAL  1 
HETATM 4858 C CBL  . PP7 E 4 .   ? 24.234  9.323   19.655 1.00 9.16   ? 324  PP7 A CBL  1 
HETATM 4859 C CGL  . PP7 E 4 .   ? 23.971  7.860   19.291 1.00 10.05  ? 324  PP7 A CGL  1 
HETATM 4860 C CL1  . PP7 E 4 .   ? 24.599  7.488   17.969 1.00 12.56  ? 324  PP7 A CL1  1 
HETATM 4861 C CL2  . PP7 E 4 .   ? 24.428  6.913   20.416 1.00 12.37  ? 324  PP7 A CL2  1 
HETATM 4862 P P    . PP7 E 4 .   ? 23.722  11.649  21.101 1.00 9.20   ? 324  PP7 A P    1 
HETATM 4863 O O3   . PP7 E 4 .   ? 22.754  12.289  20.134 1.00 10.49  ? 324  PP7 A O3   1 
HETATM 4864 O O4   . PP7 E 4 .   ? 25.171  12.047  20.965 1.00 9.56   ? 324  PP7 A O4   1 
HETATM 4865 O O5   . PP7 E 4 .   ? 23.354  11.926  22.622 1.00 11.50  ? 324  PP7 A O5   1 
HETATM 4866 C C5   . PP7 E 4 .   ? 23.966  12.973  23.404 1.00 9.77   ? 324  PP7 A C5   1 
HETATM 4867 C C6   . PP7 E 4 .   ? 22.907  14.068  23.713 1.00 10.15  ? 324  PP7 A C6   1 
HETATM 4868 C C7   . PP7 E 4 .   ? 25.513  12.998  26.779 1.00 15.53  ? 324  PP7 A C7   1 
HETATM 4869 C CE2  . PP7 E 4 .   ? 21.817  13.632  24.615 1.00 9.86   ? 324  PP7 A CE2  1 
HETATM 4870 C CZ   . PP7 E 4 .   ? 21.720  14.088  25.948 1.00 11.49  ? 324  PP7 A CZ   1 
HETATM 4871 C CD2  . PP7 E 4 .   ? 20.807  12.768  24.178 1.00 9.39   ? 324  PP7 A CD2  1 
HETATM 4872 C CE1  . PP7 E 4 .   ? 20.688  13.668  26.773 1.00 13.24  ? 324  PP7 A CE1  1 
HETATM 4873 C CD1  . PP7 E 4 .   ? 19.738  12.758  26.326 1.00 11.79  ? 324  PP7 A CD1  1 
HETATM 4874 C CG   . PP7 E 4 .   ? 19.782  12.332  24.983 1.00 9.54   ? 324  PP7 A CG   1 
HETATM 4875 C CT   . PP7 E 4 .   ? 24.524  12.380  24.690 1.00 10.53  ? 324  PP7 A CT   1 
HETATM 4876 O OT1  . PP7 E 4 .   ? 24.976  13.328  25.465 1.00 11.88  ? 324  PP7 A OT1  1 
HETATM 4877 O OT2  . PP7 E 4 .   ? 24.527  11.217  24.955 1.00 14.08  ? 324  PP7 A OT2  1 
HETATM 4878 H HV2  . PP7 E 4 .   ? 17.760  5.912   17.883 1.00 11.87  ? 324  PP7 A HV2  1 
HETATM 4879 H HV12 . PP7 E 4 .   ? 15.994  4.835   17.158 1.00 15.01  ? 324  PP7 A HV12 1 
HETATM 4880 H HV6  . PP7 E 4 .   ? 19.409  4.915   19.819 1.00 11.98  ? 324  PP7 A HV6  1 
HETATM 4881 H HV33 . PP7 E 4 .   ? 13.880  4.770   20.046 1.00 28.76  ? 324  PP7 A HV33 1 
HETATM 4882 H HV83 . PP7 E 4 .   ? 20.670  3.469   18.347 1.00 18.34  ? 324  PP7 A HV83 1 
HETATM 4883 H HV42 . PP7 E 4 .   ? 13.777  3.073   16.942 1.00 31.03  ? 324  PP7 A HV42 1 
HETATM 4884 H HV93 . PP7 E 4 .   ? 20.429  7.438   17.580 0.87 15.16  ? 324  PP7 A HV93 1 
HETATM 4885 H H1   . PP7 E 4 .   ? 20.716  6.542   20.913 1.00 11.19  ? 324  PP7 A H1   1 
HETATM 4886 H H1A  . PP7 E 4 .   ? 19.657  9.061   21.224 1.00 10.75  ? 324  PP7 A H1A  1 
HETATM 4887 H HC21 . PP7 E 4 .   ? 18.490  7.700   22.735 1.00 11.51  ? 324  PP7 A HC21 1 
HETATM 4888 H HC22 . PP7 E 4 .   ? 19.834  7.297   23.416 1.00 11.51  ? 324  PP7 A HC22 1 
HETATM 4889 H H2   . PP7 E 4 .   ? 19.256  10.531  22.758 1.00 11.84  ? 324  PP7 A H2   1 
HETATM 4890 H HCB1 . PP7 E 4 .   ? 18.165  11.116  25.192 1.00 11.71  ? 324  PP7 A HCB1 1 
HETATM 4891 H HCB2 . PP7 E 4 .   ? 18.061  12.045  23.938 1.00 11.71  ? 324  PP7 A HCB2 1 
HETATM 4892 H HL   . PP7 E 4 .   ? 21.640  9.779   20.336 1.00 10.87  ? 324  PP7 A HL   1 
HETATM 4893 H HAL  . PP7 E 4 .   ? 23.993  9.429   21.704 1.00 10.56  ? 324  PP7 A HAL  1 
HETATM 4894 H HBL2 . PP7 E 4 .   ? 23.946  9.876   18.911 1.00 10.99  ? 324  PP7 A HBL2 1 
HETATM 4895 H HGL  . PP7 E 4 .   ? 23.002  7.753   19.194 1.00 12.06  ? 324  PP7 A HGL  1 
HETATM 4896 H HL12 . PP7 E 4 .   ? 24.414  6.566   17.775 1.00 18.84  ? 324  PP7 A HL12 1 
HETATM 4897 H HL21 . PP7 E 4 .   ? 24.017  7.176   21.242 1.00 18.56  ? 324  PP7 A HL21 1 
HETATM 4898 H HC5  . PP7 E 4 .   ? 24.699  13.371  22.890 1.00 11.73  ? 324  PP7 A HC5  1 
HETATM 4899 H HC61 . PP7 E 4 .   ? 23.356  14.829  24.115 1.00 12.18  ? 324  PP7 A HC61 1 
HETATM 4900 H HC62 . PP7 E 4 .   ? 22.517  14.367  22.877 1.00 12.18  ? 324  PP7 A HC62 1 
HETATM 4901 H H7A  . PP7 E 4 .   ? 25.802  13.801  27.218 1.00 23.30  ? 324  PP7 A H7A  1 
HETATM 4902 H H7B  . PP7 E 4 .   ? 26.258  12.401  26.680 1.00 23.30  ? 324  PP7 A H7B  1 
HETATM 4903 H H7C  . PP7 E 4 .   ? 24.831  12.574  27.306 1.00 23.30  ? 324  PP7 A H7C  1 
HETATM 4904 H HZ   . PP7 E 4 .   ? 22.358  14.678  26.278 1.00 13.79  ? 324  PP7 A HZ   1 
HETATM 4905 H HD2  . PP7 E 4 .   ? 20.831  12.473  23.296 1.00 11.27  ? 324  PP7 A HD2  1 
HETATM 4906 H HE1  . PP7 E 4 .   ? 20.630  14.001  27.639 1.00 15.89  ? 324  PP7 A HE1  1 
HETATM 4907 H HD1  . PP7 E 4 .   ? 19.085  12.434  26.903 1.00 14.15  ? 324  PP7 A HD1  1 
HETATM 4908 C C1   . GOL F 5 .   ? 15.252  35.226  -0.694 1.00 19.98  ? 325  GOL A C1   1 
HETATM 4909 O O1   . GOL F 5 .   ? 15.982  34.386  0.226  1.00 20.81  ? 325  GOL A O1   1 
HETATM 4910 C C2   . GOL F 5 .   ? 15.111  36.618  -0.068 1.00 19.00  ? 325  GOL A C2   1 
HETATM 4911 O O2   . GOL F 5 .   ? 16.413  37.133  0.168  1.00 27.46  ? 325  GOL A O2   1 
HETATM 4912 C C3   . GOL F 5 .   ? 14.324  37.511  -0.925 1.00 19.56  ? 325  GOL A C3   1 
HETATM 4913 O O3   . GOL F 5 .   ? 14.259  38.834  -0.256 1.00 16.68  ? 325  GOL A O3   1 
HETATM 4914 C C1   . GOL G 5 .   ? 29.490  2.376   31.160 1.00 45.46  ? 326  GOL A C1   1 
HETATM 4915 O O1   . GOL G 5 .   ? 28.524  1.609   30.767 1.00 58.53  ? 326  GOL A O1   1 
HETATM 4916 C C2   . GOL G 5 .   ? 30.249  2.850   29.893 1.00 41.38  ? 326  GOL A C2   1 
HETATM 4917 O O2   . GOL G 5 .   ? 29.526  4.021   29.804 1.00 32.75  ? 326  GOL A O2   1 
HETATM 4918 C C3   . GOL G 5 .   ? 31.780  2.780   29.785 1.00 36.37  ? 326  GOL A C3   1 
HETATM 4919 O O3   . GOL G 5 .   ? 32.215  4.129   29.472 1.00 24.09  ? 326  GOL A O3   1 
HETATM 4920 O O    . HOH H 6 .   ? 13.636  9.733   12.879 1.00 10.49  ? 501  HOH A O    1 
HETATM 4921 O O    . HOH H 6 .   ? 34.091  16.351  14.841 1.00 10.21  ? 502  HOH A O    1 
HETATM 4922 O O    . HOH H 6 .   ? 16.766  19.330  9.588  1.00 9.55   ? 503  HOH A O    1 
HETATM 4923 O O    . HOH H 6 .   ? 17.710  13.318  4.896  1.00 9.88   ? 504  HOH A O    1 
HETATM 4924 O O    . HOH H 6 .   ? 35.656  15.961  17.221 1.00 10.54  ? 505  HOH A O    1 
HETATM 4925 O O    . HOH H 6 .   ? 23.254  19.795  20.908 1.00 9.46   ? 506  HOH A O    1 
HETATM 4926 O O    . HOH H 6 .   ? 14.249  22.507  30.704 1.00 12.00  ? 507  HOH A O    1 
HETATM 4927 O O    . HOH H 6 .   ? 16.715  30.340  23.179 1.00 11.13  ? 508  HOH A O    1 
HETATM 4928 O O    . HOH H 6 .   ? 30.825  11.421  19.334 1.00 10.74  ? 509  HOH A O    1 
HETATM 4929 O O    . HOH H 6 .   ? 31.639  14.551  23.152 1.00 11.34  ? 510  HOH A O    1 
HETATM 4930 O O    . HOH H 6 .   ? 19.647  9.398   14.988 1.00 11.49  ? 511  HOH A O    1 
HETATM 4931 O O    . HOH H 6 .   ? 41.056  18.392  16.036 1.00 13.70  ? 512  HOH A O    1 
HETATM 4932 O O    . HOH H 6 .   ? 7.333   24.948  11.366 1.00 12.18  ? 513  HOH A O    1 
HETATM 4933 O O    . HOH H 6 .   ? 24.726  23.555  26.692 1.00 10.14  ? 514  HOH A O    1 
HETATM 4934 O O    . HOH H 6 .   ? 36.090  2.966   2.005  1.00 11.59  ? 515  HOH A O    1 
HETATM 4935 O O    . HOH H 6 .   ? 40.115  1.879   24.723 1.00 15.66  ? 516  HOH A O    1 
HETATM 4936 O O    . HOH H 6 .   ? 22.297  22.798  0.130  1.00 12.89  ? 517  HOH A O    1 
HETATM 4937 O O    . HOH H 6 .   ? 45.333  -4.305  15.810 1.00 12.95  ? 518  HOH A O    1 
HETATM 4938 O O    . HOH H 6 .   ? 31.405  1.562   4.964  1.00 13.35  ? 519  HOH A O    1 
HETATM 4939 O O    . HOH H 6 .   ? 21.834  10.872  12.656 1.00 12.78  ? 520  HOH A O    1 
HETATM 4940 O O    . HOH H 6 .   ? 11.117  31.480  10.802 1.00 12.73  ? 521  HOH A O    1 
HETATM 4941 O O    . HOH H 6 .   ? 11.764  19.468  29.066 1.00 15.70  ? 522  HOH A O    1 
HETATM 4942 O O    . HOH H 6 .   ? 13.469  31.135  2.030  1.00 14.39  ? 523  HOH A O    1 
HETATM 4943 O O    . HOH H 6 .   ? -2.085  21.148  17.391 1.00 12.29  ? 524  HOH A O    1 
HETATM 4944 O O    . HOH H 6 .   ? 41.438  4.243   25.519 1.00 12.78  ? 525  HOH A O    1 
HETATM 4945 O O    . HOH H 6 .   ? 33.809  29.322  -5.580 1.00 13.49  ? 526  HOH A O    1 
HETATM 4946 O O    . HOH H 6 .   ? 46.913  8.255   21.183 1.00 16.02  ? 527  HOH A O    1 
HETATM 4947 O O    . HOH H 6 .   ? 7.920   7.141   26.168 1.00 16.97  ? 528  HOH A O    1 
HETATM 4948 O O    . HOH H 6 .   ? 38.645  27.647  13.074 1.00 14.77  ? 529  HOH A O    1 
HETATM 4949 O O    . HOH H 6 .   ? 38.313  15.948  27.475 1.00 14.53  ? 530  HOH A O    1 
HETATM 4950 O O    . HOH H 6 .   ? 11.057  28.006  -0.363 1.00 11.84  ? 531  HOH A O    1 
HETATM 4951 O O    . HOH H 6 .   ? 22.215  8.969   15.516 1.00 11.93  ? 532  HOH A O    1 
HETATM 4952 O O    . HOH H 6 .   ? 27.431  17.945  28.854 1.00 15.94  ? 533  HOH A O    1 
HETATM 4953 O O    . HOH H 6 .   ? 20.298  30.369  -1.198 1.00 15.53  ? 534  HOH A O    1 
HETATM 4954 O O    . HOH H 6 .   ? 25.046  11.979  9.181  1.00 14.27  ? 535  HOH A O    1 
HETATM 4955 O O    . HOH H 6 .   ? 8.908   18.560  27.444 1.00 13.55  ? 536  HOH A O    1 
HETATM 4956 O O    . HOH H 6 .   ? 23.380  33.102  10.491 1.00 20.52  ? 537  HOH A O    1 
HETATM 4957 O O    . HOH H 6 .   ? 28.667  14.519  0.599  1.00 15.45  ? 538  HOH A O    1 
HETATM 4958 O O    . HOH H 6 .   ? 37.945  14.470  17.424 1.00 13.27  ? 539  HOH A O    1 
HETATM 4959 O O    . HOH H 6 .   ? 9.962   30.991  0.722  1.00 14.09  ? 540  HOH A O    1 
HETATM 4960 O O    . HOH H 6 .   ? 25.703  -0.733  23.715 1.00 15.99  ? 541  HOH A O    1 
HETATM 4961 O O    . HOH H 6 .   ? 18.749  27.020  26.782 1.00 13.77  ? 542  HOH A O    1 
HETATM 4962 O O    . HOH H 6 .   ? 31.335  -4.793  14.797 1.00 18.49  ? 543  HOH A O    1 
HETATM 4963 O O    . HOH H 6 .   ? 30.811  14.573  2.411  1.00 14.97  ? 544  HOH A O    1 
HETATM 4964 O O    . HOH H 6 .   ? 6.887   15.169  33.571 1.00 16.16  ? 545  HOH A O    1 
HETATM 4965 O O    . HOH H 6 .   ? 9.187   11.016  10.732 1.00 16.59  ? 546  HOH A O    1 
HETATM 4966 O O    . HOH H 6 .   ? 34.283  31.999  9.295  1.00 15.82  ? 547  HOH A O    1 
HETATM 4967 O O    . HOH H 6 .   ? -8.527  3.845   10.036 1.00 21.14  ? 548  HOH A O    1 
HETATM 4968 O O    . HOH H 6 .   ? 7.934   -7.834  26.439 1.00 19.15  ? 549  HOH A O    1 
HETATM 4969 O O    . HOH H 6 .   ? 14.847  8.984   27.227 1.00 14.59  ? 550  HOH A O    1 
HETATM 4970 O O    . HOH H 6 .   ? 0.093   15.547  9.210  1.00 21.19  ? 551  HOH A O    1 
HETATM 4971 O O    . HOH H 6 .   ? 8.030   32.949  21.747 1.00 16.03  ? 552  HOH A O    1 
HETATM 4972 O O    . HOH H 6 .   ? 20.128  34.463  8.179  1.00 19.54  ? 553  HOH A O    1 
HETATM 4973 O O    . HOH H 6 .   ? -7.001  22.972  25.461 1.00 15.58  ? 554  HOH A O    1 
HETATM 4974 O O    . HOH H 6 .   ? 15.395  36.360  14.095 1.00 19.01  ? 555  HOH A O    1 
HETATM 4975 O O    . HOH H 6 .   ? 37.772  -4.503  21.484 1.00 18.29  ? 556  HOH A O    1 
HETATM 4976 O O    . HOH H 6 .   ? 42.357  19.519  18.218 1.00 16.30  ? 557  HOH A O    1 
HETATM 4977 O O    . HOH H 6 .   ? 28.166  1.436   14.602 1.00 15.20  ? 558  HOH A O    1 
HETATM 4978 O O    . HOH H 6 .   ? 10.609  7.873   10.509 1.00 18.39  ? 559  HOH A O    1 
HETATM 4979 O O    . HOH H 6 .   ? 38.202  -0.300  5.052  1.00 17.48  ? 560  HOH A O    1 
HETATM 4980 O O    . HOH H 6 .   ? 10.821  14.782  4.398  1.00 19.04  ? 561  HOH A O    1 
HETATM 4981 O O    . HOH H 6 .   ? 30.063  30.102  19.721 1.00 23.47  ? 562  HOH A O    1 
HETATM 4982 O O    . HOH H 6 .   ? 27.783  2.214   5.546  1.00 18.65  ? 563  HOH A O    1 
HETATM 4983 O O    . HOH H 6 .   ? 35.093  -3.981  21.271 1.00 16.12  ? 564  HOH A O    1 
HETATM 4984 O O    . HOH H 6 .   ? 7.415   0.981   27.042 1.00 18.04  ? 565  HOH A O    1 
HETATM 4985 O O    . HOH H 6 .   ? 11.750  17.090  5.485  1.00 15.61  ? 566  HOH A O    1 
HETATM 4986 O O    . HOH H 6 .   ? 23.182  13.024  11.097 1.00 13.69  ? 567  HOH A O    1 
HETATM 4987 O O    . HOH H 6 .   ? 16.559  11.105  27.615 1.00 17.27  ? 568  HOH A O    1 
HETATM 4988 O O    . HOH H 6 .   ? 8.451   27.122  0.115  1.00 18.52  ? 569  HOH A O    1 
HETATM 4989 O O    . HOH H 6 .   ? 33.770  24.904  22.977 1.00 15.66  ? 570  HOH A O    1 
HETATM 4990 O O    . HOH H 6 .   ? 45.089  11.037  30.201 1.00 19.43  ? 571  HOH A O    1 
HETATM 4991 O O    . HOH H 6 .   ? -6.388  16.091  19.309 1.00 23.21  ? 572  HOH A O    1 
HETATM 4992 O O    . HOH H 6 .   ? 29.340  0.549   7.153  1.00 18.55  ? 573  HOH A O    1 
HETATM 4993 O O    . HOH H 6 .   ? 23.258  0.652   24.029 1.00 20.69  ? 574  HOH A O    1 
HETATM 4994 O O    . HOH H 6 .   ? 7.524   21.778  8.089  1.00 17.48  ? 575  HOH A O    1 
HETATM 4995 O O    . HOH H 6 .   ? 19.833  8.831   -3.221 1.00 22.12  ? 576  HOH A O    1 
HETATM 4996 O O    . HOH H 6 .   ? 31.721  22.134  17.009 1.00 18.51  ? 577  HOH A O    1 
HETATM 4997 O O    . HOH H 6 .   ? 11.998  31.125  22.939 1.00 16.45  ? 578  HOH A O    1 
HETATM 4998 O O    . HOH H 6 .   ? 43.678  -5.092  12.151 1.00 22.78  ? 579  HOH A O    1 
HETATM 4999 O O    A HOH H 6 .   ? 8.892   33.960  7.584  0.57 17.46  ? 580  HOH A O    1 
HETATM 5000 O O    B HOH H 6 .   ? 8.220   34.522  6.939  0.43 25.50  ? 580  HOH A O    1 
HETATM 5001 O O    . HOH H 6 .   ? 30.948  10.522  27.725 1.00 22.02  ? 581  HOH A O    1 
HETATM 5002 O O    . HOH H 6 .   ? 5.462   22.479  9.787  1.00 18.50  ? 582  HOH A O    1 
HETATM 5003 O O    . HOH H 6 .   ? 26.057  30.371  25.302 1.00 17.67  ? 583  HOH A O    1 
HETATM 5004 O O    . HOH H 6 .   ? 33.222  25.221  20.353 1.00 20.36  ? 584  HOH A O    1 
HETATM 5005 O O    . HOH H 6 .   ? 32.646  32.327  15.458 1.00 22.43  ? 585  HOH A O    1 
HETATM 5006 O O    . HOH H 6 .   ? 8.457   20.261  29.682 1.00 17.94  ? 586  HOH A O    1 
HETATM 5007 O O    . HOH H 6 .   ? 32.930  0.505   24.758 1.00 19.68  ? 587  HOH A O    1 
HETATM 5008 O O    . HOH H 6 .   ? -4.630  23.898  26.611 1.00 20.60  ? 588  HOH A O    1 
HETATM 5009 O O    . HOH H 6 .   ? 45.480  9.223   28.112 1.00 17.25  ? 589  HOH A O    1 
HETATM 5010 O O    . HOH H 6 .   ? 42.604  4.557   6.492  1.00 21.40  ? 590  HOH A O    1 
HETATM 5011 O O    . HOH H 6 .   ? 5.684   31.513  13.106 1.00 17.75  ? 591  HOH A O    1 
HETATM 5012 O O    . HOH H 6 .   ? 34.835  32.019  13.657 1.00 20.77  ? 592  HOH A O    1 
HETATM 5013 O O    . HOH H 6 .   ? 0.449   4.307   29.921 1.00 19.46  ? 593  HOH A O    1 
HETATM 5014 O O    . HOH H 6 .   ? 16.979  34.389  22.419 1.00 24.00  ? 594  HOH A O    1 
HETATM 5015 O O    . HOH H 6 .   ? -4.151  2.710   18.358 1.00 20.98  ? 595  HOH A O    1 
HETATM 5016 O O    . HOH H 6 .   ? 29.072  -3.401  13.821 1.00 18.42  ? 596  HOH A O    1 
HETATM 5017 O O    . HOH H 6 .   ? 25.597  6.612   29.507 1.00 22.43  ? 597  HOH A O    1 
HETATM 5018 O O    . HOH H 6 .   ? 38.798  -11.123 15.574 1.00 20.75  ? 598  HOH A O    1 
HETATM 5019 O O    . HOH H 6 .   ? 10.457  35.469  24.014 1.00 25.03  ? 599  HOH A O    1 
HETATM 5020 O O    . HOH H 6 .   ? 32.689  -10.994 11.899 1.00 24.68  ? 600  HOH A O    1 
HETATM 5021 O O    . HOH H 6 .   ? 35.231  27.803  -1.779 1.00 22.46  ? 601  HOH A O    1 
HETATM 5022 O O    . HOH H 6 .   ? 27.875  14.541  24.531 1.00 18.32  ? 602  HOH A O    1 
HETATM 5023 O O    . HOH H 6 .   ? 28.153  11.759  24.936 1.00 20.66  ? 603  HOH A O    1 
HETATM 5024 O O    . HOH H 6 .   ? 10.126  0.966   26.859 1.00 24.01  ? 604  HOH A O    1 
HETATM 5025 O O    . HOH H 6 .   ? 31.198  14.885  27.125 1.00 19.82  ? 605  HOH A O    1 
HETATM 5026 O O    . HOH H 6 .   ? 28.335  0.698   26.971 1.00 17.46  ? 606  HOH A O    1 
HETATM 5027 O O    . HOH H 6 .   ? 25.714  9.496   28.475 1.00 23.39  ? 607  HOH A O    1 
HETATM 5028 O O    . HOH H 6 .   ? 33.481  22.160  -0.984 1.00 21.27  ? 608  HOH A O    1 
HETATM 5029 O O    . HOH H 6 .   ? 22.375  6.874   29.941 1.00 21.98  ? 609  HOH A O    1 
HETATM 5030 O O    . HOH H 6 .   ? 0.594   21.778  17.358 1.00 18.50  ? 610  HOH A O    1 
HETATM 5031 O O    . HOH H 6 .   ? 2.151   23.597  31.466 1.00 22.34  ? 611  HOH A O    1 
HETATM 5032 O O    . HOH H 6 .   ? 31.797  -0.209  2.177  1.00 19.24  ? 612  HOH A O    1 
HETATM 5033 O O    . HOH H 6 .   ? -5.144  7.324   24.548 1.00 23.76  ? 613  HOH A O    1 
HETATM 5034 O O    . HOH H 6 .   ? 20.495  23.745  -3.381 1.00 22.38  ? 614  HOH A O    1 
HETATM 5035 O O    . HOH H 6 .   ? 6.829   22.240  30.501 1.00 29.84  ? 615  HOH A O    1 
HETATM 5036 O O    . HOH H 6 .   ? 48.461  15.157  11.035 1.00 26.31  ? 616  HOH A O    1 
HETATM 5037 O O    . HOH H 6 .   ? 41.025  31.576  13.762 1.00 25.13  ? 617  HOH A O    1 
HETATM 5038 O O    . HOH H 6 .   ? 30.101  20.912  -1.877 1.00 25.54  ? 618  HOH A O    1 
HETATM 5039 O O    . HOH H 6 .   ? 40.966  0.519   5.575  1.00 23.55  ? 619  HOH A O    1 
HETATM 5040 O O    . HOH H 6 .   ? 9.301   4.696   8.647  1.00 26.28  ? 620  HOH A O    1 
HETATM 5041 O O    . HOH H 6 .   ? 15.937  15.054  -1.253 1.00 24.26  ? 621  HOH A O    1 
HETATM 5042 O O    . HOH H 6 .   ? 18.812  9.588   27.977 1.00 19.75  ? 622  HOH A O    1 
HETATM 5043 O O    . HOH H 6 .   ? 33.541  4.508   27.016 1.00 17.74  ? 623  HOH A O    1 
HETATM 5044 O O    . HOH H 6 .   ? -6.042  -2.651  14.813 1.00 19.44  ? 624  HOH A O    1 
HETATM 5045 O O    A HOH H 6 .   ? -3.882  26.840  24.119 0.63 24.35  ? 625  HOH A O    1 
HETATM 5046 O O    B HOH H 6 .   ? -4.532  26.575  26.238 0.37 15.73  ? 625  HOH A O    1 
HETATM 5047 O O    A HOH H 6 .   ? 40.863  14.062  3.716  0.54 14.23  ? 626  HOH A O    1 
HETATM 5048 O O    B HOH H 6 .   ? 41.425  12.506  3.709  0.46 17.13  ? 626  HOH A O    1 
HETATM 5049 O O    . HOH H 6 .   ? 7.388   22.883  5.516  1.00 21.87  ? 627  HOH A O    1 
HETATM 5050 O O    . HOH H 6 .   ? 0.255   1.850   28.360 1.00 21.51  ? 628  HOH A O    1 
HETATM 5051 O O    . HOH H 6 .   ? -5.951  -0.527  8.408  1.00 31.16  ? 629  HOH A O    1 
HETATM 5052 O O    . HOH H 6 .   ? 19.340  29.460  25.439 1.00 16.69  ? 630  HOH A O    1 
HETATM 5053 O O    . HOH H 6 .   ? -1.195  11.308  11.113 1.00 33.04  ? 631  HOH A O    1 
HETATM 5054 O O    . HOH H 6 .   ? 20.637  15.864  -0.750 1.00 20.62  ? 632  HOH A O    1 
HETATM 5055 O O    . HOH H 6 .   ? 14.848  33.546  2.468  1.00 24.24  ? 633  HOH A O    1 
HETATM 5056 O O    . HOH H 6 .   ? 0.066   14.937  31.692 1.00 26.60  ? 634  HOH A O    1 
HETATM 5057 O O    . HOH H 6 .   ? 38.573  21.166  22.896 1.00 26.76  ? 635  HOH A O    1 
HETATM 5058 O O    . HOH H 6 .   ? 19.450  2.441   21.314 1.00 24.06  ? 636  HOH A O    1 
HETATM 5059 O O    . HOH H 6 .   ? 14.329  1.713   14.200 1.00 27.38  ? 637  HOH A O    1 
HETATM 5060 O O    . HOH H 6 .   ? 46.348  -0.916  13.685 1.00 21.23  ? 638  HOH A O    1 
HETATM 5061 O O    . HOH H 6 .   ? 5.182   25.246  9.774  1.00 21.37  ? 639  HOH A O    1 
HETATM 5062 O O    . HOH H 6 .   ? 22.517  28.347  32.000 1.00 34.88  ? 640  HOH A O    1 
HETATM 5063 O O    . HOH H 6 .   ? 9.684   31.100  7.921  1.00 25.31  ? 641  HOH A O    1 
HETATM 5064 O O    . HOH H 6 .   ? 8.005   9.014   9.546  1.00 25.50  ? 642  HOH A O    1 
HETATM 5065 O O    . HOH H 6 .   ? 38.695  18.135  28.985 1.00 19.77  ? 643  HOH A O    1 
HETATM 5066 O O    . HOH H 6 .   ? 28.279  15.737  27.275 1.00 18.81  ? 644  HOH A O    1 
HETATM 5067 O O    . HOH H 6 .   ? 34.784  -12.921 11.411 1.00 18.81  ? 645  HOH A O    1 
HETATM 5068 O O    . HOH H 6 .   ? 40.470  5.667   27.707 1.00 18.35  ? 646  HOH A O    1 
HETATM 5069 O O    . HOH H 6 .   ? 43.218  -5.320  17.888 1.00 22.22  ? 647  HOH A O    1 
HETATM 5070 O O    . HOH H 6 .   ? 37.755  0.890   2.589  1.00 18.45  ? 648  HOH A O    1 
HETATM 5071 O O    . HOH H 6 .   ? 38.945  -13.069 13.676 1.00 22.72  ? 649  HOH A O    1 
HETATM 5072 O O    A HOH H 6 .   ? 23.026  24.364  28.767 0.48 15.00  ? 650  HOH A O    1 
HETATM 5073 O O    B HOH H 6 .   ? 22.495  22.763  28.112 0.52 15.03  ? 650  HOH A O    1 
HETATM 5074 O O    . HOH H 6 .   ? 20.642  10.989  29.503 1.00 22.94  ? 651  HOH A O    1 
HETATM 5075 O O    . HOH H 6 .   ? 37.359  -12.111 11.643 1.00 23.94  ? 652  HOH A O    1 
HETATM 5076 O O    . HOH H 6 .   ? 44.239  21.502  12.838 1.00 20.27  ? 653  HOH A O    1 
HETATM 5077 O O    . HOH H 6 .   ? 21.021  32.284  1.894  1.00 24.66  ? 654  HOH A O    1 
HETATM 5078 O O    . HOH H 6 .   ? 40.167  8.380   27.775 1.00 14.94  ? 655  HOH A O    1 
HETATM 5079 O O    . HOH H 6 .   ? 37.892  10.112  27.950 1.00 20.22  ? 656  HOH A O    1 
HETATM 5080 O O    . HOH H 6 .   ? 46.924  22.293  12.891 1.00 22.57  ? 657  HOH A O    1 
HETATM 5081 O O    . HOH H 6 .   ? 22.701  21.617  -2.312 1.00 26.01  ? 658  HOH A O    1 
HETATM 5082 O O    . HOH H 6 .   ? 40.191  1.386   1.274  1.00 24.30  ? 659  HOH A O    1 
HETATM 5083 O O    . HOH H 6 .   ? 32.445  26.794  24.392 1.00 23.17  ? 660  HOH A O    1 
HETATM 5084 O O    . HOH H 6 .   ? 24.666  20.832  -3.759 1.00 25.41  ? 661  HOH A O    1 
HETATM 5085 O O    A HOH H 6 .   ? 26.977  4.608   28.129 0.50 16.43  ? 662  HOH A O    1 
HETATM 5086 O O    . HOH H 6 .   ? 37.093  31.831  15.034 1.00 24.72  ? 663  HOH A O    1 
HETATM 5087 O O    . HOH H 6 .   ? 17.918  34.683  1.769  1.00 26.36  ? 664  HOH A O    1 
HETATM 5088 O O    . HOH H 6 .   ? 40.752  30.460  16.041 1.00 25.02  ? 665  HOH A O    1 
HETATM 5089 O O    . HOH H 6 .   ? 11.174  28.588  31.473 1.00 38.98  ? 666  HOH A O    1 
HETATM 5090 O O    . HOH H 6 .   ? 25.289  32.197  3.717  1.00 22.51  ? 667  HOH A O    1 
HETATM 5091 O O    . HOH H 6 .   ? 52.770  3.169   12.297 1.00 26.30  ? 668  HOH A O    1 
HETATM 5092 O O    . HOH H 6 .   ? 0.269   0.101   30.468 1.00 31.02  ? 669  HOH A O    1 
HETATM 5093 O O    . HOH H 6 .   ? 10.320  -9.744  26.667 1.00 28.02  ? 670  HOH A O    1 
HETATM 5094 O O    A HOH H 6 .   ? 51.023  3.526   21.735 0.65 21.86  ? 671  HOH A O    1 
HETATM 5095 O O    B HOH H 6 .   ? 52.288  3.016   19.426 0.34 14.29  ? 671  HOH A O    1 
HETATM 5096 O O    . HOH H 6 .   ? 30.852  25.184  25.634 1.00 24.06  ? 672  HOH A O    1 
HETATM 5097 O O    . HOH H 6 .   ? 38.120  29.307  15.405 1.00 26.77  ? 673  HOH A O    1 
HETATM 5098 O O    . HOH H 6 .   ? 34.941  1.646   26.090 1.00 28.52  ? 674  HOH A O    1 
HETATM 5099 O O    . HOH H 6 .   ? 46.360  18.581  22.545 1.00 30.80  ? 675  HOH A O    1 
HETATM 5100 O O    . HOH H 6 .   ? 1.627   -1.078  31.833 1.00 19.95  ? 676  HOH A O    1 
HETATM 5101 O O    . HOH H 6 .   ? 48.744  13.125  9.196  1.00 26.58  ? 677  HOH A O    1 
HETATM 5102 O O    . HOH H 6 .   ? 16.185  36.236  9.375  1.00 26.17  ? 678  HOH A O    1 
HETATM 5103 O O    . HOH H 6 .   ? -0.707  -2.372  30.619 1.00 23.70  ? 679  HOH A O    1 
HETATM 5104 O O    . HOH H 6 .   ? 27.953  12.361  -1.008 1.00 31.55  ? 680  HOH A O    1 
HETATM 5105 O O    . HOH H 6 .   ? 29.827  34.977  19.403 1.00 31.43  ? 681  HOH A O    1 
HETATM 5106 O O    . HOH H 6 .   ? 13.434  32.985  24.251 1.00 25.63  ? 682  HOH A O    1 
HETATM 5107 O O    . HOH H 6 .   ? 9.788   36.116  15.859 1.00 31.05  ? 683  HOH A O    1 
HETATM 5108 O O    . HOH H 6 .   ? 46.712  16.601  7.690  1.00 30.46  ? 684  HOH A O    1 
HETATM 5109 O O    . HOH H 6 .   ? -6.921  9.140   17.586 1.00 31.42  ? 685  HOH A O    1 
HETATM 5110 O O    . HOH H 6 .   ? 51.638  13.688  22.932 1.00 32.88  ? 686  HOH A O    1 
HETATM 5111 O O    . HOH H 6 .   ? 36.468  -4.375  6.936  1.00 27.38  ? 687  HOH A O    1 
HETATM 5112 O O    A HOH H 6 .   ? 6.308   8.453   28.997 0.48 20.70  ? 688  HOH A O    1 
HETATM 5113 O O    B HOH H 6 .   ? 4.253   9.584   29.854 0.52 23.56  ? 688  HOH A O    1 
HETATM 5114 O O    . HOH H 6 .   ? 29.022  31.566  0.642  1.00 24.30  ? 689  HOH A O    1 
HETATM 5115 O O    . HOH H 6 .   ? 39.084  22.866  2.204  1.00 28.01  ? 690  HOH A O    1 
HETATM 5116 O O    . HOH H 6 .   ? -0.244  7.472   11.565 1.00 32.43  ? 691  HOH A O    1 
HETATM 5117 O O    . HOH H 6 .   ? -6.069  5.142   16.761 1.00 28.94  ? 692  HOH A O    1 
HETATM 5118 O O    . HOH H 6 .   ? 4.672   25.938  7.121  1.00 32.94  ? 693  HOH A O    1 
HETATM 5119 O O    . HOH H 6 .   ? 39.206  19.993  0.164  1.00 30.52  ? 694  HOH A O    1 
HETATM 5120 O O    . HOH H 6 .   ? 18.701  22.189  30.845 1.00 29.51  ? 695  HOH A O    1 
HETATM 5121 O O    . HOH H 6 .   ? 13.497  35.673  22.732 1.00 36.51  ? 696  HOH A O    1 
HETATM 5122 O O    . HOH H 6 .   ? 0.627   26.550  18.892 1.00 25.62  ? 697  HOH A O    1 
HETATM 5123 O O    . HOH H 6 .   ? 19.674  35.044  18.611 1.00 27.40  ? 698  HOH A O    1 
HETATM 5124 O O    . HOH H 6 .   ? 45.004  5.815   6.314  1.00 29.10  ? 699  HOH A O    1 
HETATM 5125 O O    . HOH H 6 .   ? 35.660  7.056   30.532 1.00 27.76  ? 700  HOH A O    1 
HETATM 5126 O O    . HOH H 6 .   ? 41.486  27.731  13.052 1.00 28.53  ? 701  HOH A O    1 
HETATM 5127 O O    . HOH H 6 .   ? 15.954  32.365  24.930 1.00 27.61  ? 702  HOH A O    1 
HETATM 5128 O O    . HOH H 6 .   ? 42.389  -9.128  15.143 1.00 41.25  ? 703  HOH A O    1 
HETATM 5129 O O    . HOH H 6 .   ? 24.923  10.251  2.398  1.00 27.79  ? 704  HOH A O    1 
HETATM 5130 O O    . HOH H 6 .   ? 12.873  3.525   5.678  1.00 27.47  ? 705  HOH A O    1 
HETATM 5131 O O    . HOH H 6 .   ? 3.113   19.474  30.805 1.00 29.39  ? 706  HOH A O    1 
HETATM 5132 O O    . HOH H 6 .   ? 30.299  -1.030  4.748  1.00 29.18  ? 707  HOH A O    1 
HETATM 5133 O O    . HOH H 6 .   ? 20.127  37.176  15.134 1.00 28.56  ? 708  HOH A O    1 
HETATM 5134 O O    . HOH H 6 .   ? -6.961  13.555  18.547 1.00 35.42  ? 709  HOH A O    1 
HETATM 5135 O O    . HOH H 6 .   ? -8.496  4.989   23.447 1.00 38.27  ? 710  HOH A O    1 
HETATM 5136 O O    . HOH H 6 .   ? 19.149  0.815   6.773  1.00 34.05  ? 711  HOH A O    1 
HETATM 5137 O O    A HOH H 6 .   ? 6.792   29.131  29.897 0.58 26.00  ? 712  HOH A O    1 
HETATM 5138 O O    B HOH H 6 .   ? 9.032   29.816  28.999 0.42 23.21  ? 712  HOH A O    1 
HETATM 5139 O O    . HOH H 6 .   ? 16.913  0.711   19.125 1.00 37.56  ? 713  HOH A O    1 
HETATM 5140 O O    . HOH H 6 .   ? 12.546  4.323   22.458 1.00 31.54  ? 714  HOH A O    1 
HETATM 5141 O O    . HOH H 6 .   ? -5.419  10.779  17.078 1.00 33.67  ? 715  HOH A O    1 
HETATM 5142 O O    . HOH H 6 .   ? 6.932   18.470  33.299 1.00 35.09  ? 716  HOH A O    1 
HETATM 5143 O O    . HOH H 6 .   ? 24.548  34.337  8.236  1.00 27.11  ? 717  HOH A O    1 
HETATM 5144 O O    . HOH H 6 .   ? 5.180   36.127  16.816 1.00 41.84  ? 718  HOH A O    1 
HETATM 5145 O O    . HOH H 6 .   ? 26.115  24.056  34.297 1.00 30.89  ? 719  HOH A O    1 
HETATM 5146 O O    . HOH H 6 .   ? 20.872  14.289  -2.876 1.00 39.23  ? 720  HOH A O    1 
HETATM 5147 O O    . HOH H 6 .   ? 2.907   9.152   8.412  1.00 26.51  ? 721  HOH A O    1 
HETATM 5148 O O    . HOH H 6 .   ? -2.521  16.549  12.441 1.00 26.74  ? 722  HOH A O    1 
HETATM 5149 O O    . HOH H 6 .   ? 18.038  17.742  0.156  1.00 44.90  ? 723  HOH A O    1 
HETATM 5150 O O    . HOH H 6 .   ? -0.635  18.105  9.883  1.00 32.73  ? 724  HOH A O    1 
HETATM 5151 O O    . HOH H 6 .   ? 26.213  10.509  0.086  1.00 35.24  ? 725  HOH A O    1 
HETATM 5152 O O    . HOH H 6 .   ? 5.673   28.138  -0.216 1.00 35.51  ? 726  HOH A O    1 
HETATM 5153 O O    A HOH H 6 .   ? 30.047  24.291  17.835 0.54 28.93  ? 727  HOH A O    1 
HETATM 5154 O O    B HOH H 6 .   ? 29.406  23.456  16.500 0.46 18.11  ? 727  HOH A O    1 
HETATM 5155 O O    . HOH H 6 .   ? 1.657   16.335  6.669  1.00 47.03  ? 728  HOH A O    1 
HETATM 5156 O O    . HOH H 6 .   ? 51.594  7.664   9.447  1.00 34.79  ? 729  HOH A O    1 
HETATM 5157 O O    . HOH H 6 .   ? 20.039  2.462   11.619 1.00 33.29  ? 730  HOH A O    1 
HETATM 5158 O O    . HOH H 6 .   ? 48.618  2.025   16.612 1.00 31.95  ? 731  HOH A O    1 
HETATM 5159 O O    . HOH H 6 .   ? -8.804  16.698  22.047 1.00 34.18  ? 732  HOH A O    1 
HETATM 5160 O O    . HOH H 6 .   ? 29.705  16.327  -1.136 1.00 33.44  ? 733  HOH A O    1 
HETATM 5161 O O    . HOH H 6 .   ? 50.533  6.021   12.665 1.00 26.45  ? 734  HOH A O    1 
HETATM 5162 O O    . HOH H 6 .   ? 34.570  -0.649  2.417  1.00 30.24  ? 735  HOH A O    1 
HETATM 5163 O O    . HOH H 6 .   ? 0.128   27.267  30.847 1.00 38.48  ? 736  HOH A O    1 
HETATM 5164 O O    . HOH H 6 .   ? -1.710  9.025   28.002 1.00 35.14  ? 737  HOH A O    1 
HETATM 5165 O O    . HOH H 6 .   ? 31.344  24.622  -4.285 1.00 37.07  ? 738  HOH A O    1 
HETATM 5166 O O    . HOH H 6 .   ? 20.476  31.513  26.772 1.00 37.67  ? 739  HOH A O    1 
HETATM 5167 O O    . HOH H 6 .   ? 11.686  28.435  28.633 1.00 33.79  ? 740  HOH A O    1 
HETATM 5168 O O    . HOH H 6 .   ? 31.680  22.042  29.056 1.00 40.51  ? 741  HOH A O    1 
HETATM 5169 O O    A HOH H 6 .   ? 35.577  17.313  30.105 0.50 27.47  ? 742  HOH A O    1 
HETATM 5170 O O    . HOH H 6 .   ? 10.552  -0.229  17.293 1.00 34.77  ? 743  HOH A O    1 
HETATM 5171 O O    . HOH H 6 .   ? 13.021  12.431  37.420 1.00 35.29  ? 744  HOH A O    1 
HETATM 5172 O O    . HOH H 6 .   ? 33.837  -4.659  23.561 1.00 36.25  ? 745  HOH A O    1 
HETATM 5173 O O    . HOH H 6 .   ? 18.873  13.714  -4.536 1.00 45.06  ? 746  HOH A O    1 
HETATM 5174 O O    . HOH H 6 .   ? 36.187  25.411  23.691 1.00 48.80  ? 747  HOH A O    1 
HETATM 5175 O O    . HOH H 6 .   ? 27.453  26.279  -4.172 1.00 49.56  ? 748  HOH A O    1 
HETATM 5176 O O    . HOH H 6 .   ? 8.623   32.078  9.891  1.00 35.10  ? 749  HOH A O    1 
HETATM 5177 O O    . HOH H 6 .   ? 17.689  1.546   10.690 1.00 32.78  ? 750  HOH A O    1 
HETATM 5178 O O    . HOH H 6 .   ? 29.967  12.692  25.965 1.00 39.67  ? 751  HOH A O    1 
HETATM 5179 O O    . HOH H 6 .   ? 46.922  12.273  5.370  1.00 33.42  ? 752  HOH A O    1 
HETATM 5180 O O    . HOH H 6 .   ? 22.439  35.565  6.828  1.00 40.45  ? 753  HOH A O    1 
HETATM 5181 O O    . HOH H 6 .   ? 9.336   34.918  13.504 1.00 31.95  ? 754  HOH A O    1 
HETATM 5182 O O    . HOH H 6 .   ? 22.613  -1.661  17.013 1.00 28.46  ? 755  HOH A O    1 
HETATM 5183 O O    . HOH H 6 .   ? 23.558  33.645  22.539 1.00 43.28  ? 756  HOH A O    1 
HETATM 5184 O O    . HOH H 6 .   ? 37.398  20.395  27.789 1.00 31.02  ? 757  HOH A O    1 
HETATM 5185 O O    . HOH H 6 .   ? 38.936  34.232  1.123  1.00 42.24  ? 758  HOH A O    1 
HETATM 5186 O O    . HOH H 6 .   ? 12.114  36.200  10.664 1.00 30.58  ? 759  HOH A O    1 
HETATM 5187 O O    . HOH H 6 .   ? 45.472  4.394   4.016  1.00 30.87  ? 760  HOH A O    1 
HETATM 5188 O O    . HOH H 6 .   ? -0.605  27.547  22.201 1.00 34.49  ? 761  HOH A O    1 
HETATM 5189 O O    . HOH H 6 .   ? 30.052  -7.091  11.738 1.00 51.63  ? 762  HOH A O    1 
HETATM 5190 O O    . HOH H 6 .   ? 28.285  32.024  25.149 1.00 33.38  ? 763  HOH A O    1 
HETATM 5191 O O    . HOH H 6 .   ? 5.237   14.369  6.400  1.00 41.58  ? 764  HOH A O    1 
HETATM 5192 O O    . HOH H 6 .   ? 0.864   21.068  10.109 1.00 37.97  ? 765  HOH A O    1 
HETATM 5193 O O    . HOH H 6 .   ? -2.666  -3.720  15.526 1.00 37.31  ? 766  HOH A O    1 
HETATM 5194 O O    A HOH H 6 .   ? 30.707  -7.452  15.960 0.44 27.92  ? 767  HOH A O    1 
HETATM 5195 O O    B HOH H 6 .   ? 30.697  -8.697  17.904 0.56 27.99  ? 767  HOH A O    1 
HETATM 5196 O O    . HOH H 6 .   ? 41.973  2.062   3.578  1.00 41.45  ? 768  HOH A O    1 
HETATM 5197 O O    . HOH H 6 .   ? 42.672  -1.339  6.493  1.00 46.66  ? 769  HOH A O    1 
HETATM 5198 O O    . HOH H 6 .   ? 9.402   11.023  1.768  1.00 39.42  ? 770  HOH A O    1 
HETATM 5199 O O    A HOH H 6 .   ? 6.554   25.275  4.300  0.63 21.21  ? 771  HOH A O    1 
HETATM 5200 O O    B HOH H 6 .   ? 7.693   24.495  3.693  0.37 19.29  ? 771  HOH A O    1 
HETATM 5201 O O    . HOH H 6 .   ? 14.426  2.478   22.715 1.00 36.35  ? 772  HOH A O    1 
HETATM 5202 O O    . HOH H 6 .   ? 27.382  -6.819  13.427 1.00 34.10  ? 773  HOH A O    1 
HETATM 5203 O O    . HOH H 6 .   ? 43.058  -6.309  15.449 1.00 38.35  ? 774  HOH A O    1 
HETATM 5204 O O    . HOH H 6 .   ? 20.237  19.891  -2.683 1.00 39.30  ? 775  HOH A O    1 
HETATM 5205 O O    . HOH H 6 .   ? 43.660  5.529   2.742  1.00 35.66  ? 776  HOH A O    1 
HETATM 5206 O O    . HOH H 6 .   ? 34.309  19.752  29.637 0.50 38.49  ? 777  HOH A O    1 
HETATM 5207 O O    . HOH H 6 .   ? 34.309  24.115  29.637 0.50 42.34  ? 778  HOH A O    1 
HETATM 5208 O O    . HOH H 6 .   ? 24.305  3.084   17.331 1.00 36.34  ? 779  HOH A O    1 
HETATM 5209 O O    . HOH H 6 .   ? -7.027  14.339  26.045 1.00 44.53  ? 780  HOH A O    1 
HETATM 5210 O O    . HOH H 6 .   ? 41.320  31.117  1.117  1.00 81.56  ? 781  HOH A O    1 
HETATM 5211 O O    . HOH H 6 .   ? 7.154   19.038  7.537  1.00 37.50  ? 782  HOH A O    1 
HETATM 5212 O O    . HOH H 6 .   ? 22.230  9.040   -0.659 1.00 31.21  ? 783  HOH A O    1 
HETATM 5213 O O    . HOH H 6 .   ? -5.330  4.676   25.433 1.00 36.10  ? 784  HOH A O    1 
HETATM 5214 O O    . HOH H 6 .   ? 23.075  -3.285  11.267 1.00 40.96  ? 785  HOH A O    1 
HETATM 5215 O O    . HOH H 6 .   ? 14.481  36.400  16.861 1.00 33.59  ? 786  HOH A O    1 
HETATM 5216 O O    . HOH H 6 .   ? 36.432  10.981  -1.609 1.00 41.57  ? 787  HOH A O    1 
HETATM 5217 O O    . HOH H 6 .   ? 6.494   10.226  8.192  1.00 35.42  ? 788  HOH A O    1 
HETATM 5218 O O    . HOH H 6 .   ? 31.692  26.738  17.522 1.00 43.94  ? 789  HOH A O    1 
HETATM 5219 O O    . HOH H 6 .   ? 32.269  35.746  4.019  1.00 45.29  ? 790  HOH A O    1 
HETATM 5220 O O    . HOH H 6 .   ? 45.912  18.396  18.309 1.00 31.14  ? 791  HOH A O    1 
HETATM 5221 O O    . HOH H 6 .   ? 38.323  26.772  16.854 1.00 35.09  ? 792  HOH A O    1 
HETATM 5222 O O    . HOH H 6 .   ? 32.082  28.205  19.332 1.00 36.84  ? 793  HOH A O    1 
HETATM 5223 O O    . HOH H 6 .   ? -7.432  1.511   8.268  1.00 40.53  ? 794  HOH A O    1 
HETATM 5224 O O    . HOH H 6 .   ? -2.542  13.724  30.303 1.00 42.80  ? 795  HOH A O    1 
HETATM 5225 O O    . HOH H 6 .   ? 2.886   21.908  9.181  1.00 44.67  ? 796  HOH A O    1 
HETATM 5226 O O    . HOH H 6 .   ? 21.450  17.956  -2.462 1.00 32.78  ? 797  HOH A O    1 
HETATM 5227 O O    . HOH H 6 .   ? 27.912  -3.449  5.831  1.00 36.68  ? 798  HOH A O    1 
HETATM 5228 O O    . HOH H 6 .   ? 15.307  0.638   11.997 1.00 40.07  ? 799  HOH A O    1 
HETATM 5229 O O    . HOH H 6 .   ? 6.525   29.718  6.014  1.00 37.59  ? 800  HOH A O    1 
HETATM 5230 O O    . HOH H 6 .   ? 22.187  2.117   29.747 1.00 56.58  ? 801  HOH A O    1 
HETATM 5231 O O    . HOH H 6 .   ? 47.807  21.062  10.083 1.00 39.60  ? 802  HOH A O    1 
HETATM 5232 O O    . HOH H 6 .   ? -0.228  22.027  30.265 1.00 36.49  ? 803  HOH A O    1 
HETATM 5233 O O    . HOH H 6 .   ? 26.787  37.180  22.010 1.00 44.06  ? 804  HOH A O    1 
HETATM 5234 O O    . HOH H 6 .   ? 37.676  -8.306  9.253  1.00 38.10  ? 805  HOH A O    1 
HETATM 5235 O O    . HOH H 6 .   ? 20.138  0.303   18.664 1.00 47.75  ? 806  HOH A O    1 
HETATM 5236 O O    A HOH H 6 .   ? -8.407  2.842   18.718 0.58 32.29  ? 807  HOH A O    1 
HETATM 5237 O O    B HOH H 6 .   ? -9.282  2.343   20.928 0.42 29.25  ? 807  HOH A O    1 
HETATM 5238 O O    A HOH H 6 .   ? 9.146   18.301  6.107  0.76 34.05  ? 808  HOH A O    1 
HETATM 5239 O O    B HOH H 6 .   ? 9.319   18.675  4.232  0.24 28.37  ? 808  HOH A O    1 
HETATM 5240 O O    . HOH H 6 .   ? 34.592  26.960  26.611 1.00 43.44  ? 809  HOH A O    1 
HETATM 5241 O O    . HOH H 6 .   ? 25.589  30.488  28.142 1.00 42.93  ? 810  HOH A O    1 
HETATM 5242 O O    . HOH H 6 .   ? 6.381   6.691   5.503  1.00 44.33  ? 811  HOH A O    1 
HETATM 5243 O O    . HOH H 6 .   ? 31.896  35.437  8.528  1.00 48.72  ? 812  HOH A O    1 
HETATM 5244 O O    . HOH H 6 .   ? -2.088  0.291   9.486  1.00 41.62  ? 813  HOH A O    1 
HETATM 5245 O O    . HOH H 6 .   ? 38.736  -12.645 9.517  1.00 43.60  ? 814  HOH A O    1 
HETATM 5246 O O    . HOH H 6 .   ? -8.659  12.903  24.215 1.00 60.00  ? 815  HOH A O    1 
HETATM 5247 O O    . HOH H 6 .   ? 23.912  4.347   30.525 1.00 43.24  ? 816  HOH A O    1 
HETATM 5248 O O    . HOH H 6 .   ? 39.275  -4.348  7.733  1.00 37.38  ? 817  HOH A O    1 
HETATM 5249 O O    . HOH H 6 .   ? 24.692  -10.028 16.800 1.00 30.77  ? 818  HOH A O    1 
HETATM 5250 O O    . HOH H 6 .   ? 17.021  35.150  26.023 1.00 45.83  ? 819  HOH A O    1 
HETATM 5251 O O    . HOH H 6 .   ? 47.641  14.445  6.978  1.00 41.85  ? 820  HOH A O    1 
HETATM 5252 O O    . HOH H 6 .   ? 12.181  38.863  1.801  1.00 44.14  ? 821  HOH A O    1 
HETATM 5253 O O    . HOH H 6 .   ? 49.764  6.484   23.603 1.00 44.64  ? 822  HOH A O    1 
HETATM 5254 O O    . HOH H 6 .   ? 52.140  14.076  20.109 1.00 41.87  ? 823  HOH A O    1 
HETATM 5255 O O    . HOH H 6 .   ? 27.593  -7.761  20.618 1.00 39.92  ? 824  HOH A O    1 
HETATM 5256 O O    . HOH H 6 .   ? 6.949   33.658  12.350 1.00 42.78  ? 825  HOH A O    1 
HETATM 5257 O O    . HOH H 6 .   ? 32.495  -9.853  16.523 1.00 41.12  ? 826  HOH A O    1 
HETATM 5258 O O    . HOH H 6 .   ? 22.498  -0.096  27.622 1.00 41.70  ? 827  HOH A O    1 
HETATM 5259 O O    . HOH H 6 .   ? -0.228  6.497   29.386 1.00 65.09  ? 828  HOH A O    1 
HETATM 5260 O O    . HOH H 6 .   ? 5.433   29.668  9.896  1.00 49.57  ? 829  HOH A O    1 
HETATM 5261 O O    . HOH H 6 .   ? 26.703  2.288   29.540 1.00 50.31  ? 830  HOH A O    1 
HETATM 5262 O O    . HOH H 6 .   ? 37.215  -2.814  5.235  1.00 59.46  ? 831  HOH A O    1 
HETATM 5263 O O    . HOH H 6 .   ? 39.341  29.209  3.215  1.00 40.63  ? 832  HOH A O    1 
HETATM 5264 O O    . HOH H 6 .   ? 31.693  31.466  25.194 1.00 53.40  ? 833  HOH A O    1 
HETATM 5265 O O    . HOH H 6 .   ? 49.493  2.296   14.012 1.00 53.10  ? 834  HOH A O    1 
HETATM 5266 O O    . HOH H 6 .   ? -4.404  14.832  29.173 1.00 46.85  ? 835  HOH A O    1 
HETATM 5267 O O    . HOH H 6 .   ? -4.034  14.879  11.568 1.00 71.62  ? 836  HOH A O    1 
HETATM 5268 O O    . HOH H 6 .   ? 37.133  32.997  6.155  1.00 42.31  ? 837  HOH A O    1 
HETATM 5269 O O    . HOH H 6 .   ? -2.047  14.027  10.793 1.00 41.01  ? 838  HOH A O    1 
HETATM 5270 O O    . HOH H 6 .   ? 47.500  0.736   11.678 1.00 49.86  ? 839  HOH A O    1 
HETATM 5271 O O    . HOH H 6 .   ? 15.588  8.244   20.043 1.00 11.43  ? 840  HOH A O    1 
HETATM 5272 O O    A HOH H 6 .   ? 12.151  7.143   25.524 0.71 18.92  ? 841  HOH A O    1 
HETATM 5273 O O    B HOH H 6 .   ? 10.422  5.175   25.651 0.29 20.96  ? 841  HOH A O    1 
HETATM 5274 O O    . HOH H 6 .   ? 25.714  35.546  12.283 1.00 23.14  ? 842  HOH A O    1 
HETATM 5275 O O    . HOH H 6 .   ? 28.101  33.642  11.372 1.00 24.29  ? 843  HOH A O    1 
HETATM 5276 O O    . HOH H 6 .   ? 17.908  6.322   25.784 1.00 30.06  ? 844  HOH A O    1 
HETATM 5277 O O    A HOH H 6 .   ? 15.158  6.822   22.494 0.61 22.71  ? 845  HOH A O    1 
HETATM 5278 O O    B HOH H 6 .   ? 13.558  6.814   22.909 0.39 18.82  ? 845  HOH A O    1 
HETATM 5279 O O    . HOH H 6 .   ? 32.696  -2.106  25.317 1.00 28.56  ? 846  HOH A O    1 
HETATM 5280 O O    . HOH H 6 .   ? 17.094  5.651   22.263 1.00 36.93  ? 847  HOH A O    1 
HETATM 5281 O O    . HOH H 6 .   ? 54.399  13.766  19.524 1.00 39.82  ? 848  HOH A O    1 
HETATM 5282 O O    . HOH H 6 .   ? -6.946  7.379   9.194  1.00 40.47  ? 849  HOH A O    1 
HETATM 5283 O O    . HOH H 6 .   ? 22.993  36.902  12.656 1.00 41.60  ? 850  HOH A O    1 
HETATM 5284 O O    . HOH H 6 .   ? 27.172  38.106  17.573 1.00 42.66  ? 851  HOH A O    1 
HETATM 5285 O O    . HOH H 6 .   ? 15.746  7.209   25.560 1.00 40.21  ? 852  HOH A O    1 
HETATM 5286 O O    . HOH H 6 .   ? 50.714  0.883   7.341  1.00 36.62  ? 853  HOH A O    1 
HETATM 5287 O O    . HOH H 6 .   ? 29.099  24.928  32.953 1.00 43.49  ? 854  HOH A O    1 
HETATM 5288 O O    . HOH H 6 .   ? -6.044  0.850   18.472 1.00 39.28  ? 855  HOH A O    1 
HETATM 5289 O O    . HOH H 6 .   ? 22.869  29.751  -1.969 1.00 50.11  ? 856  HOH A O    1 
HETATM 5290 O O    . HOH H 6 .   ? 6.868   28.758  32.385 1.00 44.46  ? 857  HOH A O    1 
HETATM 5291 O O    . HOH H 6 .   ? 30.963  31.533  22.338 1.00 48.48  ? 858  HOH A O    1 
HETATM 5292 O O    . HOH H 6 .   ? 20.298  33.833  4.926  1.00 50.11  ? 859  HOH A O    1 
HETATM 5293 O O    . HOH H 6 .   ? 38.979  25.055  4.207  1.00 43.53  ? 860  HOH A O    1 
HETATM 5294 O O    . HOH H 6 .   ? 14.633  40.426  13.112 1.00 102.21 ? 861  HOH A O    1 
HETATM 5295 O O    . HOH H 6 .   ? 21.833  -7.826  22.619 1.00 51.33  ? 862  HOH A O    1 
HETATM 5296 O O    . HOH H 6 .   ? 48.033  18.558  20.565 1.00 50.77  ? 863  HOH A O    1 
HETATM 5297 O O    . HOH H 6 .   ? 33.673  32.032  18.013 1.00 48.03  ? 864  HOH A O    1 
HETATM 5298 O O    . HOH H 6 .   ? 46.122  11.083  3.014  1.00 54.03  ? 865  HOH A O    1 
HETATM 5299 O O    . HOH H 6 .   ? 27.188  22.412  -4.015 1.00 51.18  ? 866  HOH A O    1 
HETATM 5300 O O    . HOH H 6 .   ? 49.605  15.256  15.796 1.00 41.74  ? 867  HOH A O    1 
HETATM 5301 O O    . HOH H 6 .   ? 5.431   16.659  6.414  1.00 55.30  ? 868  HOH A O    1 
HETATM 5302 O O    . HOH H 6 .   ? 35.981  32.654  17.697 1.00 57.75  ? 869  HOH A O    1 
HETATM 5303 O O    . HOH H 6 .   ? -7.346  9.237   26.879 1.00 57.88  ? 870  HOH A O    1 
HETATM 5304 O O    . HOH H 6 .   ? 22.721  -3.300  22.035 1.00 47.97  ? 871  HOH A O    1 
HETATM 5305 O O    . HOH H 6 .   ? 12.248  -0.593  26.368 1.00 51.91  ? 872  HOH A O    1 
HETATM 5306 O O    . HOH H 6 .   ? 33.605  -6.911  5.324  1.00 44.01  ? 873  HOH A O    1 
HETATM 5307 O O    . HOH H 6 .   ? 11.916  36.888  17.162 1.00 45.81  ? 874  HOH A O    1 
HETATM 5308 O O    . HOH H 6 .   ? 48.452  17.945  16.254 1.00 46.53  ? 875  HOH A O    1 
HETATM 5309 O O    . HOH H 6 .   ? 17.067  19.663  -3.882 1.00 44.64  ? 876  HOH A O    1 
HETATM 5310 O O    . HOH H 6 .   ? -8.979  0.829   6.228  1.00 36.14  ? 877  HOH A O    1 
HETATM 5311 O O    . HOH H 6 .   ? 1.342   19.122  33.058 1.00 55.52  ? 878  HOH A O    1 
HETATM 5312 O O    . HOH H 6 .   ? 10.403  37.313  0.483  1.00 44.20  ? 879  HOH A O    1 
HETATM 5313 O O    . HOH H 6 .   ? 36.677  21.312  -2.469 1.00 53.64  ? 880  HOH A O    1 
HETATM 5314 O O    . HOH H 6 .   ? 23.674  -7.984  14.363 1.00 55.28  ? 881  HOH A O    1 
HETATM 5315 O O    . HOH H 6 .   ? 8.046   14.701  4.785  1.00 52.43  ? 882  HOH A O    1 
HETATM 5316 O O    . HOH H 6 .   ? 24.441  8.595   -0.229 1.00 65.18  ? 883  HOH A O    1 
HETATM 5317 O O    . HOH H 6 .   ? 24.389  3.579   5.979  1.00 57.32  ? 884  HOH A O    1 
HETATM 5318 O O    . HOH H 6 .   ? 17.527  37.770  15.416 1.00 50.51  ? 885  HOH A O    1 
HETATM 5319 O O    . HOH H 6 .   ? 42.641  22.017  0.973  1.00 55.71  ? 886  HOH A O    1 
HETATM 5320 O O    . HOH H 6 .   ? 20.481  35.736  20.770 1.00 50.42  ? 887  HOH A O    1 
HETATM 5321 O O    . HOH H 6 .   ? 23.072  30.766  32.577 1.00 44.27  ? 888  HOH A O    1 
HETATM 5322 O O    . HOH H 6 .   ? 10.991  13.122  38.249 1.00 63.94  ? 889  HOH A O    1 
HETATM 5323 O O    . HOH H 6 .   ? -9.083  14.023  21.492 1.00 45.19  ? 890  HOH A O    1 
HETATM 5324 O O    . HOH H 6 .   ? 19.876  15.310  -7.756 1.00 54.38  ? 891  HOH A O    1 
HETATM 5325 O O    . HOH H 6 .   ? -1.640  0.402   20.879 1.00 27.69  ? 892  HOH A O    1 
HETATM 5326 O O    . HOH H 6 .   ? 24.627  4.661   15.508 1.00 50.10  ? 893  HOH A O    1 
HETATM 5327 O O    . HOH H 6 .   ? 3.470   -2.659  12.043 1.00 40.59  ? 894  HOH A O    1 
HETATM 5328 O O    . HOH H 6 .   ? 5.267   -3.793  13.234 1.00 55.81  ? 895  HOH A O    1 
HETATM 5329 O O    . HOH H 6 .   ? 30.770  -2.538  26.746 1.00 47.71  ? 896  HOH A O    1 
HETATM 5330 O O    . HOH H 6 .   ? -3.557  21.968  28.195 1.00 41.24  ? 897  HOH A O    1 
HETATM 5331 O O    . HOH H 6 .   ? 16.995  37.540  11.494 1.00 45.82  ? 898  HOH A O    1 
HETATM 5332 O O    . HOH H 6 .   ? 30.817  18.436  -2.150 1.00 62.04  ? 899  HOH A O    1 
HETATM 5333 O O    . HOH H 6 .   ? 14.065  1.266   24.959 1.00 44.51  ? 900  HOH A O    1 
HETATM 5334 O O    . HOH H 6 .   ? 25.202  -6.867  12.392 1.00 51.07  ? 901  HOH A O    1 
HETATM 5335 O O    . HOH H 6 .   ? 20.745  -4.398  20.960 1.00 67.30  ? 902  HOH A O    1 
HETATM 5336 O O    . HOH H 6 .   ? 48.251  5.437   2.226  1.00 64.05  ? 903  HOH A O    1 
HETATM 5337 O O    . HOH H 6 .   ? 37.208  -12.154 18.315 1.00 44.78  ? 904  HOH A O    1 
HETATM 5338 O O    . HOH H 6 .   ? 29.136  29.893  27.981 1.00 47.77  ? 905  HOH A O    1 
HETATM 5339 O O    . HOH H 6 .   ? 23.028  37.062  19.115 1.00 49.75  ? 906  HOH A O    1 
HETATM 5340 O O    . HOH H 6 .   ? 41.733  -4.594  8.510  1.00 57.16  ? 907  HOH A O    1 
HETATM 5341 O O    . HOH H 6 .   ? 28.025  13.698  -3.928 1.00 75.30  ? 908  HOH A O    1 
HETATM 5342 O O    . HOH H 6 .   ? 9.987   0.292   7.536  1.00 48.76  ? 909  HOH A O    1 
HETATM 5343 O O    . HOH H 6 .   ? 6.959   30.576  8.445  1.00 42.76  ? 910  HOH A O    1 
HETATM 5344 O O    . HOH H 6 .   ? 10.948  0.531   14.970 1.00 54.37  ? 911  HOH A O    1 
HETATM 5345 O O    . HOH H 6 .   ? 7.872   7.534   30.985 1.00 44.00  ? 912  HOH A O    1 
HETATM 5346 O O    . HOH H 6 .   ? 2.078   30.394  30.140 1.00 51.49  ? 913  HOH A O    1 
HETATM 5347 O O    . HOH H 6 .   ? 27.887  34.198  24.132 1.00 50.79  ? 914  HOH A O    1 
HETATM 5348 O O    . HOH H 6 .   ? 13.198  2.068   3.627  1.00 42.52  ? 915  HOH A O    1 
HETATM 5349 O O    . HOH H 6 .   ? 24.683  0.168   29.327 1.00 70.62  ? 916  HOH A O    1 
HETATM 5350 O O    . HOH H 6 .   ? 3.743   29.221  28.269 1.00 44.55  ? 917  HOH A O    1 
HETATM 5351 O O    . HOH H 6 .   ? 41.292  26.140  14.839 1.00 54.52  ? 918  HOH A O    1 
HETATM 5352 O O    . HOH H 6 .   ? 8.498   8.419   1.573  1.00 41.99  ? 919  HOH A O    1 
HETATM 5353 O O    . HOH H 6 .   ? 4.206   35.009  14.793 1.00 63.41  ? 920  HOH A O    1 
HETATM 5354 O O    . HOH H 6 .   ? 22.551  34.108  4.107  1.00 37.18  ? 921  HOH A O    1 
HETATM 5355 O O    . HOH H 6 .   ? 21.637  1.035   16.403 1.00 41.26  ? 922  HOH A O    1 
HETATM 5356 O O    . HOH H 6 .   ? 29.306  23.273  -3.328 1.00 60.76  ? 923  HOH A O    1 
HETATM 5357 O O    . HOH H 6 .   ? 39.833  10.809  -1.778 1.00 49.25  ? 924  HOH A O    1 
HETATM 5358 O O    . HOH H 6 .   ? 43.035  7.777   -1.703 1.00 48.48  ? 925  HOH A O    1 
HETATM 5359 O O    . HOH H 6 .   ? 22.001  10.446  -2.543 1.00 40.26  ? 926  HOH A O    1 
HETATM 5360 O O    . HOH H 6 .   ? 41.064  -6.267  6.524  1.00 67.55  ? 927  HOH A O    1 
HETATM 5361 O O    . HOH H 6 .   ? -1.363  21.496  10.478 1.00 56.30  ? 928  HOH A O    1 
HETATM 5362 O O    . HOH H 6 .   ? 45.763  9.992   1.028  1.00 62.29  ? 929  HOH A O    1 
HETATM 5363 O O    . HOH H 6 .   ? 31.922  25.815  28.885 1.00 64.47  ? 930  HOH A O    1 
HETATM 5364 O O    . HOH H 6 .   ? 48.499  1.099   3.516  1.00 82.04  ? 931  HOH A O    1 
HETATM 5365 O O    . HOH H 6 .   ? 6.329   11.981  5.888  1.00 53.13  ? 932  HOH A O    1 
HETATM 5366 O O    . HOH H 6 .   ? 14.500  -0.128  20.658 1.00 49.64  ? 933  HOH A O    1 
HETATM 5367 O O    . HOH H 6 .   ? 36.470  -10.900 8.912  1.00 84.48  ? 934  HOH A O    1 
HETATM 5368 O O    . HOH H 6 .   ? 6.161   6.756   8.560  1.00 56.74  ? 935  HOH A O    1 
HETATM 5369 O O    . HOH H 6 .   ? 36.544  29.459  19.680 1.00 66.51  ? 936  HOH A O    1 
HETATM 5370 O O    . HOH H 6 .   ? 41.915  29.865  6.394  1.00 55.70  ? 937  HOH A O    1 
HETATM 5371 O O    . HOH H 6 .   ? 12.774  37.388  14.962 1.00 70.95  ? 938  HOH A O    1 
HETATM 5372 O O    . HOH H 6 .   ? 3.941   7.045   7.972  1.00 64.73  ? 939  HOH A O    1 
HETATM 5373 O O    . HOH H 6 .   ? 27.808  27.195  33.994 1.00 47.23  ? 940  HOH A O    1 
HETATM 5374 O O    . HOH H 6 .   ? 1.262   -2.639  24.594 1.00 24.10  ? 941  HOH A O    1 
HETATM 5375 O O    . HOH H 6 .   ? -3.495  8.551   8.927  1.00 51.87  ? 942  HOH A O    1 
HETATM 5376 O O    . HOH H 6 .   ? 36.625  -7.059  7.225  1.00 50.38  ? 943  HOH A O    1 
HETATM 5377 O O    . HOH H 6 .   ? 45.628  -4.024  10.321 1.00 59.21  ? 944  HOH A O    1 
HETATM 5378 O O    . HOH H 6 .   ? 20.859  33.338  24.921 1.00 64.45  ? 945  HOH A O    1 
HETATM 5379 O O    . HOH H 6 .   ? 42.283  12.617  -0.259 1.00 57.82  ? 946  HOH A O    1 
HETATM 5380 O O    . HOH H 6 .   ? 36.241  27.501  25.105 1.00 56.38  ? 947  HOH A O    1 
HETATM 5381 O O    . HOH H 6 .   ? 2.853   -1.753  9.743  1.00 49.89  ? 948  HOH A O    1 
HETATM 5382 O O    . HOH H 6 .   ? 32.272  28.982  22.692 1.00 51.32  ? 949  HOH A O    1 
HETATM 5383 O O    . HOH H 6 .   ? 1.776   15.590  35.010 1.00 61.46  ? 950  HOH A O    1 
HETATM 5384 O O    . HOH H 6 .   ? 20.980  36.969  11.566 1.00 60.52  ? 951  HOH A O    1 
HETATM 5385 O O    . HOH H 6 .   ? 5.909   20.637  31.850 1.00 58.43  ? 952  HOH A O    1 
HETATM 5386 O O    . HOH H 6 .   ? 36.024  25.158  27.181 1.00 54.86  ? 953  HOH A O    1 
HETATM 5387 O O    . HOH H 6 .   ? 33.509  14.906  -3.426 1.00 69.28  ? 954  HOH A O    1 
HETATM 5388 O O    . HOH H 6 .   ? -0.914  6.658   8.827  1.00 45.46  ? 955  HOH A O    1 
HETATM 5389 O O    . HOH H 6 .   ? 21.825  17.531  -6.447 1.00 48.90  ? 956  HOH A O    1 
HETATM 5390 O O    . HOH H 6 .   ? 6.960   1.927   6.447  1.00 49.19  ? 957  HOH A O    1 
HETATM 5391 O O    . HOH H 6 .   ? 9.561   -4.550  18.436 1.00 54.76  ? 958  HOH A O    1 
HETATM 5392 O O    . HOH H 6 .   ? 39.551  -6.569  24.750 1.00 52.04  ? 959  HOH A O    1 
HETATM 5393 O O    . HOH H 6 .   ? 25.595  29.020  -5.289 1.00 59.52  ? 960  HOH A O    1 
HETATM 5394 O O    . HOH H 6 .   ? 32.847  -9.024  18.629 1.00 81.11  ? 961  HOH A O    1 
HETATM 5395 O O    . HOH H 6 .   ? 32.750  0.764   27.317 1.00 53.96  ? 962  HOH A O    1 
HETATM 5396 O O    A HOH H 6 .   ? -8.195  0.235   16.152 0.57 63.76  ? 963  HOH A O    1 
HETATM 5397 O O    B HOH H 6 .   ? -4.419  0.010   10.670 0.43 28.36  ? 963  HOH A O    1 
HETATM 5398 O O    . HOH H 6 .   ? 1.270   25.400  33.671 1.00 48.97  ? 964  HOH A O    1 
HETATM 5399 O O    . HOH H 6 .   ? 4.533   28.059  5.817  1.00 57.41  ? 965  HOH A O    1 
HETATM 5400 O O    . HOH H 6 .   ? 34.309  14.243  29.637 0.50 61.22  ? 966  HOH A O    1 
HETATM 5401 O O    . HOH H 6 .   ? 25.121  29.735  31.149 1.00 49.76  ? 967  HOH A O    1 
HETATM 5402 O O    . HOH H 6 .   ? -3.526  -1.201  19.032 1.00 54.19  ? 968  HOH A O    1 
HETATM 5403 O O    . HOH H 6 .   ? 42.278  8.949   -4.810 1.00 52.36  ? 969  HOH A O    1 
HETATM 5404 O O    . HOH H 6 .   ? 17.650  37.097  3.645  1.00 58.58  ? 970  HOH A O    1 
HETATM 5405 O O    . HOH H 6 .   ? 20.497  -0.614  14.349 1.00 69.07  ? 971  HOH A O    1 
HETATM 5406 O O    . HOH H 6 .   ? 12.271  1.802   20.433 1.00 62.24  ? 972  HOH A O    1 
HETATM 5407 O O    . HOH H 6 .   ? 23.954  22.105  -6.023 1.00 47.51  ? 973  HOH A O    1 
HETATM 5408 O O    . HOH H 6 .   ? 18.561  -0.713  9.637  1.00 52.55  ? 974  HOH A O    1 
HETATM 5409 O O    . HOH H 6 .   ? 4.595   -6.411  21.015 1.00 47.62  ? 975  HOH A O    1 
HETATM 5410 O O    . HOH H 6 .   ? 27.009  35.244  9.641  1.00 47.72  ? 976  HOH A O    1 
HETATM 5411 O O    . HOH H 6 .   ? -11.264 2.613   19.429 1.00 50.82  ? 977  HOH A O    1 
HETATM 5412 O O    . HOH H 6 .   ? 10.707  -1.651  12.321 1.00 59.61  ? 978  HOH A O    1 
HETATM 5413 O O    . HOH H 6 .   ? -0.052  -2.008  22.277 1.00 48.99  ? 979  HOH A O    1 
HETATM 5414 O O    . HOH H 6 .   ? 32.198  33.882  17.809 1.00 54.32  ? 980  HOH A O    1 
HETATM 5415 O O    . HOH H 6 .   ? 13.647  -1.978  21.720 1.00 65.78  ? 981  HOH A O    1 
HETATM 5416 O O    . HOH H 6 .   ? 22.767  35.506  20.738 1.00 72.11  ? 982  HOH A O    1 
HETATM 5417 O O    . HOH H 6 .   ? 17.988  -2.148  7.243  1.00 53.01  ? 983  HOH A O    1 
HETATM 5418 O O    . HOH H 6 .   ? 31.740  -8.825  21.283 1.00 59.71  ? 984  HOH A O    1 
HETATM 5419 O O    . HOH H 6 .   ? 40.914  26.649  3.341  1.00 54.09  ? 985  HOH A O    1 
HETATM 5420 O O    . HOH H 6 .   ? 0.763   20.278  7.960  1.00 58.72  ? 986  HOH A O    1 
HETATM 5421 O O    . HOH H 6 .   ? 11.649  -3.846  17.521 1.00 55.90  ? 987  HOH A O    1 
HETATM 5422 O O    A HOH H 6 .   ? 53.388  11.385  20.504 0.54 15.65  ? 988  HOH A O    1 
HETATM 5423 O O    . HOH H 6 .   ? 14.984  20.361  -0.060 1.00 45.78  ? 989  HOH A O    1 
HETATM 5424 O O    . HOH H 6 .   ? 34.992  16.848  28.529 0.50 34.63  ? 990  HOH A O    1 
HETATM 5425 O O    . HOH H 6 .   ? 51.696  7.962   14.166 1.00 26.08  ? 991  HOH A O    1 
HETATM 5426 O O    . HOH H 6 .   ? 50.736  5.911   19.638 1.00 43.49  ? 992  HOH A O    1 
HETATM 5427 O O    . HOH H 6 .   ? 50.250  17.872  24.508 1.00 39.75  ? 993  HOH A O    1 
HETATM 5428 O O    . HOH H 6 .   ? 39.707  29.280  0.941  1.00 76.14  ? 994  HOH A O    1 
HETATM 5429 O O    . HOH H 6 .   ? 18.315  1.016   23.263 1.00 51.06  ? 995  HOH A O    1 
HETATM 5430 O O    . HOH H 6 .   ? 37.959  23.123  25.035 1.00 69.96  ? 996  HOH A O    1 
HETATM 5431 O O    . HOH H 6 .   ? 30.268  25.543  30.450 1.00 79.36  ? 997  HOH A O    1 
HETATM 5432 O O    . HOH H 6 .   ? 42.527  26.464  6.032  1.00 44.97  ? 998  HOH A O    1 
HETATM 5433 O O    . HOH H 6 .   ? 0.732   28.175  26.927 1.00 58.60  ? 999  HOH A O    1 
HETATM 5434 O O    . HOH H 6 .   ? 38.496  22.963  -1.683 1.00 62.57  ? 1000 HOH A O    1 
HETATM 5435 O O    . HOH H 6 .   ? 49.786  11.279  5.520  1.00 51.30  ? 1001 HOH A O    1 
HETATM 5436 O O    . HOH H 6 .   ? 21.254  1.437   5.877  1.00 62.40  ? 1002 HOH A O    1 
HETATM 5437 O O    . HOH H 6 .   ? 8.368   27.018  32.513 1.00 70.18  ? 1003 HOH A O    1 
HETATM 5438 O O    . HOH H 6 .   ? 9.600   36.839  10.611 1.00 66.64  ? 1004 HOH A O    1 
HETATM 5439 O O    . HOH H 6 .   ? 45.092  1.964   3.845  1.00 67.57  ? 1005 HOH A O    1 
HETATM 5440 O O    . HOH H 6 .   ? 44.037  11.228  -0.815 1.00 70.23  ? 1006 HOH A O    1 
HETATM 5441 O O    . HOH H 6 .   ? 11.968  -0.480  6.539  1.00 68.67  ? 1007 HOH A O    1 
HETATM 5442 O O    . HOH H 6 .   ? 5.699   25.002  -0.152 1.00 77.11  ? 1008 HOH A O    1 
HETATM 5443 O O    . HOH H 6 .   ? 19.131  9.341   30.222 1.00 63.62  ? 1009 HOH A O    1 
HETATM 5444 O O    . HOH H 6 .   ? 24.774  27.585  -3.693 1.00 64.19  ? 1010 HOH A O    1 
HETATM 5445 O O    . HOH H 6 .   ? 42.173  -7.846  9.524  1.00 66.76  ? 1011 HOH A O    1 
HETATM 5446 O O    . HOH H 6 .   ? 41.914  21.645  21.556 1.00 60.45  ? 1012 HOH A O    1 
HETATM 5447 O O    . HOH H 6 .   ? 11.060  36.755  3.717  1.00 89.80  ? 1013 HOH A O    1 
HETATM 5448 O O    . HOH H 6 .   ? 27.825  32.416  27.683 1.00 66.12  ? 1014 HOH A O    1 
HETATM 5449 O O    . HOH H 6 .   ? 35.176  -7.654  22.118 1.00 70.33  ? 1015 HOH A O    1 
HETATM 5450 O O    . HOH H 6 .   ? 20.081  -3.095  7.249  1.00 62.41  ? 1016 HOH A O    1 
HETATM 5451 O O    . HOH H 6 .   ? -8.099  9.439   22.592 1.00 58.62  ? 1017 HOH A O    1 
HETATM 5452 O O    . HOH H 6 .   ? 9.386   15.115  40.098 1.00 61.30  ? 1018 HOH A O    1 
HETATM 5453 O O    . HOH H 6 .   ? 27.591  -3.046  26.446 1.00 32.68  ? 1019 HOH A O    1 
HETATM 5454 O O    . HOH H 6 .   ? 21.215  -7.224  16.081 1.00 66.98  ? 1020 HOH A O    1 
HETATM 5455 O O    . HOH H 6 .   ? 15.138  -2.044  10.056 1.00 73.47  ? 1021 HOH A O    1 
HETATM 5456 O O    . HOH H 6 .   ? 35.807  -9.969  19.404 1.00 71.95  ? 1022 HOH A O    1 
HETATM 5457 O O    . HOH H 6 .   ? 7.076   -4.777  10.901 1.00 67.71  ? 1023 HOH A O    1 
HETATM 5458 O O    . HOH H 6 .   ? 7.129   38.089  0.002  1.00 105.64 ? 1024 HOH A O    1 
HETATM 5459 O O    . HOH H 6 .   ? 40.075  32.133  4.403  1.00 92.77  ? 1025 HOH A O    1 
HETATM 5460 O O    . HOH H 6 .   ? 12.882  -0.019  18.547 1.00 74.41  ? 1026 HOH A O    1 
HETATM 5461 O O    . HOH H 6 .   ? 51.742  8.898   5.179  1.00 53.43  ? 1027 HOH A O    1 
HETATM 5462 O O    . HOH H 6 .   ? 44.033  16.236  1.965  1.00 65.20  ? 1028 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N    A ALA A 1   ? 0.1031 0.2118 0.1764 -0.0123 -0.0102 0.0531  1    ALA A N    
2    N N    B ALA A 1   ? 0.2384 0.4260 0.2382 0.1362  0.0604  0.1326  1    ALA A N    
3    C CA   A ALA A 1   ? 0.1259 0.1732 0.1609 -0.0214 -0.0336 0.0498  1    ALA A CA   
4    C CA   B ALA A 1   ? 0.1620 0.2045 0.2344 0.0161  0.0176  0.0436  1    ALA A CA   
5    C C    A ALA A 1   ? 0.1444 0.1555 0.1519 0.0118  -0.0209 0.0403  1    ALA A C    
6    C C    B ALA A 1   ? 0.2309 0.2100 0.2017 0.0298  -0.0089 0.0472  1    ALA A C    
7    O O    A ALA A 1   ? 0.2285 0.1820 0.1601 -0.0313 -0.0403 0.0314  1    ALA A O    
8    O O    B ALA A 1   ? 0.2876 0.2624 0.2174 0.0484  -0.0516 0.0522  1    ALA A O    
9    C CB   A ALA A 1   ? 0.1981 0.1830 0.1935 -0.0723 0.0506  -0.0273 1    ALA A CB   
10   C CB   B ALA A 1   ? 0.3534 0.4845 0.1767 -0.2168 0.0793  -0.0459 1    ALA A CB   
11   H H1   A ALA A 1   ? 0.2457 0.2457 0.2457 0.0000  0.0000  0.0000  1    ALA A H1   
12   H H1   B ALA A 1   ? 0.4513 0.4513 0.4513 0.0000  0.0000  0.0000  1    ALA A H1   
13   H H2   A ALA A 1   ? 0.2457 0.2457 0.2457 0.0000  0.0000  0.0000  1    ALA A H2   
14   H H2   B ALA A 1   ? 0.4513 0.4513 0.4513 0.0000  0.0000  0.0000  1    ALA A H2   
15   H H3   A ALA A 1   ? 0.2457 0.2457 0.2457 0.0000  0.0000  0.0000  1    ALA A H3   
16   H H3   B ALA A 1   ? 0.4513 0.4513 0.4513 0.0000  0.0000  0.0000  1    ALA A H3   
17   H HA   A ALA A 1   ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  1    ALA A HA   
18   H HA   B ALA A 1   ? 0.2404 0.2404 0.2404 0.0000  0.0000  0.0000  1    ALA A HA   
19   H HB1  A ALA A 1   ? 0.2872 0.2872 0.2872 0.0000  0.0000  0.0000  1    ALA A HB1  
20   H HB1  B ALA A 1   ? 0.5072 0.5072 0.5072 0.0000  0.0000  0.0000  1    ALA A HB1  
21   H HB2  A ALA A 1   ? 0.2872 0.2872 0.2872 0.0000  0.0000  0.0000  1    ALA A HB2  
22   H HB2  B ALA A 1   ? 0.5072 0.5072 0.5072 0.0000  0.0000  0.0000  1    ALA A HB2  
23   H HB3  A ALA A 1   ? 0.2872 0.2872 0.2872 0.0000  0.0000  0.0000  1    ALA A HB3  
24   H HB3  B ALA A 1   ? 0.5072 0.5072 0.5072 0.0000  0.0000  0.0000  1    ALA A HB3  
25   N N    A ALA A 2   ? 0.1275 0.1556 0.1528 -0.0148 -0.0036 0.0193  2    ALA A N    
26   N N    B ALA A 2   ? 0.1451 0.1735 0.1816 -0.0125 -0.0126 0.0234  2    ALA A N    
27   C CA   A ALA A 2   ? 0.1412 0.1668 0.1615 -0.0274 0.0057  0.0129  2    ALA A CA   
28   C CA   B ALA A 2   ? 0.1617 0.1845 0.1612 -0.0411 0.0010  0.0150  2    ALA A CA   
29   C C    A ALA A 2   ? 0.1319 0.1716 0.1312 -0.0192 -0.0019 0.0250  2    ALA A C    
30   C C    B ALA A 2   ? 0.1500 0.2062 0.1327 -0.0419 -0.0176 0.0030  2    ALA A C    
31   O O    A ALA A 2   ? 0.1511 0.1768 0.1330 -0.0213 0.0008  0.0216  2    ALA A O    
32   O O    B ALA A 2   ? 0.1564 0.2041 0.1727 -0.0526 0.0025  -0.0153 2    ALA A O    
33   C CB   A ALA A 2   ? 0.1248 0.1535 0.2595 0.0070  0.0089  0.0259  2    ALA A CB   
34   C CB   B ALA A 2   ? 0.1557 0.1775 0.2014 -0.0109 0.0265  0.0066  2    ALA A CB   
35   H H    A ALA A 2   ? 0.1744 0.1744 0.1744 0.0000  0.0000  0.0000  2    ALA A H    
36   H H    B ALA A 2   ? 0.2001 0.2001 0.2001 0.0000  0.0000  0.0000  2    ALA A H    
37   H HA   A ALA A 2   ? 0.1878 0.1878 0.1878 0.0000  0.0000  0.0000  2    ALA A HA   
38   H HA   B ALA A 2   ? 0.2030 0.2030 0.2030 0.0000  0.0000  0.0000  2    ALA A HA   
39   H HB1  A ALA A 2   ? 0.2689 0.2689 0.2689 0.0000  0.0000  0.0000  2    ALA A HB1  
40   H HB1  B ALA A 2   ? 0.2674 0.2674 0.2674 0.0000  0.0000  0.0000  2    ALA A HB1  
41   H HB2  A ALA A 2   ? 0.2689 0.2689 0.2689 0.0000  0.0000  0.0000  2    ALA A HB2  
42   H HB2  B ALA A 2   ? 0.2674 0.2674 0.2674 0.0000  0.0000  0.0000  2    ALA A HB2  
43   H HB3  A ALA A 2   ? 0.2689 0.2689 0.2689 0.0000  0.0000  0.0000  2    ALA A HB3  
44   H HB3  B ALA A 2   ? 0.2674 0.2674 0.2674 0.0000  0.0000  0.0000  2    ALA A HB3  
45   N N    . SER A 3   ? 0.1355 0.1857 0.1329 -0.0308 0.0072  0.0155  3    SER A N    
46   C CA   . SER A 3   ? 0.1323 0.1474 0.1313 -0.0188 0.0015  0.0230  3    SER A CA   
47   C C    . SER A 3   ? 0.1285 0.1526 0.1186 -0.0065 -0.0005 0.0242  3    SER A C    
48   O O    . SER A 3   ? 0.1481 0.1564 0.1452 -0.0051 0.0194  0.0224  3    SER A O    
49   C CB   . SER A 3   ? 0.1423 0.1536 0.1353 -0.0127 0.0064  0.0256  3    SER A CB   
50   O OG   . SER A 3   ? 0.1789 0.1476 0.1414 -0.0064 -0.0076 0.0310  3    SER A OG   
51   H H    . SER A 3   ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  3    SER A H    
52   H HA   . SER A 3   ? 0.1644 0.1644 0.1644 0.0000  0.0000  0.0000  3    SER A HA   
53   H HB2  . SER A 3   ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  3    SER A HB2  
54   H HB3  . SER A 3   ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  3    SER A HB3  
55   N N    . GLY A 4   ? 0.1386 0.1314 0.1285 -0.0057 0.0053  0.0115  4    GLY A N    
56   C CA   . GLY A 4   ? 0.1390 0.1391 0.1356 -0.0058 0.0065  -0.0028 4    GLY A CA   
57   C C    . GLY A 4   ? 0.1351 0.1365 0.1184 -0.0032 0.0035  0.0038  4    GLY A C    
58   O O    . GLY A 4   ? 0.1383 0.1681 0.1282 -0.0204 0.0147  -0.0084 4    GLY A O    
59   H H    . GLY A 4   ? 0.1595 0.1595 0.1595 0.0000  0.0000  0.0000  4    GLY A H    
60   H HA2  . GLY A 4   ? 0.1655 0.1655 0.1655 0.0000  0.0000  0.0000  4    GLY A HA2  
61   H HA3  . GLY A 4   ? 0.1655 0.1655 0.1655 0.0000  0.0000  0.0000  4    GLY A HA3  
62   N N    . VAL A 5   ? 0.1328 0.1654 0.1260 -0.0099 0.0207  -0.0040 5    VAL A N    
63   C CA   . VAL A 5   ? 0.1313 0.1521 0.1406 -0.0105 0.0194  -0.0091 5    VAL A CA   
64   C C    . VAL A 5   ? 0.1154 0.1620 0.1461 -0.0092 0.0138  -0.0132 5    VAL A C    
65   O O    . VAL A 5   ? 0.1490 0.1723 0.1498 0.0046  0.0182  -0.0237 5    VAL A O    
66   C CB   . VAL A 5   ? 0.1353 0.1728 0.1431 -0.0054 0.0068  -0.0132 5    VAL A CB   
67   C CG1  . VAL A 5   ? 0.1424 0.1823 0.2029 -0.0090 -0.0077 -0.0019 5    VAL A CG1  
68   C CG2  . VAL A 5   ? 0.1605 0.1830 0.1657 0.0072  0.0006  0.0028  5    VAL A CG2  
69   H H    . VAL A 5   ? 0.1697 0.1697 0.1697 0.0000  0.0000  0.0000  5    VAL A H    
70   H HA   . VAL A 5   ? 0.1696 0.1696 0.1696 0.0000  0.0000  0.0000  5    VAL A HA   
71   H HB   . VAL A 5   ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  5    VAL A HB   
72   H HG11 . VAL A 5   ? 0.2638 0.2638 0.2638 0.0000  0.0000  0.0000  5    VAL A HG11 
73   H HG12 . VAL A 5   ? 0.2638 0.2638 0.2638 0.0000  0.0000  0.0000  5    VAL A HG12 
74   H HG13 . VAL A 5   ? 0.2638 0.2638 0.2638 0.0000  0.0000  0.0000  5    VAL A HG13 
75   H HG21 . VAL A 5   ? 0.2546 0.2546 0.2546 0.0000  0.0000  0.0000  5    VAL A HG21 
76   H HG22 . VAL A 5   ? 0.2546 0.2546 0.2546 0.0000  0.0000  0.0000  5    VAL A HG22 
77   H HG23 . VAL A 5   ? 0.2546 0.2546 0.2546 0.0000  0.0000  0.0000  5    VAL A HG23 
78   N N    . ALA A 6   ? 0.1254 0.1441 0.1511 -0.0030 0.0168  -0.0101 6    ALA A N    
79   C CA   . ALA A 6   ? 0.1390 0.1373 0.1749 -0.0026 0.0064  -0.0138 6    ALA A CA   
80   C C    . ALA A 6   ? 0.1381 0.1416 0.1628 -0.0035 0.0207  -0.0062 6    ALA A C    
81   O O    . ALA A 6   ? 0.1449 0.1868 0.2557 -0.0270 0.0476  -0.0804 6    ALA A O    
82   C CB   . ALA A 6   ? 0.1638 0.1696 0.2012 0.0051  -0.0106 0.0148  6    ALA A CB   
83   H H    . ALA A 6   ? 0.1682 0.1682 0.1682 0.0000  0.0000  0.0000  6    ALA A H    
84   H HA   . ALA A 6   ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  6    ALA A HA   
85   H HB1  . ALA A 6   ? 0.2672 0.2672 0.2672 0.0000  0.0000  0.0000  6    ALA A HB1  
86   H HB2  . ALA A 6   ? 0.2672 0.2672 0.2672 0.0000  0.0000  0.0000  6    ALA A HB2  
87   H HB3  . ALA A 6   ? 0.2672 0.2672 0.2672 0.0000  0.0000  0.0000  6    ALA A HB3  
88   N N    . THR A 7   ? 0.1296 0.1424 0.1375 0.0059  0.0092  -0.0018 7    THR A N    
89   C CA   . THR A 7   ? 0.1369 0.1432 0.1378 0.0122  -0.0064 0.0006  7    THR A CA   
90   C C    . THR A 7   ? 0.1086 0.1624 0.1705 0.0032  -0.0127 0.0316  7    THR A C    
91   O O    . THR A 7   ? 0.1472 0.1891 0.2088 0.0346  0.0046  0.0504  7    THR A O    
92   C CB   . THR A 7   ? 0.1602 0.1721 0.1581 0.0028  -0.0125 -0.0157 7    THR A CB   
93   O OG1  . THR A 7   ? 0.2053 0.1982 0.1346 -0.0038 0.0002  -0.0002 7    THR A OG1  
94   C CG2  . THR A 7   ? 0.1988 0.2049 0.1960 -0.0358 -0.0180 -0.0339 7    THR A CG2  
95   H H    . THR A 7   ? 0.1638 0.1638 0.1638 0.0000  0.0000  0.0000  7    THR A H    
96   H HA   . THR A 7   ? 0.1672 0.1672 0.1672 0.0000  0.0000  0.0000  7    THR A HA   
97   H HB   . THR A 7   ? 0.1962 0.1962 0.1962 0.0000  0.0000  0.0000  7    THR A HB   
98   H HG21 . THR A 7   ? 0.2999 0.2999 0.2999 0.0000  0.0000  0.0000  7    THR A HG21 
99   H HG22 . THR A 7   ? 0.2999 0.2999 0.2999 0.0000  0.0000  0.0000  7    THR A HG22 
100  H HG23 . THR A 7   ? 0.2999 0.2999 0.2999 0.0000  0.0000  0.0000  7    THR A HG23 
101  N N    . ASN A 8   ? 0.1180 0.1499 0.1505 -0.0066 -0.0109 0.0197  8    ASN A N    
102  C CA   . ASN A 8   ? 0.1115 0.1610 0.1733 -0.0008 -0.0211 0.0376  8    ASN A CA   
103  C C    . ASN A 8   ? 0.1218 0.1487 0.1633 -0.0013 -0.0167 0.0337  8    ASN A C    
104  O O    . ASN A 8   ? 0.1231 0.1529 0.1783 -0.0016 -0.0298 0.0259  8    ASN A O    
105  C CB   . ASN A 8   ? 0.1084 0.1899 0.1638 -0.0101 -0.0259 0.0301  8    ASN A CB   
106  C CG   . ASN A 8   ? 0.1192 0.1856 0.1442 -0.0079 -0.0096 0.0302  8    ASN A CG   
107  O OD1  . ASN A 8   ? 0.1152 0.2233 0.1770 -0.0006 -0.0286 0.0045  8    ASN A OD1  
108  N ND2  . ASN A 8   ? 0.1467 0.1995 0.1350 -0.0011 -0.0127 0.0155  8    ASN A ND2  
109  H H    . ASN A 8   ? 0.1673 0.1673 0.1673 0.0000  0.0000  0.0000  8    ASN A H    
110  H HA   . ASN A 8   ? 0.1783 0.1783 0.1783 0.0000  0.0000  0.0000  8    ASN A HA   
111  H HB2  . ASN A 8   ? 0.1848 0.1848 0.1848 0.0000  0.0000  0.0000  8    ASN A HB2  
112  H HB3  . ASN A 8   ? 0.1848 0.1848 0.1848 0.0000  0.0000  0.0000  8    ASN A HB3  
113  H HD21 . ASN A 8   ? 0.1925 0.1925 0.1925 0.0000  0.0000  0.0000  8    ASN A HD21 
114  H HD22 . ASN A 8   ? 0.1925 0.1925 0.1925 0.0000  0.0000  0.0000  8    ASN A HD22 
115  N N    . THR A 9   ? 0.1188 0.1552 0.1665 0.0010  -0.0121 0.0269  9    THR A N    
116  C CA   . THR A 9   ? 0.1519 0.1439 0.1448 -0.0048 -0.0121 0.0086  9    THR A CA   
117  C C    . THR A 9   ? 0.1266 0.1334 0.1384 0.0004  -0.0140 0.0003  9    THR A C    
118  O O    . THR A 9   ? 0.1363 0.1521 0.1456 -0.0071 -0.0192 0.0073  9    THR A O    
119  C CB   A THR A 9   ? 0.2274 0.1720 0.1743 -0.0043 0.0452  0.0050  9    THR A CB   
120  C CB   B THR A 9   ? 0.1967 0.1792 0.1491 -0.0206 0.0325  0.0038  9    THR A CB   
121  O OG1  A THR A 9   ? 0.1930 0.1974 0.2211 -0.0062 0.0678  0.0057  9    THR A OG1  
122  O OG1  B THR A 9   ? 0.2095 0.1545 0.1652 -0.0138 0.0253  -0.0366 9    THR A OG1  
123  C CG2  A THR A 9   ? 0.2746 0.1927 0.3777 -0.0540 0.1382  -0.1172 9    THR A CG2  
124  C CG2  B THR A 9   ? 0.2345 0.2221 0.2047 0.0445  0.0078  -0.0647 9    THR A CG2  
125  H H    . THR A 9   ? 0.1762 0.1762 0.1762 0.0000  0.0000  0.0000  9    THR A H    
126  H HA   A THR A 9   ? 0.1763 0.1763 0.1763 0.0000  0.0000  0.0000  9    THR A HA   
127  H HB   A THR A 9   ? 0.2295 0.2295 0.2295 0.0000  0.0000  0.0000  9    THR A HB   
128  H HB   B THR A 9   ? 0.2100 0.2100 0.2100 0.0000  0.0000  0.0000  9    THR A HB   
129  H HG1  A THR A 9   ? 0.3057 0.3057 0.3057 0.0000  0.0000  0.0000  9    THR A HG1  
130  H HG1  B THR A 9   ? 0.2646 0.2646 0.2646 0.0000  0.0000  0.0000  9    THR A HG1  
131  H HG21 A THR A 9   ? 0.4225 0.4225 0.4225 0.0000  0.0000  0.0000  9    THR A HG21 
132  H HG21 B THR A 9   ? 0.3307 0.3307 0.3307 0.0000  0.0000  0.0000  9    THR A HG21 
133  H HG22 A THR A 9   ? 0.4225 0.4225 0.4225 0.0000  0.0000  0.0000  9    THR A HG22 
134  H HG22 B THR A 9   ? 0.3307 0.3307 0.3307 0.0000  0.0000  0.0000  9    THR A HG22 
135  H HG23 A THR A 9   ? 0.4225 0.4225 0.4225 0.0000  0.0000  0.0000  9    THR A HG23 
136  H HG23 B THR A 9   ? 0.3307 0.3307 0.3307 0.0000  0.0000  0.0000  9    THR A HG23 
137  N N    . PRO A 10  ? 0.1220 0.1326 0.1303 0.0010  -0.0195 -0.0088 10   PRO A N    
138  C CA   . PRO A 10  ? 0.1216 0.1348 0.1296 -0.0025 -0.0160 -0.0164 10   PRO A CA   
139  C C    . PRO A 10  ? 0.1301 0.1405 0.1302 0.0034  -0.0102 -0.0185 10   PRO A C    
140  O O    . PRO A 10  ? 0.1703 0.1448 0.1394 0.0131  -0.0160 -0.0156 10   PRO A O    
141  C CB   . PRO A 10  ? 0.1305 0.1387 0.1427 0.0036  -0.0121 -0.0256 10   PRO A CB   
142  C CG   . PRO A 10  ? 0.1266 0.1451 0.1659 0.0053  -0.0284 -0.0183 10   PRO A CG   
143  C CD   . PRO A 10  ? 0.1325 0.1408 0.1410 0.0114  -0.0208 -0.0126 10   PRO A CD   
144  H HA   . PRO A 10  ? 0.1544 0.1544 0.1544 0.0000  0.0000  0.0000  10   PRO A HA   
145  H HB2  . PRO A 10  ? 0.1648 0.1648 0.1648 0.0000  0.0000  0.0000  10   PRO A HB2  
146  H HB3  . PRO A 10  ? 0.1648 0.1648 0.1648 0.0000  0.0000  0.0000  10   PRO A HB3  
147  H HG2  . PRO A 10  ? 0.1750 0.1750 0.1750 0.0000  0.0000  0.0000  10   PRO A HG2  
148  H HG3  . PRO A 10  ? 0.1750 0.1750 0.1750 0.0000  0.0000  0.0000  10   PRO A HG3  
149  H HD2  . PRO A 10  ? 0.1658 0.1658 0.1658 0.0000  0.0000  0.0000  10   PRO A HD2  
150  H HD3  . PRO A 10  ? 0.1658 0.1658 0.1658 0.0000  0.0000  0.0000  10   PRO A HD3  
151  N N    . THR A 11  ? 0.1518 0.1268 0.1364 -0.0006 -0.0012 -0.0108 11   THR A N    
152  C CA   . THR A 11  ? 0.1556 0.1290 0.1539 0.0148  0.0062  -0.0205 11   THR A CA   
153  C C    . THR A 11  ? 0.1586 0.1274 0.1581 -0.0027 -0.0041 -0.0223 11   THR A C    
154  O O    . THR A 11  ? 0.1512 0.1429 0.1488 -0.0072 0.0041  -0.0148 11   THR A O    
155  C CB   . THR A 11  ? 0.1785 0.1471 0.1649 0.0372  -0.0076 -0.0111 11   THR A CB   
156  O OG1  . THR A 11  ? 0.1872 0.1509 0.1507 0.0097  0.0024  -0.0087 11   THR A OG1  
157  C CG2  . THR A 11  ? 0.1652 0.2305 0.1998 0.0398  -0.0135 -0.0147 11   THR A CG2  
158  H H    . THR A 11  ? 0.1660 0.1660 0.1660 0.0000  0.0000  0.0000  11   THR A H    
159  H HA   . THR A 11  ? 0.1754 0.1754 0.1754 0.0000  0.0000  0.0000  11   THR A HA   
160  H HB   . THR A 11  ? 0.1962 0.1962 0.1962 0.0000  0.0000  0.0000  11   THR A HB   
161  H HG1  . THR A 11  ? 0.2444 0.2444 0.2444 0.0000  0.0000  0.0000  11   THR A HG1  
162  H HG21 . THR A 11  ? 0.2978 0.2978 0.2978 0.0000  0.0000  0.0000  11   THR A HG21 
163  H HG22 . THR A 11  ? 0.2978 0.2978 0.2978 0.0000  0.0000  0.0000  11   THR A HG22 
164  H HG23 . THR A 11  ? 0.2978 0.2978 0.2978 0.0000  0.0000  0.0000  11   THR A HG23 
165  N N    . ALA A 12  ? 0.2109 0.1282 0.1673 -0.0099 -0.0125 -0.0181 12   ALA A N    
166  C CA   . ALA A 12  ? 0.2290 0.1465 0.1982 -0.0409 -0.0065 -0.0308 12   ALA A CA   
167  C C    . ALA A 12  ? 0.1917 0.1451 0.1684 -0.0453 -0.0111 -0.0104 12   ALA A C    
168  O O    . ALA A 12  ? 0.2010 0.1614 0.1704 -0.0317 -0.0164 -0.0108 12   ALA A O    
169  C CB   . ALA A 12  ? 0.2823 0.1450 0.2558 -0.0365 0.0062  -0.0325 12   ALA A CB   
170  H H    . ALA A 12  ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  12   ALA A H    
171  H HA   . ALA A 12  ? 0.2295 0.2295 0.2295 0.0000  0.0000  0.0000  12   ALA A HA   
172  H HB1  . ALA A 12  ? 0.3416 0.3416 0.3416 0.0000  0.0000  0.0000  12   ALA A HB1  
173  H HB2  . ALA A 12  ? 0.3416 0.3416 0.3416 0.0000  0.0000  0.0000  12   ALA A HB2  
174  H HB3  . ALA A 12  ? 0.3416 0.3416 0.3416 0.0000  0.0000  0.0000  12   ALA A HB3  
175  N N    . ASN A 13  ? 0.1765 0.2059 0.1616 -0.0528 -0.0105 -0.0255 13   ASN A N    
176  C CA   . ASN A 13  ? 0.1694 0.2334 0.1697 -0.0617 0.0096  -0.0283 13   ASN A CA   
177  C C    . ASN A 13  ? 0.1272 0.2227 0.1497 -0.0329 0.0023  -0.0236 13   ASN A C    
178  O O    . ASN A 13  ? 0.1390 0.2754 0.1821 -0.0365 0.0209  -0.0541 13   ASN A O    
179  C CB   . ASN A 13  ? 0.2127 0.2694 0.2007 -0.0858 0.0215  -0.0145 13   ASN A CB   
180  C CG   . ASN A 13  ? 0.4590 0.2980 0.2699 -0.1962 -0.0278 0.0288  13   ASN A CG   
181  O OD1  . ASN A 13  ? 0.6393 0.2809 0.6352 -0.1648 -0.0489 0.0431  13   ASN A OD1  
182  N ND2  . ASN A 13  ? 0.3056 0.4181 0.2945 -0.2077 0.0513  -0.1142 13   ASN A ND2  
183  H H    . ASN A 13  ? 0.2176 0.2176 0.2176 0.0000  0.0000  0.0000  13   ASN A H    
184  H HA   . ASN A 13  ? 0.2290 0.2290 0.2290 0.0000  0.0000  0.0000  13   ASN A HA   
185  H HB2  . ASN A 13  ? 0.2731 0.2731 0.2731 0.0000  0.0000  0.0000  13   ASN A HB2  
186  H HB3  . ASN A 13  ? 0.2731 0.2731 0.2731 0.0000  0.0000  0.0000  13   ASN A HB3  
187  H HD21 . ASN A 13  ? 0.4073 0.4073 0.4073 0.0000  0.0000  0.0000  13   ASN A HD21 
188  H HD22 . ASN A 13  ? 0.4073 0.4073 0.4073 0.0000  0.0000  0.0000  13   ASN A HD22 
189  N N    . ASP A 14  ? 0.1298 0.1527 0.1375 -0.0090 0.0008  -0.0166 14   ASP A N    
190  C CA   . ASP A 14  ? 0.1283 0.1395 0.1361 0.0039  -0.0059 -0.0153 14   ASP A CA   
191  C C    . ASP A 14  ? 0.1136 0.1313 0.1394 0.0007  -0.0079 -0.0160 14   ASP A C    
192  O O    . ASP A 14  ? 0.1394 0.1271 0.1382 0.0053  -0.0151 -0.0142 14   ASP A O    
193  C CB   . ASP A 14  ? 0.1412 0.1623 0.1337 0.0269  -0.0128 -0.0057 14   ASP A CB   
194  C CG   . ASP A 14  ? 0.1255 0.1477 0.1317 0.0026  -0.0025 -0.0153 14   ASP A CG   
195  O OD1  . ASP A 14  ? 0.1382 0.1700 0.1341 0.0052  -0.0075 -0.0090 14   ASP A OD1  
196  O OD2  . ASP A 14  ? 0.1410 0.1550 0.1486 0.0168  -0.0146 -0.0141 14   ASP A OD2  
197  H H    . ASP A 14  ? 0.1679 0.1679 0.1679 0.0000  0.0000  0.0000  14   ASP A H    
198  H HA   . ASP A 14  ? 0.1616 0.1616 0.1616 0.0000  0.0000  0.0000  14   ASP A HA   
199  H HB2  . ASP A 14  ? 0.1749 0.1749 0.1749 0.0000  0.0000  0.0000  14   ASP A HB2  
200  H HB3  . ASP A 14  ? 0.1749 0.1749 0.1749 0.0000  0.0000  0.0000  14   ASP A HB3  
201  N N    . GLU A 15  ? 0.1362 0.1348 0.1360 0.0053  -0.0103 -0.0139 15   GLU A N    
202  C CA   . GLU A 15  ? 0.1301 0.1294 0.1372 0.0056  -0.0096 -0.0042 15   GLU A CA   
203  C C    . GLU A 15  ? 0.1306 0.1274 0.1301 0.0093  -0.0066 -0.0034 15   GLU A C    
204  O O    . GLU A 15  ? 0.1384 0.1314 0.1307 0.0082  -0.0122 -0.0085 15   GLU A O    
205  C CB   . GLU A 15  ? 0.1607 0.1264 0.1529 -0.0021 -0.0051 0.0017  15   GLU A CB   
206  C CG   . GLU A 15  ? 0.2085 0.1510 0.1663 0.0109  -0.0195 0.0131  15   GLU A CG   
207  C CD   . GLU A 15  ? 0.3620 0.1750 0.2504 0.0647  -0.0696 0.0242  15   GLU A CD   
208  O OE1  . GLU A 15  ? 0.9334 0.1851 0.3549 0.1574  -0.1443 -0.0412 15   GLU A OE1  
209  O OE2  . GLU A 15  ? 0.4187 0.2299 0.2834 0.0517  -0.0049 0.1036  15   GLU A OE2  
210  H H    . GLU A 15  ? 0.1627 0.1627 0.1627 0.0000  0.0000  0.0000  15   GLU A H    
211  H HA   . GLU A 15  ? 0.1587 0.1587 0.1587 0.0000  0.0000  0.0000  15   GLU A HA   
212  H HB2  . GLU A 15  ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  15   GLU A HB2  
213  H HB3  . GLU A 15  ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  15   GLU A HB3  
214  H HG2  . GLU A 15  ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  15   GLU A HG2  
215  H HG3  . GLU A 15  ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  15   GLU A HG3  
216  N N    . GLU A 16  ? 0.1295 0.1287 0.1308 -0.0007 -0.0075 -0.0028 16   GLU A N    
217  C CA   . GLU A 16  ? 0.1296 0.1516 0.1338 -0.0122 -0.0155 0.0041  16   GLU A CA   
218  C C    . GLU A 16  ? 0.1200 0.1336 0.1270 -0.0007 -0.0027 -0.0131 16   GLU A C    
219  O O    . GLU A 16  ? 0.1391 0.1480 0.1392 -0.0064 -0.0114 -0.0096 16   GLU A O    
220  C CB   A GLU A 16  ? 0.1372 0.1825 0.2169 -0.0233 -0.0593 0.0478  16   GLU A CB   
221  C CB   B GLU A 16  ? 0.1262 0.1937 0.1431 -0.0125 -0.0137 0.0187  16   GLU A CB   
222  C CG   A GLU A 16  ? 0.2218 0.1870 0.2044 0.0148  -0.0454 0.0406  16   GLU A CG   
223  C CG   B GLU A 16  ? 0.1269 0.1734 0.1474 0.0011  0.0054  0.0346  16   GLU A CG   
224  C CD   A GLU A 16  ? 0.5156 0.1454 0.2500 0.0889  -0.0835 0.0005  16   GLU A CD   
225  C CD   B GLU A 16  ? 0.2642 0.2013 0.2698 0.0559  -0.0409 0.0636  16   GLU A CD   
226  O OE1  A GLU A 16  ? 0.2150 0.2358 0.2844 0.0341  -0.0971 -0.0339 16   GLU A OE1  
227  O OE1  B GLU A 16  ? 0.4163 0.4518 0.2778 0.1009  -0.0380 0.1928  16   GLU A OE1  
228  O OE2  A GLU A 16  ? 0.3222 0.4130 0.3000 0.1755  0.0496  0.1714  16   GLU A OE2  
229  O OE2  B GLU A 16  ? 0.2660 0.4870 0.3405 0.1697  -0.0629 0.1349  16   GLU A OE2  
230  H H    . GLU A 16  ? 0.1557 0.1557 0.1557 0.0000  0.0000  0.0000  16   GLU A H    
231  H HA   A GLU A 16  ? 0.1660 0.1660 0.1660 0.0000  0.0000  0.0000  16   GLU A HA   
232  H HB2  A GLU A 16  ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  16   GLU A HB2  
233  H HB2  B GLU A 16  ? 0.1852 0.1852 0.1852 0.0000  0.0000  0.0000  16   GLU A HB2  
234  H HB3  A GLU A 16  ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  16   GLU A HB3  
235  H HB3  B GLU A 16  ? 0.1852 0.1852 0.1852 0.0000  0.0000  0.0000  16   GLU A HB3  
236  H HG2  A GLU A 16  ? 0.2453 0.2453 0.2453 0.0000  0.0000  0.0000  16   GLU A HG2  
237  H HG2  B GLU A 16  ? 0.1791 0.1791 0.1791 0.0000  0.0000  0.0000  16   GLU A HG2  
238  H HG3  A GLU A 16  ? 0.2453 0.2453 0.2453 0.0000  0.0000  0.0000  16   GLU A HG3  
239  H HG3  B GLU A 16  ? 0.1791 0.1791 0.1791 0.0000  0.0000  0.0000  16   GLU A HG3  
240  N N    . TYR A 17  ? 0.1127 0.1566 0.1237 -0.0047 -0.0031 -0.0049 17   TYR A N    
241  C CA   . TYR A 17  ? 0.1128 0.1869 0.1226 0.0015  -0.0041 0.0079  17   TYR A CA   
242  C C    . TYR A 17  ? 0.1060 0.2464 0.1240 -0.0188 0.0000  0.0008  17   TYR A C    
243  O O    . TYR A 17  ? 0.1168 0.3231 0.1375 0.0092  -0.0163 -0.0261 17   TYR A O    
244  C CB   . TYR A 17  ? 0.1283 0.1715 0.1493 -0.0300 -0.0219 0.0252  17   TYR A CB   
245  C CG   . TYR A 17  ? 0.1299 0.1289 0.1287 -0.0157 -0.0127 -0.0047 17   TYR A CG   
246  C CD1  . TYR A 17  ? 0.1474 0.1219 0.1225 0.0084  -0.0189 -0.0076 17   TYR A CD1  
247  C CD2  . TYR A 17  ? 0.1285 0.1372 0.1359 -0.0134 -0.0108 0.0104  17   TYR A CD2  
248  C CE1  . TYR A 17  ? 0.1403 0.1374 0.1258 0.0152  -0.0017 -0.0129 17   TYR A CE1  
249  C CE2  . TYR A 17  ? 0.1306 0.1183 0.1251 0.0006  -0.0148 -0.0088 17   TYR A CE2  
250  C CZ   . TYR A 17  ? 0.1327 0.1250 0.1238 0.0023  -0.0104 -0.0124 17   TYR A CZ   
251  O OH   . TYR A 17  ? 0.1350 0.1736 0.1366 0.0291  -0.0081 0.0017  17   TYR A OH   
252  H H    . TYR A 17  ? 0.1572 0.1572 0.1572 0.0000  0.0000  0.0000  17   TYR A H    
253  H HA   . TYR A 17  ? 0.1690 0.1690 0.1690 0.0000  0.0000  0.0000  17   TYR A HA   
254  H HB2  . TYR A 17  ? 0.1796 0.1796 0.1796 0.0000  0.0000  0.0000  17   TYR A HB2  
255  H HB3  . TYR A 17  ? 0.1796 0.1796 0.1796 0.0000  0.0000  0.0000  17   TYR A HB3  
256  H HD1  . TYR A 17  ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  17   TYR A HD1  
257  H HD2  . TYR A 17  ? 0.1606 0.1606 0.1606 0.0000  0.0000  0.0000  17   TYR A HD2  
258  H HE1  . TYR A 17  ? 0.1614 0.1614 0.1614 0.0000  0.0000  0.0000  17   TYR A HE1  
259  H HE2  . TYR A 17  ? 0.1496 0.1496 0.1496 0.0000  0.0000  0.0000  17   TYR A HE2  
260  H HH   . TYR A 17  ? 0.2227 0.2227 0.2227 0.0000  0.0000  0.0000  17   TYR A HH   
261  N N    . ILE A 18  ? 0.1038 0.2061 0.1262 -0.0054 -0.0062 0.0066  18   ILE A N    
262  C CA   . ILE A 18  ? 0.1154 0.1884 0.1398 0.0026  -0.0011 0.0154  18   ILE A CA   
263  C C    . ILE A 18  ? 0.1048 0.1592 0.1285 0.0188  -0.0005 0.0037  18   ILE A C    
264  O O    . ILE A 18  ? 0.1052 0.1879 0.1389 0.0107  -0.0108 0.0133  18   ILE A O    
265  C CB   . ILE A 18  ? 0.2070 0.1769 0.2670 0.0186  0.0580  0.0273  18   ILE A CB   
266  C CG1  . ILE A 18  ? 0.3227 0.1942 0.2816 -0.0015 0.0450  0.0445  18   ILE A CG1  
267  C CG2  . ILE A 18  ? 0.1660 0.2143 0.3621 0.0229  -0.0067 -0.0333 18   ILE A CG2  
268  C CD1  . ILE A 18  ? 0.3032 0.3471 0.3676 -0.0193 -0.0462 0.1664  18   ILE A CD1  
269  H H    . ILE A 18  ? 0.1744 0.1744 0.1744 0.0000  0.0000  0.0000  18   ILE A H    
270  H HA   . ILE A 18  ? 0.1774 0.1774 0.1774 0.0000  0.0000  0.0000  18   ILE A HA   
271  H HB   . ILE A 18  ? 0.2604 0.2604 0.2604 0.0000  0.0000  0.0000  18   ILE A HB   
272  H HG12 . ILE A 18  ? 0.3194 0.3194 0.3194 0.0000  0.0000  0.0000  18   ILE A HG12 
273  H HG13 . ILE A 18  ? 0.3194 0.3194 0.3194 0.0000  0.0000  0.0000  18   ILE A HG13 
274  H HG21 . ILE A 18  ? 0.3712 0.3712 0.3712 0.0000  0.0000  0.0000  18   ILE A HG21 
275  H HG22 . ILE A 18  ? 0.3712 0.3712 0.3712 0.0000  0.0000  0.0000  18   ILE A HG22 
276  H HG23 . ILE A 18  ? 0.3712 0.3712 0.3712 0.0000  0.0000  0.0000  18   ILE A HG23 
277  H HD11 . ILE A 18  ? 0.5089 0.5089 0.5089 0.0000  0.0000  0.0000  18   ILE A HD11 
278  H HD12 . ILE A 18  ? 0.5089 0.5089 0.5089 0.0000  0.0000  0.0000  18   ILE A HD12 
279  H HD13 . ILE A 18  ? 0.5089 0.5089 0.5089 0.0000  0.0000  0.0000  18   ILE A HD13 
280  N N    . THR A 19  ? 0.1075 0.1606 0.1172 0.0158  -0.0089 0.0080  19   THR A N    
281  C CA   . THR A 19  ? 0.1133 0.1532 0.1169 0.0092  -0.0157 0.0170  19   THR A CA   
282  C C    . THR A 19  ? 0.1123 0.1387 0.1187 0.0045  -0.0086 0.0036  19   THR A C    
283  O O    . THR A 19  ? 0.1168 0.1438 0.1300 0.0120  -0.0133 0.0087  19   THR A O    
284  C CB   . THR A 19  ? 0.1445 0.1573 0.1297 0.0240  -0.0144 -0.0046 19   THR A CB   
285  O OG1  . THR A 19  ? 0.1522 0.1792 0.1605 0.0399  -0.0285 -0.0235 19   THR A OG1  
286  C CG2  . THR A 19  ? 0.2247 0.1530 0.1427 -0.0040 -0.0166 0.0134  19   THR A CG2  
287  H H    . THR A 19  ? 0.1541 0.1541 0.1541 0.0000  0.0000  0.0000  19   THR A H    
288  H HA   . THR A 19  ? 0.1534 0.1534 0.1534 0.0000  0.0000  0.0000  19   THR A HA   
289  H HB   . THR A 19  ? 0.1726 0.1726 0.1726 0.0000  0.0000  0.0000  19   THR A HB   
290  H HG1  . THR A 19  ? 0.2460 0.2460 0.2460 0.0000  0.0000  0.0000  19   THR A HG1  
291  H HG21 . THR A 19  ? 0.2601 0.2601 0.2601 0.0000  0.0000  0.0000  19   THR A HG21 
292  H HG22 . THR A 19  ? 0.2601 0.2601 0.2601 0.0000  0.0000  0.0000  19   THR A HG22 
293  H HG23 . THR A 19  ? 0.2601 0.2601 0.2601 0.0000  0.0000  0.0000  19   THR A HG23 
294  N N    . PRO A 20  ? 0.1005 0.1482 0.1253 0.0036  -0.0082 0.0061  20   PRO A N    
295  C CA   . PRO A 20  ? 0.1024 0.1459 0.1276 0.0026  -0.0021 0.0008  20   PRO A CA   
296  C C    . PRO A 20  ? 0.1020 0.1417 0.1290 0.0059  -0.0020 0.0011  20   PRO A C    
297  O O    . PRO A 20  ? 0.1272 0.1335 0.1617 0.0041  -0.0137 0.0194  20   PRO A O    
298  C CB   . PRO A 20  ? 0.1350 0.1756 0.1310 0.0125  -0.0044 -0.0172 20   PRO A CB   
299  C CG   . PRO A 20  ? 0.1205 0.1871 0.1260 0.0092  -0.0018 -0.0016 20   PRO A CG   
300  C CD   . PRO A 20  ? 0.1205 0.1886 0.1180 0.0051  -0.0107 -0.0012 20   PRO A CD   
301  H HA   . PRO A 20  ? 0.1503 0.1503 0.1503 0.0000  0.0000  0.0000  20   PRO A HA   
302  H HB2  . PRO A 20  ? 0.1767 0.1767 0.1767 0.0000  0.0000  0.0000  20   PRO A HB2  
303  H HB3  . PRO A 20  ? 0.1767 0.1767 0.1767 0.0000  0.0000  0.0000  20   PRO A HB3  
304  H HG2  . PRO A 20  ? 0.1734 0.1734 0.1734 0.0000  0.0000  0.0000  20   PRO A HG2  
305  H HG3  . PRO A 20  ? 0.1734 0.1734 0.1734 0.0000  0.0000  0.0000  20   PRO A HG3  
306  H HD2  . PRO A 20  ? 0.1709 0.1709 0.1709 0.0000  0.0000  0.0000  20   PRO A HD2  
307  H HD3  . PRO A 20  ? 0.1709 0.1709 0.1709 0.0000  0.0000  0.0000  20   PRO A HD3  
308  N N    . VAL A 21  ? 0.0968 0.1187 0.1340 0.0071  -0.0003 -0.0028 21   VAL A N    
309  C CA   . VAL A 21  ? 0.1038 0.1258 0.1386 0.0054  0.0043  -0.0113 21   VAL A CA   
310  C C    . VAL A 21  ? 0.1020 0.1265 0.1341 0.0014  -0.0013 -0.0149 21   VAL A C    
311  O O    . VAL A 21  ? 0.1197 0.1182 0.1443 0.0038  0.0039  -0.0175 21   VAL A O    
312  C CB   . VAL A 21  ? 0.1124 0.1348 0.1387 0.0043  0.0026  -0.0238 21   VAL A CB   
313  C CG1  . VAL A 21  ? 0.1223 0.1528 0.1572 0.0124  -0.0134 -0.0374 21   VAL A CG1  
314  C CG2  . VAL A 21  ? 0.1249 0.1495 0.1445 0.0112  0.0059  -0.0321 21   VAL A CG2  
315  H H    . VAL A 21  ? 0.1398 0.1398 0.1398 0.0000  0.0000  0.0000  21   VAL A H    
316  H HA   . VAL A 21  ? 0.1473 0.1473 0.1473 0.0000  0.0000  0.0000  21   VAL A HA   
317  H HB   . VAL A 21  ? 0.1544 0.1544 0.1544 0.0000  0.0000  0.0000  21   VAL A HB   
318  H HG11 . VAL A 21  ? 0.2162 0.2162 0.2162 0.0000  0.0000  0.0000  21   VAL A HG11 
319  H HG12 . VAL A 21  ? 0.2162 0.2162 0.2162 0.0000  0.0000  0.0000  21   VAL A HG12 
320  H HG13 . VAL A 21  ? 0.2162 0.2162 0.2162 0.0000  0.0000  0.0000  21   VAL A HG13 
321  H HG21 . VAL A 21  ? 0.2095 0.2095 0.2095 0.0000  0.0000  0.0000  21   VAL A HG21 
322  H HG22 . VAL A 21  ? 0.2095 0.2095 0.2095 0.0000  0.0000  0.0000  21   VAL A HG22 
323  H HG23 . VAL A 21  ? 0.2095 0.2095 0.2095 0.0000  0.0000  0.0000  21   VAL A HG23 
324  N N    . THR A 22  ? 0.0995 0.1288 0.1386 0.0012  -0.0013 -0.0098 22   THR A N    
325  C CA   . THR A 22  ? 0.0935 0.1318 0.1353 -0.0016 0.0048  -0.0161 22   THR A CA   
326  C C    . THR A 22  ? 0.1024 0.1373 0.1446 0.0065  -0.0068 -0.0262 22   THR A C    
327  O O    . THR A 22  ? 0.1358 0.1286 0.1800 0.0072  -0.0328 -0.0274 22   THR A O    
328  C CB   . THR A 22  ? 0.1309 0.1527 0.1324 0.0118  0.0068  -0.0119 22   THR A CB   
329  O OG1  . THR A 22  ? 0.1532 0.1665 0.1399 -0.0007 -0.0202 -0.0227 22   THR A OG1  
330  C CG2  . THR A 22  ? 0.1378 0.1955 0.1654 0.0093  0.0290  -0.0313 22   THR A CG2  
331  H H    . THR A 22  ? 0.1468 0.1468 0.1468 0.0000  0.0000  0.0000  22   THR A H    
332  H HA   . THR A 22  ? 0.1443 0.1443 0.1443 0.0000  0.0000  0.0000  22   THR A HA   
333  H HB   . THR A 22  ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  22   THR A HB   
334  H HG1  . THR A 22  ? 0.2297 0.2297 0.2297 0.0000  0.0000  0.0000  22   THR A HG1  
335  H HG21 . THR A 22  ? 0.2494 0.2494 0.2494 0.0000  0.0000  0.0000  22   THR A HG21 
336  H HG22 . THR A 22  ? 0.2494 0.2494 0.2494 0.0000  0.0000  0.0000  22   THR A HG22 
337  H HG23 . THR A 22  ? 0.2494 0.2494 0.2494 0.0000  0.0000  0.0000  22   THR A HG23 
338  N N    . ILE A 23  ? 0.1156 0.1266 0.1585 0.0134  -0.0216 -0.0339 23   ILE A N    
339  C CA   . ILE A 23  ? 0.1338 0.1360 0.1560 0.0172  -0.0306 -0.0305 23   ILE A CA   
340  C C    . ILE A 23  ? 0.1285 0.1735 0.2044 0.0267  -0.0507 -0.0640 23   ILE A C    
341  O O    . ILE A 23  ? 0.1561 0.1634 0.2249 0.0430  -0.0579 -0.0740 23   ILE A O    
342  C CB   . ILE A 23  ? 0.1995 0.1554 0.1534 0.0291  -0.0332 -0.0348 23   ILE A CB   
343  C CG1  A ILE A 23  ? 0.1867 0.2108 0.1735 -0.0002 0.0056  -0.0153 23   ILE A CG1  
344  C CG1  B ILE A 23  ? 0.1909 0.1390 0.1407 0.0015  0.0032  0.0089  23   ILE A CG1  
345  C CG2  . ILE A 23  ? 0.2382 0.1916 0.1756 0.0521  -0.0720 -0.0345 23   ILE A CG2  
346  C CD1  A ILE A 23  ? 0.2366 0.1716 0.3812 0.0143  0.0357  0.0618  23   ILE A CD1  
347  C CD1  B ILE A 23  ? 0.2939 0.2593 0.1248 -0.0022 0.0166  0.0222  23   ILE A CD1  
348  H H    . ILE A 23  ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  23   ILE A H    
349  H HA   . ILE A 23  ? 0.1703 0.1703 0.1703 0.0000  0.0000  0.0000  23   ILE A HA   
350  H HB   A ILE A 23  ? 0.2033 0.2033 0.2033 0.0000  0.0000  0.0000  23   ILE A HB   
351  H HG12 A ILE A 23  ? 0.2284 0.2284 0.2284 0.0000  0.0000  0.0000  23   ILE A HG12 
352  H HG12 B ILE A 23  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  23   ILE A HG12 
353  H HG13 A ILE A 23  ? 0.2284 0.2284 0.2284 0.0000  0.0000  0.0000  23   ILE A HG13 
354  H HG13 B ILE A 23  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  23   ILE A HG13 
355  H HG21 . ILE A 23  ? 0.3027 0.3027 0.3027 0.0000  0.0000  0.0000  23   ILE A HG21 
356  H HG22 . ILE A 23  ? 0.3027 0.3027 0.3027 0.0000  0.0000  0.0000  23   ILE A HG22 
357  H HG23 . ILE A 23  ? 0.3027 0.3027 0.3027 0.0000  0.0000  0.0000  23   ILE A HG23 
358  H HD11 A ILE A 23  ? 0.3946 0.3946 0.3946 0.0000  0.0000  0.0000  23   ILE A HD11 
359  H HD11 B ILE A 23  ? 0.3390 0.3390 0.3390 0.0000  0.0000  0.0000  23   ILE A HD11 
360  H HD12 A ILE A 23  ? 0.3946 0.3946 0.3946 0.0000  0.0000  0.0000  23   ILE A HD12 
361  H HD12 B ILE A 23  ? 0.3390 0.3390 0.3390 0.0000  0.0000  0.0000  23   ILE A HD12 
362  H HD13 A ILE A 23  ? 0.3946 0.3946 0.3946 0.0000  0.0000  0.0000  23   ILE A HD13 
363  H HD13 B ILE A 23  ? 0.3390 0.3390 0.3390 0.0000  0.0000  0.0000  23   ILE A HD13 
364  N N    . GLY A 24  ? 0.1218 0.1962 0.2967 0.0192  -0.0363 -0.0995 24   GLY A N    
365  C CA   . GLY A 24  ? 0.1056 0.2937 0.3929 0.0235  -0.0388 -0.1649 24   GLY A CA   
366  C C    . GLY A 24  ? 0.1295 0.3034 0.3587 0.0267  -0.0173 -0.1518 24   GLY A C    
367  O O    . GLY A 24  ? 0.2412 0.2741 0.3671 0.0384  0.0319  -0.1209 24   GLY A O    
368  H H    . GLY A 24  ? 0.2458 0.2458 0.2458 0.0000  0.0000  0.0000  24   GLY A H    
369  H HA2  . GLY A 24  ? 0.3169 0.3169 0.3169 0.0000  0.0000  0.0000  24   GLY A HA2  
370  H HA3  . GLY A 24  ? 0.3169 0.3169 0.3169 0.0000  0.0000  0.0000  24   GLY A HA3  
371  N N    . GLY A 25  ? 0.1299 0.2681 0.3139 -0.0303 0.0187  -0.0743 25   GLY A N    
372  C CA   . GLY A 25  ? 0.1783 0.3091 0.2828 -0.0706 0.0082  -0.0363 25   GLY A CA   
373  C C    . GLY A 25  ? 0.1531 0.2364 0.1897 -0.0144 -0.0028 -0.0221 25   GLY A C    
374  O O    . GLY A 25  ? 0.1970 0.2795 0.1786 -0.0240 -0.0230 -0.0132 25   GLY A O    
375  H H    . GLY A 25  ? 0.2847 0.2847 0.2847 0.0000  0.0000  0.0000  25   GLY A H    
376  H HA2  . GLY A 25  ? 0.3080 0.3080 0.3080 0.0000  0.0000  0.0000  25   GLY A HA2  
377  H HA3  . GLY A 25  ? 0.3080 0.3080 0.3080 0.0000  0.0000  0.0000  25   GLY A HA3  
378  N N    . THR A 26  ? 0.1214 0.2205 0.1710 -0.0056 -0.0187 -0.0422 26   THR A N    
379  C CA   . THR A 26  ? 0.1263 0.1704 0.1695 0.0135  -0.0194 -0.0354 26   THR A CA   
380  C C    . THR A 26  ? 0.1174 0.1329 0.1499 0.0090  -0.0140 -0.0321 26   THR A C    
381  O O    . THR A 26  ? 0.1356 0.1504 0.1565 0.0189  -0.0289 -0.0355 26   THR A O    
382  C CB   . THR A 26  ? 0.1756 0.1791 0.2044 0.0573  -0.0376 -0.0309 26   THR A CB   
383  O OG1  . THR A 26  ? 0.1693 0.2106 0.3348 0.0625  -0.0529 -0.0481 26   THR A OG1  
384  C CG2  . THR A 26  ? 0.2007 0.1919 0.2366 0.0403  -0.0341 0.0080  26   THR A CG2  
385  H H    . THR A 26  ? 0.2052 0.2052 0.2052 0.0000  0.0000  0.0000  26   THR A H    
386  H HA   . THR A 26  ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  26   THR A HA   
387  H HB   . THR A 26  ? 0.2237 0.2237 0.2237 0.0000  0.0000  0.0000  26   THR A HB   
388  H HG1  . THR A 26  ? 0.3574 0.3574 0.3574 0.0000  0.0000  0.0000  26   THR A HG1  
389  H HG21 . THR A 26  ? 0.3146 0.3146 0.3146 0.0000  0.0000  0.0000  26   THR A HG21 
390  H HG22 . THR A 26  ? 0.3146 0.3146 0.3146 0.0000  0.0000  0.0000  26   THR A HG22 
391  H HG23 . THR A 26  ? 0.3146 0.3146 0.3146 0.0000  0.0000  0.0000  26   THR A HG23 
392  N N    . THR A 27  ? 0.1100 0.1307 0.1271 0.0035  -0.0055 -0.0217 27   THR A N    
393  C CA   . THR A 27  ? 0.1046 0.1321 0.1128 0.0086  -0.0057 -0.0152 27   THR A CA   
394  C C    . THR A 27  ? 0.1077 0.1268 0.1197 0.0047  -0.0046 -0.0165 27   THR A C    
395  O O    . THR A 27  ? 0.1417 0.1275 0.1296 -0.0001 0.0035  -0.0219 27   THR A O    
396  C CB   . THR A 27  ? 0.1165 0.1333 0.1230 0.0005  -0.0115 -0.0150 27   THR A CB   
397  O OG1  . THR A 27  ? 0.1281 0.1496 0.1205 -0.0078 -0.0069 -0.0078 27   THR A OG1  
398  C CG2  . THR A 27  ? 0.1197 0.1514 0.1265 0.0152  -0.0156 -0.0093 27   THR A CG2  
399  H H    . THR A 27  ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  27   THR A H    
400  H HA   . THR A 27  ? 0.1398 0.1398 0.1398 0.0000  0.0000  0.0000  27   THR A HA   
401  H HB   . THR A 27  ? 0.1491 0.1491 0.1491 0.0000  0.0000  0.0000  27   THR A HB   
402  H HG1  . THR A 27  ? 0.1991 0.1991 0.1991 0.0000  0.0000  0.0000  27   THR A HG1  
403  H HG21 . THR A 27  ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  27   THR A HG21 
404  H HG22 . THR A 27  ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  27   THR A HG22 
405  H HG23 . THR A 27  ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  27   THR A HG23 
406  N N    . LEU A 28  ? 0.1161 0.1172 0.1173 0.0021  0.0032  -0.0155 28   LEU A N    
407  C CA   . LEU A 28  ? 0.1230 0.1179 0.1178 0.0076  0.0018  -0.0107 28   LEU A CA   
408  C C    . LEU A 28  ? 0.1172 0.1192 0.1223 0.0025  -0.0043 -0.0093 28   LEU A C    
409  O O    . LEU A 28  ? 0.1283 0.1262 0.1575 0.0107  0.0005  0.0063  28   LEU A O    
410  C CB   A LEU A 28  ? 0.1235 0.1777 0.1274 -0.0236 -0.0145 0.0096  28   LEU A CB   
411  C CB   B LEU A 28  ? 0.1247 0.1356 0.1094 0.0328  0.0061  -0.0237 28   LEU A CB   
412  C CG   A LEU A 28  ? 0.1423 0.2080 0.1489 0.0290  -0.0046 -0.0139 28   LEU A CG   
413  C CG   B LEU A 28  ? 0.1283 0.1249 0.1223 0.0074  -0.0090 -0.0092 28   LEU A CG   
414  C CD1  A LEU A 28  ? 0.1937 0.4636 0.2101 0.0736  -0.0867 -0.0566 28   LEU A CD1  
415  C CD1  B LEU A 28  ? 0.1196 0.1515 0.1378 0.0276  -0.0127 -0.0371 28   LEU A CD1  
416  C CD2  A LEU A 28  ? 0.2779 0.1854 0.3802 0.0557  -0.0859 -0.0080 28   LEU A CD2  
417  C CD2  B LEU A 28  ? 0.1342 0.1309 0.1221 -0.0072 -0.0131 0.0068  28   LEU A CD2  
418  H H    . LEU A 28  ? 0.1402 0.1402 0.1402 0.0000  0.0000  0.0000  28   LEU A H    
419  H HA   A LEU A 28  ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  28   LEU A HA   
420  H HB2  A LEU A 28  ? 0.1715 0.1715 0.1715 0.0000  0.0000  0.0000  28   LEU A HB2  
421  H HB2  B LEU A 28  ? 0.1479 0.1479 0.1479 0.0000  0.0000  0.0000  28   LEU A HB2  
422  H HB3  A LEU A 28  ? 0.1715 0.1715 0.1715 0.0000  0.0000  0.0000  28   LEU A HB3  
423  H HB3  B LEU A 28  ? 0.1479 0.1479 0.1479 0.0000  0.0000  0.0000  28   LEU A HB3  
424  H HG   A LEU A 28  ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  28   LEU A HG   
425  H HG   B LEU A 28  ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  28   LEU A HG   
426  H HD11 A LEU A 28  ? 0.4337 0.4337 0.4337 0.0000  0.0000  0.0000  28   LEU A HD11 
427  H HD11 B LEU A 28  ? 0.2044 0.2044 0.2044 0.0000  0.0000  0.0000  28   LEU A HD11 
428  H HD12 A LEU A 28  ? 0.4337 0.4337 0.4337 0.0000  0.0000  0.0000  28   LEU A HD12 
429  H HD12 B LEU A 28  ? 0.2044 0.2044 0.2044 0.0000  0.0000  0.0000  28   LEU A HD12 
430  H HD13 A LEU A 28  ? 0.4337 0.4337 0.4337 0.0000  0.0000  0.0000  28   LEU A HD13 
431  H HD13 B LEU A 28  ? 0.2044 0.2044 0.2044 0.0000  0.0000  0.0000  28   LEU A HD13 
432  H HD21 A LEU A 28  ? 0.4217 0.4217 0.4217 0.0000  0.0000  0.0000  28   LEU A HD21 
433  H HD21 B LEU A 28  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  28   LEU A HD21 
434  H HD22 A LEU A 28  ? 0.4217 0.4217 0.4217 0.0000  0.0000  0.0000  28   LEU A HD22 
435  H HD22 B LEU A 28  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  28   LEU A HD22 
436  H HD23 A LEU A 28  ? 0.4217 0.4217 0.4217 0.0000  0.0000  0.0000  28   LEU A HD23 
437  H HD23 B LEU A 28  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  28   LEU A HD23 
438  N N    . ASN A 29  ? 0.1170 0.1243 0.1198 0.0059  0.0045  -0.0132 29   ASN A N    
439  C CA   . ASN A 29  ? 0.1096 0.1348 0.1194 -0.0014 -0.0044 -0.0129 29   ASN A CA   
440  C C    . ASN A 29  ? 0.1109 0.1237 0.1116 0.0044  -0.0015 -0.0031 29   ASN A C    
441  O O    . ASN A 29  ? 0.1664 0.1252 0.1212 -0.0021 -0.0092 -0.0055 29   ASN A O    
442  C CB   . ASN A 29  ? 0.1243 0.1711 0.1245 -0.0139 0.0014  -0.0276 29   ASN A CB   
443  C CG   . ASN A 29  ? 0.1235 0.1753 0.1221 -0.0086 -0.0140 -0.0140 29   ASN A CG   
444  O OD1  . ASN A 29  ? 0.2001 0.2294 0.1240 -0.0446 -0.0196 -0.0086 29   ASN A OD1  
445  N ND2  . ASN A 29  ? 0.1628 0.1936 0.1269 -0.0013 -0.0127 -0.0351 29   ASN A ND2  
446  H H    . ASN A 29  ? 0.1444 0.1444 0.1444 0.0000  0.0000  0.0000  29   ASN A H    
447  H HA   . ASN A 29  ? 0.1455 0.1455 0.1455 0.0000  0.0000  0.0000  29   ASN A HA   
448  H HB2  . ASN A 29  ? 0.1679 0.1679 0.1679 0.0000  0.0000  0.0000  29   ASN A HB2  
449  H HB3  . ASN A 29  ? 0.1679 0.1679 0.1679 0.0000  0.0000  0.0000  29   ASN A HB3  
450  H HD21 . ASN A 29  ? 0.1933 0.1933 0.1933 0.0000  0.0000  0.0000  29   ASN A HD21 
451  H HD22 . ASN A 29  ? 0.1933 0.1933 0.1933 0.0000  0.0000  0.0000  29   ASN A HD22 
452  N N    . LEU A 30  ? 0.1233 0.1249 0.1044 0.0125  -0.0042 -0.0064 30   LEU A N    
453  C CA   . LEU A 30  ? 0.1170 0.1166 0.1077 0.0094  -0.0082 -0.0061 30   LEU A CA   
454  C C    . LEU A 30  ? 0.1086 0.1233 0.1141 0.0086  -0.0090 -0.0031 30   LEU A C    
455  O O    . LEU A 30  ? 0.1146 0.1536 0.1129 0.0267  -0.0039 0.0041  30   LEU A O    
456  C CB   . LEU A 30  ? 0.1097 0.1361 0.1168 0.0133  -0.0075 -0.0136 30   LEU A CB   
457  C CG   . LEU A 30  ? 0.1118 0.1339 0.1146 0.0131  -0.0020 -0.0093 30   LEU A CG   
458  C CD1  . LEU A 30  ? 0.1156 0.1433 0.1599 0.0073  -0.0034 -0.0214 30   LEU A CD1  
459  C CD2  . LEU A 30  ? 0.1192 0.1332 0.1348 0.0172  -0.0112 -0.0144 30   LEU A CD2  
460  H H    . LEU A 30  ? 0.1411 0.1411 0.1411 0.0000  0.0000  0.0000  30   LEU A H    
461  H HA   . LEU A 30  ? 0.1365 0.1365 0.1365 0.0000  0.0000  0.0000  30   LEU A HA   
462  H HB2  . LEU A 30  ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  30   LEU A HB2  
463  H HB3  . LEU A 30  ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  30   LEU A HB3  
464  H HG   . LEU A 30  ? 0.1441 0.1441 0.1441 0.0000  0.0000  0.0000  30   LEU A HG   
465  H HD11 . LEU A 30  ? 0.2094 0.2094 0.2094 0.0000  0.0000  0.0000  30   LEU A HD11 
466  H HD12 . LEU A 30  ? 0.2094 0.2094 0.2094 0.0000  0.0000  0.0000  30   LEU A HD12 
467  H HD13 . LEU A 30  ? 0.2094 0.2094 0.2094 0.0000  0.0000  0.0000  30   LEU A HD13 
468  H HD21 . LEU A 30  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  30   LEU A HD21 
469  H HD22 . LEU A 30  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  30   LEU A HD22 
470  H HD23 . LEU A 30  ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  30   LEU A HD23 
471  N N    . ASN A 31  ? 0.1028 0.1332 0.1122 0.0193  -0.0051 -0.0037 31   ASN A N    
472  C CA   . ASN A 31  ? 0.1030 0.1348 0.1089 0.0164  -0.0020 -0.0004 31   ASN A CA   
473  C C    . ASN A 31  ? 0.1007 0.1278 0.1069 0.0103  -0.0094 0.0016  31   ASN A C    
474  O O    . ASN A 31  ? 0.1255 0.1284 0.1233 0.0085  -0.0149 0.0024  31   ASN A O    
475  C CB   . ASN A 31  ? 0.1029 0.1339 0.1241 0.0062  0.0035  0.0006  31   ASN A CB   
476  C CG   . ASN A 31  ? 0.1239 0.1313 0.1171 0.0060  0.0009  -0.0002 31   ASN A CG   
477  O OD1  . ASN A 31  ? 0.1354 0.1391 0.1685 0.0170  0.0172  0.0120  31   ASN A OD1  
478  N ND2  . ASN A 31  ? 0.1321 0.1327 0.1406 0.0130  0.0297  0.0086  31   ASN A ND2  
479  H H    . ASN A 31  ? 0.1393 0.1393 0.1393 0.0000  0.0000  0.0000  31   ASN A H    
480  H HA   . ASN A 31  ? 0.1387 0.1387 0.1387 0.0000  0.0000  0.0000  31   ASN A HA   
481  H HB2  . ASN A 31  ? 0.1444 0.1444 0.1444 0.0000  0.0000  0.0000  31   ASN A HB2  
482  H HB3  . ASN A 31  ? 0.1444 0.1444 0.1444 0.0000  0.0000  0.0000  31   ASN A HB3  
483  H HD21 . ASN A 31  ? 0.1621 0.1621 0.1621 0.0000  0.0000  0.0000  31   ASN A HD21 
484  H HD22 . ASN A 31  ? 0.1621 0.1621 0.1621 0.0000  0.0000  0.0000  31   ASN A HD22 
485  N N    . PHE A 32  ? 0.1180 0.1245 0.1086 0.0162  -0.0084 -0.0065 32   PHE A N    
486  C CA   . PHE A 32  ? 0.1171 0.1214 0.1071 0.0164  -0.0081 -0.0040 32   PHE A CA   
487  C C    . PHE A 32  ? 0.1033 0.1316 0.1175 0.0174  -0.0130 0.0009  32   PHE A C    
488  O O    . PHE A 32  ? 0.1214 0.1488 0.1151 0.0155  -0.0085 -0.0185 32   PHE A O    
489  C CB   . PHE A 32  ? 0.1159 0.1260 0.1095 0.0168  -0.0053 -0.0061 32   PHE A CB   
490  C CG   . PHE A 32  ? 0.1014 0.1292 0.1078 0.0111  -0.0084 0.0036  32   PHE A CG   
491  C CD1  . PHE A 32  ? 0.1146 0.1301 0.1126 0.0181  -0.0108 -0.0023 32   PHE A CD1  
492  C CD2  . PHE A 32  ? 0.1248 0.1231 0.1362 0.0120  -0.0070 0.0032  32   PHE A CD2  
493  C CE1  . PHE A 32  ? 0.1049 0.1329 0.1294 0.0085  0.0051  0.0011  32   PHE A CE1  
494  C CE2  . PHE A 32  ? 0.1433 0.1322 0.1429 0.0011  0.0105  0.0054  32   PHE A CE2  
495  C CZ   . PHE A 32  ? 0.1359 0.1445 0.1338 0.0161  0.0124  0.0068  32   PHE A CZ   
496  H H    . PHE A 32  ? 0.1405 0.1405 0.1405 0.0000  0.0000  0.0000  32   PHE A H    
497  H HA   . PHE A 32  ? 0.1382 0.1382 0.1382 0.0000  0.0000  0.0000  32   PHE A HA   
498  H HB2  . PHE A 32  ? 0.1406 0.1406 0.1406 0.0000  0.0000  0.0000  32   PHE A HB2  
499  H HB3  . PHE A 32  ? 0.1406 0.1406 0.1406 0.0000  0.0000  0.0000  32   PHE A HB3  
500  H HD1  . PHE A 32  ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  32   PHE A HD1  
501  H HD2  . PHE A 32  ? 0.1536 0.1536 0.1536 0.0000  0.0000  0.0000  32   PHE A HD2  
502  H HE1  . PHE A 32  ? 0.1469 0.1469 0.1469 0.0000  0.0000  0.0000  32   PHE A HE1  
503  H HE2  . PHE A 32  ? 0.1673 0.1673 0.1673 0.0000  0.0000  0.0000  32   PHE A HE2  
504  H HZ   . PHE A 32  ? 0.1657 0.1657 0.1657 0.0000  0.0000  0.0000  32   PHE A HZ   
505  N N    . ASP A 33  ? 0.1112 0.1194 0.1060 0.0080  -0.0058 -0.0044 33   ASP A N    
506  C CA   . ASP A 33  ? 0.1042 0.1094 0.1064 0.0080  -0.0039 -0.0017 33   ASP A CA   
507  C C    . ASP A 33  ? 0.0926 0.1112 0.1050 0.0063  0.0015  0.0034  33   ASP A C    
508  O O    . ASP A 33  ? 0.0939 0.1155 0.1186 0.0091  -0.0064 -0.0057 33   ASP A O    
509  C CB   . ASP A 33  ? 0.1165 0.1079 0.1160 0.0105  -0.0070 -0.0016 33   ASP A CB   
510  C CG   . ASP A 33  ? 0.1097 0.1056 0.1198 0.0070  -0.0112 0.0026  33   ASP A CG   
511  O OD1  . ASP A 33  ? 0.1152 0.1110 0.1199 0.0066  -0.0025 0.0007  33   ASP A OD1  
512  O OD2  . ASP A 33  ? 0.1140 0.1259 0.1197 0.0110  -0.0026 0.0019  33   ASP A OD2  
513  H H    . ASP A 33  ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  33   ASP A H    
514  H HA   . ASP A 33  ? 0.1280 0.1280 0.1280 0.0000  0.0000  0.0000  33   ASP A HA   
515  H HB2  . ASP A 33  ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  33   ASP A HB2  
516  H HB3  . ASP A 33  ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  33   ASP A HB3  
517  N N    . THR A 34  ? 0.0968 0.1092 0.1114 0.0041  -0.0081 -0.0045 34   THR A N    
518  C CA   . THR A 34  ? 0.0955 0.1024 0.1167 0.0018  0.0008  -0.0039 34   THR A CA   
519  C C    . THR A 34  ? 0.0934 0.1132 0.1199 0.0080  -0.0035 -0.0027 34   THR A C    
520  O O    . THR A 34  ? 0.1117 0.1094 0.1208 0.0043  -0.0013 -0.0118 34   THR A O    
521  C CB   . THR A 34  ? 0.0946 0.1086 0.1284 0.0027  -0.0064 0.0006  34   THR A CB   
522  O OG1  . THR A 34  ? 0.0989 0.1136 0.1121 0.0009  -0.0002 0.0030  34   THR A OG1  
523  C CG2  . THR A 34  ? 0.1009 0.1165 0.1286 0.0089  0.0023  0.0145  34   THR A CG2  
524  H H    . THR A 34  ? 0.1269 0.1269 0.1269 0.0000  0.0000  0.0000  34   THR A H    
525  H HA   . THR A 34  ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  34   THR A HA   
526  H HB   . THR A 34  ? 0.1326 0.1326 0.1326 0.0000  0.0000  0.0000  34   THR A HB   
527  H HG1  . THR A 34  ? 0.1622 0.1622 0.1622 0.0000  0.0000  0.0000  34   THR A HG1  
528  H HG21 . THR A 34  ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  34   THR A HG21 
529  H HG22 . THR A 34  ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  34   THR A HG22 
530  H HG23 . THR A 34  ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  34   THR A HG23 
531  N N    . GLY A 35  ? 0.1046 0.1086 0.1074 0.0057  -0.0019 -0.0006 35   GLY A N    
532  C CA   . GLY A 35  ? 0.0973 0.1210 0.1157 0.0038  -0.0025 -0.0026 35   GLY A CA   
533  C C    . GLY A 35  ? 0.0968 0.1122 0.1146 -0.0051 -0.0032 -0.0069 35   GLY A C    
534  O O    . GLY A 35  ? 0.1207 0.1317 0.1136 0.0035  -0.0051 0.0045  35   GLY A O    
535  H H    . GLY A 35  ? 0.1283 0.1283 0.1283 0.0000  0.0000  0.0000  35   GLY A H    
536  H HA2  . GLY A 35  ? 0.1336 0.1336 0.1336 0.0000  0.0000  0.0000  35   GLY A HA2  
537  H HA3  . GLY A 35  ? 0.1336 0.1336 0.1336 0.0000  0.0000  0.0000  35   GLY A HA3  
538  N N    . SER A 36  ? 0.0940 0.1103 0.1186 -0.0002 -0.0031 -0.0030 36   SER A N    
539  C CA   . SER A 36  ? 0.0927 0.1102 0.1205 0.0071  -0.0095 0.0011  36   SER A CA   
540  C C    . SER A 36  ? 0.0982 0.1060 0.1051 0.0110  -0.0048 -0.0057 36   SER A C    
541  O O    . SER A 36  ? 0.1051 0.1109 0.1115 0.0075  -0.0091 -0.0028 36   SER A O    
542  C CB   . SER A 36  ? 0.1175 0.1113 0.1390 0.0052  -0.0066 -0.0021 36   SER A CB   
543  O OG   . SER A 36  ? 0.1337 0.1264 0.1476 0.0117  -0.0059 -0.0024 36   SER A OG   
544  H H    . SER A 36  ? 0.1292 0.1292 0.1292 0.0000  0.0000  0.0000  36   SER A H    
545  H HA   . SER A 36  ? 0.1293 0.1293 0.1293 0.0000  0.0000  0.0000  36   SER A HA   
546  H HB2  . SER A 36  ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  36   SER A HB2  
547  H HB3  . SER A 36  ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  36   SER A HB3  
548  H HG   . SER A 36  ? 0.2039 0.2039 0.2039 0.0000  0.0000  0.0000  36   SER A HG   
549  N N    . ALA A 37  ? 0.0936 0.1134 0.1122 0.0070  -0.0063 0.0062  37   ALA A N    
550  C CA   . ALA A 37  ? 0.0946 0.1142 0.1151 0.0083  -0.0092 -0.0043 37   ALA A CA   
551  C C    . ALA A 37  ? 0.0945 0.1063 0.1136 0.0009  -0.0116 0.0038  37   ALA A C    
552  O O    . ALA A 37  ? 0.0980 0.1179 0.1365 0.0114  -0.0064 -0.0009 37   ALA A O    
553  C CB   . ALA A 37  ? 0.1105 0.1181 0.1240 0.0007  -0.0079 -0.0064 37   ALA A CB   
554  H H    . ALA A 37  ? 0.1277 0.1277 0.1277 0.0000  0.0000  0.0000  37   ALA A H    
555  H HA   . ALA A 37  ? 0.1296 0.1296 0.1296 0.0000  0.0000  0.0000  37   ALA A HA   
556  H HB1  . ALA A 37  ? 0.1763 0.1763 0.1763 0.0000  0.0000  0.0000  37   ALA A HB1  
557  H HB2  . ALA A 37  ? 0.1763 0.1763 0.1763 0.0000  0.0000  0.0000  37   ALA A HB2  
558  H HB3  . ALA A 37  ? 0.1763 0.1763 0.1763 0.0000  0.0000  0.0000  37   ALA A HB3  
559  N N    . ASP A 38  ? 0.0998 0.1142 0.1230 0.0048  -0.0095 -0.0066 38   ASP A N    
560  C CA   . ASP A 38  ? 0.1106 0.1111 0.1168 0.0146  -0.0163 -0.0045 38   ASP A CA   
561  C C    . ASP A 38  ? 0.1035 0.1071 0.1225 0.0119  -0.0136 -0.0106 38   ASP A C    
562  O O    . ASP A 38  ? 0.1058 0.1417 0.1218 0.0067  -0.0135 -0.0073 38   ASP A O    
563  C CB   . ASP A 38  ? 0.1211 0.1089 0.1234 0.0077  -0.0201 -0.0043 38   ASP A CB   
564  C CG   . ASP A 38  ? 0.1045 0.1266 0.1216 0.0119  -0.0104 -0.0049 38   ASP A CG   
565  O OD1  . ASP A 38  ? 0.1340 0.1204 0.1298 0.0046  -0.0204 -0.0130 38   ASP A OD1  
566  O OD2  . ASP A 38  ? 0.1344 0.1655 0.1205 0.0290  -0.0133 -0.0037 38   ASP A OD2  
567  H H    . ASP A 38  ? 0.1348 0.1348 0.1348 0.0000  0.0000  0.0000  38   ASP A H    
568  H HA   . ASP A 38  ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  38   ASP A HA   
569  H HB2  . ASP A 38  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  38   ASP A HB2  
570  H HB3  . ASP A 38  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  38   ASP A HB3  
571  N N    . LEU A 39  ? 0.1061 0.1166 0.1207 0.0007  -0.0065 -0.0101 39   LEU A N    
572  C CA   . LEU A 39  ? 0.1083 0.1064 0.1204 0.0172  -0.0084 -0.0034 39   LEU A CA   
573  C C    . LEU A 39  ? 0.0952 0.1131 0.1119 0.0078  -0.0116 -0.0077 39   LEU A C    
574  O O    . LEU A 39  ? 0.1026 0.1174 0.1386 0.0096  -0.0162 0.0017  39   LEU A O    
575  C CB   . LEU A 39  ? 0.1183 0.1063 0.1303 0.0104  -0.0092 0.0034  39   LEU A CB   
576  C CG   . LEU A 39  ? 0.1932 0.1557 0.1380 -0.0382 0.0242  -0.0014 39   LEU A CG   
577  C CD1  . LEU A 39  ? 0.2711 0.1918 0.1531 -0.0713 0.0365  0.0166  39   LEU A CD1  
578  C CD2  . LEU A 39  ? 0.2332 0.1541 0.1542 -0.0231 0.0214  -0.0109 39   LEU A CD2  
579  H H    . LEU A 39  ? 0.1374 0.1374 0.1374 0.0000  0.0000  0.0000  39   LEU A H    
580  H HA   . LEU A 39  ? 0.1340 0.1340 0.1340 0.0000  0.0000  0.0000  39   LEU A HA   
581  H HB2  . LEU A 39  ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  39   LEU A HB2  
582  H HB3  . LEU A 39  ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  39   LEU A HB3  
583  H HG   . LEU A 39  ? 0.1948 0.1948 0.1948 0.0000  0.0000  0.0000  39   LEU A HG   
584  H HD11 . LEU A 39  ? 0.3080 0.3080 0.3080 0.0000  0.0000  0.0000  39   LEU A HD11 
585  H HD12 . LEU A 39  ? 0.3080 0.3080 0.3080 0.0000  0.0000  0.0000  39   LEU A HD12 
586  H HD13 . LEU A 39  ? 0.3080 0.3080 0.3080 0.0000  0.0000  0.0000  39   LEU A HD13 
587  H HD21 . LEU A 39  ? 0.2708 0.2708 0.2708 0.0000  0.0000  0.0000  39   LEU A HD21 
588  H HD22 . LEU A 39  ? 0.2708 0.2708 0.2708 0.0000  0.0000  0.0000  39   LEU A HD22 
589  H HD23 . LEU A 39  ? 0.2708 0.2708 0.2708 0.0000  0.0000  0.0000  39   LEU A HD23 
590  N N    . TRP A 40  ? 0.1024 0.1054 0.1198 0.0062  -0.0080 -0.0050 40   TRP A N    
591  C CA   . TRP A 40  ? 0.1096 0.0975 0.1260 0.0061  -0.0220 0.0025  40   TRP A CA   
592  C C    . TRP A 40  ? 0.1006 0.1067 0.1186 0.0042  -0.0069 0.0004  40   TRP A C    
593  O O    . TRP A 40  ? 0.1023 0.1153 0.1322 0.0086  -0.0203 -0.0080 40   TRP A O    
594  C CB   . TRP A 40  ? 0.1071 0.1076 0.1225 0.0060  -0.0119 -0.0005 40   TRP A CB   
595  C CG   . TRP A 40  ? 0.1112 0.1133 0.1141 0.0106  -0.0105 -0.0010 40   TRP A CG   
596  C CD1  . TRP A 40  ? 0.1119 0.1184 0.1256 0.0120  -0.0042 0.0006  40   TRP A CD1  
597  C CD2  . TRP A 40  ? 0.1052 0.1194 0.1189 0.0098  -0.0101 0.0057  40   TRP A CD2  
598  N NE1  . TRP A 40  ? 0.1126 0.1369 0.1315 0.0068  0.0047  -0.0085 40   TRP A NE1  
599  C CE2  . TRP A 40  ? 0.1181 0.1188 0.1273 0.0081  -0.0052 0.0081  40   TRP A CE2  
600  C CE3  . TRP A 40  ? 0.1296 0.1054 0.1287 0.0047  -0.0070 0.0011  40   TRP A CE3  
601  C CZ2  . TRP A 40  ? 0.1146 0.1364 0.1411 -0.0050 0.0037  0.0029  40   TRP A CZ2  
602  C CZ3  . TRP A 40  ? 0.1331 0.1179 0.1461 0.0012  -0.0013 -0.0018 40   TRP A CZ3  
603  C CH2  . TRP A 40  ? 0.1400 0.1200 0.1485 -0.0085 -0.0039 0.0044  40   TRP A CH2  
604  H H    . TRP A 40  ? 0.1311 0.1311 0.1311 0.0000  0.0000  0.0000  40   TRP A H    
605  H HA   . TRP A 40  ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  40   TRP A HA   
606  H HB2  . TRP A 40  ? 0.1349 0.1349 0.1349 0.0000  0.0000  0.0000  40   TRP A HB2  
607  H HB3  . TRP A 40  ? 0.1349 0.1349 0.1349 0.0000  0.0000  0.0000  40   TRP A HB3  
608  H HD1  . TRP A 40  ? 0.1424 0.1424 0.1424 0.0000  0.0000  0.0000  40   TRP A HD1  
609  H HE1  . TRP A 40  ? 0.1524 0.1524 0.1524 0.0000  0.0000  0.0000  40   TRP A HE1  
610  H HE3  . TRP A 40  ? 0.1455 0.1455 0.1455 0.0000  0.0000  0.0000  40   TRP A HE3  
611  H HZ2  . TRP A 40  ? 0.1568 0.1568 0.1568 0.0000  0.0000  0.0000  40   TRP A HZ2  
612  H HZ3  . TRP A 40  ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  40   TRP A HZ3  
613  H HH2  . TRP A 40  ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  40   TRP A HH2  
614  N N    . VAL A 41  ? 0.1102 0.1002 0.1205 0.0137  -0.0189 -0.0034 41   VAL A N    
615  C CA   . VAL A 41  ? 0.1123 0.1112 0.1182 0.0118  -0.0125 -0.0040 41   VAL A CA   
616  C C    . VAL A 41  ? 0.1007 0.1065 0.1276 0.0060  -0.0113 -0.0109 41   VAL A C    
617  O O    . VAL A 41  ? 0.1177 0.1119 0.1252 0.0127  -0.0178 -0.0046 41   VAL A O    
618  C CB   . VAL A 41  ? 0.1358 0.1085 0.1238 -0.0037 -0.0089 -0.0070 41   VAL A CB   
619  C CG1  . VAL A 41  ? 0.1824 0.1203 0.1325 0.0090  -0.0042 0.0084  41   VAL A CG1  
620  C CG2  . VAL A 41  ? 0.1317 0.1314 0.1500 0.0021  0.0043  -0.0168 41   VAL A CG2  
621  H H    . VAL A 41  ? 0.1324 0.1324 0.1324 0.0000  0.0000  0.0000  41   VAL A H    
622  H HA   . VAL A 41  ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  41   VAL A HA   
623  H HB   . VAL A 41  ? 0.1473 0.1473 0.1473 0.0000  0.0000  0.0000  41   VAL A HB   
624  H HG11 . VAL A 41  ? 0.2176 0.2176 0.2176 0.0000  0.0000  0.0000  41   VAL A HG11 
625  H HG12 . VAL A 41  ? 0.2176 0.2176 0.2176 0.0000  0.0000  0.0000  41   VAL A HG12 
626  H HG13 . VAL A 41  ? 0.2176 0.2176 0.2176 0.0000  0.0000  0.0000  41   VAL A HG13 
627  H HG21 . VAL A 41  ? 0.2066 0.2066 0.2066 0.0000  0.0000  0.0000  41   VAL A HG21 
628  H HG22 . VAL A 41  ? 0.2066 0.2066 0.2066 0.0000  0.0000  0.0000  41   VAL A HG22 
629  H HG23 . VAL A 41  ? 0.2066 0.2066 0.2066 0.0000  0.0000  0.0000  41   VAL A HG23 
630  N N    . PHE A 42  ? 0.1136 0.1088 0.1311 0.0097  -0.0175 -0.0103 42   PHE A N    
631  C CA   . PHE A 42  ? 0.1224 0.1004 0.1361 0.0073  -0.0186 -0.0042 42   PHE A CA   
632  C C    . PHE A 42  ? 0.1255 0.1116 0.1284 0.0118  -0.0124 -0.0137 42   PHE A C    
633  O O    . PHE A 42  ? 0.1439 0.1229 0.1287 0.0153  -0.0026 -0.0005 42   PHE A O    
634  C CB   . PHE A 42  ? 0.1455 0.1107 0.1422 0.0073  -0.0220 -0.0174 42   PHE A CB   
635  C CG   . PHE A 42  ? 0.1368 0.1127 0.1481 -0.0029 -0.0359 -0.0027 42   PHE A CG   
636  C CD1  . PHE A 42  ? 0.1385 0.1270 0.1367 -0.0061 -0.0235 0.0031  42   PHE A CD1  
637  C CD2  . PHE A 42  ? 0.1544 0.1174 0.2133 -0.0149 -0.0452 0.0119  42   PHE A CD2  
638  C CE1  . PHE A 42  ? 0.1334 0.1560 0.1592 -0.0248 -0.0220 0.0068  42   PHE A CE1  
639  C CE2  . PHE A 42  ? 0.1598 0.1422 0.2367 -0.0255 -0.0450 0.0357  42   PHE A CE2  
640  C CZ   . PHE A 42  ? 0.1635 0.1679 0.1878 -0.0281 -0.0342 0.0314  42   PHE A CZ   
641  H H    . PHE A 42  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  42   PHE A H    
642  H HA   . PHE A 42  ? 0.1436 0.1436 0.1436 0.0000  0.0000  0.0000  42   PHE A HA   
643  H HB2  . PHE A 42  ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  42   PHE A HB2  
644  H HB3  . PHE A 42  ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  42   PHE A HB3  
645  H HD1  . PHE A 42  ? 0.1608 0.1608 0.1608 0.0000  0.0000  0.0000  42   PHE A HD1  
646  H HD2  . PHE A 42  ? 0.1940 0.1940 0.1940 0.0000  0.0000  0.0000  42   PHE A HD2  
647  H HE1  . PHE A 42  ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  42   PHE A HE1  
648  H HE2  . PHE A 42  ? 0.2154 0.2154 0.2154 0.0000  0.0000  0.0000  42   PHE A HE2  
649  H HZ   . PHE A 42  ? 0.2077 0.2077 0.2077 0.0000  0.0000  0.0000  42   PHE A HZ   
650  N N    . SER A 43  ? 0.1285 0.1185 0.1347 0.0155  -0.0081 -0.0044 43   SER A N    
651  C CA   . SER A 43  ? 0.1277 0.1212 0.1447 0.0196  -0.0072 -0.0038 43   SER A CA   
652  C C    . SER A 43  ? 0.1387 0.1201 0.1305 0.0218  -0.0035 -0.0158 43   SER A C    
653  O O    . SER A 43  ? 0.1420 0.1131 0.1579 0.0200  -0.0133 -0.0105 43   SER A O    
654  C CB   . SER A 43  ? 0.1235 0.1138 0.1440 0.0269  -0.0111 -0.0081 43   SER A CB   
655  O OG   . SER A 43  ? 0.1432 0.1250 0.1296 0.0264  -0.0092 -0.0086 43   SER A OG   
656  H H    . SER A 43  ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  43   SER A H    
657  H HA   . SER A 43  ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  43   SER A HA   
658  H HB2  . SER A 43  ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  43   SER A HB2  
659  H HB3  . SER A 43  ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  43   SER A HB3  
660  H HG   . SER A 43  ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  43   SER A HG   
661  N N    . THR A 44  ? 0.1431 0.1182 0.1399 0.0281  0.0010  -0.0074 44   THR A N    
662  C CA   . THR A 44  ? 0.1671 0.1259 0.1534 0.0411  -0.0060 -0.0163 44   THR A CA   
663  C C    . THR A 44  ? 0.1507 0.1220 0.1554 0.0313  -0.0044 -0.0144 44   THR A C    
664  O O    . THR A 44  ? 0.1829 0.1354 0.1587 0.0527  -0.0069 -0.0081 44   THR A O    
665  C CB   . THR A 44  ? 0.1951 0.1610 0.1665 0.0796  0.0264  0.0059  44   THR A CB   
666  O OG1  . THR A 44  ? 0.1813 0.1790 0.2005 0.0533  0.0291  0.0207  44   THR A OG1  
667  C CG2  . THR A 44  ? 0.2562 0.1986 0.1625 0.0897  0.0267  0.0012  44   THR A CG2  
668  H H    . THR A 44  ? 0.1605 0.1605 0.1605 0.0000  0.0000  0.0000  44   THR A H    
669  H HA   . THR A 44  ? 0.1786 0.1786 0.1786 0.0000  0.0000  0.0000  44   THR A HA   
670  H HB   . THR A 44  ? 0.2091 0.2091 0.2091 0.0000  0.0000  0.0000  44   THR A HB   
671  H HG1  . THR A 44  ? 0.2804 0.2804 0.2804 0.0000  0.0000  0.0000  44   THR A HG1  
672  H HG21 . THR A 44  ? 0.3086 0.3086 0.3086 0.0000  0.0000  0.0000  44   THR A HG21 
673  H HG22 . THR A 44  ? 0.3086 0.3086 0.3086 0.0000  0.0000  0.0000  44   THR A HG22 
674  H HG23 . THR A 44  ? 0.3086 0.3086 0.3086 0.0000  0.0000  0.0000  44   THR A HG23 
675  N N    . GLU A 45  ? 0.1303 0.1174 0.1514 0.0223  -0.0034 -0.0029 45   GLU A N    
676  C CA   . GLU A 45  ? 0.1282 0.1198 0.1535 0.0230  -0.0117 0.0023  45   GLU A CA   
677  C C    . GLU A 45  ? 0.1288 0.1165 0.1444 0.0206  -0.0092 0.0006  45   GLU A C    
678  O O    . GLU A 45  ? 0.1342 0.1657 0.1667 0.0021  -0.0193 0.0244  45   GLU A O    
679  C CB   . GLU A 45  ? 0.1298 0.1261 0.1397 0.0227  -0.0088 -0.0014 45   GLU A CB   
680  C CG   . GLU A 45  ? 0.1445 0.1250 0.1558 0.0164  -0.0012 -0.0030 45   GLU A CG   
681  C CD   . GLU A 45  ? 0.1265 0.1302 0.1665 0.0225  -0.0113 -0.0107 45   GLU A CD   
682  O OE1  . GLU A 45  ? 0.1411 0.1551 0.1840 0.0331  -0.0236 -0.0273 45   GLU A OE1  
683  O OE2  . GLU A 45  ? 0.1398 0.1732 0.2743 0.0145  0.0099  -0.0628 45   GLU A OE2  
684  H H    . GLU A 45  ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  45   GLU A H    
685  H HA   . GLU A 45  ? 0.1606 0.1606 0.1606 0.0000  0.0000  0.0000  45   GLU A HA   
686  H HB2  . GLU A 45  ? 0.1582 0.1582 0.1582 0.0000  0.0000  0.0000  45   GLU A HB2  
687  H HB3  . GLU A 45  ? 0.1582 0.1582 0.1582 0.0000  0.0000  0.0000  45   GLU A HB3  
688  H HG2  . GLU A 45  ? 0.1701 0.1701 0.1701 0.0000  0.0000  0.0000  45   GLU A HG2  
689  H HG3  . GLU A 45  ? 0.1701 0.1701 0.1701 0.0000  0.0000  0.0000  45   GLU A HG3  
690  N N    . LEU A 46  ? 0.1284 0.1132 0.1495 0.0100  -0.0093 -0.0026 46   LEU A N    
691  C CA   . LEU A 46  ? 0.1355 0.1139 0.1507 -0.0010 -0.0149 -0.0034 46   LEU A CA   
692  C C    . LEU A 46  ? 0.1480 0.1222 0.1868 0.0050  -0.0257 -0.0004 46   LEU A C    
693  O O    . LEU A 46  ? 0.1541 0.1217 0.1913 0.0134  -0.0070 -0.0150 46   LEU A O    
694  C CB   . LEU A 46  ? 0.1354 0.1105 0.1555 0.0052  -0.0142 -0.0096 46   LEU A CB   
695  C CG   . LEU A 46  ? 0.1379 0.1147 0.1664 0.0112  -0.0149 -0.0060 46   LEU A CG   
696  C CD1  . LEU A 46  ? 0.1324 0.1370 0.1840 0.0116  -0.0199 0.0045  46   LEU A CD1  
697  C CD2  . LEU A 46  ? 0.1581 0.1411 0.1714 0.0264  -0.0069 -0.0145 46   LEU A CD2  
698  H H    . LEU A 46  ? 0.1564 0.1564 0.1564 0.0000  0.0000  0.0000  46   LEU A H    
699  H HA   . LEU A 46  ? 0.1601 0.1601 0.1601 0.0000  0.0000  0.0000  46   LEU A HA   
700  H HB2  . LEU A 46  ? 0.1606 0.1606 0.1606 0.0000  0.0000  0.0000  46   LEU A HB2  
701  H HB3  . LEU A 46  ? 0.1606 0.1606 0.1606 0.0000  0.0000  0.0000  46   LEU A HB3  
702  H HG   . LEU A 46  ? 0.1676 0.1676 0.1676 0.0000  0.0000  0.0000  46   LEU A HG   
703  H HD11 . LEU A 46  ? 0.2267 0.2267 0.2267 0.0000  0.0000  0.0000  46   LEU A HD11 
704  H HD12 . LEU A 46  ? 0.2267 0.2267 0.2267 0.0000  0.0000  0.0000  46   LEU A HD12 
705  H HD13 . LEU A 46  ? 0.2267 0.2267 0.2267 0.0000  0.0000  0.0000  46   LEU A HD13 
706  H HD21 . LEU A 46  ? 0.2353 0.2353 0.2353 0.0000  0.0000  0.0000  46   LEU A HD21 
707  H HD22 . LEU A 46  ? 0.2353 0.2353 0.2353 0.0000  0.0000  0.0000  46   LEU A HD22 
708  H HD23 . LEU A 46  ? 0.2353 0.2353 0.2353 0.0000  0.0000  0.0000  46   LEU A HD23 
709  N N    . PRO A 47  ? 0.1810 0.1159 0.1963 0.0072  -0.0258 0.0064  47   PRO A N    
710  C CA   . PRO A 47  ? 0.2099 0.1140 0.2395 -0.0055 -0.0470 0.0023  47   PRO A CA   
711  C C    . PRO A 47  ? 0.1748 0.1040 0.2392 0.0089  -0.0452 -0.0155 47   PRO A C    
712  O O    . PRO A 47  ? 0.1619 0.1134 0.2113 0.0107  -0.0237 -0.0194 47   PRO A O    
713  C CB   . PRO A 47  ? 0.2426 0.1436 0.2623 -0.0441 -0.0684 0.0370  47   PRO A CB   
714  C CG   . PRO A 47  ? 0.2604 0.1613 0.2896 -0.0113 0.0172  0.0498  47   PRO A CG   
715  C CD   . PRO A 47  ? 0.1945 0.1484 0.1999 -0.0265 -0.0193 0.0188  47   PRO A CD   
716  H HA   . PRO A 47  ? 0.2253 0.2253 0.2253 0.0000  0.0000  0.0000  47   PRO A HA   
717  H HB2  . PRO A 47  ? 0.2594 0.2594 0.2594 0.0000  0.0000  0.0000  47   PRO A HB2  
718  H HB3  . PRO A 47  ? 0.2594 0.2594 0.2594 0.0000  0.0000  0.0000  47   PRO A HB3  
719  H HG2  . PRO A 47  ? 0.2845 0.2845 0.2845 0.0000  0.0000  0.0000  47   PRO A HG2  
720  H HG3  . PRO A 47  ? 0.2845 0.2845 0.2845 0.0000  0.0000  0.0000  47   PRO A HG3  
721  H HD2  . PRO A 47  ? 0.2171 0.2171 0.2171 0.0000  0.0000  0.0000  47   PRO A HD2  
722  H HD3  . PRO A 47  ? 0.2171 0.2171 0.2171 0.0000  0.0000  0.0000  47   PRO A HD3  
723  N N    . ALA A 48  ? 0.1687 0.1187 0.2669 0.0155  -0.0304 -0.0212 48   ALA A N    
724  C CA   . ALA A 48  ? 0.1790 0.1374 0.2694 0.0225  -0.0133 -0.0382 48   ALA A CA   
725  C C    . ALA A 48  ? 0.1774 0.1175 0.2203 0.0085  -0.0223 -0.0272 48   ALA A C    
726  O O    . ALA A 48  ? 0.2011 0.1401 0.2166 0.0156  -0.0154 -0.0157 48   ALA A O    
727  C CB   . ALA A 48  ? 0.2107 0.1837 0.3308 0.0278  0.0275  -0.0824 48   ALA A CB   
728  H H    . ALA A 48  ? 0.2218 0.2218 0.2218 0.0000  0.0000  0.0000  48   ALA A H    
729  H HA   . ALA A 48  ? 0.2343 0.2343 0.2343 0.0000  0.0000  0.0000  48   ALA A HA   
730  H HB1  . ALA A 48  ? 0.3626 0.3626 0.3626 0.0000  0.0000  0.0000  48   ALA A HB1  
731  H HB2  . ALA A 48  ? 0.3626 0.3626 0.3626 0.0000  0.0000  0.0000  48   ALA A HB2  
732  H HB3  . ALA A 48  ? 0.3626 0.3626 0.3626 0.0000  0.0000  0.0000  48   ALA A HB3  
733  N N    . SER A 49  ? 0.1938 0.1150 0.2227 0.0031  -0.0334 -0.0225 49   SER A N    
734  C CA   . SER A 49  ? 0.1918 0.1204 0.2484 -0.0002 -0.0162 -0.0257 49   SER A CA   
735  C C    . SER A 49  ? 0.1828 0.1234 0.2554 -0.0114 -0.0183 -0.0153 49   SER A C    
736  O O    . SER A 49  ? 0.1830 0.1490 0.3038 -0.0071 -0.0358 -0.0455 49   SER A O    
737  C CB   . SER A 49  ? 0.2545 0.1408 0.3003 -0.0063 0.0078  0.0050  49   SER A CB   
738  O OG   . SER A 49  ? 0.3300 0.1880 0.2733 0.0006  0.0018  0.0279  49   SER A OG   
739  H H    . SER A 49  ? 0.2126 0.2126 0.2126 0.0000  0.0000  0.0000  49   SER A H    
740  H HA   . SER A 49  ? 0.2243 0.2243 0.2243 0.0000  0.0000  0.0000  49   SER A HA   
741  H HB2  . SER A 49  ? 0.2783 0.2783 0.2783 0.0000  0.0000  0.0000  49   SER A HB2  
742  H HB3  . SER A 49  ? 0.2783 0.2783 0.2783 0.0000  0.0000  0.0000  49   SER A HB3  
743  H HG   . SER A 49  ? 0.3957 0.3957 0.3957 0.0000  0.0000  0.0000  49   SER A HG   
744  N N    . GLN A 50  ? 0.1686 0.1217 0.1998 -0.0007 -0.0040 -0.0131 50   GLN A N    
745  C CA   . GLN A 50  ? 0.1457 0.1344 0.2176 0.0140  -0.0078 -0.0192 50   GLN A CA   
746  C C    . GLN A 50  ? 0.1694 0.1237 0.2235 0.0154  -0.0126 -0.0197 50   GLN A C    
747  O O    . GLN A 50  ? 0.1836 0.1452 0.2543 0.0335  -0.0126 -0.0063 50   GLN A O    
748  C CB   . GLN A 50  ? 0.1991 0.1438 0.2192 0.0276  -0.0131 -0.0209 50   GLN A CB   
749  C CG   . GLN A 50  ? 0.2441 0.1875 0.2233 0.0043  0.0309  -0.0341 50   GLN A CG   
750  C CD   . GLN A 50  ? 0.2524 0.2121 0.2240 0.0243  0.0169  -0.0360 50   GLN A CD   
751  O OE1  . GLN A 50  ? 0.3460 0.1854 0.2841 0.0592  -0.0937 -0.0521 50   GLN A OE1  
752  N NE2  . GLN A 50  ? 0.5455 0.2366 0.2295 -0.0342 0.0256  -0.0053 50   GLN A NE2  
753  H H    . GLN A 50  ? 0.1961 0.1961 0.1961 0.0000  0.0000  0.0000  50   GLN A H    
754  H HA   . GLN A 50  ? 0.1991 0.1991 0.1991 0.0000  0.0000  0.0000  50   GLN A HA   
755  H HB2  . GLN A 50  ? 0.2248 0.2248 0.2248 0.0000  0.0000  0.0000  50   GLN A HB2  
756  H HB3  . GLN A 50  ? 0.2248 0.2248 0.2248 0.0000  0.0000  0.0000  50   GLN A HB3  
757  H HG2  . GLN A 50  ? 0.2619 0.2619 0.2619 0.0000  0.0000  0.0000  50   GLN A HG2  
758  H HG3  . GLN A 50  ? 0.2619 0.2619 0.2619 0.0000  0.0000  0.0000  50   GLN A HG3  
759  H HE21 . GLN A 50  ? 0.4047 0.4047 0.4047 0.0000  0.0000  0.0000  50   GLN A HE21 
760  H HE22 . GLN A 50  ? 0.4047 0.4047 0.4047 0.0000  0.0000  0.0000  50   GLN A HE22 
761  N N    . GLN A 51  ? 0.1878 0.1282 0.2018 0.0246  -0.0134 -0.0060 51   GLN A N    
762  C CA   . GLN A 51  ? 0.2103 0.1144 0.2044 0.0069  -0.0287 -0.0020 51   GLN A CA   
763  C C    . GLN A 51  ? 0.2230 0.1169 0.2253 0.0029  -0.0438 0.0004  51   GLN A C    
764  O O    . GLN A 51  ? 0.2221 0.1282 0.2332 0.0043  -0.0587 -0.0048 51   GLN A O    
765  C CB   . GLN A 51  ? 0.2143 0.1363 0.1820 0.0161  -0.0142 -0.0233 51   GLN A CB   
766  C CG   . GLN A 51  ? 0.1990 0.1394 0.1978 0.0197  -0.0223 -0.0185 51   GLN A CG   
767  C CD   . GLN A 51  ? 0.2052 0.1550 0.1977 0.0043  -0.0088 -0.0154 51   GLN A CD   
768  O OE1  . GLN A 51  ? 0.2359 0.2498 0.2051 0.0212  0.0042  0.0098  51   GLN A OE1  
769  N NE2  . GLN A 51  ? 0.2089 0.1495 0.2098 0.0221  -0.0124 -0.0164 51   GLN A NE2  
770  H H    . GLN A 51  ? 0.2071 0.2071 0.2071 0.0000  0.0000  0.0000  51   GLN A H    
771  H HA   . GLN A 51  ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  51   GLN A HA   
772  H HB2  . GLN A 51  ? 0.2130 0.2130 0.2130 0.0000  0.0000  0.0000  51   GLN A HB2  
773  H HB3  . GLN A 51  ? 0.2130 0.2130 0.2130 0.0000  0.0000  0.0000  51   GLN A HB3  
774  H HG2  . GLN A 51  ? 0.2144 0.2144 0.2144 0.0000  0.0000  0.0000  51   GLN A HG2  
775  H HG3  . GLN A 51  ? 0.2144 0.2144 0.2144 0.0000  0.0000  0.0000  51   GLN A HG3  
776  H HE21 . GLN A 51  ? 0.2273 0.2273 0.2273 0.0000  0.0000  0.0000  51   GLN A HE21 
777  H HE22 . GLN A 51  ? 0.2273 0.2273 0.2273 0.0000  0.0000  0.0000  51   GLN A HE22 
778  N N    . SER A 52  ? 0.3321 0.1220 0.2247 -0.0143 -0.0604 -0.0095 52   SER A N    
779  C CA   . SER A 52  ? 0.3768 0.1242 0.2641 -0.0455 -0.0790 -0.0148 52   SER A CA   
780  C C    . SER A 52  ? 0.3751 0.1266 0.2567 -0.0451 -0.1013 -0.0136 52   SER A C    
781  O O    . SER A 52  ? 0.3147 0.1731 0.2692 -0.0616 -0.0882 0.0150  52   SER A O    
782  C CB   A SER A 52  ? 0.6002 0.1084 0.3072 -0.0382 -0.1742 -0.0042 52   SER A CB   
783  C CB   B SER A 52  ? 0.4556 0.1188 0.3282 -0.0442 -0.1062 0.0057  52   SER A CB   
784  O OG   A SER A 52  ? 0.9188 0.1839 0.3512 -0.1978 -0.2160 -0.0186 52   SER A OG   
785  O OG   B SER A 52  ? 0.4699 0.1252 0.5091 -0.0435 -0.2183 -0.0198 52   SER A OG   
786  H H    . SER A 52  ? 0.2715 0.2715 0.2715 0.0000  0.0000  0.0000  52   SER A H    
787  H HA   A SER A 52  ? 0.3060 0.3060 0.3060 0.0000  0.0000  0.0000  52   SER A HA   
788  H HB2  A SER A 52  ? 0.4063 0.4063 0.4063 0.0000  0.0000  0.0000  52   SER A HB2  
789  H HB2  B SER A 52  ? 0.3611 0.3611 0.3611 0.0000  0.0000  0.0000  52   SER A HB2  
790  H HB3  A SER A 52  ? 0.4063 0.4063 0.4063 0.0000  0.0000  0.0000  52   SER A HB3  
791  H HB3  B SER A 52  ? 0.3611 0.3611 0.3611 0.0000  0.0000  0.0000  52   SER A HB3  
792  H HG   A SER A 52  ? 0.7270 0.7270 0.7270 0.0000  0.0000  0.0000  52   SER A HG   
793  H HG   B SER A 52  ? 0.5521 0.5521 0.5521 0.0000  0.0000  0.0000  52   SER A HG   
794  N N    . GLY A 53  ? 0.3596 0.1367 0.2695 -0.0633 -0.0942 -0.0113 53   GLY A N    
795  C CA   . GLY A 53  ? 0.3393 0.1777 0.2950 -0.0904 -0.1221 0.0335  53   GLY A CA   
796  C C    . GLY A 53  ? 0.2287 0.1740 0.2890 -0.0430 -0.0737 0.0030  53   GLY A C    
797  O O    . GLY A 53  ? 0.2279 0.2080 0.3730 -0.0529 -0.1267 0.0311  53   GLY A O    
798  H H    . GLY A 53  ? 0.3064 0.3064 0.3064 0.0000  0.0000  0.0000  53   GLY A H    
799  H HA2  . GLY A 53  ? 0.3249 0.3249 0.3249 0.0000  0.0000  0.0000  53   GLY A HA2  
800  H HA3  . GLY A 53  ? 0.3249 0.3249 0.3249 0.0000  0.0000  0.0000  53   GLY A HA3  
801  N N    . HIS A 54  ? 0.2172 0.1441 0.1899 -0.0360 -0.0462 -0.0195 54   HIS A N    
802  C CA   . HIS A 54  ? 0.1711 0.1342 0.1688 0.0014  -0.0322 -0.0186 54   HIS A CA   
803  C C    . HIS A 54  ? 0.1555 0.1409 0.1629 0.0086  -0.0217 -0.0234 54   HIS A C    
804  O O    . HIS A 54  ? 0.2103 0.1394 0.2022 0.0240  -0.0027 -0.0253 54   HIS A O    
805  C CB   . HIS A 54  ? 0.1520 0.1277 0.1691 -0.0030 -0.0292 -0.0103 54   HIS A CB   
806  C CG   . HIS A 54  ? 0.1586 0.1216 0.1600 0.0036  -0.0326 -0.0073 54   HIS A CG   
807  N ND1  . HIS A 54  ? 0.1590 0.1424 0.1593 0.0102  -0.0260 -0.0005 54   HIS A ND1  
808  C CD2  . HIS A 54  ? 0.1770 0.1438 0.1927 0.0095  -0.0169 0.0133  54   HIS A CD2  
809  C CE1  . HIS A 54  ? 0.1654 0.1468 0.1748 0.0099  -0.0188 0.0025  54   HIS A CE1  
810  N NE2  . HIS A 54  ? 0.1660 0.1649 0.2015 0.0074  -0.0174 0.0218  54   HIS A NE2  
811  H H    . HIS A 54  ? 0.2205 0.2205 0.2205 0.0000  0.0000  0.0000  54   HIS A H    
812  H HA   . HIS A 54  ? 0.1896 0.1896 0.1896 0.0000  0.0000  0.0000  54   HIS A HA   
813  H HB2  . HIS A 54  ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  54   HIS A HB2  
814  H HB3  . HIS A 54  ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  54   HIS A HB3  
815  H HD1  . HIS A 54  ? 0.1843 0.1843 0.1843 0.0000  0.0000  0.0000  54   HIS A HD1  
816  H HD2  . HIS A 54  ? 0.2054 0.2054 0.2054 0.0000  0.0000  0.0000  54   HIS A HD2  
817  H HE1  . HIS A 54  ? 0.1948 0.1948 0.1948 0.0000  0.0000  0.0000  54   HIS A HE1  
818  N N    . SER A 55  ? 0.1348 0.1421 0.1666 0.0101  -0.0270 -0.0184 55   SER A N    
819  C CA   . SER A 55  ? 0.1265 0.1499 0.1503 0.0128  -0.0212 -0.0200 55   SER A CA   
820  C C    . SER A 55  ? 0.1398 0.1341 0.1402 0.0100  -0.0191 -0.0204 55   SER A C    
821  O O    . SER A 55  ? 0.1535 0.1642 0.1504 0.0107  -0.0124 -0.0276 55   SER A O    
822  C CB   . SER A 55  ? 0.1649 0.1692 0.1369 0.0167  -0.0205 -0.0114 55   SER A CB   
823  O OG   . SER A 55  ? 0.1745 0.1861 0.1531 0.0196  -0.0295 -0.0299 55   SER A OG   
824  H H    . SER A 55  ? 0.1774 0.1774 0.1774 0.0000  0.0000  0.0000  55   SER A H    
825  H HA   . SER A 55  ? 0.1707 0.1707 0.1707 0.0000  0.0000  0.0000  55   SER A HA   
826  H HB2  . SER A 55  ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  55   SER A HB2  
827  H HB3  . SER A 55  ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  55   SER A HB3  
828  H HG   . SER A 55  ? 0.2568 0.2568 0.2568 0.0000  0.0000  0.0000  55   SER A HG   
829  N N    . VAL A 56  ? 0.1421 0.1474 0.1525 0.0182  -0.0254 -0.0287 56   VAL A N    
830  C CA   . VAL A 56  ? 0.1482 0.1443 0.1530 -0.0047 -0.0328 -0.0088 56   VAL A CA   
831  C C    . VAL A 56  ? 0.1382 0.1396 0.1424 0.0122  -0.0187 -0.0087 56   VAL A C    
832  O O    . VAL A 56  ? 0.1756 0.1858 0.1390 -0.0197 0.0019  -0.0226 56   VAL A O    
833  C CB   . VAL A 56  ? 0.1819 0.1614 0.2167 0.0030  -0.0440 0.0212  56   VAL A CB   
834  C CG1  . VAL A 56  ? 0.2185 0.1591 0.2143 -0.0025 -0.0139 0.0220  56   VAL A CG1  
835  C CG2  . VAL A 56  ? 0.2155 0.1666 0.3503 0.0295  0.0112  0.0141  56   VAL A CG2  
836  H H    . VAL A 56  ? 0.1768 0.1768 0.1768 0.0000  0.0000  0.0000  56   VAL A H    
837  H HA   . VAL A 56  ? 0.1782 0.1782 0.1782 0.0000  0.0000  0.0000  56   VAL A HA   
838  H HB   . VAL A 56  ? 0.2240 0.2240 0.2240 0.0000  0.0000  0.0000  56   VAL A HB   
839  H HG11 . VAL A 56  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  56   VAL A HG11 
840  H HG12 . VAL A 56  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  56   VAL A HG12 
841  H HG13 . VAL A 56  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  56   VAL A HG13 
842  H HG21 . VAL A 56  ? 0.3661 0.3661 0.3661 0.0000  0.0000  0.0000  56   VAL A HG21 
843  H HG22 . VAL A 56  ? 0.3661 0.3661 0.3661 0.0000  0.0000  0.0000  56   VAL A HG22 
844  H HG23 . VAL A 56  ? 0.3661 0.3661 0.3661 0.0000  0.0000  0.0000  56   VAL A HG23 
845  N N    . TYR A 57  ? 0.1332 0.1438 0.1361 0.0008  -0.0067 -0.0023 57   TYR A N    
846  C CA   . TYR A 57  ? 0.1259 0.1424 0.1307 -0.0032 -0.0030 0.0043  57   TYR A CA   
847  C C    . TYR A 57  ? 0.1269 0.1335 0.1395 0.0106  0.0047  -0.0159 57   TYR A C    
848  O O    . TYR A 57  ? 0.1443 0.1314 0.1607 0.0227  0.0058  0.0003  57   TYR A O    
849  C CB   . TYR A 57  ? 0.1322 0.1248 0.1642 0.0167  -0.0006 -0.0001 57   TYR A CB   
850  C CG   . TYR A 57  ? 0.1192 0.1277 0.1666 0.0146  -0.0057 -0.0019 57   TYR A CG   
851  C CD1  . TYR A 57  ? 0.1450 0.1447 0.1747 0.0012  -0.0188 0.0074  57   TYR A CD1  
852  C CD2  . TYR A 57  ? 0.1440 0.1438 0.1674 0.0136  -0.0061 -0.0071 57   TYR A CD2  
853  C CE1  . TYR A 57  ? 0.1498 0.1446 0.1654 -0.0028 -0.0024 0.0033  57   TYR A CE1  
854  C CE2  . TYR A 57  ? 0.1512 0.1498 0.1601 0.0034  -0.0117 -0.0080 57   TYR A CE2  
855  C CZ   . TYR A 57  ? 0.1154 0.1316 0.1813 0.0155  -0.0105 -0.0093 57   TYR A CZ   
856  O OH   . TYR A 57  ? 0.1356 0.1527 0.2007 -0.0022 -0.0110 -0.0066 57   TYR A OH   
857  H H    . TYR A 57  ? 0.1653 0.1653 0.1653 0.0000  0.0000  0.0000  57   TYR A H    
858  H HA   . TYR A 57  ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  57   TYR A HA   
859  H HB2  . TYR A 57  ? 0.1684 0.1684 0.1684 0.0000  0.0000  0.0000  57   TYR A HB2  
860  H HB3  . TYR A 57  ? 0.1684 0.1684 0.1684 0.0000  0.0000  0.0000  57   TYR A HB3  
861  H HD1  . TYR A 57  ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  57   TYR A HD1  
862  H HD2  . TYR A 57  ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  57   TYR A HD2  
863  H HE1  . TYR A 57  ? 0.1839 0.1839 0.1839 0.0000  0.0000  0.0000  57   TYR A HE1  
864  H HE2  . TYR A 57  ? 0.1844 0.1844 0.1844 0.0000  0.0000  0.0000  57   TYR A HE2  
865  H HH   . TYR A 57  ? 0.2444 0.2444 0.2444 0.0000  0.0000  0.0000  57   TYR A HH   
866  N N    . ASN A 58  ? 0.1359 0.1795 0.1347 0.0074  0.0045  -0.0087 58   ASN A N    
867  C CA   . ASN A 58  ? 0.1358 0.1953 0.1815 0.0262  0.0169  -0.0297 58   ASN A CA   
868  C C    . ASN A 58  ? 0.1057 0.1941 0.1948 0.0315  0.0143  -0.0158 58   ASN A C    
869  O O    . ASN A 58  ? 0.1680 0.2109 0.2014 0.0061  0.0166  -0.0009 58   ASN A O    
870  C CB   . ASN A 58  ? 0.1735 0.2268 0.2187 -0.0012 0.0509  -0.0591 58   ASN A CB   
871  C CG   . ASN A 58  ? 0.2222 0.3638 0.3005 0.1073  0.1007  -0.0403 58   ASN A CG   
872  O OD1  . ASN A 58  ? 0.4569 0.5816 0.5125 0.2614  0.0599  -0.2433 58   ASN A OD1  
873  N ND2  . ASN A 58  ? 0.2121 0.2710 0.3966 0.1216  0.0170  -0.0277 58   ASN A ND2  
874  H H    . ASN A 58  ? 0.1801 0.1801 0.1801 0.0000  0.0000  0.0000  58   ASN A H    
875  H HA   . ASN A 58  ? 0.2050 0.2050 0.2050 0.0000  0.0000  0.0000  58   ASN A HA   
876  H HB2  . ASN A 58  ? 0.2476 0.2476 0.2476 0.0000  0.0000  0.0000  58   ASN A HB2  
877  H HB3  . ASN A 58  ? 0.2476 0.2476 0.2476 0.0000  0.0000  0.0000  58   ASN A HB3  
878  H HD21 . ASN A 58  ? 0.3518 0.3518 0.3518 0.0000  0.0000  0.0000  58   ASN A HD21 
879  H HD22 . ASN A 58  ? 0.3518 0.3518 0.3518 0.0000  0.0000  0.0000  58   ASN A HD22 
880  N N    . PRO A 59  ? 0.1335 0.1789 0.2028 0.0341  -0.0026 -0.0158 59   PRO A N    
881  C CA   . PRO A 59  ? 0.1573 0.1725 0.2168 0.0278  -0.0242 -0.0021 59   PRO A CA   
882  C C    . PRO A 59  ? 0.1555 0.1858 0.2521 0.0180  -0.0033 -0.0072 59   PRO A C    
883  O O    . PRO A 59  ? 0.1813 0.1955 0.2893 0.0000  -0.0043 0.0056  59   PRO A O    
884  C CB   . PRO A 59  ? 0.1906 0.2587 0.2096 -0.0170 -0.0128 -0.0210 59   PRO A CB   
885  C CG   . PRO A 59  ? 0.2980 0.2003 0.2068 -0.0152 -0.0401 0.0068  59   PRO A CG   
886  C CD   . PRO A 59  ? 0.2325 0.2249 0.1949 -0.0193 0.0106  -0.0215 59   PRO A CD   
887  H HA   . PRO A 59  ? 0.2186 0.2186 0.2186 0.0000  0.0000  0.0000  59   PRO A HA   
888  H HB2  . PRO A 59  ? 0.2636 0.2636 0.2636 0.0000  0.0000  0.0000  59   PRO A HB2  
889  H HB3  . PRO A 59  ? 0.2636 0.2636 0.2636 0.0000  0.0000  0.0000  59   PRO A HB3  
890  H HG2  . PRO A 59  ? 0.2821 0.2821 0.2821 0.0000  0.0000  0.0000  59   PRO A HG2  
891  H HG3  . PRO A 59  ? 0.2821 0.2821 0.2821 0.0000  0.0000  0.0000  59   PRO A HG3  
892  H HD2  . PRO A 59  ? 0.2609 0.2609 0.2609 0.0000  0.0000  0.0000  59   PRO A HD2  
893  H HD3  . PRO A 59  ? 0.2609 0.2609 0.2609 0.0000  0.0000  0.0000  59   PRO A HD3  
894  N N    . SER A 60  ? 0.1331 0.1978 0.3344 0.0256  0.0024  0.0193  60   SER A N    
895  C CA   . SER A 60  ? 0.1418 0.3233 0.3249 0.0658  -0.0075 0.0046  60   SER A CA   
896  C C    . SER A 60  ? 0.1590 0.2410 0.3348 0.0227  0.0338  -0.0423 60   SER A C    
897  O O    . SER A 60  ? 0.2058 0.3997 0.4652 -0.0184 0.0949  -0.0390 60   SER A O    
898  C CB   A SER A 60  ? 0.1752 0.3541 0.4041 0.1161  0.0619  0.0649  60   SER A CB   
899  C CB   B SER A 60  ? 0.1845 0.3482 0.3977 0.1224  0.0484  0.0585  60   SER A CB   
900  O OG   A SER A 60  ? 0.4184 0.4842 0.4038 0.2309  0.0315  0.1165  60   SER A OG   
901  O OG   B SER A 60  ? 0.3751 0.5490 0.5058 0.2565  0.0536  -0.2256 60   SER A OG   
902  H H    . SER A 60  ? 0.2661 0.2661 0.2661 0.0000  0.0000  0.0000  60   SER A H    
903  H HA   A SER A 60  ? 0.3160 0.3160 0.3160 0.0000  0.0000  0.0000  60   SER A HA   
904  H HB2  A SER A 60  ? 0.3734 0.3734 0.3734 0.0000  0.0000  0.0000  60   SER A HB2  
905  H HB2  B SER A 60  ? 0.3721 0.3721 0.3721 0.0000  0.0000  0.0000  60   SER A HB2  
906  H HB3  A SER A 60  ? 0.3734 0.3734 0.3734 0.0000  0.0000  0.0000  60   SER A HB3  
907  H HB3  B SER A 60  ? 0.3721 0.3721 0.3721 0.0000  0.0000  0.0000  60   SER A HB3  
908  H HG   A SER A 60  ? 0.6531 0.6531 0.6531 0.0000  0.0000  0.0000  60   SER A HG   
909  H HG   B SER A 60  ? 0.7149 0.7149 0.7149 0.0000  0.0000  0.0000  60   SER A HG   
910  N N    . ALA A 61  ? 0.2465 0.2273 0.2733 0.0637  0.0279  -0.0338 61   ALA A N    
911  C CA   . ALA A 61  ? 0.3069 0.2368 0.3005 0.0658  0.0982  -0.0172 61   ALA A CA   
912  C C    . ALA A 61  ? 0.3100 0.2538 0.2795 0.0476  0.1346  -0.0316 61   ALA A C    
913  O O    . ALA A 61  ? 0.3519 0.2733 0.3348 0.0772  0.1678  0.0242  61   ALA A O    
914  C CB   . ALA A 61  ? 0.7088 0.3004 0.2949 0.0450  -0.0710 -0.1353 61   ALA A CB   
915  H H    . ALA A 61  ? 0.2989 0.2989 0.2989 0.0000  0.0000  0.0000  61   ALA A H    
916  H HA   . ALA A 61  ? 0.3377 0.3377 0.3377 0.0000  0.0000  0.0000  61   ALA A HA   
917  H HB1  . ALA A 61  ? 0.6520 0.6520 0.6520 0.0000  0.0000  0.0000  61   ALA A HB1  
918  H HB2  . ALA A 61  ? 0.6520 0.6520 0.6520 0.0000  0.0000  0.0000  61   ALA A HB2  
919  H HB3  . ALA A 61  ? 0.6520 0.6520 0.6520 0.0000  0.0000  0.0000  61   ALA A HB3  
920  N N    . THR A 62  ? 0.2504 0.2263 0.2148 0.0406  0.0547  -0.0333 62   THR A N    
921  C CA   . THR A 62  ? 0.2253 0.2232 0.1911 0.0237  0.0332  0.0010  62   THR A CA   
922  C C    . THR A 62  ? 0.1635 0.1991 0.2034 0.0143  0.0280  0.0012  62   THR A C    
923  O O    . THR A 62  ? 0.2032 0.2108 0.2212 -0.0036 0.0182  0.0051  62   THR A O    
924  C CB   . THR A 62  ? 0.2133 0.2333 0.1824 0.0003  0.0398  -0.0296 62   THR A CB   
925  O OG1  . THR A 62  ? 0.2161 0.2133 0.2183 -0.0166 0.0472  -0.0646 62   THR A OG1  
926  C CG2  . THR A 62  ? 0.3044 0.3391 0.1905 -0.0033 0.0462  -0.0763 62   THR A CG2  
927  H H    . THR A 62  ? 0.2766 0.2766 0.2766 0.0000  0.0000  0.0000  62   THR A H    
928  H HA   . THR A 62  ? 0.2558 0.2558 0.2558 0.0000  0.0000  0.0000  62   THR A HA   
929  H HB   . THR A 62  ? 0.2517 0.2517 0.2517 0.0000  0.0000  0.0000  62   THR A HB   
930  H HG1  . THR A 62  ? 0.3238 0.3238 0.3238 0.0000  0.0000  0.0000  62   THR A HG1  
931  H HG21 . THR A 62  ? 0.4171 0.4171 0.4171 0.0000  0.0000  0.0000  62   THR A HG21 
932  H HG22 . THR A 62  ? 0.4171 0.4171 0.4171 0.0000  0.0000  0.0000  62   THR A HG22 
933  H HG23 . THR A 62  ? 0.4171 0.4171 0.4171 0.0000  0.0000  0.0000  62   THR A HG23 
934  N N    . GLY A 63  ? 0.1639 0.1935 0.1843 0.0311  0.0155  -0.0212 63   GLY A N    
935  C CA   . GLY A 63  ? 0.1436 0.2160 0.1909 0.0285  0.0036  -0.0452 63   GLY A CA   
936  C C    . GLY A 63  ? 0.1342 0.1706 0.1870 0.0325  0.0044  -0.0101 63   GLY A C    
937  O O    . GLY A 63  ? 0.1581 0.2300 0.2356 0.0667  -0.0185 -0.0464 63   GLY A O    
938  H H    . GLY A 63  ? 0.2167 0.2167 0.2167 0.0000  0.0000  0.0000  63   GLY A H    
939  H HA2  . GLY A 63  ? 0.2202 0.2202 0.2202 0.0000  0.0000  0.0000  63   GLY A HA2  
940  H HA3  . GLY A 63  ? 0.2202 0.2202 0.2202 0.0000  0.0000  0.0000  63   GLY A HA3  
941  N N    . LYS A 64  ? 0.1222 0.1704 0.1668 0.0229  -0.0074 -0.0063 64   LYS A N    
942  C CA   . LYS A 64  ? 0.1197 0.1883 0.1853 0.0334  -0.0124 -0.0059 64   LYS A CA   
943  C C    . LYS A 64  ? 0.0960 0.2042 0.1849 0.0221  -0.0216 -0.0157 64   LYS A C    
944  O O    . LYS A 64  ? 0.1046 0.1961 0.1949 0.0221  -0.0148 -0.0150 64   LYS A O    
945  C CB   . LYS A 64  ? 0.1422 0.2333 0.2434 -0.0329 -0.0475 0.0161  64   LYS A CB   
946  C CG   . LYS A 64  ? 0.2794 0.3790 0.3199 -0.0641 0.0583  0.0647  64   LYS A CG   
947  C CD   . LYS A 64  ? 0.4788 0.6589 0.4404 0.1311  0.1981  0.0579  64   LYS A CD   
948  C CE   . LYS A 64  ? 0.4743 0.9272 0.4977 0.0576  0.2409  0.0708  64   LYS A CE   
949  N NZ   . LYS A 64  ? 0.4505 1.1806 0.8540 0.0531  0.2612  0.3132  64   LYS A NZ   
950  H H    . LYS A 64  ? 0.1838 0.1838 0.1838 0.0000  0.0000  0.0000  64   LYS A H    
951  H HA   . LYS A 64  ? 0.1973 0.1973 0.1973 0.0000  0.0000  0.0000  64   LYS A HA   
952  H HB2  . LYS A 64  ? 0.2476 0.2476 0.2476 0.0000  0.0000  0.0000  64   LYS A HB2  
953  H HB3  . LYS A 64  ? 0.2476 0.2476 0.2476 0.0000  0.0000  0.0000  64   LYS A HB3  
954  H HG2  . LYS A 64  ? 0.3914 0.3914 0.3914 0.0000  0.0000  0.0000  64   LYS A HG2  
955  H HG3  . LYS A 64  ? 0.3914 0.3914 0.3914 0.0000  0.0000  0.0000  64   LYS A HG3  
956  H HD2  . LYS A 64  ? 0.6312 0.6312 0.6312 0.0000  0.0000  0.0000  64   LYS A HD2  
957  H HD3  . LYS A 64  ? 0.6312 0.6312 0.6312 0.0000  0.0000  0.0000  64   LYS A HD3  
958  H HE2  . LYS A 64  ? 0.7597 0.7597 0.7597 0.0000  0.0000  0.0000  64   LYS A HE2  
959  H HE3  . LYS A 64  ? 0.7597 0.7597 0.7597 0.0000  0.0000  0.0000  64   LYS A HE3  
960  H HZ1  . LYS A 64  ? 1.2426 1.2426 1.2426 0.0000  0.0000  0.0000  64   LYS A HZ1  
961  H HZ2  . LYS A 64  ? 1.2426 1.2426 1.2426 0.0000  0.0000  0.0000  64   LYS A HZ2  
962  H HZ3  . LYS A 64  ? 1.2426 1.2426 1.2426 0.0000  0.0000  0.0000  64   LYS A HZ3  
963  N N    . GLU A 65  ? 0.1390 0.2338 0.1629 0.0551  -0.0150 -0.0100 65   GLU A N    
964  C CA   . GLU A 65  ? 0.1190 0.3360 0.1472 0.0612  -0.0126 -0.0262 65   GLU A CA   
965  C C    . GLU A 65  ? 0.1094 0.3922 0.1835 -0.0011 -0.0064 -0.0785 65   GLU A C    
966  O O    . GLU A 65  ? 0.1300 0.5520 0.2298 -0.0781 0.0322  -0.1433 65   GLU A O    
967  C CB   . GLU A 65  ? 0.1603 0.3969 0.1556 0.0686  0.0233  0.0563  65   GLU A CB   
968  C CG   A GLU A 65  ? 0.1973 0.4482 0.3099 0.0935  -0.0963 0.0114  65   GLU A CG   
969  C CG   B GLU A 65  ? 0.1609 0.2178 0.1533 0.0737  0.0160  0.0525  65   GLU A CG   
970  C CD   A GLU A 65  ? 0.1781 0.2924 0.4245 -0.0148 -0.0603 0.0765  65   GLU A CD   
971  C CD   B GLU A 65  ? 0.2270 0.1244 0.1631 0.0388  -0.0522 -0.0085 65   GLU A CD   
972  O OE1  A GLU A 65  ? 0.5124 0.3709 0.7697 -0.1985 -0.1904 0.1062  65   GLU A OE1  
973  O OE1  B GLU A 65  ? 0.1638 0.1238 0.1632 0.0021  -0.0113 0.0055  65   GLU A OE1  
974  O OE2  A GLU A 65  ? 0.1576 0.3671 0.3454 0.0475  -0.0322 -0.0077 65   GLU A OE2  
975  O OE2  B GLU A 65  ? 0.1666 0.1348 0.1776 0.0183  -0.0406 -0.0016 65   GLU A OE2  
976  H H    . GLU A 65  ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  65   GLU A H    
977  H HA   . GLU A 65  ? 0.2409 0.2409 0.2409 0.0000  0.0000  0.0000  65   GLU A HA   
978  H HB2  . GLU A 65  ? 0.2851 0.2851 0.2851 0.0000  0.0000  0.0000  65   GLU A HB2  
979  H HB3  . GLU A 65  ? 0.2851 0.2851 0.2851 0.0000  0.0000  0.0000  65   GLU A HB3  
980  H HG2  A GLU A 65  ? 0.3821 0.3821 0.3821 0.0000  0.0000  0.0000  65   GLU A HG2  
981  H HG2  B GLU A 65  ? 0.2128 0.2128 0.2128 0.0000  0.0000  0.0000  65   GLU A HG2  
982  H HG3  A GLU A 65  ? 0.3821 0.3821 0.3821 0.0000  0.0000  0.0000  65   GLU A HG3  
983  H HG3  B GLU A 65  ? 0.2128 0.2128 0.2128 0.0000  0.0000  0.0000  65   GLU A HG3  
984  N N    . LEU A 66  ? 0.1113 0.3580 0.2311 -0.0377 0.0107  -0.1213 66   LEU A N    
985  C CA   . LEU A 66  ? 0.1476 0.3984 0.2466 -0.1003 0.0407  -0.1466 66   LEU A CA   
986  C C    . LEU A 66  ? 0.1474 0.4824 0.2222 -0.0172 0.0246  -0.1673 66   LEU A C    
987  O O    . LEU A 66  ? 0.1192 0.3799 0.2071 0.0204  -0.0091 -0.1425 66   LEU A O    
988  C CB   . LEU A 66  ? 0.2278 0.2837 0.2626 -0.0683 0.0481  -0.1131 66   LEU A CB   
989  C CG   . LEU A 66  ? 0.2502 0.3693 0.3404 -0.1103 0.0446  0.0012  66   LEU A CG   
990  C CD1  . LEU A 66  ? 0.3061 0.2528 0.4061 -0.0718 0.0107  0.0045  66   LEU A CD1  
991  C CD2  . LEU A 66  ? 0.3252 0.5917 0.7071 -0.1881 0.0541  0.2191  66   LEU A CD2  
992  H H    . LEU A 66  ? 0.2802 0.2802 0.2802 0.0000  0.0000  0.0000  66   LEU A H    
993  H HA   . LEU A 66  ? 0.3170 0.3170 0.3170 0.0000  0.0000  0.0000  66   LEU A HA   
994  H HB2  . LEU A 66  ? 0.3097 0.3097 0.3097 0.0000  0.0000  0.0000  66   LEU A HB2  
995  H HB3  . LEU A 66  ? 0.3097 0.3097 0.3097 0.0000  0.0000  0.0000  66   LEU A HB3  
996  H HG   . LEU A 66  ? 0.3840 0.3840 0.3840 0.0000  0.0000  0.0000  66   LEU A HG   
997  H HD11 . LEU A 66  ? 0.4825 0.4825 0.4825 0.0000  0.0000  0.0000  66   LEU A HD11 
998  H HD12 . LEU A 66  ? 0.4825 0.4825 0.4825 0.0000  0.0000  0.0000  66   LEU A HD12 
999  H HD13 . LEU A 66  ? 0.4825 0.4825 0.4825 0.0000  0.0000  0.0000  66   LEU A HD13 
1000 H HD21 . LEU A 66  ? 0.8120 0.8120 0.8120 0.0000  0.0000  0.0000  66   LEU A HD21 
1001 H HD22 . LEU A 66  ? 0.8120 0.8120 0.8120 0.0000  0.0000  0.0000  66   LEU A HD22 
1002 H HD23 . LEU A 66  ? 0.8120 0.8120 0.8120 0.0000  0.0000  0.0000  66   LEU A HD23 
1003 N N    . SER A 67  ? 0.1236 0.6038 0.2678 0.0045  0.0695  -0.1400 67   SER A N    
1004 C CA   . SER A 67  ? 0.2533 0.5652 0.3234 0.1237  -0.0274 -0.2314 67   SER A CA   
1005 C C    . SER A 67  ? 0.1203 0.4431 0.2531 0.0744  -0.0269 -0.1681 67   SER A C    
1006 O O    . SER A 67  ? 0.1364 0.3790 0.1917 0.0551  -0.0178 -0.0856 67   SER A O    
1007 C CB   A SER A 67  ? 0.1944 0.2966 0.3111 -0.0110 0.1104  -0.0904 67   SER A CB   
1008 C CB   B SER A 67  ? 0.1941 0.4622 0.3220 0.0494  0.1062  -0.0776 67   SER A CB   
1009 O OG   A SER A 67  ? 0.4030 0.3237 0.5359 -0.0682 0.1901  -0.2268 67   SER A OG   
1010 O OG   B SER A 67  ? 0.1427 0.3934 0.1926 -0.0612 0.0293  -0.1518 67   SER A OG   
1011 H H    . SER A 67  ? 0.3981 0.3981 0.3981 0.0000  0.0000  0.0000  67   SER A H    
1012 H HA   A SER A 67  ? 0.4567 0.4567 0.4567 0.0000  0.0000  0.0000  67   SER A HA   
1013 H HB2  A SER A 67  ? 0.3208 0.3208 0.3208 0.0000  0.0000  0.0000  67   SER A HB2  
1014 H HB2  B SER A 67  ? 0.3914 0.3914 0.3914 0.0000  0.0000  0.0000  67   SER A HB2  
1015 H HB3  A SER A 67  ? 0.3208 0.3208 0.3208 0.0000  0.0000  0.0000  67   SER A HB3  
1016 H HB3  B SER A 67  ? 0.3914 0.3914 0.3914 0.0000  0.0000  0.0000  67   SER A HB3  
1017 H HG   A SER A 67  ? 0.6314 0.6314 0.6314 0.0000  0.0000  0.0000  67   SER A HG   
1018 H HG   B SER A 67  ? 0.3644 0.3644 0.3644 0.0000  0.0000  0.0000  67   SER A HG   
1019 N N    . GLY A 68  ? 0.1607 0.3266 0.3718 0.0885  -0.0930 -0.1669 68   GLY A N    
1020 C CA   . GLY A 68  ? 0.1526 0.2135 0.3551 0.0352  -0.0853 -0.0469 68   GLY A CA   
1021 C C    . GLY A 68  ? 0.1547 0.1728 0.2973 0.0212  -0.0692 -0.0216 68   GLY A C    
1022 O O    . GLY A 68  ? 0.1672 0.2229 0.2655 0.0022  -0.0681 0.0350  68   GLY A O    
1023 H H    . GLY A 68  ? 0.3436 0.3436 0.3436 0.0000  0.0000  0.0000  68   GLY A H    
1024 H HA2  . GLY A 68  ? 0.2885 0.2885 0.2885 0.0000  0.0000  0.0000  68   GLY A HA2  
1025 H HA3  . GLY A 68  ? 0.2885 0.2885 0.2885 0.0000  0.0000  0.0000  68   GLY A HA3  
1026 N N    . TYR A 69  ? 0.1202 0.1843 0.2483 0.0353  -0.0429 -0.0824 69   TYR A N    
1027 C CA   . TYR A 69  ? 0.1073 0.1712 0.1815 0.0128  -0.0189 -0.0441 69   TYR A CA   
1028 C C    . TYR A 69  ? 0.1106 0.1719 0.1989 0.0200  -0.0191 -0.0568 69   TYR A C    
1029 O O    . TYR A 69  ? 0.1360 0.2016 0.2694 0.0043  0.0029  -0.1090 69   TYR A O    
1030 C CB   . TYR A 69  ? 0.1145 0.2019 0.1568 0.0050  -0.0131 -0.0412 69   TYR A CB   
1031 C CG   . TYR A 69  ? 0.1086 0.1811 0.1307 0.0084  -0.0024 -0.0161 69   TYR A CG   
1032 C CD1  . TYR A 69  ? 0.1121 0.1984 0.1636 0.0012  -0.0174 -0.0295 69   TYR A CD1  
1033 C CD2  . TYR A 69  ? 0.1276 0.1931 0.1724 0.0279  0.0177  0.0206  69   TYR A CD2  
1034 C CE1  . TYR A 69  ? 0.1539 0.2164 0.1956 -0.0373 -0.0045 -0.0335 69   TYR A CE1  
1035 C CE2  . TYR A 69  ? 0.2172 0.1687 0.2335 0.0271  0.0748  0.0230  69   TYR A CE2  
1036 C CZ   . TYR A 69  ? 0.2440 0.1910 0.2046 -0.0368 0.0641  -0.0374 69   TYR A CZ   
1037 O OH   . TYR A 69  ? 0.4297 0.2242 0.3443 -0.1170 0.1523  -0.1073 69   TYR A OH   
1038 H H    . TYR A 69  ? 0.2211 0.2211 0.2211 0.0000  0.0000  0.0000  69   TYR A H    
1039 H HA   . TYR A 69  ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  69   TYR A HA   
1040 H HB2  . TYR A 69  ? 0.1892 0.1892 0.1892 0.0000  0.0000  0.0000  69   TYR A HB2  
1041 H HB3  . TYR A 69  ? 0.1892 0.1892 0.1892 0.0000  0.0000  0.0000  69   TYR A HB3  
1042 H HD1  . TYR A 69  ? 0.1896 0.1896 0.1896 0.0000  0.0000  0.0000  69   TYR A HD1  
1043 H HD2  . TYR A 69  ? 0.1972 0.1972 0.1972 0.0000  0.0000  0.0000  69   TYR A HD2  
1044 H HE1  . TYR A 69  ? 0.2263 0.2263 0.2263 0.0000  0.0000  0.0000  69   TYR A HE1  
1045 H HE2  . TYR A 69  ? 0.2477 0.2477 0.2477 0.0000  0.0000  0.0000  69   TYR A HE2  
1046 H HH   . TYR A 69  ? 0.4991 0.4991 0.4991 0.0000  0.0000  0.0000  69   TYR A HH   
1047 N N    . THR A 70  ? 0.1109 0.1376 0.1623 0.0170  -0.0313 -0.0363 70   THR A N    
1048 C CA   . THR A 70  ? 0.1262 0.1239 0.1589 0.0148  -0.0303 -0.0198 70   THR A CA   
1049 C C    . THR A 70  ? 0.1143 0.1214 0.1326 0.0126  -0.0281 -0.0164 70   THR A C    
1050 O O    . THR A 70  ? 0.1305 0.1206 0.1818 0.0146  -0.0433 -0.0277 70   THR A O    
1051 C CB   . THR A 70  ? 0.1657 0.1467 0.1464 0.0188  -0.0458 -0.0113 70   THR A CB   
1052 O OG1  . THR A 70  ? 0.1851 0.1672 0.1609 0.0239  -0.0490 -0.0134 70   THR A OG1  
1053 C CG2  . THR A 70  ? 0.1963 0.1643 0.2049 0.0532  -0.0749 -0.0186 70   THR A CG2  
1054 H H    . THR A 70  ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  70   THR A H    
1055 H HA   . THR A 70  ? 0.1636 0.1636 0.1636 0.0000  0.0000  0.0000  70   THR A HA   
1056 H HB   . THR A 70  ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  70   THR A HB   
1057 H HG1  . THR A 70  ? 0.2566 0.2566 0.2566 0.0000  0.0000  0.0000  70   THR A HG1  
1058 H HG21 . THR A 70  ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  70   THR A HG21 
1059 H HG22 . THR A 70  ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  70   THR A HG22 
1060 H HG23 . THR A 70  ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  70   THR A HG23 
1061 N N    . TRP A 71  ? 0.1168 0.1161 0.1332 0.0164  -0.0220 -0.0088 71   TRP A N    
1062 C CA   . TRP A 71  ? 0.1158 0.1193 0.1304 0.0066  -0.0225 -0.0091 71   TRP A CA   
1063 C C    . TRP A 71  ? 0.1225 0.1242 0.1186 0.0071  -0.0183 -0.0085 71   TRP A C    
1064 O O    . TRP A 71  ? 0.1272 0.1239 0.1307 0.0084  -0.0206 0.0061  71   TRP A O    
1065 C CB   . TRP A 71  ? 0.1202 0.1180 0.1260 0.0140  -0.0141 -0.0024 71   TRP A CB   
1066 C CG   . TRP A 71  ? 0.1234 0.1129 0.1194 0.0107  -0.0157 0.0031  71   TRP A CG   
1067 C CD1  . TRP A 71  ? 0.1030 0.1161 0.1266 0.0111  -0.0082 0.0032  71   TRP A CD1  
1068 C CD2  . TRP A 71  ? 0.1024 0.1153 0.1210 0.0113  -0.0146 0.0066  71   TRP A CD2  
1069 N NE1  . TRP A 71  ? 0.1193 0.1111 0.1236 0.0149  -0.0168 0.0001  71   TRP A NE1  
1070 C CE2  . TRP A 71  ? 0.1196 0.1092 0.1204 0.0140  -0.0163 0.0045  71   TRP A CE2  
1071 C CE3  . TRP A 71  ? 0.1164 0.1235 0.1196 0.0115  -0.0122 0.0045  71   TRP A CE3  
1072 C CZ2  . TRP A 71  ? 0.1138 0.1077 0.1300 0.0083  -0.0181 0.0059  71   TRP A CZ2  
1073 C CZ3  . TRP A 71  ? 0.1078 0.1305 0.1322 0.0054  -0.0152 0.0060  71   TRP A CZ3  
1074 C CH2  . TRP A 71  ? 0.1233 0.1182 0.1273 0.0034  -0.0219 0.0079  71   TRP A CH2  
1075 H H    . TRP A 71  ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  71   TRP A H    
1076 H HA   . TRP A 71  ? 0.1462 0.1462 0.1462 0.0000  0.0000  0.0000  71   TRP A HA   
1077 H HB2  . TRP A 71  ? 0.1456 0.1456 0.1456 0.0000  0.0000  0.0000  71   TRP A HB2  
1078 H HB3  . TRP A 71  ? 0.1456 0.1456 0.1456 0.0000  0.0000  0.0000  71   TRP A HB3  
1079 H HD1  . TRP A 71  ? 0.1383 0.1383 0.1383 0.0000  0.0000  0.0000  71   TRP A HD1  
1080 H HE1  . TRP A 71  ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  71   TRP A HE1  
1081 H HE3  . TRP A 71  ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  71   TRP A HE3  
1082 H HZ2  . TRP A 71  ? 0.1406 0.1406 0.1406 0.0000  0.0000  0.0000  71   TRP A HZ2  
1083 H HZ3  . TRP A 71  ? 0.1482 0.1482 0.1482 0.0000  0.0000  0.0000  71   TRP A HZ3  
1084 H HH2  . TRP A 71  ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  71   TRP A HH2  
1085 N N    . SER A 72  ? 0.1268 0.1280 0.1345 0.0072  -0.0091 -0.0149 72   SER A N    
1086 C CA   . SER A 72  ? 0.1236 0.1350 0.1383 0.0059  -0.0162 -0.0015 72   SER A CA   
1087 C C    . SER A 72  ? 0.1261 0.1289 0.1431 0.0033  -0.0100 -0.0071 72   SER A C    
1088 O O    . SER A 72  ? 0.1366 0.1557 0.1788 0.0169  -0.0197 -0.0396 72   SER A O    
1089 C CB   . SER A 72  ? 0.1569 0.1512 0.1321 0.0070  -0.0169 0.0015  72   SER A CB   
1090 O OG   . SER A 72  ? 0.1751 0.1962 0.1688 -0.0128 -0.0189 0.0288  72   SER A OG   
1091 H H    . SER A 72  ? 0.1558 0.1558 0.1558 0.0000  0.0000  0.0000  72   SER A H    
1092 H HA   . SER A 72  ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  72   SER A HA   
1093 H HB2  . SER A 72  ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  72   SER A HB2  
1094 H HB3  . SER A 72  ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  72   SER A HB3  
1095 H HG   . SER A 72  ? 0.2700 0.2700 0.2700 0.0000  0.0000  0.0000  72   SER A HG   
1096 N N    . ILE A 73  ? 0.1168 0.1226 0.1373 0.0113  -0.0122 -0.0032 73   ILE A N    
1097 C CA   . ILE A 73  ? 0.1230 0.1286 0.1330 0.0074  -0.0120 -0.0027 73   ILE A CA   
1098 C C    . ILE A 73  ? 0.1268 0.1253 0.1236 0.0056  -0.0094 -0.0056 73   ILE A C    
1099 O O    . ILE A 73  ? 0.1358 0.1342 0.1718 0.0030  -0.0067 -0.0168 73   ILE A O    
1100 C CB   . ILE A 73  ? 0.1188 0.1474 0.1438 0.0037  -0.0136 0.0166  73   ILE A CB   
1101 C CG1  . ILE A 73  ? 0.1394 0.1258 0.1713 0.0083  -0.0177 0.0142  73   ILE A CG1  
1102 C CG2  . ILE A 73  ? 0.1719 0.1789 0.1387 0.0522  -0.0147 0.0016  73   ILE A CG2  
1103 C CD1  . ILE A 73  ? 0.1690 0.1444 0.1833 -0.0088 -0.0438 0.0221  73   ILE A CD1  
1104 H H    . ILE A 73  ? 0.1507 0.1507 0.1507 0.0000  0.0000  0.0000  73   ILE A H    
1105 H HA   . ILE A 73  ? 0.1539 0.1539 0.1539 0.0000  0.0000  0.0000  73   ILE A HA   
1106 H HB   . ILE A 73  ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  73   ILE A HB   
1107 H HG12 . ILE A 73  ? 0.1747 0.1747 0.1747 0.0000  0.0000  0.0000  73   ILE A HG12 
1108 H HG13 . ILE A 73  ? 0.1747 0.1747 0.1747 0.0000  0.0000  0.0000  73   ILE A HG13 
1109 H HG21 . ILE A 73  ? 0.2447 0.2447 0.2447 0.0000  0.0000  0.0000  73   ILE A HG21 
1110 H HG22 . ILE A 73  ? 0.2447 0.2447 0.2447 0.0000  0.0000  0.0000  73   ILE A HG22 
1111 H HG23 . ILE A 73  ? 0.2447 0.2447 0.2447 0.0000  0.0000  0.0000  73   ILE A HG23 
1112 H HD11 . ILE A 73  ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  73   ILE A HD11 
1113 H HD12 . ILE A 73  ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  73   ILE A HD12 
1114 H HD13 . ILE A 73  ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  73   ILE A HD13 
1115 N N    . SER A 74  ? 0.1200 0.1389 0.1468 0.0015  -0.0105 0.0038  74   SER A N    
1116 C CA   . SER A 74  ? 0.1226 0.1413 0.1567 0.0095  -0.0071 0.0152  74   SER A CA   
1117 C C    . SER A 74  ? 0.1209 0.1355 0.1467 0.0056  -0.0177 0.0045  74   SER A C    
1118 O O    . SER A 74  ? 0.1366 0.1380 0.2682 0.0100  -0.0574 -0.0095 74   SER A O    
1119 C CB   A SER A 74  ? 0.1823 0.3121 0.1756 0.0583  0.0109  0.1054  74   SER A CB   
1120 C CB   B SER A 74  ? 0.1413 0.2859 0.1780 0.0082  -0.0115 0.0930  74   SER A CB   
1121 O OG   A SER A 74  ? 0.2357 0.7495 0.2663 -0.0396 0.0822  0.1296  74   SER A OG   
1122 O OG   B SER A 74  ? 0.1606 0.3453 0.1869 0.0494  0.0163  0.1181  74   SER A OG   
1123 H H    . SER A 74  ? 0.1622 0.1622 0.1622 0.0000  0.0000  0.0000  74   SER A H    
1124 H HA   A SER A 74  ? 0.1682 0.1682 0.1682 0.0000  0.0000  0.0000  74   SER A HA   
1125 H HB2  A SER A 74  ? 0.2680 0.2680 0.2680 0.0000  0.0000  0.0000  74   SER A HB2  
1126 H HB2  B SER A 74  ? 0.2420 0.2420 0.2420 0.0000  0.0000  0.0000  74   SER A HB2  
1127 H HB3  A SER A 74  ? 0.2680 0.2680 0.2680 0.0000  0.0000  0.0000  74   SER A HB3  
1128 H HB3  B SER A 74  ? 0.2420 0.2420 0.2420 0.0000  0.0000  0.0000  74   SER A HB3  
1129 H HG   A SER A 74  ? 0.6258 0.6258 0.6258 0.0000  0.0000  0.0000  74   SER A HG   
1130 H HG   B SER A 74  ? 0.3464 0.3464 0.3464 0.0000  0.0000  0.0000  74   SER A HG   
1131 N N    . TYR A 75  ? 0.1279 0.1231 0.1251 0.0133  -0.0094 0.0087  75   TYR A N    
1132 C CA   . TYR A 75  ? 0.1238 0.1253 0.1202 0.0130  -0.0127 0.0014  75   TYR A CA   
1133 C C    . TYR A 75  ? 0.1270 0.1290 0.1119 0.0031  -0.0150 0.0079  75   TYR A C    
1134 O O    . TYR A 75  ? 0.1418 0.1574 0.1329 -0.0045 -0.0176 0.0200  75   TYR A O    
1135 C CB   . TYR A 75  ? 0.1271 0.1288 0.1190 0.0075  -0.0114 0.0093  75   TYR A CB   
1136 C CG   . TYR A 75  ? 0.1194 0.1301 0.1145 0.0125  -0.0125 0.0037  75   TYR A CG   
1137 C CD1  . TYR A 75  ? 0.1188 0.1200 0.1205 0.0086  -0.0212 0.0041  75   TYR A CD1  
1138 C CD2  . TYR A 75  ? 0.1222 0.1217 0.1431 0.0086  -0.0101 0.0089  75   TYR A CD2  
1139 C CE1  . TYR A 75  ? 0.1294 0.1163 0.1277 0.0121  -0.0108 0.0056  75   TYR A CE1  
1140 C CE2  . TYR A 75  ? 0.1377 0.1226 0.1258 0.0147  0.0047  -0.0033 75   TYR A CE2  
1141 C CZ   . TYR A 75  ? 0.1277 0.1237 0.1229 0.0124  -0.0057 0.0008  75   TYR A CZ   
1142 O OH   . TYR A 75  ? 0.1390 0.1229 0.1387 0.0153  -0.0003 -0.0016 75   TYR A OH   
1143 H H    . TYR A 75  ? 0.1505 0.1505 0.1505 0.0000  0.0000  0.0000  75   TYR A H    
1144 H HA   . TYR A 75  ? 0.1477 0.1477 0.1477 0.0000  0.0000  0.0000  75   TYR A HA   
1145 H HB2  . TYR A 75  ? 0.1500 0.1500 0.1500 0.0000  0.0000  0.0000  75   TYR A HB2  
1146 H HB3  . TYR A 75  ? 0.1500 0.1500 0.1500 0.0000  0.0000  0.0000  75   TYR A HB3  
1147 H HD1  . TYR A 75  ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  75   TYR A HD1  
1148 H HD2  . TYR A 75  ? 0.1548 0.1548 0.1548 0.0000  0.0000  0.0000  75   TYR A HD2  
1149 H HE1  . TYR A 75  ? 0.1493 0.1493 0.1493 0.0000  0.0000  0.0000  75   TYR A HE1  
1150 H HE2  . TYR A 75  ? 0.1544 0.1544 0.1544 0.0000  0.0000  0.0000  75   TYR A HE2  
1151 H HH   . TYR A 75  ? 0.2004 0.2004 0.2004 0.0000  0.0000  0.0000  75   TYR A HH   
1152 N N    . GLY A 76  ? 0.1285 0.1376 0.1247 0.0057  0.0025  -0.0009 76   GLY A N    
1153 C CA   . GLY A 76  ? 0.1364 0.1408 0.1515 0.0001  0.0031  -0.0102 76   GLY A CA   
1154 C C    . GLY A 76  ? 0.1177 0.1564 0.1322 0.0035  -0.0042 0.0043  76   GLY A C    
1155 O O    . GLY A 76  ? 0.1704 0.1886 0.1423 -0.0178 0.0092  0.0111  76   GLY A O    
1156 H H    . GLY A 76  ? 0.1563 0.1563 0.1563 0.0000  0.0000  0.0000  76   GLY A H    
1157 H HA2  . GLY A 76  ? 0.1715 0.1715 0.1715 0.0000  0.0000  0.0000  76   GLY A HA2  
1158 H HA3  . GLY A 76  ? 0.1715 0.1715 0.1715 0.0000  0.0000  0.0000  76   GLY A HA3  
1159 N N    . ASP A 77  ? 0.1366 0.1350 0.1422 0.0009  -0.0132 0.0046  77   ASP A N    
1160 C CA   . ASP A 77  ? 0.1305 0.1401 0.1799 -0.0033 -0.0233 -0.0010 77   ASP A CA   
1161 C C    . ASP A 77  ? 0.1354 0.1432 0.1718 -0.0071 0.0001  0.0199  77   ASP A C    
1162 O O    . ASP A 77  ? 0.1805 0.1502 0.2107 -0.0095 -0.0319 0.0373  77   ASP A O    
1163 C CB   . ASP A 77  ? 0.1508 0.1370 0.1952 0.0093  -0.0379 -0.0026 77   ASP A CB   
1164 C CG   . ASP A 77  ? 0.1656 0.1389 0.1616 0.0225  -0.0430 -0.0039 77   ASP A CG   
1165 O OD1  . ASP A 77  ? 0.1540 0.1585 0.1442 0.0129  -0.0173 0.0137  77   ASP A OD1  
1166 O OD2  . ASP A 77  ? 0.2148 0.1873 0.1739 0.0764  -0.0569 -0.0152 77   ASP A OD2  
1167 H H    . ASP A 77  ? 0.1655 0.1655 0.1655 0.0000  0.0000  0.0000  77   ASP A H    
1168 H HA   . ASP A 77  ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  77   ASP A HA   
1169 H HB2  . ASP A 77  ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  77   ASP A HB2  
1170 H HB3  . ASP A 77  ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  77   ASP A HB3  
1171 N N    . GLY A 78  ? 0.1285 0.1481 0.1514 0.0110  -0.0037 0.0206  78   GLY A N    
1172 C CA   . GLY A 78  ? 0.1536 0.1661 0.1481 0.0170  -0.0064 0.0257  78   GLY A CA   
1173 C C    . GLY A 78  ? 0.1290 0.1499 0.1578 0.0084  -0.0168 0.0264  78   GLY A C    
1174 O O    . GLY A 78  ? 0.1663 0.2046 0.1777 0.0500  -0.0074 0.0410  78   GLY A O    
1175 H H    . GLY A 78  ? 0.1712 0.1712 0.1712 0.0000  0.0000  0.0000  78   GLY A H    
1176 H HA2  . GLY A 78  ? 0.1871 0.1871 0.1871 0.0000  0.0000  0.0000  78   GLY A HA2  
1177 H HA3  . GLY A 78  ? 0.1871 0.1871 0.1871 0.0000  0.0000  0.0000  78   GLY A HA3  
1178 N N    . SER A 79  ? 0.1204 0.1302 0.1523 0.0095  -0.0027 0.0170  79   SER A N    
1179 C CA   . SER A 79  ? 0.1211 0.1206 0.1582 0.0064  -0.0101 0.0063  79   SER A CA   
1180 C C    . SER A 79  ? 0.1189 0.1169 0.1391 0.0001  -0.0098 0.0115  79   SER A C    
1181 O O    . SER A 79  ? 0.1296 0.1206 0.1536 0.0033  -0.0081 0.0036  79   SER A O    
1182 C CB   . SER A 79  ? 0.1361 0.1339 0.1556 0.0032  -0.0163 0.0018  79   SER A CB   
1183 O OG   . SER A 79  ? 0.1588 0.1334 0.1504 0.0135  -0.0138 0.0010  79   SER A OG   
1184 H H    . SER A 79  ? 0.1611 0.1611 0.1611 0.0000  0.0000  0.0000  79   SER A H    
1185 H HA   . SER A 79  ? 0.1600 0.1600 0.1600 0.0000  0.0000  0.0000  79   SER A HA   
1186 H HB2  . SER A 79  ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  79   SER A HB2  
1187 H HB3  . SER A 79  ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  79   SER A HB3  
1188 H HG   . SER A 79  ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  79   SER A HG   
1189 N N    . SER A 80  ? 0.1158 0.1199 0.1525 0.0021  -0.0094 -0.0040 80   SER A N    
1190 C CA   . SER A 80  ? 0.1142 0.1261 0.1468 0.0040  -0.0092 -0.0016 80   SER A CA   
1191 C C    . SER A 80  ? 0.1193 0.1248 0.1453 0.0040  -0.0114 0.0024  80   SER A C    
1192 O O    . SER A 80  ? 0.1270 0.1257 0.1649 0.0040  -0.0126 -0.0101 80   SER A O    
1193 C CB   . SER A 80  ? 0.1457 0.1562 0.1531 0.0060  -0.0153 0.0138  80   SER A CB   
1194 O OG   . SER A 80  ? 0.1714 0.1577 0.1703 0.0150  -0.0174 0.0219  80   SER A OG   
1195 H H    . SER A 80  ? 0.1553 0.1553 0.1553 0.0000  0.0000  0.0000  80   SER A H    
1196 H HA   . SER A 80  ? 0.1549 0.1549 0.1549 0.0000  0.0000  0.0000  80   SER A HA   
1197 H HB2  . SER A 80  ? 0.1820 0.1820 0.1820 0.0000  0.0000  0.0000  80   SER A HB2  
1198 H HB3  . SER A 80  ? 0.1820 0.1820 0.1820 0.0000  0.0000  0.0000  80   SER A HB3  
1199 H HG   . SER A 80  ? 0.2498 0.2498 0.2498 0.0000  0.0000  0.0000  80   SER A HG   
1200 N N    . ALA A 81  ? 0.1090 0.1191 0.1413 0.0063  -0.0091 -0.0034 81   ALA A N    
1201 C CA   . ALA A 81  ? 0.1167 0.1131 0.1360 -0.0022 -0.0151 -0.0014 81   ALA A CA   
1202 C C    . ALA A 81  ? 0.1070 0.1216 0.1289 0.0042  -0.0080 0.0038  81   ALA A C    
1203 O O    . ALA A 81  ? 0.1167 0.1265 0.1407 0.0110  -0.0111 -0.0113 81   ALA A O    
1204 C CB   . ALA A 81  ? 0.1344 0.1373 0.1329 0.0000  -0.0202 -0.0040 81   ALA A CB   
1205 H H    . ALA A 81  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  81   ALA A H    
1206 H HA   . ALA A 81  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  81   ALA A HA   
1207 H HB1  . ALA A 81  ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  81   ALA A HB1  
1208 H HB2  . ALA A 81  ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  81   ALA A HB2  
1209 H HB3  . ALA A 81  ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  81   ALA A HB3  
1210 N N    . SER A 82  ? 0.1079 0.1194 0.1298 0.0075  -0.0075 -0.0041 82   SER A N    
1211 C CA   . SER A 82  ? 0.1109 0.1204 0.1313 0.0072  -0.0142 -0.0063 82   SER A CA   
1212 C C    . SER A 82  ? 0.1170 0.1042 0.1228 0.0137  -0.0164 0.0079  82   SER A C    
1213 O O    . SER A 82  ? 0.1314 0.1136 0.1252 0.0054  -0.0146 0.0001  82   SER A O    
1214 C CB   . SER A 82  ? 0.1334 0.1245 0.1322 0.0091  -0.0079 0.0086  82   SER A CB   
1215 O OG   . SER A 82  ? 0.1535 0.1314 0.1434 0.0121  -0.0107 0.0121  82   SER A OG   
1216 H H    . SER A 82  ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  82   SER A H    
1217 H HA   . SER A 82  ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  82   SER A HA   
1218 H HB2  . SER A 82  ? 0.1560 0.1560 0.1560 0.0000  0.0000  0.0000  82   SER A HB2  
1219 H HB3  . SER A 82  ? 0.1560 0.1560 0.1560 0.0000  0.0000  0.0000  82   SER A HB3  
1220 H HG   . SER A 82  ? 0.2142 0.2142 0.2142 0.0000  0.0000  0.0000  82   SER A HG   
1221 N N    . GLY A 83  ? 0.1166 0.1133 0.1219 0.0096  -0.0135 -0.0030 83   GLY A N    
1222 C CA   . GLY A 83  ? 0.1162 0.1062 0.1279 0.0089  -0.0148 -0.0040 83   GLY A CA   
1223 C C    . GLY A 83  ? 0.1195 0.1086 0.1194 0.0207  -0.0090 0.0006  83   GLY A C    
1224 O O    . GLY A 83  ? 0.1154 0.1196 0.1228 0.0091  -0.0117 -0.0026 83   GLY A O    
1225 H H    . GLY A 83  ? 0.1407 0.1407 0.1407 0.0000  0.0000  0.0000  83   GLY A H    
1226 H HA2  . GLY A 83  ? 0.1401 0.1401 0.1401 0.0000  0.0000  0.0000  83   GLY A HA2  
1227 H HA3  . GLY A 83  ? 0.1401 0.1401 0.1401 0.0000  0.0000  0.0000  83   GLY A HA3  
1228 N N    . ASN A 84  ? 0.1135 0.1148 0.1250 0.0160  -0.0131 -0.0089 84   ASN A N    
1229 C CA   . ASN A 84  ? 0.1101 0.1138 0.1305 0.0075  -0.0175 -0.0114 84   ASN A CA   
1230 C C    . ASN A 84  ? 0.1115 0.1152 0.1191 0.0183  -0.0098 -0.0138 84   ASN A C    
1231 O O    . ASN A 84  ? 0.1022 0.1150 0.1324 0.0049  -0.0155 -0.0033 84   ASN A O    
1232 C CB   . ASN A 84  ? 0.1206 0.1236 0.1466 0.0227  -0.0185 0.0009  84   ASN A CB   
1233 C CG   . ASN A 84  ? 0.1227 0.1222 0.1387 0.0207  -0.0018 0.0024  84   ASN A CG   
1234 O OD1  . ASN A 84  ? 0.1517 0.1803 0.2545 0.0489  -0.0127 -0.0341 84   ASN A OD1  
1235 N ND2  . ASN A 84  ? 0.1248 0.1089 0.1282 0.0346  -0.0036 -0.0123 84   ASN A ND2  
1236 H H    . ASN A 84  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  84   ASN A H    
1237 H HA   . ASN A 84  ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  84   ASN A HA   
1238 H HB2  . ASN A 84  ? 0.1563 0.1563 0.1563 0.0000  0.0000  0.0000  84   ASN A HB2  
1239 H HB3  . ASN A 84  ? 0.1563 0.1563 0.1563 0.0000  0.0000  0.0000  84   ASN A HB3  
1240 H HD21 . ASN A 84  ? 0.1448 0.1448 0.1448 0.0000  0.0000  0.0000  84   ASN A HD21 
1241 H HD22 . ASN A 84  ? 0.1448 0.1448 0.1448 0.0000  0.0000  0.0000  84   ASN A HD22 
1242 N N    . VAL A 85  ? 0.1002 0.1155 0.1378 0.0081  -0.0144 -0.0075 85   VAL A N    
1243 C CA   . VAL A 85  ? 0.1038 0.1168 0.1379 0.0126  -0.0084 0.0002  85   VAL A CA   
1244 C C    . VAL A 85  ? 0.1032 0.1132 0.1406 0.0044  -0.0079 -0.0004 85   VAL A C    
1245 O O    . VAL A 85  ? 0.1004 0.1417 0.1456 0.0075  -0.0122 0.0058  85   VAL A O    
1246 C CB   . VAL A 85  ? 0.1058 0.1250 0.1491 0.0109  -0.0074 -0.0133 85   VAL A CB   
1247 C CG1  . VAL A 85  ? 0.1871 0.1099 0.1751 0.0207  0.0097  -0.0024 85   VAL A CG1  
1248 C CG2  . VAL A 85  ? 0.1298 0.1176 0.1565 0.0053  0.0013  -0.0190 85   VAL A CG2  
1249 H H    . VAL A 85  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  85   VAL A H    
1250 H HA   . VAL A 85  ? 0.1434 0.1434 0.1434 0.0000  0.0000  0.0000  85   VAL A HA   
1251 H HB   . VAL A 85  ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  85   VAL A HB   
1252 H HG11 . VAL A 85  ? 0.2361 0.2361 0.2361 0.0000  0.0000  0.0000  85   VAL A HG11 
1253 H HG12 . VAL A 85  ? 0.2361 0.2361 0.2361 0.0000  0.0000  0.0000  85   VAL A HG12 
1254 H HG13 . VAL A 85  ? 0.2361 0.2361 0.2361 0.0000  0.0000  0.0000  85   VAL A HG13 
1255 H HG21 . VAL A 85  ? 0.2020 0.2020 0.2020 0.0000  0.0000  0.0000  85   VAL A HG21 
1256 H HG22 . VAL A 85  ? 0.2020 0.2020 0.2020 0.0000  0.0000  0.0000  85   VAL A HG22 
1257 H HG23 . VAL A 85  ? 0.2020 0.2020 0.2020 0.0000  0.0000  0.0000  85   VAL A HG23 
1258 N N    . PHE A 86  ? 0.1047 0.1312 0.1404 0.0192  -0.0116 0.0026  86   PHE A N    
1259 C CA   . PHE A 86  ? 0.1046 0.1428 0.1344 0.0193  -0.0029 0.0119  86   PHE A CA   
1260 C C    . PHE A 86  ? 0.0954 0.1440 0.1657 0.0124  -0.0075 0.0184  86   PHE A C    
1261 O O    . PHE A 86  ? 0.1075 0.2211 0.3315 0.0131  -0.0063 0.1363  86   PHE A O    
1262 C CB   . PHE A 86  ? 0.1408 0.1423 0.1425 0.0065  -0.0090 0.0039  86   PHE A CB   
1263 C CG   . PHE A 86  ? 0.1605 0.1405 0.1364 0.0180  0.0103  0.0010  86   PHE A CG   
1264 C CD1  . PHE A 86  ? 0.1670 0.1504 0.1493 0.0138  0.0123  0.0065  86   PHE A CD1  
1265 C CD2  . PHE A 86  ? 0.1584 0.1559 0.1561 0.0286  0.0020  -0.0036 86   PHE A CD2  
1266 C CE1  . PHE A 86  ? 0.2165 0.1410 0.1581 0.0225  0.0074  0.0030  86   PHE A CE1  
1267 C CE2  . PHE A 86  ? 0.1951 0.1806 0.1937 0.0523  0.0000  0.0045  86   PHE A CE2  
1268 C CZ   . PHE A 86  ? 0.2283 0.1586 0.1829 0.0421  -0.0310 0.0245  86   PHE A CZ   
1269 H H    . PHE A 86  ? 0.1505 0.1505 0.1505 0.0000  0.0000  0.0000  86   PHE A H    
1270 H HA   . PHE A 86  ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  86   PHE A HA   
1271 H HB2  . PHE A 86  ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  86   PHE A HB2  
1272 H HB3  . PHE A 86  ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  86   PHE A HB3  
1273 H HD1  . PHE A 86  ? 0.1867 0.1867 0.1867 0.0000  0.0000  0.0000  86   PHE A HD1  
1274 H HD2  . PHE A 86  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  86   PHE A HD2  
1275 H HE1  . PHE A 86  ? 0.2062 0.2062 0.2062 0.0000  0.0000  0.0000  86   PHE A HE1  
1276 H HE2  . PHE A 86  ? 0.2277 0.2277 0.2277 0.0000  0.0000  0.0000  86   PHE A HE2  
1277 H HZ   . PHE A 86  ? 0.2280 0.2280 0.2280 0.0000  0.0000  0.0000  86   PHE A HZ   
1278 N N    . THR A 87  ? 0.1030 0.1392 0.1387 0.0066  -0.0117 -0.0005 87   THR A N    
1279 C CA   . THR A 87  ? 0.1282 0.1186 0.1388 0.0103  -0.0012 -0.0034 87   THR A CA   
1280 C C    . THR A 87  ? 0.1128 0.1295 0.1421 0.0043  -0.0010 -0.0033 87   THR A C    
1281 O O    . THR A 87  ? 0.1227 0.1568 0.1511 0.0269  -0.0036 -0.0069 87   THR A O    
1282 C CB   . THR A 87  ? 0.1720 0.1407 0.1626 -0.0190 -0.0267 0.0022  87   THR A CB   
1283 O OG1  . THR A 87  ? 0.1639 0.1934 0.2206 -0.0499 -0.0276 0.0114  87   THR A OG1  
1284 C CG2  . THR A 87  ? 0.2405 0.1575 0.1684 -0.0328 -0.0335 -0.0148 87   THR A CG2  
1285 H H    . THR A 87  ? 0.1524 0.1524 0.1524 0.0000  0.0000  0.0000  87   THR A H    
1286 H HA   . THR A 87  ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  87   THR A HA   
1287 H HB   . THR A 87  ? 0.1901 0.1901 0.1901 0.0000  0.0000  0.0000  87   THR A HB   
1288 H HG1  . THR A 87  ? 0.2889 0.2889 0.2889 0.0000  0.0000  0.0000  87   THR A HG1  
1289 H HG21 . THR A 87  ? 0.2832 0.2832 0.2832 0.0000  0.0000  0.0000  87   THR A HG21 
1290 H HG22 . THR A 87  ? 0.2832 0.2832 0.2832 0.0000  0.0000  0.0000  87   THR A HG22 
1291 H HG23 . THR A 87  ? 0.2832 0.2832 0.2832 0.0000  0.0000  0.0000  87   THR A HG23 
1292 N N    . ASP A 88  ? 0.1025 0.1339 0.1350 0.0121  -0.0061 -0.0034 88   ASP A N    
1293 C CA   . ASP A 88  ? 0.1209 0.1346 0.1342 0.0072  -0.0024 -0.0060 88   ASP A CA   
1294 C C    . ASP A 88  ? 0.0941 0.1475 0.1360 0.0055  0.0029  -0.0045 88   ASP A C    
1295 O O    . ASP A 88  ? 0.1343 0.1560 0.1327 0.0304  -0.0047 -0.0067 88   ASP A O    
1296 C CB   . ASP A 88  ? 0.1226 0.1424 0.1436 0.0049  0.0000  -0.0109 88   ASP A CB   
1297 C CG   . ASP A 88  ? 0.1386 0.1507 0.1511 -0.0020 0.0005  -0.0205 88   ASP A CG   
1298 O OD1  . ASP A 88  ? 0.1709 0.1603 0.1549 0.0150  0.0248  -0.0196 88   ASP A OD1  
1299 O OD2  . ASP A 88  ? 0.1526 0.1455 0.1955 0.0032  0.0105  -0.0275 88   ASP A OD2  
1300 H H    . ASP A 88  ? 0.1486 0.1486 0.1486 0.0000  0.0000  0.0000  88   ASP A H    
1301 H HA   . ASP A 88  ? 0.1559 0.1559 0.1559 0.0000  0.0000  0.0000  88   ASP A HA   
1302 H HB2  . ASP A 88  ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  88   ASP A HB2  
1303 H HB3  . ASP A 88  ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  88   ASP A HB3  
1304 N N    . SER A 89  ? 0.1147 0.1495 0.1289 0.0084  -0.0038 -0.0111 89   SER A N    
1305 C CA   . SER A 89  ? 0.1104 0.1511 0.1411 0.0063  -0.0122 -0.0078 89   SER A CA   
1306 C C    . SER A 89  ? 0.1231 0.1406 0.1370 0.0089  -0.0126 -0.0155 89   SER A C    
1307 O O    . SER A 89  ? 0.1250 0.1515 0.2496 0.0221  -0.0458 -0.0581 89   SER A O    
1308 C CB   A SER A 89  ? 0.1291 0.2754 0.1478 0.0198  -0.0014 0.0268  89   SER A CB   
1309 C CB   B SER A 89  ? 0.1528 0.2047 0.1370 -0.0012 0.0001  -0.0032 89   SER A CB   
1310 C CB   C SER A 89  ? 0.1380 0.2072 0.1403 0.0147  -0.0032 0.0068  89   SER A CB   
1311 O OG   A SER A 89  ? 0.1794 0.2981 0.1773 -0.0302 0.0207  0.0591  89   SER A OG   
1312 O OG   B SER A 89  ? 0.1806 0.2298 0.1616 0.0286  -0.0126 -0.0440 89   SER A OG   
1313 O OG   C SER A 89  ? 0.1684 0.2498 0.1381 0.0740  0.0039  0.0054  89   SER A OG   
1314 H H    . SER A 89  ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  89   SER A H    
1315 H HA   A SER A 89  ? 0.1611 0.1611 0.1611 0.0000  0.0000  0.0000  89   SER A HA   
1316 H HB2  A SER A 89  ? 0.2209 0.2209 0.2209 0.0000  0.0000  0.0000  89   SER A HB2  
1317 H HB2  B SER A 89  ? 0.1978 0.1978 0.1978 0.0000  0.0000  0.0000  89   SER A HB2  
1318 H HB2  C SER A 89  ? 0.1942 0.1942 0.1942 0.0000  0.0000  0.0000  89   SER A HB2  
1319 H HB3  A SER A 89  ? 0.2209 0.2209 0.2209 0.0000  0.0000  0.0000  89   SER A HB3  
1320 H HB3  B SER A 89  ? 0.1978 0.1978 0.1978 0.0000  0.0000  0.0000  89   SER A HB3  
1321 H HB3  C SER A 89  ? 0.1942 0.1942 0.1942 0.0000  0.0000  0.0000  89   SER A HB3  
1322 H HG   A SER A 89  ? 0.3274 0.3274 0.3274 0.0000  0.0000  0.0000  89   SER A HG   
1323 H HG   B SER A 89  ? 0.2860 0.2860 0.2860 0.0000  0.0000  0.0000  89   SER A HG   
1324 H HG   C SER A 89  ? 0.2781 0.2781 0.2781 0.0000  0.0000  0.0000  89   SER A HG   
1325 N N    . VAL A 90  ? 0.1217 0.1237 0.1389 0.0037  -0.0163 -0.0118 90   VAL A N    
1326 C CA   . VAL A 90  ? 0.1212 0.1211 0.1286 0.0034  -0.0125 -0.0058 90   VAL A CA   
1327 C C    . VAL A 90  ? 0.1137 0.1264 0.1359 0.0070  -0.0088 -0.0058 90   VAL A C    
1328 O O    . VAL A 90  ? 0.1505 0.1216 0.1477 0.0080  -0.0212 -0.0034 90   VAL A O    
1329 C CB   . VAL A 90  ? 0.1280 0.1168 0.1389 0.0062  -0.0104 -0.0046 90   VAL A CB   
1330 C CG1  . VAL A 90  ? 0.1348 0.1454 0.1356 0.0020  -0.0100 0.0030  90   VAL A CG1  
1331 C CG2  . VAL A 90  ? 0.1551 0.1272 0.1310 0.0035  -0.0177 -0.0017 90   VAL A CG2  
1332 H H    . VAL A 90  ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  90   VAL A H    
1333 H HA   . VAL A 90  ? 0.1483 0.1483 0.1483 0.0000  0.0000  0.0000  90   VAL A HA   
1334 H HB   . VAL A 90  ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  90   VAL A HB   
1335 H HG11 . VAL A 90  ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  90   VAL A HG11 
1336 H HG12 . VAL A 90  ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  90   VAL A HG12 
1337 H HG13 . VAL A 90  ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  90   VAL A HG13 
1338 H HG21 . VAL A 90  ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  90   VAL A HG21 
1339 H HG22 . VAL A 90  ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  90   VAL A HG22 
1340 H HG23 . VAL A 90  ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  90   VAL A HG23 
1341 N N    . THR A 91  ? 0.1090 0.1232 0.1362 0.0077  -0.0111 -0.0059 91   THR A N    
1342 C CA   . THR A 91  ? 0.1156 0.1286 0.1341 0.0076  -0.0080 0.0011  91   THR A CA   
1343 C C    . THR A 91  ? 0.1169 0.1298 0.1212 0.0140  0.0000  0.0004  91   THR A C    
1344 O O    . THR A 91  ? 0.1202 0.1221 0.1438 0.0077  -0.0045 -0.0022 91   THR A O    
1345 C CB   . THR A 91  ? 0.1281 0.1701 0.1314 0.0041  -0.0015 -0.0010 91   THR A CB   
1346 O OG1  . THR A 91  ? 0.1307 0.2200 0.1556 0.0024  0.0134  0.0055  91   THR A OG1  
1347 C CG2  . THR A 91  ? 0.1699 0.2029 0.1341 0.0306  -0.0031 0.0161  91   THR A CG2  
1348 H H    . THR A 91  ? 0.1474 0.1474 0.1474 0.0000  0.0000  0.0000  91   THR A H    
1349 H HA   . THR A 91  ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  91   THR A HA   
1350 H HB   . THR A 91  ? 0.1719 0.1719 0.1719 0.0000  0.0000  0.0000  91   THR A HB   
1351 H HG1  . THR A 91  ? 0.2532 0.2532 0.2532 0.0000  0.0000  0.0000  91   THR A HG1  
1352 H HG21 . THR A 91  ? 0.2534 0.2534 0.2534 0.0000  0.0000  0.0000  91   THR A HG21 
1353 H HG22 . THR A 91  ? 0.2534 0.2534 0.2534 0.0000  0.0000  0.0000  91   THR A HG22 
1354 H HG23 . THR A 91  ? 0.2534 0.2534 0.2534 0.0000  0.0000  0.0000  91   THR A HG23 
1355 N N    . VAL A 92  ? 0.1145 0.1244 0.1313 0.0058  -0.0003 0.0004  92   VAL A N    
1356 C CA   . VAL A 92  ? 0.1109 0.1364 0.1336 0.0068  -0.0104 0.0057  92   VAL A CA   
1357 C C    . VAL A 92  ? 0.1199 0.1396 0.1336 0.0091  -0.0052 0.0045  92   VAL A C    
1358 O O    . VAL A 92  ? 0.1365 0.1332 0.1360 0.0014  -0.0021 0.0075  92   VAL A O    
1359 C CB   . VAL A 92  ? 0.1265 0.1344 0.1410 0.0084  0.0028  0.0161  92   VAL A CB   
1360 C CG1  . VAL A 92  ? 0.1339 0.1733 0.1487 0.0168  0.0111  0.0235  92   VAL A CG1  
1361 C CG2  . VAL A 92  ? 0.1403 0.1439 0.1301 0.0027  -0.0001 0.0109  92   VAL A CG2  
1362 H H    . VAL A 92  ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  92   VAL A H    
1363 H HA   . VAL A 92  ? 0.1524 0.1524 0.1524 0.0000  0.0000  0.0000  92   VAL A HA   
1364 H HB   . VAL A 92  ? 0.1607 0.1607 0.1607 0.0000  0.0000  0.0000  92   VAL A HB   
1365 H HG11 . VAL A 92  ? 0.2280 0.2280 0.2280 0.0000  0.0000  0.0000  92   VAL A HG11 
1366 H HG12 . VAL A 92  ? 0.2280 0.2280 0.2280 0.0000  0.0000  0.0000  92   VAL A HG12 
1367 H HG13 . VAL A 92  ? 0.2280 0.2280 0.2280 0.0000  0.0000  0.0000  92   VAL A HG13 
1368 H HG21 . VAL A 92  ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  92   VAL A HG21 
1369 H HG22 . VAL A 92  ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  92   VAL A HG22 
1370 H HG23 . VAL A 92  ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  92   VAL A HG23 
1371 N N    . GLY A 93  ? 0.1271 0.1499 0.1454 0.0031  -0.0179 0.0110  93   GLY A N    
1372 C CA   . GLY A 93  ? 0.1415 0.1681 0.1645 0.0058  -0.0274 0.0220  93   GLY A CA   
1373 C C    . GLY A 93  ? 0.1463 0.1604 0.1333 0.0028  -0.0238 0.0104  93   GLY A C    
1374 O O    . GLY A 93  ? 0.1777 0.1506 0.1654 0.0102  -0.0230 0.0146  93   GLY A O    
1375 H H    . GLY A 93  ? 0.1690 0.1690 0.1690 0.0000  0.0000  0.0000  93   GLY A H    
1376 H HA2  . GLY A 93  ? 0.1896 0.1896 0.1896 0.0000  0.0000  0.0000  93   GLY A HA2  
1377 H HA3  . GLY A 93  ? 0.1896 0.1896 0.1896 0.0000  0.0000  0.0000  93   GLY A HA3  
1378 N N    . GLY A 94  ? 0.1611 0.1480 0.1322 0.0017  -0.0089 0.0071  94   GLY A N    
1379 C CA   . GLY A 94  ? 0.1564 0.1738 0.1343 0.0076  -0.0004 -0.0005 94   GLY A CA   
1380 C C    . GLY A 94  ? 0.1662 0.1674 0.1369 -0.0091 0.0051  0.0133  94   GLY A C    
1381 O O    . GLY A 94  ? 0.1956 0.2192 0.1505 -0.0349 0.0255  0.0170  94   GLY A O    
1382 H H    . GLY A 94  ? 0.1766 0.1766 0.1766 0.0000  0.0000  0.0000  94   GLY A H    
1383 H HA2  . GLY A 94  ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  94   GLY A HA2  
1384 H HA3  . GLY A 94  ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  94   GLY A HA3  
1385 N N    . VAL A 95  ? 0.1486 0.1550 0.1289 -0.0049 -0.0050 0.0177  95   VAL A N    
1386 C CA   . VAL A 95  ? 0.1423 0.1411 0.1460 -0.0032 -0.0164 0.0178  95   VAL A CA   
1387 C C    . VAL A 95  ? 0.1447 0.1235 0.1443 -0.0052 -0.0143 0.0081  95   VAL A C    
1388 O O    . VAL A 95  ? 0.1419 0.1324 0.1440 -0.0032 -0.0091 0.0097  95   VAL A O    
1389 C CB   . VAL A 95  ? 0.1704 0.1276 0.1565 0.0093  -0.0258 0.0082  95   VAL A CB   
1390 C CG1  . VAL A 95  ? 0.2225 0.1425 0.1693 0.0192  -0.0515 -0.0068 95   VAL A CG1  
1391 C CG2  . VAL A 95  ? 0.1893 0.1561 0.1673 0.0288  -0.0276 0.0139  95   VAL A CG2  
1392 H H    . VAL A 95  ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  95   VAL A H    
1393 H HA   . VAL A 95  ? 0.1717 0.1717 0.1717 0.0000  0.0000  0.0000  95   VAL A HA   
1394 H HB   . VAL A 95  ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  95   VAL A HB   
1395 H HG11 . VAL A 95  ? 0.2671 0.2671 0.2671 0.0000  0.0000  0.0000  95   VAL A HG11 
1396 H HG12 . VAL A 95  ? 0.2671 0.2671 0.2671 0.0000  0.0000  0.0000  95   VAL A HG12 
1397 H HG13 . VAL A 95  ? 0.2671 0.2671 0.2671 0.0000  0.0000  0.0000  95   VAL A HG13 
1398 H HG21 . VAL A 95  ? 0.2563 0.2563 0.2563 0.0000  0.0000  0.0000  95   VAL A HG21 
1399 H HG22 . VAL A 95  ? 0.2563 0.2563 0.2563 0.0000  0.0000  0.0000  95   VAL A HG22 
1400 H HG23 . VAL A 95  ? 0.2563 0.2563 0.2563 0.0000  0.0000  0.0000  95   VAL A HG23 
1401 N N    . THR A 96  ? 0.1451 0.1511 0.1686 -0.0149 -0.0172 0.0270  96   THR A N    
1402 C CA   . THR A 96  ? 0.1369 0.1583 0.1850 -0.0224 -0.0267 0.0200  96   THR A CA   
1403 C C    . THR A 96  ? 0.1420 0.1395 0.2090 -0.0054 -0.0388 0.0174  96   THR A C    
1404 O O    . THR A 96  ? 0.1860 0.1561 0.2212 -0.0364 -0.0447 0.0194  96   THR A O    
1405 C CB   . THR A 96  ? 0.1443 0.1819 0.2133 -0.0174 -0.0138 0.0200  96   THR A CB   
1406 O OG1  . THR A 96  ? 0.1679 0.2197 0.1976 -0.0097 0.0020  0.0083  96   THR A OG1  
1407 C CG2  . THR A 96  ? 0.1531 0.2033 0.2355 -0.0032 -0.0099 0.0195  96   THR A CG2  
1408 H H    . THR A 96  ? 0.1859 0.1859 0.1859 0.0000  0.0000  0.0000  96   THR A H    
1409 H HA   . THR A 96  ? 0.1921 0.1921 0.1921 0.0000  0.0000  0.0000  96   THR A HA   
1410 H HB   . THR A 96  ? 0.2158 0.2158 0.2158 0.0000  0.0000  0.0000  96   THR A HB   
1411 H HG1  . THR A 96  ? 0.2926 0.2926 0.2926 0.0000  0.0000  0.0000  96   THR A HG1  
1412 H HG21 . THR A 96  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  96   THR A HG21 
1413 H HG22 . THR A 96  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  96   THR A HG22 
1414 H HG23 . THR A 96  ? 0.2960 0.2960 0.2960 0.0000  0.0000  0.0000  96   THR A HG23 
1415 N N    . ALA A 97  ? 0.1665 0.1296 0.1934 -0.0032 -0.0415 -0.0019 97   ALA A N    
1416 C CA   . ALA A 97  ? 0.1789 0.1307 0.2048 0.0017  -0.0604 -0.0080 97   ALA A CA   
1417 C C    . ALA A 97  ? 0.1660 0.1370 0.1807 -0.0091 -0.0443 -0.0062 97   ALA A C    
1418 O O    . ALA A 97  ? 0.1558 0.1283 0.2662 -0.0015 -0.0535 -0.0091 97   ALA A O    
1419 C CB   . ALA A 97  ? 0.2052 0.1651 0.1855 0.0341  -0.0344 -0.0128 97   ALA A CB   
1420 H H    . ALA A 97  ? 0.1958 0.1958 0.1958 0.0000  0.0000  0.0000  97   ALA A H    
1421 H HA   . ALA A 97  ? 0.2058 0.2058 0.2058 0.0000  0.0000  0.0000  97   ALA A HA   
1422 H HB1  . ALA A 97  ? 0.2779 0.2779 0.2779 0.0000  0.0000  0.0000  97   ALA A HB1  
1423 H HB2  . ALA A 97  ? 0.2779 0.2779 0.2779 0.0000  0.0000  0.0000  97   ALA A HB2  
1424 H HB3  . ALA A 97  ? 0.2779 0.2779 0.2779 0.0000  0.0000  0.0000  97   ALA A HB3  
1425 N N    . HIS A 98  ? 0.1863 0.1470 0.2044 -0.0281 -0.0557 0.0192  98   HIS A N    
1426 C CA   . HIS A 98  ? 0.1652 0.1860 0.1675 -0.0436 -0.0142 0.0159  98   HIS A CA   
1427 C C    . HIS A 98  ? 0.1432 0.1594 0.1714 -0.0195 -0.0150 0.0165  98   HIS A C    
1428 O O    . HIS A 98  ? 0.2009 0.1643 0.1766 -0.0202 -0.0234 0.0031  98   HIS A O    
1429 C CB   A HIS A 98  ? 0.2183 0.2661 0.1972 -0.1064 -0.0334 0.0576  98   HIS A CB   
1430 C CB   B HIS A 98  ? 0.2378 0.3211 0.1989 -0.1338 -0.0336 0.0652  98   HIS A CB   
1431 C CG   A HIS A 98  ? 0.1980 0.3898 0.2103 -0.0608 0.0305  0.0405  98   HIS A CG   
1432 C CG   B HIS A 98  ? 0.2348 0.3759 0.1753 -0.1198 -0.0075 0.0622  98   HIS A CG   
1433 N ND1  A HIS A 98  ? 0.3385 0.4786 0.2466 0.0057  0.0509  0.0005  98   HIS A ND1  
1434 N ND1  B HIS A 98  ? 0.3564 0.4125 0.1913 -0.1040 0.0092  0.0438  98   HIS A ND1  
1435 C CD2  A HIS A 98  ? 0.3483 0.4063 0.1641 -0.0809 0.0188  0.0429  98   HIS A CD2  
1436 C CD2  B HIS A 98  ? 0.2996 0.4601 0.1776 -0.0533 0.0163  0.1065  98   HIS A CD2  
1437 C CE1  A HIS A 98  ? 0.4590 0.4947 0.2458 -0.0151 0.0187  -0.0248 98   HIS A CE1  
1438 C CE1  B HIS A 98  ? 0.3000 0.4581 0.1705 -0.1892 0.0096  0.0632  98   HIS A CE1  
1439 N NE2  A HIS A 98  ? 0.3485 0.4744 0.1894 -0.0695 0.0670  0.0167  98   HIS A NE2  
1440 N NE2  B HIS A 98  ? 0.3738 0.4617 0.1973 -0.1255 -0.0556 0.0908  98   HIS A NE2  
1441 H H    . HIS A 98  ? 0.2151 0.2151 0.2151 0.0000  0.0000  0.0000  98   HIS A H    
1442 H HA   A HIS A 98  ? 0.2075 0.2075 0.2075 0.0000  0.0000  0.0000  98   HIS A HA   
1443 H HB2  A HIS A 98  ? 0.2727 0.2727 0.2727 0.0000  0.0000  0.0000  98   HIS A HB2  
1444 H HB2  B HIS A 98  ? 0.3031 0.3031 0.3031 0.0000  0.0000  0.0000  98   HIS A HB2  
1445 H HB3  A HIS A 98  ? 0.2727 0.2727 0.2727 0.0000  0.0000  0.0000  98   HIS A HB3  
1446 H HB3  B HIS A 98  ? 0.3031 0.3031 0.3031 0.0000  0.0000  0.0000  98   HIS A HB3  
1447 H HD1  A HIS A 98  ? 0.4254 0.4254 0.4254 0.0000  0.0000  0.0000  98   HIS A HD1  
1448 H HD1  B HIS A 98  ? 0.3841 0.3841 0.3841 0.0000  0.0000  0.0000  98   HIS A HD1  
1449 H HD2  A HIS A 98  ? 0.3674 0.3674 0.3674 0.0000  0.0000  0.0000  98   HIS A HD2  
1450 H HD2  B HIS A 98  ? 0.3749 0.3749 0.3749 0.0000  0.0000  0.0000  98   HIS A HD2  
1451 H HE1  A HIS A 98  ? 0.4798 0.4798 0.4798 0.0000  0.0000  0.0000  98   HIS A HE1  
1452 H HE1  B HIS A 98  ? 0.3715 0.3715 0.3715 0.0000  0.0000  0.0000  98   HIS A HE1  
1453 N N    . GLY A 99  ? 0.1418 0.2080 0.1962 0.0050  0.0157  0.0416  99   GLY A N    
1454 C CA   . GLY A 99  ? 0.1394 0.2525 0.2261 -0.0038 0.0031  0.0967  99   GLY A CA   
1455 C C    . GLY A 99  ? 0.1398 0.1928 0.1711 0.0080  -0.0075 0.0305  99   GLY A C    
1456 O O    . GLY A 99  ? 0.1965 0.2555 0.1776 -0.0631 -0.0407 0.0391  99   GLY A O    
1457 H H    . GLY A 99  ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  99   GLY A H    
1458 H HA2  . GLY A 99  ? 0.2472 0.2472 0.2472 0.0000  0.0000  0.0000  99   GLY A HA2  
1459 H HA3  . GLY A 99  ? 0.2472 0.2472 0.2472 0.0000  0.0000  0.0000  99   GLY A HA3  
1460 N N    . GLN A 100 ? 0.1388 0.1342 0.1498 0.0045  0.0114  0.0058  100  GLN A N    
1461 C CA   . GLN A 100 ? 0.1322 0.1154 0.1393 0.0094  -0.0008 -0.0027 100  GLN A CA   
1462 C C    . GLN A 100 ? 0.1146 0.1175 0.1243 0.0036  -0.0054 -0.0017 100  GLN A C    
1463 O O    . GLN A 100 ? 0.1207 0.1181 0.1315 0.0137  -0.0055 -0.0067 100  GLN A O    
1464 C CB   . GLN A 100 ? 0.1288 0.1336 0.1318 0.0167  -0.0062 -0.0017 100  GLN A CB   
1465 C CG   . GLN A 100 ? 0.1175 0.1414 0.1319 0.0237  -0.0114 -0.0037 100  GLN A CG   
1466 C CD   . GLN A 100 ? 0.1342 0.1285 0.1365 0.0270  -0.0138 -0.0036 100  GLN A CD   
1467 O OE1  . GLN A 100 ? 0.1580 0.1331 0.1520 0.0326  -0.0043 0.0031  100  GLN A OE1  
1468 N NE2  . GLN A 100 ? 0.1390 0.1317 0.1374 0.0345  -0.0017 -0.0053 100  GLN A NE2  
1469 H H    . GLN A 100 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  100  GLN A H    
1470 H HA   . GLN A 100 ? 0.1548 0.1548 0.1548 0.0000  0.0000  0.0000  100  GLN A HA   
1471 H HB2  . GLN A 100 ? 0.1577 0.1577 0.1577 0.0000  0.0000  0.0000  100  GLN A HB2  
1472 H HB3  . GLN A 100 ? 0.1577 0.1577 0.1577 0.0000  0.0000  0.0000  100  GLN A HB3  
1473 H HG2  . GLN A 100 ? 0.1563 0.1563 0.1563 0.0000  0.0000  0.0000  100  GLN A HG2  
1474 H HG3  . GLN A 100 ? 0.1563 0.1563 0.1563 0.0000  0.0000  0.0000  100  GLN A HG3  
1475 H HE21 . GLN A 100 ? 0.1633 0.1633 0.1633 0.0000  0.0000  0.0000  100  GLN A HE21 
1476 H HE22 . GLN A 100 ? 0.1633 0.1633 0.1633 0.0000  0.0000  0.0000  100  GLN A HE22 
1477 N N    . ALA A 101 ? 0.1261 0.1154 0.1265 0.0086  -0.0033 -0.0047 101  ALA A N    
1478 C CA   . ALA A 101 ? 0.1323 0.1100 0.1278 0.0062  0.0017  -0.0031 101  ALA A CA   
1479 C C    . ALA A 101 ? 0.1113 0.1222 0.1156 0.0122  -0.0021 0.0012  101  ALA A C    
1480 O O    . ALA A 101 ? 0.1100 0.1291 0.1475 0.0147  -0.0037 -0.0043 101  ALA A O    
1481 C CB   . ALA A 101 ? 0.1655 0.1273 0.1277 0.0084  -0.0058 -0.0087 101  ALA A CB   
1482 H H    . ALA A 101 ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  101  ALA A H    
1483 H HA   . ALA A 101 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  101  ALA A HA   
1484 H HB1  . ALA A 101 ? 0.2102 0.2102 0.2102 0.0000  0.0000  0.0000  101  ALA A HB1  
1485 H HB2  . ALA A 101 ? 0.2102 0.2102 0.2102 0.0000  0.0000  0.0000  101  ALA A HB2  
1486 H HB3  . ALA A 101 ? 0.2102 0.2102 0.2102 0.0000  0.0000  0.0000  101  ALA A HB3  
1487 N N    . VAL A 102 ? 0.1044 0.1100 0.1282 0.0084  -0.0089 -0.0024 102  VAL A N    
1488 C CA   . VAL A 102 ? 0.0959 0.1173 0.1306 0.0053  -0.0087 0.0057  102  VAL A CA   
1489 C C    . VAL A 102 ? 0.1069 0.1118 0.1244 0.0068  -0.0091 0.0004  102  VAL A C    
1490 O O    . VAL A 102 ? 0.0941 0.1258 0.1479 0.0111  -0.0139 0.0118  102  VAL A O    
1491 C CB   . VAL A 102 ? 0.1231 0.1185 0.1267 0.0043  -0.0101 -0.0053 102  VAL A CB   
1492 C CG1  . VAL A 102 ? 0.1255 0.1253 0.1372 -0.0027 -0.0096 -0.0095 102  VAL A CG1  
1493 C CG2  . VAL A 102 ? 0.1581 0.1412 0.1241 -0.0108 -0.0127 0.0034  102  VAL A CG2  
1494 H H    . VAL A 102 ? 0.1370 0.1370 0.1370 0.0000  0.0000  0.0000  102  VAL A H    
1495 H HA   . VAL A 102 ? 0.1375 0.1375 0.1375 0.0000  0.0000  0.0000  102  VAL A HA   
1496 H HB   . VAL A 102 ? 0.1473 0.1473 0.1473 0.0000  0.0000  0.0000  102  VAL A HB   
1497 H HG11 . VAL A 102 ? 0.1940 0.1940 0.1940 0.0000  0.0000  0.0000  102  VAL A HG11 
1498 H HG12 . VAL A 102 ? 0.1940 0.1940 0.1940 0.0000  0.0000  0.0000  102  VAL A HG12 
1499 H HG13 . VAL A 102 ? 0.1940 0.1940 0.1940 0.0000  0.0000  0.0000  102  VAL A HG13 
1500 H HG21 . VAL A 102 ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  102  VAL A HG21 
1501 H HG22 . VAL A 102 ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  102  VAL A HG22 
1502 H HG23 . VAL A 102 ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  102  VAL A HG23 
1503 N N    . GLN A 103 ? 0.0936 0.1058 0.1256 0.0147  -0.0127 0.0062  103  GLN A N    
1504 C CA   . GLN A 103 ? 0.1029 0.1056 0.1171 0.0053  -0.0149 0.0015  103  GLN A CA   
1505 C C    . GLN A 103 ? 0.0991 0.1117 0.1180 0.0122  -0.0109 0.0005  103  GLN A C    
1506 O O    . GLN A 103 ? 0.0987 0.1092 0.1388 0.0088  -0.0150 -0.0105 103  GLN A O    
1507 C CB   . GLN A 103 ? 0.1105 0.1085 0.1202 0.0063  -0.0158 -0.0066 103  GLN A CB   
1508 C CG   . GLN A 103 ? 0.1145 0.1105 0.1329 0.0114  -0.0124 -0.0094 103  GLN A CG   
1509 C CD   . GLN A 103 ? 0.1228 0.1241 0.1188 0.0127  -0.0153 -0.0093 103  GLN A CD   
1510 O OE1  . GLN A 103 ? 0.1414 0.1148 0.1364 0.0189  -0.0049 -0.0040 103  GLN A OE1  
1511 N NE2  . GLN A 103 ? 0.1063 0.1174 0.1113 0.0222  -0.0001 0.0054  103  GLN A NE2  
1512 H H    . GLN A 103 ? 0.1299 0.1299 0.1299 0.0000  0.0000  0.0000  103  GLN A H    
1513 H HA   . GLN A 103 ? 0.1302 0.1302 0.1302 0.0000  0.0000  0.0000  103  GLN A HA   
1514 H HB2  . GLN A 103 ? 0.1356 0.1356 0.1356 0.0000  0.0000  0.0000  103  GLN A HB2  
1515 H HB3  . GLN A 103 ? 0.1356 0.1356 0.1356 0.0000  0.0000  0.0000  103  GLN A HB3  
1516 H HG2  . GLN A 103 ? 0.1431 0.1431 0.1431 0.0000  0.0000  0.0000  103  GLN A HG2  
1517 H HG3  . GLN A 103 ? 0.1431 0.1431 0.1431 0.0000  0.0000  0.0000  103  GLN A HG3  
1518 H HE21 . GLN A 103 ? 0.1340 0.1340 0.1340 0.0000  0.0000  0.0000  103  GLN A HE21 
1519 H HE22 . GLN A 103 ? 0.1340 0.1340 0.1340 0.0000  0.0000  0.0000  103  GLN A HE22 
1520 N N    . ALA A 104 ? 0.1005 0.1108 0.1258 0.0079  -0.0138 -0.0096 104  ALA A N    
1521 C CA   . ALA A 104 ? 0.1146 0.1019 0.1205 0.0119  -0.0147 -0.0104 104  ALA A CA   
1522 C C    . ALA A 104 ? 0.1148 0.1099 0.1238 0.0145  -0.0138 -0.0118 104  ALA A C    
1523 O O    . ALA A 104 ? 0.1253 0.1134 0.1289 0.0098  -0.0184 -0.0035 104  ALA A O    
1524 C CB   . ALA A 104 ? 0.1234 0.1160 0.1401 0.0151  -0.0078 -0.0093 104  ALA A CB   
1525 H H    . ALA A 104 ? 0.1349 0.1349 0.1349 0.0000  0.0000  0.0000  104  ALA A H    
1526 H HA   . ALA A 104 ? 0.1348 0.1348 0.1348 0.0000  0.0000  0.0000  104  ALA A HA   
1527 H HB1  . ALA A 104 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  104  ALA A HB1  
1528 H HB2  . ALA A 104 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  104  ALA A HB2  
1529 H HB3  . ALA A 104 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  104  ALA A HB3  
1530 N N    . ALA A 105 ? 0.1132 0.1029 0.1224 0.0103  -0.0140 0.0008  105  ALA A N    
1531 C CA   . ALA A 105 ? 0.1243 0.1094 0.1291 0.0097  -0.0094 0.0001  105  ALA A CA   
1532 C C    . ALA A 105 ? 0.1152 0.1046 0.1280 0.0092  -0.0167 -0.0063 105  ALA A C    
1533 O O    . ALA A 105 ? 0.1267 0.1097 0.1344 0.0124  -0.0011 -0.0028 105  ALA A O    
1534 C CB   . ALA A 105 ? 0.1145 0.1188 0.1493 0.0083  -0.0100 0.0010  105  ALA A CB   
1535 H H    . ALA A 105 ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  105  ALA A H    
1536 H HA   . ALA A 105 ? 0.1451 0.1451 0.1451 0.0000  0.0000  0.0000  105  ALA A HA   
1537 H HB1  . ALA A 105 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  105  ALA A HB1  
1538 H HB2  . ALA A 105 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  105  ALA A HB2  
1539 H HB3  . ALA A 105 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  105  ALA A HB3  
1540 N N    . GLN A 106 ? 0.1323 0.1073 0.1275 0.0130  -0.0131 0.0041  106  GLN A N    
1541 C CA   . GLN A 106 ? 0.1217 0.1096 0.1424 0.0167  -0.0098 0.0041  106  GLN A CA   
1542 C C    . GLN A 106 ? 0.1200 0.1154 0.1489 0.0125  -0.0175 0.0038  106  GLN A C    
1543 O O    . GLN A 106 ? 0.1401 0.1108 0.1724 0.0151  -0.0078 0.0119  106  GLN A O    
1544 C CB   . GLN A 106 ? 0.1219 0.1174 0.1426 0.0167  -0.0107 0.0145  106  GLN A CB   
1545 C CG   . GLN A 106 ? 0.1299 0.1384 0.1559 0.0060  -0.0075 0.0135  106  GLN A CG   
1546 C CD   . GLN A 106 ? 0.1311 0.1371 0.1727 0.0053  -0.0088 0.0038  106  GLN A CD   
1547 O OE1  . GLN A 106 ? 0.1528 0.1775 0.2133 0.0334  -0.0410 -0.0325 106  GLN A OE1  
1548 N NE2  . GLN A 106 ? 0.1135 0.1869 0.1999 0.0135  -0.0027 -0.0026 106  GLN A NE2  
1549 H H    . GLN A 106 ? 0.1468 0.1468 0.1468 0.0000  0.0000  0.0000  106  GLN A H    
1550 H HA   . GLN A 106 ? 0.1494 0.1494 0.1494 0.0000  0.0000  0.0000  106  GLN A HA   
1551 H HB2  . GLN A 106 ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  106  GLN A HB2  
1552 H HB3  . GLN A 106 ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  106  GLN A HB3  
1553 H HG2  . GLN A 106 ? 0.1697 0.1697 0.1697 0.0000  0.0000  0.0000  106  GLN A HG2  
1554 H HG3  . GLN A 106 ? 0.1697 0.1697 0.1697 0.0000  0.0000  0.0000  106  GLN A HG3  
1555 H HE21 . GLN A 106 ? 0.2001 0.2001 0.2001 0.0000  0.0000  0.0000  106  GLN A HE21 
1556 H HE22 . GLN A 106 ? 0.2001 0.2001 0.2001 0.0000  0.0000  0.0000  106  GLN A HE22 
1557 N N    . GLN A 107 ? 0.1223 0.1097 0.1560 0.0099  -0.0071 0.0050  107  GLN A N    
1558 C CA   . GLN A 107 ? 0.1260 0.1140 0.1665 0.0039  -0.0121 0.0094  107  GLN A CA   
1559 C C    . GLN A 107 ? 0.1145 0.1233 0.1756 0.0038  -0.0096 -0.0084 107  GLN A C    
1560 O O    . GLN A 107 ? 0.1287 0.1070 0.2117 0.0097  -0.0154 -0.0100 107  GLN A O    
1561 C CB   . GLN A 107 ? 0.1589 0.1626 0.1624 0.0004  -0.0006 0.0102  107  GLN A CB   
1562 C CG   . GLN A 107 ? 0.1963 0.2784 0.1684 0.0185  -0.0332 0.0381  107  GLN A CG   
1563 C CD   . GLN A 107 ? 0.2106 0.2876 0.4507 0.0432  0.0015  0.1288  107  GLN A CD   
1564 O OE1  . GLN A 107 ? 0.2758 0.3257 0.5576 -0.0115 0.0958  0.1173  107  GLN A OE1  
1565 N NE2  . GLN A 107 ? 0.2440 0.3407 0.3501 0.0807  -0.0158 0.0243  107  GLN A NE2  
1566 H H    . GLN A 107 ? 0.1551 0.1551 0.1551 0.0000  0.0000  0.0000  107  GLN A H    
1567 H HA   . GLN A 107 ? 0.1626 0.1626 0.1626 0.0000  0.0000  0.0000  107  GLN A HA   
1568 H HB2  . GLN A 107 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  107  GLN A HB2  
1569 H HB3  . GLN A 107 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  107  GLN A HB3  
1570 H HG2  . GLN A 107 ? 0.2572 0.2572 0.2572 0.0000  0.0000  0.0000  107  GLN A HG2  
1571 H HG3  . GLN A 107 ? 0.2572 0.2572 0.2572 0.0000  0.0000  0.0000  107  GLN A HG3  
1572 H HE21 . GLN A 107 ? 0.3739 0.3739 0.3739 0.0000  0.0000  0.0000  107  GLN A HE21 
1573 H HE22 . GLN A 107 ? 0.3739 0.3739 0.3739 0.0000  0.0000  0.0000  107  GLN A HE22 
1574 N N    . ILE A 108 ? 0.1267 0.1125 0.1862 0.0076  -0.0179 -0.0069 108  ILE A N    
1575 C CA   . ILE A 108 ? 0.1178 0.1239 0.1815 0.0065  -0.0120 -0.0128 108  ILE A CA   
1576 C C    . ILE A 108 ? 0.1250 0.1140 0.1989 -0.0025 -0.0196 -0.0145 108  ILE A C    
1577 O O    . ILE A 108 ? 0.1470 0.1258 0.2387 0.0032  -0.0105 -0.0059 108  ILE A O    
1578 C CB   . ILE A 108 ? 0.1353 0.1343 0.1819 0.0033  -0.0250 -0.0097 108  ILE A CB   
1579 C CG1  . ILE A 108 ? 0.1511 0.1461 0.1977 0.0019  -0.0171 -0.0257 108  ILE A CG1  
1580 C CG2  . ILE A 108 ? 0.1663 0.1419 0.1857 0.0124  0.0021  -0.0101 108  ILE A CG2  
1581 C CD1  . ILE A 108 ? 0.1617 0.2009 0.1996 0.0207  -0.0360 -0.0469 108  ILE A CD1  
1582 H H    . ILE A 108 ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  108  ILE A H    
1583 H HA   . ILE A 108 ? 0.1693 0.1693 0.1693 0.0000  0.0000  0.0000  108  ILE A HA   
1584 H HB   . ILE A 108 ? 0.1806 0.1806 0.1806 0.0000  0.0000  0.0000  108  ILE A HB   
1585 H HG12 . ILE A 108 ? 0.1980 0.1980 0.1980 0.0000  0.0000  0.0000  108  ILE A HG12 
1586 H HG13 . ILE A 108 ? 0.1980 0.1980 0.1980 0.0000  0.0000  0.0000  108  ILE A HG13 
1587 H HG21 . ILE A 108 ? 0.2470 0.2470 0.2470 0.0000  0.0000  0.0000  108  ILE A HG21 
1588 H HG22 . ILE A 108 ? 0.2470 0.2470 0.2470 0.0000  0.0000  0.0000  108  ILE A HG22 
1589 H HG23 . ILE A 108 ? 0.2470 0.2470 0.2470 0.0000  0.0000  0.0000  108  ILE A HG23 
1590 H HD11 . ILE A 108 ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  108  ILE A HD11 
1591 H HD12 . ILE A 108 ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  108  ILE A HD12 
1592 H HD13 . ILE A 108 ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  108  ILE A HD13 
1593 N N    . SER A 109 ? 0.1272 0.1211 0.1881 0.0023  -0.0012 -0.0091 109  SER A N    
1594 C CA   . SER A 109 ? 0.1566 0.1169 0.2111 -0.0032 0.0100  0.0007  109  SER A CA   
1595 C C    . SER A 109 ? 0.1484 0.1215 0.2493 -0.0041 0.0163  -0.0212 109  SER A C    
1596 O O    . SER A 109 ? 0.1338 0.1425 0.2500 -0.0033 0.0015  -0.0442 109  SER A O    
1597 C CB   . SER A 109 ? 0.1333 0.1390 0.2015 -0.0050 0.0035  0.0015  109  SER A CB   
1598 O OG   . SER A 109 ? 0.1466 0.1256 0.1955 0.0005  -0.0151 -0.0099 109  SER A OG   
1599 H H    . SER A 109 ? 0.1745 0.1745 0.1745 0.0000  0.0000  0.0000  109  SER A H    
1600 H HA   . SER A 109 ? 0.1939 0.1939 0.1939 0.0000  0.0000  0.0000  109  SER A HA   
1601 H HB2  . SER A 109 ? 0.1895 0.1895 0.1895 0.0000  0.0000  0.0000  109  SER A HB2  
1602 H HB3  . SER A 109 ? 0.1895 0.1895 0.1895 0.0000  0.0000  0.0000  109  SER A HB3  
1603 H HG   . SER A 109 ? 0.2338 0.2338 0.2338 0.0000  0.0000  0.0000  109  SER A HG   
1604 N N    . ALA A 110 ? 0.1643 0.1326 0.2838 -0.0217 0.0260  -0.0225 110  ALA A N    
1605 C CA   . ALA A 110 ? 0.1747 0.1414 0.3333 -0.0253 0.0098  -0.0263 110  ALA A CA   
1606 C C    . ALA A 110 ? 0.1507 0.1425 0.3357 -0.0188 0.0011  -0.0564 110  ALA A C    
1607 O O    . ALA A 110 ? 0.1469 0.1622 0.3360 -0.0171 0.0034  -0.0715 110  ALA A O    
1608 C CB   . ALA A 110 ? 0.2025 0.1687 0.4216 -0.0615 0.0250  0.0023  110  ALA A CB   
1609 H H    . ALA A 110 ? 0.2323 0.2323 0.2323 0.0000  0.0000  0.0000  110  ALA A H    
1610 H HA   . ALA A 110 ? 0.2598 0.2598 0.2598 0.0000  0.0000  0.0000  110  ALA A HA   
1611 H HB1  . ALA A 110 ? 0.3964 0.3964 0.3964 0.0000  0.0000  0.0000  110  ALA A HB1  
1612 H HB2  . ALA A 110 ? 0.3964 0.3964 0.3964 0.0000  0.0000  0.0000  110  ALA A HB2  
1613 H HB3  . ALA A 110 ? 0.3964 0.3964 0.3964 0.0000  0.0000  0.0000  110  ALA A HB3  
1614 N N    . GLN A 111 ? 0.1294 0.1621 0.2897 -0.0161 0.0088  -0.0490 111  GLN A N    
1615 C CA   . GLN A 111 ? 0.1196 0.1751 0.2984 -0.0074 0.0104  -0.0534 111  GLN A CA   
1616 C C    . GLN A 111 ? 0.1384 0.1499 0.2706 -0.0065 0.0052  -0.0677 111  GLN A C    
1617 O O    . GLN A 111 ? 0.1383 0.2045 0.2935 -0.0123 -0.0092 -0.0849 111  GLN A O    
1618 C CB   . GLN A 111 ? 0.1537 0.1892 0.2591 0.0067  0.0022  -0.0697 111  GLN A CB   
1619 C CG   . GLN A 111 ? 0.2047 0.2704 0.3039 0.0869  -0.0698 -0.1243 111  GLN A CG   
1620 C CD   . GLN A 111 ? 0.2105 0.2267 0.2347 0.0475  -0.0202 -0.0656 111  GLN A CD   
1621 O OE1  . GLN A 111 ? 0.2854 0.2377 0.2501 0.0698  -0.0473 -0.0210 111  GLN A OE1  
1622 N NE2  . GLN A 111 ? 0.2503 0.2127 0.3146 0.0636  0.0315  -0.0409 111  GLN A NE2  
1623 H H    . GLN A 111 ? 0.2325 0.2325 0.2325 0.0000  0.0000  0.0000  111  GLN A H    
1624 H HA   . GLN A 111 ? 0.2372 0.2372 0.2372 0.0000  0.0000  0.0000  111  GLN A HA   
1625 H HB2  . GLN A 111 ? 0.2408 0.2408 0.2408 0.0000  0.0000  0.0000  111  GLN A HB2  
1626 H HB3  . GLN A 111 ? 0.2408 0.2408 0.2408 0.0000  0.0000  0.0000  111  GLN A HB3  
1627 H HG2  . GLN A 111 ? 0.3116 0.3116 0.3116 0.0000  0.0000  0.0000  111  GLN A HG2  
1628 H HG3  . GLN A 111 ? 0.3116 0.3116 0.3116 0.0000  0.0000  0.0000  111  GLN A HG3  
1629 H HE21 . GLN A 111 ? 0.3111 0.3111 0.3111 0.0000  0.0000  0.0000  111  GLN A HE21 
1630 H HE22 . GLN A 111 ? 0.3111 0.3111 0.3111 0.0000  0.0000  0.0000  111  GLN A HE22 
1631 N N    . PHE A 112 ? 0.1295 0.1468 0.2459 -0.0045 0.0002  -0.0446 112  PHE A N    
1632 C CA   . PHE A 112 ? 0.1343 0.1541 0.2316 -0.0026 -0.0076 -0.0445 112  PHE A CA   
1633 C C    . PHE A 112 ? 0.1675 0.1713 0.2602 -0.0204 0.0082  -0.0665 112  PHE A C    
1634 O O    . PHE A 112 ? 0.1778 0.1979 0.2663 -0.0279 0.0254  -0.0778 112  PHE A O    
1635 C CB   . PHE A 112 ? 0.1332 0.1563 0.2227 -0.0027 -0.0221 -0.0332 112  PHE A CB   
1636 C CG   . PHE A 112 ? 0.1271 0.1401 0.1785 -0.0073 -0.0033 -0.0178 112  PHE A CG   
1637 C CD1  . PHE A 112 ? 0.1413 0.1637 0.1726 -0.0035 -0.0233 -0.0194 112  PHE A CD1  
1638 C CD2  . PHE A 112 ? 0.1634 0.1378 0.1605 -0.0026 -0.0116 0.0077  112  PHE A CD2  
1639 C CE1  . PHE A 112 ? 0.1640 0.1489 0.2004 0.0013  -0.0341 -0.0057 112  PHE A CE1  
1640 C CE2  . PHE A 112 ? 0.1994 0.1384 0.1534 -0.0070 0.0034  -0.0060 112  PHE A CE2  
1641 C CZ   . PHE A 112 ? 0.1367 0.1384 0.1900 0.0103  0.0082  -0.0174 112  PHE A CZ   
1642 H H    . PHE A 112 ? 0.2088 0.2088 0.2088 0.0000  0.0000  0.0000  112  PHE A H    
1643 H HA   . PHE A 112 ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  112  PHE A HA   
1644 H HB2  . PHE A 112 ? 0.2049 0.2049 0.2049 0.0000  0.0000  0.0000  112  PHE A HB2  
1645 H HB3  . PHE A 112 ? 0.2049 0.2049 0.2049 0.0000  0.0000  0.0000  112  PHE A HB3  
1646 H HD1  . PHE A 112 ? 0.1910 0.1910 0.1910 0.0000  0.0000  0.0000  112  PHE A HD1  
1647 H HD2  . PHE A 112 ? 0.1847 0.1847 0.1847 0.0000  0.0000  0.0000  112  PHE A HD2  
1648 H HE1  . PHE A 112 ? 0.2053 0.2053 0.2053 0.0000  0.0000  0.0000  112  PHE A HE1  
1649 H HE2  . PHE A 112 ? 0.1964 0.1964 0.1964 0.0000  0.0000  0.0000  112  PHE A HE2  
1650 H HZ   . PHE A 112 ? 0.1861 0.1861 0.1861 0.0000  0.0000  0.0000  112  PHE A HZ   
1651 N N    . GLN A 113 ? 0.1701 0.1575 0.2849 0.0084  0.0063  -0.0726 113  GLN A N    
1652 C CA   . GLN A 113 ? 0.1617 0.1731 0.3311 0.0137  -0.0156 -0.0849 113  GLN A CA   
1653 C C    . GLN A 113 ? 0.1946 0.1938 0.2959 0.0118  -0.0210 -0.0877 113  GLN A C    
1654 O O    . GLN A 113 ? 0.2322 0.2275 0.3832 0.0085  -0.0201 -0.1370 113  GLN A O    
1655 C CB   . GLN A 113 ? 0.1953 0.1545 0.3664 0.0338  -0.0609 -0.0913 113  GLN A CB   
1656 C CG   . GLN A 113 ? 0.1795 0.1607 0.3729 0.0136  -0.0454 -0.0781 113  GLN A CG   
1657 C CD   . GLN A 113 ? 0.2666 0.1346 0.5168 0.0091  -0.1805 -0.0509 113  GLN A CD   
1658 O OE1  . GLN A 113 ? 0.5278 0.1413 0.7199 0.0159  -0.3481 -0.0654 113  GLN A OE1  
1659 N NE2  . GLN A 113 ? 0.3222 0.1381 0.4167 -0.0133 -0.0843 0.0012  113  GLN A NE2  
1660 H H    . GLN A 113 ? 0.2449 0.2449 0.2449 0.0000  0.0000  0.0000  113  GLN A H    
1661 H HA   . GLN A 113 ? 0.2663 0.2663 0.2663 0.0000  0.0000  0.0000  113  GLN A HA   
1662 H HB2  . GLN A 113 ? 0.2865 0.2865 0.2865 0.0000  0.0000  0.0000  113  GLN A HB2  
1663 H HB3  . GLN A 113 ? 0.2865 0.2865 0.2865 0.0000  0.0000  0.0000  113  GLN A HB3  
1664 H HG2  . GLN A 113 ? 0.2852 0.2852 0.2852 0.0000  0.0000  0.0000  113  GLN A HG2  
1665 H HG3  . GLN A 113 ? 0.2852 0.2852 0.2852 0.0000  0.0000  0.0000  113  GLN A HG3  
1666 H HE21 . GLN A 113 ? 0.3508 0.3508 0.3508 0.0000  0.0000  0.0000  113  GLN A HE21 
1667 H HE22 . GLN A 113 ? 0.3508 0.3508 0.3508 0.0000  0.0000  0.0000  113  GLN A HE22 
1668 N N    . GLN A 114 ? 0.1735 0.1468 0.2782 -0.0020 -0.0437 -0.0354 114  GLN A N    
1669 C CA   . GLN A 114 ? 0.1975 0.1476 0.2613 -0.0166 -0.0435 -0.0245 114  GLN A CA   
1670 C C    . GLN A 114 ? 0.1928 0.1702 0.3361 -0.0164 -0.0728 0.0183  114  GLN A C    
1671 O O    . GLN A 114 ? 0.3124 0.2508 0.4245 -0.0919 -0.1755 0.0833  114  GLN A O    
1672 C CB   . GLN A 114 ? 0.1994 0.2336 0.3255 -0.0669 -0.0421 -0.0012 114  GLN A CB   
1673 C CG   . GLN A 114 ? 0.2570 0.2471 0.3479 -0.0859 -0.0279 0.0282  114  GLN A CG   
1674 C CD   . GLN A 114 ? 0.3537 0.5769 0.3869 -0.1328 0.0342  0.1105  114  GLN A CD   
1675 O OE1  . GLN A 114 ? 0.5273 1.0165 0.4067 -0.2749 -0.1081 0.2386  114  GLN A OE1  
1676 N NE2  . GLN A 114 ? 0.3583 1.2325 0.4973 0.0456  0.0771  -0.0723 114  GLN A NE2  
1677 H H    . GLN A 114 ? 0.2394 0.2394 0.2394 0.0000  0.0000  0.0000  114  GLN A H    
1678 H HA   . GLN A 114 ? 0.2425 0.2425 0.2425 0.0000  0.0000  0.0000  114  GLN A HA   
1679 H HB2  . GLN A 114 ? 0.3035 0.3035 0.3035 0.0000  0.0000  0.0000  114  GLN A HB2  
1680 H HB3  . GLN A 114 ? 0.3035 0.3035 0.3035 0.0000  0.0000  0.0000  114  GLN A HB3  
1681 H HG2  . GLN A 114 ? 0.3408 0.3408 0.3408 0.0000  0.0000  0.0000  114  GLN A HG2  
1682 H HG3  . GLN A 114 ? 0.3408 0.3408 0.3408 0.0000  0.0000  0.0000  114  GLN A HG3  
1683 H HE21 . GLN A 114 ? 0.8353 0.8353 0.8353 0.0000  0.0000  0.0000  114  GLN A HE21 
1684 H HE22 . GLN A 114 ? 0.8353 0.8353 0.8353 0.0000  0.0000  0.0000  114  GLN A HE22 
1685 N N    . ASP A 115 ? 0.1563 0.1748 0.3392 -0.0067 -0.0122 0.0226  115  ASP A N    
1686 C CA   . ASP A 115 ? 0.1800 0.1759 0.3748 -0.0031 0.0001  0.0444  115  ASP A CA   
1687 C C    . ASP A 115 ? 0.1436 0.1936 0.3376 -0.0137 -0.0375 0.0420  115  ASP A C    
1688 O O    . ASP A 115 ? 0.1710 0.2145 0.3884 -0.0317 0.0081  0.0022  115  ASP A O    
1689 C CB   . ASP A 115 ? 0.1629 0.1851 0.5380 0.0339  0.0212  0.0103  115  ASP A CB   
1690 C CG   . ASP A 115 ? 0.1675 0.1816 0.6259 0.0034  0.0265  0.0740  115  ASP A CG   
1691 O OD1  . ASP A 115 ? 0.2168 0.2653 0.6389 0.0405  -0.0620 0.0927  115  ASP A OD1  
1692 O OD2  . ASP A 115 ? 0.2188 0.1895 0.7542 0.0429  -0.0025 0.0565  115  ASP A OD2  
1693 H H    . ASP A 115 ? 0.2681 0.2681 0.2681 0.0000  0.0000  0.0000  115  ASP A H    
1694 H HA   . ASP A 115 ? 0.2923 0.2923 0.2923 0.0000  0.0000  0.0000  115  ASP A HA   
1695 H HB2  . ASP A 115 ? 0.3544 0.3544 0.3544 0.0000  0.0000  0.0000  115  ASP A HB2  
1696 H HB3  . ASP A 115 ? 0.3544 0.3544 0.3544 0.0000  0.0000  0.0000  115  ASP A HB3  
1697 N N    . THR A 116 ? 0.1879 0.1842 0.3252 -0.0207 -0.0426 0.0772  116  THR A N    
1698 C CA   . THR A 116 ? 0.2055 0.1929 0.3006 -0.0371 -0.0606 0.0522  116  THR A CA   
1699 C C    . THR A 116 ? 0.1901 0.2135 0.3168 -0.0626 -0.0735 0.0728  116  THR A C    
1700 O O    . THR A 116 ? 0.2533 0.2902 0.2785 -0.0845 -0.0792 0.0658  116  THR A O    
1701 C CB   . THR A 116 ? 0.3412 0.2217 0.2707 -0.0377 -0.0935 0.0322  116  THR A CB   
1702 O OG1  . THR A 116 ? 0.3461 0.2605 0.3617 -0.1041 -0.0604 -0.0007 116  THR A OG1  
1703 C CG2  . THR A 116 ? 0.7405 0.2152 0.3061 0.0700  -0.1787 -0.0112 116  THR A CG2  
1704 H H    . THR A 116 ? 0.2789 0.2789 0.2789 0.0000  0.0000  0.0000  116  THR A H    
1705 H HA   . THR A 116 ? 0.2796 0.2796 0.2796 0.0000  0.0000  0.0000  116  THR A HA   
1706 H HB   . THR A 116 ? 0.3335 0.3335 0.3335 0.0000  0.0000  0.0000  116  THR A HB   
1707 H HG1  . THR A 116 ? 0.4842 0.4842 0.4842 0.0000  0.0000  0.0000  116  THR A HG1  
1708 H HG21 . THR A 116 ? 0.6309 0.6309 0.6309 0.0000  0.0000  0.0000  116  THR A HG21 
1709 H HG22 . THR A 116 ? 0.6309 0.6309 0.6309 0.0000  0.0000  0.0000  116  THR A HG22 
1710 H HG23 . THR A 116 ? 0.6309 0.6309 0.6309 0.0000  0.0000  0.0000  116  THR A HG23 
1711 N N    . ASN A 117 ? 0.1797 0.2107 0.3719 -0.0513 -0.1029 0.0901  117  ASN A N    
1712 C CA   . ASN A 117 ? 0.2327 0.2143 0.3737 -0.0650 -0.1591 0.0836  117  ASN A CA   
1713 C C    . ASN A 117 ? 0.2179 0.1969 0.3142 -0.0559 -0.1429 0.0794  117  ASN A C    
1714 O O    . ASN A 117 ? 0.3823 0.1978 0.2839 -0.0926 -0.1863 0.0644  117  ASN A O    
1715 C CB   . ASN A 117 ? 0.2119 0.2899 0.5959 -0.0409 -0.1812 0.1352  117  ASN A CB   
1716 C CG   . ASN A 117 ? 0.2338 0.3343 0.5335 -0.0536 -0.0684 -0.0267 117  ASN A CG   
1717 O OD1  . ASN A 117 ? 0.4891 0.5073 0.4205 -0.1414 -0.1879 0.0318  117  ASN A OD1  
1718 N ND2  . ASN A 117 ? 0.2290 0.2816 0.6921 0.0383  0.0320  -0.0319 117  ASN A ND2  
1719 H H    . ASN A 117 ? 0.3050 0.3050 0.3050 0.0000  0.0000  0.0000  117  ASN A H    
1720 H HA   . ASN A 117 ? 0.3283 0.3283 0.3283 0.0000  0.0000  0.0000  117  ASN A HA   
1721 H HB2  . ASN A 117 ? 0.4391 0.4391 0.4391 0.0000  0.0000  0.0000  117  ASN A HB2  
1722 H HB3  . ASN A 117 ? 0.4391 0.4391 0.4391 0.0000  0.0000  0.0000  117  ASN A HB3  
1723 H HD21 . ASN A 117 ? 0.4810 0.4810 0.4810 0.0000  0.0000  0.0000  117  ASN A HD21 
1724 H HD22 . ASN A 117 ? 0.4810 0.4810 0.4810 0.0000  0.0000  0.0000  117  ASN A HD22 
1725 N N    . ASN A 118 ? 0.1358 0.2080 0.2002 -0.0205 -0.0431 0.0359  118  ASN A N    
1726 C CA   . ASN A 118 ? 0.1125 0.1955 0.1781 0.0037  -0.0168 0.0023  118  ASN A CA   
1727 C C    . ASN A 118 ? 0.1281 0.1357 0.1626 -0.0012 -0.0242 -0.0166 118  ASN A C    
1728 O O    . ASN A 118 ? 0.1418 0.1281 0.2303 -0.0028 -0.0161 -0.0060 118  ASN A O    
1729 C CB   . ASN A 118 ? 0.1524 0.1804 0.2311 0.0276  -0.0120 0.0083  118  ASN A CB   
1730 C CG   . ASN A 118 ? 0.1518 0.2027 0.1977 0.0013  0.0178  0.0123  118  ASN A CG   
1731 O OD1  . ASN A 118 ? 0.1759 0.1954 0.2154 -0.0141 -0.0254 0.0321  118  ASN A OD1  
1732 N ND2  . ASN A 118 ? 0.3671 0.7979 0.2815 0.2991  0.0921  0.0221  118  ASN A ND2  
1733 H H    . ASN A 118 ? 0.2176 0.2176 0.2176 0.0000  0.0000  0.0000  118  ASN A H    
1734 H HA   . ASN A 118 ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  118  ASN A HA   
1735 H HB2  . ASN A 118 ? 0.2256 0.2256 0.2256 0.0000  0.0000  0.0000  118  ASN A HB2  
1736 H HB3  . ASN A 118 ? 0.2256 0.2256 0.2256 0.0000  0.0000  0.0000  118  ASN A HB3  
1737 H HD21 . ASN A 118 ? 0.5785 0.5785 0.5785 0.0000  0.0000  0.0000  118  ASN A HD21 
1738 H HD22 . ASN A 118 ? 0.5785 0.5785 0.5785 0.0000  0.0000  0.0000  118  ASN A HD22 
1739 N N    . ASP A 119 ? 0.1264 0.1199 0.1279 0.0068  -0.0183 -0.0099 119  ASP A N    
1740 C CA   . ASP A 119 ? 0.1272 0.1166 0.1246 0.0065  -0.0142 -0.0034 119  ASP A CA   
1741 C C    . ASP A 119 ? 0.1170 0.1108 0.1181 0.0100  -0.0132 -0.0020 119  ASP A C    
1742 O O    . ASP A 119 ? 0.1164 0.1291 0.1265 0.0136  -0.0146 -0.0123 119  ASP A O    
1743 C CB   . ASP A 119 ? 0.1392 0.1307 0.1292 0.0038  -0.0033 -0.0174 119  ASP A CB   
1744 C CG   . ASP A 119 ? 0.1310 0.1306 0.1290 0.0113  -0.0028 -0.0150 119  ASP A CG   
1745 O OD1  . ASP A 119 ? 0.1639 0.1243 0.1354 0.0050  -0.0144 -0.0094 119  ASP A OD1  
1746 O OD2  . ASP A 119 ? 0.1543 0.1336 0.1252 0.0054  0.0005  -0.0121 119  ASP A OD2  
1747 H H    . ASP A 119 ? 0.1497 0.1497 0.1497 0.0000  0.0000  0.0000  119  ASP A H    
1748 H HA   . ASP A 119 ? 0.1474 0.1474 0.1474 0.0000  0.0000  0.0000  119  ASP A HA   
1749 H HB2  . ASP A 119 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  119  ASP A HB2  
1750 H HB3  . ASP A 119 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  119  ASP A HB3  
1751 N N    . GLY A 120 ? 0.1111 0.1170 0.1263 0.0048  -0.0110 -0.0136 120  GLY A N    
1752 C CA   . GLY A 120 ? 0.1148 0.1121 0.1206 0.0098  -0.0150 -0.0036 120  GLY A CA   
1753 C C    . GLY A 120 ? 0.0990 0.1152 0.1106 0.0061  -0.0035 -0.0021 120  GLY A C    
1754 O O    . GLY A 120 ? 0.1065 0.1183 0.1228 0.0056  -0.0109 -0.0048 120  GLY A O    
1755 H H    . GLY A 120 ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  120  GLY A H    
1756 H HA2  . GLY A 120 ? 0.1391 0.1391 0.1391 0.0000  0.0000  0.0000  120  GLY A HA2  
1757 H HA3  . GLY A 120 ? 0.1391 0.1391 0.1391 0.0000  0.0000  0.0000  120  GLY A HA3  
1758 N N    . LEU A 121 ? 0.1051 0.1080 0.1211 0.0096  -0.0162 -0.0008 121  LEU A N    
1759 C CA   . LEU A 121 ? 0.1043 0.1122 0.1154 0.0162  -0.0038 -0.0047 121  LEU A CA   
1760 C C    . LEU A 121 ? 0.1118 0.1099 0.1081 0.0097  -0.0110 -0.0071 121  LEU A C    
1761 O O    . LEU A 121 ? 0.1103 0.1127 0.1409 0.0064  -0.0242 -0.0024 121  LEU A O    
1762 C CB   . LEU A 121 ? 0.1638 0.1280 0.1203 0.0020  0.0095  -0.0072 121  LEU A CB   
1763 C CG   . LEU A 121 ? 0.1691 0.1570 0.1401 -0.0156 0.0156  -0.0020 121  LEU A CG   
1764 C CD1  . LEU A 121 ? 0.1829 0.1437 0.1584 -0.0119 0.0324  -0.0110 121  LEU A CD1  
1765 C CD2  . LEU A 121 ? 0.1544 0.1857 0.1661 0.0097  0.0088  -0.0330 121  LEU A CD2  
1766 H H    . LEU A 121 ? 0.1336 0.1336 0.1336 0.0000  0.0000  0.0000  121  LEU A H    
1767 H HA   . LEU A 121 ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  121  LEU A HA   
1768 H HB2  . LEU A 121 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  121  LEU A HB2  
1769 H HB3  . LEU A 121 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  121  LEU A HB3  
1770 H HG   . LEU A 121 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  121  LEU A HG   
1771 H HD11 . LEU A 121 ? 0.2425 0.2425 0.2425 0.0000  0.0000  0.0000  121  LEU A HD11 
1772 H HD12 . LEU A 121 ? 0.2425 0.2425 0.2425 0.0000  0.0000  0.0000  121  LEU A HD12 
1773 H HD13 . LEU A 121 ? 0.2425 0.2425 0.2425 0.0000  0.0000  0.0000  121  LEU A HD13 
1774 H HD21 . LEU A 121 ? 0.2530 0.2530 0.2530 0.0000  0.0000  0.0000  121  LEU A HD21 
1775 H HD22 . LEU A 121 ? 0.2530 0.2530 0.2530 0.0000  0.0000  0.0000  121  LEU A HD22 
1776 H HD23 . LEU A 121 ? 0.2530 0.2530 0.2530 0.0000  0.0000  0.0000  121  LEU A HD23 
1777 N N    . LEU A 122 ? 0.0992 0.1108 0.1230 0.0115  -0.0130 -0.0054 122  LEU A N    
1778 C CA   . LEU A 122 ? 0.0986 0.1049 0.1119 0.0077  -0.0098 -0.0070 122  LEU A CA   
1779 C C    . LEU A 122 ? 0.0945 0.1106 0.1076 0.0121  -0.0087 0.0024  122  LEU A C    
1780 O O    . LEU A 122 ? 0.1023 0.1233 0.1163 0.0139  -0.0064 -0.0075 122  LEU A O    
1781 C CB   . LEU A 122 ? 0.1119 0.1134 0.1158 0.0039  0.0026  -0.0111 122  LEU A CB   
1782 C CG   . LEU A 122 ? 0.1076 0.1209 0.1296 0.0066  -0.0034 -0.0002 122  LEU A CG   
1783 C CD1  . LEU A 122 ? 0.1315 0.1435 0.1247 -0.0031 0.0015  -0.0048 122  LEU A CD1  
1784 C CD2  . LEU A 122 ? 0.1233 0.1247 0.1544 0.0087  0.0083  0.0061  122  LEU A CD2  
1785 H H    . LEU A 122 ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  122  LEU A H    
1786 H HA   . LEU A 122 ? 0.1261 0.1261 0.1261 0.0000  0.0000  0.0000  122  LEU A HA   
1787 H HB2  . LEU A 122 ? 0.1364 0.1364 0.1364 0.0000  0.0000  0.0000  122  LEU A HB2  
1788 H HB3  . LEU A 122 ? 0.1364 0.1364 0.1364 0.0000  0.0000  0.0000  122  LEU A HB3  
1789 H HG   . LEU A 122 ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  122  LEU A HG   
1790 H HD11 . LEU A 122 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  122  LEU A HD11 
1791 H HD12 . LEU A 122 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  122  LEU A HD12 
1792 H HD13 . LEU A 122 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  122  LEU A HD13 
1793 H HD21 . LEU A 122 ? 0.2012 0.2012 0.2012 0.0000  0.0000  0.0000  122  LEU A HD21 
1794 H HD22 . LEU A 122 ? 0.2012 0.2012 0.2012 0.0000  0.0000  0.0000  122  LEU A HD22 
1795 H HD23 . LEU A 122 ? 0.2012 0.2012 0.2012 0.0000  0.0000  0.0000  122  LEU A HD23 
1796 N N    . GLY A 123 ? 0.1006 0.1110 0.1215 0.0135  -0.0099 -0.0061 123  GLY A N    
1797 C CA   . GLY A 123 ? 0.1132 0.1101 0.1072 0.0149  -0.0112 -0.0073 123  GLY A CA   
1798 C C    . GLY A 123 ? 0.1015 0.1117 0.1074 0.0093  -0.0078 -0.0025 123  GLY A C    
1799 O O    . GLY A 123 ? 0.1082 0.1139 0.1394 0.0142  0.0009  -0.0044 123  GLY A O    
1800 H H    . GLY A 123 ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  123  GLY A H    
1801 H HA2  . GLY A 123 ? 0.1322 0.1322 0.1322 0.0000  0.0000  0.0000  123  GLY A HA2  
1802 H HA3  . GLY A 123 ? 0.1322 0.1322 0.1322 0.0000  0.0000  0.0000  123  GLY A HA3  
1803 N N    . LEU A 124 ? 0.1044 0.1049 0.1073 0.0097  0.0009  -0.0038 124  LEU A N    
1804 C CA   . LEU A 124 ? 0.1028 0.1053 0.1120 0.0078  -0.0035 -0.0028 124  LEU A CA   
1805 C C    . LEU A 124 ? 0.1080 0.1106 0.1163 0.0079  -0.0010 -0.0017 124  LEU A C    
1806 O O    . LEU A 124 ? 0.1325 0.1120 0.1168 0.0205  0.0073  -0.0001 124  LEU A O    
1807 C CB   . LEU A 124 ? 0.1188 0.1096 0.1159 0.0096  -0.0088 0.0025  124  LEU A CB   
1808 C CG   . LEU A 124 ? 0.1274 0.1043 0.1113 0.0097  -0.0038 0.0017  124  LEU A CG   
1809 C CD1  . LEU A 124 ? 0.1676 0.1361 0.1098 0.0147  -0.0190 -0.0062 124  LEU A CD1  
1810 C CD2  . LEU A 124 ? 0.1609 0.1289 0.1328 -0.0070 0.0234  0.0050  124  LEU A CD2  
1811 H H    . LEU A 124 ? 0.1267 0.1267 0.1267 0.0000  0.0000  0.0000  124  LEU A H    
1812 H HA   . LEU A 124 ? 0.1280 0.1280 0.1280 0.0000  0.0000  0.0000  124  LEU A HA   
1813 H HB2  . LEU A 124 ? 0.1377 0.1377 0.1377 0.0000  0.0000  0.0000  124  LEU A HB2  
1814 H HB3  . LEU A 124 ? 0.1377 0.1377 0.1377 0.0000  0.0000  0.0000  124  LEU A HB3  
1815 H HG   . LEU A 124 ? 0.1372 0.1372 0.1372 0.0000  0.0000  0.0000  124  LEU A HG   
1816 H HD11 . LEU A 124 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  124  LEU A HD11 
1817 H HD12 . LEU A 124 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  124  LEU A HD12 
1818 H HD13 . LEU A 124 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  124  LEU A HD13 
1819 H HD21 . LEU A 124 ? 0.2113 0.2113 0.2113 0.0000  0.0000  0.0000  124  LEU A HD21 
1820 H HD22 . LEU A 124 ? 0.2113 0.2113 0.2113 0.0000  0.0000  0.0000  124  LEU A HD22 
1821 H HD23 . LEU A 124 ? 0.2113 0.2113 0.2113 0.0000  0.0000  0.0000  124  LEU A HD23 
1822 N N    . ALA A 125 ? 0.1098 0.1025 0.1112 0.0104  -0.0053 -0.0066 125  ALA A N    
1823 C CA   . ALA A 125 ? 0.1070 0.1046 0.1101 0.0067  -0.0019 -0.0082 125  ALA A CA   
1824 C C    . ALA A 125 ? 0.1181 0.1118 0.1080 0.0065  -0.0003 -0.0017 125  ALA A C    
1825 O O    . ALA A 125 ? 0.1312 0.1259 0.1252 -0.0119 0.0084  -0.0113 125  ALA A O    
1826 C CB   . ALA A 125 ? 0.1220 0.1131 0.1110 0.0004  -0.0036 -0.0115 125  ALA A CB   
1827 H H    . ALA A 125 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  125  ALA A H    
1828 H HA   . ALA A 125 ? 0.1287 0.1287 0.1287 0.0000  0.0000  0.0000  125  ALA A HA   
1829 H HB1  . ALA A 125 ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  125  ALA A HB1  
1830 H HB2  . ALA A 125 ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  125  ALA A HB2  
1831 H HB3  . ALA A 125 ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  125  ALA A HB3  
1832 N N    . PHE A 126 ? 0.1086 0.1196 0.1184 -0.0071 0.0005  -0.0121 126  PHE A N    
1833 C CA   . PHE A 126 ? 0.1094 0.1110 0.1323 -0.0006 -0.0033 -0.0078 126  PHE A CA   
1834 C C    . PHE A 126 ? 0.1123 0.1115 0.1203 0.0063  0.0005  -0.0121 126  PHE A C    
1835 O O    . PHE A 126 ? 0.1330 0.1128 0.1373 0.0031  0.0027  -0.0079 126  PHE A O    
1836 C CB   . PHE A 126 ? 0.1282 0.1162 0.1257 0.0010  -0.0092 -0.0127 126  PHE A CB   
1837 C CG   . PHE A 126 ? 0.1243 0.1162 0.1303 0.0066  -0.0166 -0.0185 126  PHE A CG   
1838 C CD1  . PHE A 126 ? 0.1295 0.1229 0.1424 0.0012  -0.0060 -0.0019 126  PHE A CD1  
1839 C CD2  . PHE A 126 ? 0.1248 0.1239 0.2029 0.0082  0.0110  0.0069  126  PHE A CD2  
1840 C CE1  . PHE A 126 ? 0.1254 0.1400 0.1580 0.0185  -0.0129 0.0051  126  PHE A CE1  
1841 C CE2  . PHE A 126 ? 0.1456 0.1337 0.2337 0.0189  0.0148  0.0263  126  PHE A CE2  
1842 C CZ   . PHE A 126 ? 0.1439 0.1385 0.1574 0.0255  -0.0103 0.0146  126  PHE A CZ   
1843 H H    . PHE A 126 ? 0.1387 0.1387 0.1387 0.0000  0.0000  0.0000  126  PHE A H    
1844 H HA   . PHE A 126 ? 0.1411 0.1411 0.1411 0.0000  0.0000  0.0000  126  PHE A HA   
1845 H HB2  . PHE A 126 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  126  PHE A HB2  
1846 H HB3  . PHE A 126 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  126  PHE A HB3  
1847 H HD1  . PHE A 126 ? 0.1579 0.1579 0.1579 0.0000  0.0000  0.0000  126  PHE A HD1  
1848 H HD2  . PHE A 126 ? 0.1806 0.1806 0.1806 0.0000  0.0000  0.0000  126  PHE A HD2  
1849 H HE1  . PHE A 126 ? 0.1693 0.1693 0.1693 0.0000  0.0000  0.0000  126  PHE A HE1  
1850 H HE2  . PHE A 126 ? 0.2052 0.2052 0.2052 0.0000  0.0000  0.0000  126  PHE A HE2  
1851 H HZ   . PHE A 126 ? 0.1759 0.1759 0.1759 0.0000  0.0000  0.0000  126  PHE A HZ   
1852 N N    . SER A 127 ? 0.1129 0.1142 0.1359 0.0092  -0.0050 -0.0014 127  SER A N    
1853 C CA   . SER A 127 ? 0.1244 0.1174 0.1339 0.0062  -0.0050 -0.0061 127  SER A CA   
1854 C C    . SER A 127 ? 0.1226 0.1183 0.1417 0.0062  -0.0124 -0.0101 127  SER A C    
1855 O O    . SER A 127 ? 0.1180 0.1319 0.1473 0.0122  -0.0083 0.0030  127  SER A O    
1856 C CB   . SER A 127 ? 0.1200 0.1447 0.1482 0.0178  0.0048  0.0025  127  SER A CB   
1857 O OG   . SER A 127 ? 0.1646 0.1503 0.1372 0.0296  0.0101  0.0029  127  SER A OG   
1858 H H    . SER A 127 ? 0.1451 0.1451 0.1451 0.0000  0.0000  0.0000  127  SER A H    
1859 H HA   . SER A 127 ? 0.1503 0.1503 0.1503 0.0000  0.0000  0.0000  127  SER A HA   
1860 H HB2  . SER A 127 ? 0.1652 0.1652 0.1652 0.0000  0.0000  0.0000  127  SER A HB2  
1861 H HB3  . SER A 127 ? 0.1652 0.1652 0.1652 0.0000  0.0000  0.0000  127  SER A HB3  
1862 H HG   . SER A 127 ? 0.2261 0.2261 0.2261 0.0000  0.0000  0.0000  127  SER A HG   
1863 N N    . SER A 128 ? 0.1348 0.1220 0.1294 0.0084  -0.0232 -0.0154 128  SER A N    
1864 C CA   . SER A 128 ? 0.1466 0.1334 0.1371 0.0013  -0.0160 -0.0178 128  SER A CA   
1865 C C    . SER A 128 ? 0.1452 0.1437 0.1299 0.0104  -0.0260 -0.0144 128  SER A C    
1866 O O    . SER A 128 ? 0.2207 0.1647 0.1465 -0.0190 -0.0557 0.0026  128  SER A O    
1867 C CB   . SER A 128 ? 0.1879 0.1340 0.1362 0.0026  -0.0247 -0.0215 128  SER A CB   
1868 O OG   . SER A 128 ? 0.1681 0.1555 0.1998 0.0057  0.0180  -0.0317 128  SER A OG   
1869 H H    . SER A 128 ? 0.1545 0.1545 0.1545 0.0000  0.0000  0.0000  128  SER A H    
1870 H HA   . SER A 128 ? 0.1668 0.1668 0.1668 0.0000  0.0000  0.0000  128  SER A HA   
1871 H HB2  . SER A 128 ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  128  SER A HB2  
1872 H HB3  . SER A 128 ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  128  SER A HB3  
1873 H HG   . SER A 128 ? 0.2617 0.2617 0.2617 0.0000  0.0000  0.0000  128  SER A HG   
1874 N N    . ILE A 129 ? 0.1182 0.1194 0.1196 0.0138  -0.0076 -0.0108 129  ILE A N    
1875 C CA   . ILE A 129 ? 0.1222 0.1281 0.1177 0.0200  -0.0062 -0.0061 129  ILE A CA   
1876 C C    . ILE A 129 ? 0.1173 0.1214 0.1227 0.0204  -0.0053 -0.0047 129  ILE A C    
1877 O O    . ILE A 129 ? 0.1127 0.1243 0.1428 0.0117  -0.0054 -0.0075 129  ILE A O    
1878 C CB   . ILE A 129 ? 0.1211 0.1425 0.1200 0.0172  0.0044  0.0083  129  ILE A CB   
1879 C CG1  . ILE A 129 ? 0.1112 0.1313 0.1303 0.0183  0.0057  0.0001  129  ILE A CG1  
1880 C CG2  . ILE A 129 ? 0.1561 0.1570 0.1228 0.0400  0.0026  0.0035  129  ILE A CG2  
1881 C CD1  . ILE A 129 ? 0.1182 0.1321 0.1543 0.0090  -0.0039 0.0103  129  ILE A CD1  
1882 H H    . ILE A 129 ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  129  ILE A H    
1883 H HA   . ILE A 129 ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  129  ILE A HA   
1884 H HB   . ILE A 129 ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  129  ILE A HB   
1885 H HG12 . ILE A 129 ? 0.1491 0.1491 0.1491 0.0000  0.0000  0.0000  129  ILE A HG12 
1886 H HG13 . ILE A 129 ? 0.1491 0.1491 0.1491 0.0000  0.0000  0.0000  129  ILE A HG13 
1887 H HG21 . ILE A 129 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  129  ILE A HG21 
1888 H HG22 . ILE A 129 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  129  ILE A HG22 
1889 H HG23 . ILE A 129 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  129  ILE A HG23 
1890 H HD11 . ILE A 129 ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  129  ILE A HD11 
1891 H HD12 . ILE A 129 ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  129  ILE A HD12 
1892 H HD13 . ILE A 129 ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  129  ILE A HD13 
1893 N N    . ASN A 130 ? 0.1067 0.1154 0.1324 0.0128  -0.0083 -0.0121 130  ASN A N    
1894 C CA   . ASN A 130 ? 0.0970 0.1136 0.1295 0.0108  -0.0141 -0.0115 130  ASN A CA   
1895 C C    . ASN A 130 ? 0.1020 0.1220 0.1220 0.0105  -0.0174 -0.0103 130  ASN A C    
1896 O O    . ASN A 130 ? 0.1166 0.1310 0.1371 0.0152  -0.0228 -0.0169 130  ASN A O    
1897 C CB   . ASN A 130 ? 0.1006 0.1155 0.1339 0.0105  -0.0153 -0.0079 130  ASN A CB   
1898 C CG   . ASN A 130 ? 0.0992 0.1088 0.1327 0.0081  -0.0092 -0.0049 130  ASN A CG   
1899 O OD1  . ASN A 130 ? 0.1019 0.1247 0.1367 0.0113  -0.0188 -0.0124 130  ASN A OD1  
1900 N ND2  . ASN A 130 ? 0.1070 0.1229 0.1358 0.0139  -0.0177 -0.0198 130  ASN A ND2  
1901 H H    . ASN A 130 ? 0.1418 0.1418 0.1418 0.0000  0.0000  0.0000  130  ASN A H    
1902 H HA   . ASN A 130 ? 0.1360 0.1360 0.1360 0.0000  0.0000  0.0000  130  ASN A HA   
1903 H HB2  . ASN A 130 ? 0.1399 0.1399 0.1399 0.0000  0.0000  0.0000  130  ASN A HB2  
1904 H HB3  . ASN A 130 ? 0.1399 0.1399 0.1399 0.0000  0.0000  0.0000  130  ASN A HB3  
1905 H HD21 . ASN A 130 ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  130  ASN A HD21 
1906 H HD22 . ASN A 130 ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  130  ASN A HD22 
1907 N N    . THR A 131 ? 0.1100 0.1152 0.1194 0.0075  -0.0152 -0.0074 131  THR A N    
1908 C CA   . THR A 131 ? 0.1097 0.1256 0.1219 0.0073  -0.0116 -0.0010 131  THR A CA   
1909 C C    . THR A 131 ? 0.1114 0.1283 0.1301 0.0104  -0.0245 -0.0014 131  THR A C    
1910 O O    . THR A 131 ? 0.1186 0.1566 0.1531 0.0067  -0.0249 0.0223  131  THR A O    
1911 C CB   . THR A 131 ? 0.1153 0.1229 0.1287 0.0073  -0.0082 0.0019  131  THR A CB   
1912 O OG1  . THR A 131 ? 0.1374 0.1294 0.1326 0.0126  -0.0165 -0.0051 131  THR A OG1  
1913 C CG2  . THR A 131 ? 0.1091 0.1413 0.1493 -0.0003 -0.0146 0.0024  131  THR A CG2  
1914 H H    . THR A 131 ? 0.1378 0.1378 0.1378 0.0000  0.0000  0.0000  131  THR A H    
1915 H HA   . THR A 131 ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  131  THR A HA   
1916 H HB   . THR A 131 ? 0.1468 0.1468 0.1468 0.0000  0.0000  0.0000  131  THR A HB   
1917 H HG1  . THR A 131 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  131  THR A HG1  
1918 H HG21 . THR A 131 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  131  THR A HG21 
1919 H HG22 . THR A 131 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  131  THR A HG22 
1920 H HG23 . THR A 131 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  131  THR A HG23 
1921 N N    . VAL A 132 ? 0.1046 0.1189 0.1351 0.0102  -0.0244 -0.0108 132  VAL A N    
1922 C CA   . VAL A 132 ? 0.1002 0.1101 0.1393 0.0103  -0.0244 -0.0089 132  VAL A CA   
1923 C C    . VAL A 132 ? 0.0893 0.1335 0.1342 0.0109  -0.0118 -0.0169 132  VAL A C    
1924 O O    . VAL A 132 ? 0.1155 0.1244 0.1368 0.0098  -0.0118 -0.0217 132  VAL A O    
1925 C CB   . VAL A 132 ? 0.1093 0.1152 0.1337 0.0094  -0.0170 -0.0128 132  VAL A CB   
1926 C CG1  . VAL A 132 ? 0.1064 0.1304 0.1377 0.0105  -0.0142 -0.0171 132  VAL A CG1  
1927 C CG2  . VAL A 132 ? 0.1019 0.1203 0.1412 0.0089  -0.0146 -0.0222 132  VAL A CG2  
1928 H H    . VAL A 132 ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  132  VAL A H    
1929 H HA   . VAL A 132 ? 0.1398 0.1398 0.1398 0.0000  0.0000  0.0000  132  VAL A HA   
1930 H HB   . VAL A 132 ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  132  VAL A HB   
1931 H HG11 . VAL A 132 ? 0.1872 0.1872 0.1872 0.0000  0.0000  0.0000  132  VAL A HG11 
1932 H HG12 . VAL A 132 ? 0.1872 0.1872 0.1872 0.0000  0.0000  0.0000  132  VAL A HG12 
1933 H HG13 . VAL A 132 ? 0.1872 0.1872 0.1872 0.0000  0.0000  0.0000  132  VAL A HG13 
1934 H HG21 . VAL A 132 ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  132  VAL A HG21 
1935 H HG22 . VAL A 132 ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  132  VAL A HG22 
1936 H HG23 . VAL A 132 ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  132  VAL A HG23 
1937 N N    . GLN A 133 ? 0.1012 0.1312 0.1327 0.0116  -0.0214 -0.0182 133  GLN A N    
1938 C CA   . GLN A 133 ? 0.1013 0.1563 0.1269 0.0099  -0.0255 -0.0187 133  GLN A CA   
1939 C C    . GLN A 133 ? 0.1067 0.1251 0.1231 0.0107  -0.0236 -0.0075 133  GLN A C    
1940 O O    . GLN A 133 ? 0.1091 0.1311 0.1521 0.0131  -0.0265 -0.0222 133  GLN A O    
1941 C CB   . GLN A 133 ? 0.1259 0.2457 0.1259 -0.0088 -0.0206 0.0072  133  GLN A CB   
1942 C CG   . GLN A 133 ? 0.1382 0.1933 0.1669 -0.0112 -0.0139 -0.0022 133  GLN A CG   
1943 C CD   . GLN A 133 ? 0.1583 0.1797 0.1788 -0.0081 -0.0331 -0.0001 133  GLN A CD   
1944 O OE1  . GLN A 133 ? 0.1938 0.2302 0.2178 0.0238  -0.0439 -0.0555 133  GLN A OE1  
1945 N NE2  . GLN A 133 ? 0.1868 0.2344 0.2981 0.0376  -0.0540 -0.0627 133  GLN A NE2  
1946 H H    . GLN A 133 ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  133  GLN A H    
1947 H HA   . GLN A 133 ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  133  GLN A HA   
1948 H HB2  . GLN A 133 ? 0.1990 0.1990 0.1990 0.0000  0.0000  0.0000  133  GLN A HB2  
1949 H HB3  . GLN A 133 ? 0.1990 0.1990 0.1990 0.0000  0.0000  0.0000  133  GLN A HB3  
1950 H HG2  . GLN A 133 ? 0.1993 0.1993 0.1993 0.0000  0.0000  0.0000  133  GLN A HG2  
1951 H HG3  . GLN A 133 ? 0.1993 0.1993 0.1993 0.0000  0.0000  0.0000  133  GLN A HG3  
1952 H HE21 . GLN A 133 ? 0.2878 0.2878 0.2878 0.0000  0.0000  0.0000  133  GLN A HE21 
1953 H HE22 . GLN A 133 ? 0.2878 0.2878 0.2878 0.0000  0.0000  0.0000  133  GLN A HE22 
1954 N N    . PRO A 134 ? 0.1030 0.1341 0.1273 0.0102  -0.0199 -0.0129 134  PRO A N    
1955 C CA   . PRO A 134 ? 0.1232 0.1351 0.1205 -0.0040 -0.0150 -0.0185 134  PRO A CA   
1956 C C    . PRO A 134 ? 0.1365 0.1347 0.1272 -0.0019 -0.0141 -0.0169 134  PRO A C    
1957 O O    . PRO A 134 ? 0.1894 0.1408 0.1292 0.0102  -0.0067 -0.0187 134  PRO A O    
1958 C CB   . PRO A 134 ? 0.1331 0.1641 0.1331 -0.0123 -0.0267 -0.0096 134  PRO A CB   
1959 C CG   . PRO A 134 ? 0.1248 0.1638 0.1430 -0.0109 -0.0245 -0.0206 134  PRO A CG   
1960 C CD   . PRO A 134 ? 0.1089 0.1461 0.1557 0.0102  -0.0259 -0.0212 134  PRO A CD   
1961 H HA   . PRO A 134 ? 0.1515 0.1515 0.1515 0.0000  0.0000  0.0000  134  PRO A HA   
1962 H HB2  . PRO A 134 ? 0.1721 0.1721 0.1721 0.0000  0.0000  0.0000  134  PRO A HB2  
1963 H HB3  . PRO A 134 ? 0.1721 0.1721 0.1721 0.0000  0.0000  0.0000  134  PRO A HB3  
1964 H HG2  . PRO A 134 ? 0.1726 0.1726 0.1726 0.0000  0.0000  0.0000  134  PRO A HG2  
1965 H HG3  . PRO A 134 ? 0.1726 0.1726 0.1726 0.0000  0.0000  0.0000  134  PRO A HG3  
1966 H HD2  . PRO A 134 ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  134  PRO A HD2  
1967 H HD3  . PRO A 134 ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  134  PRO A HD3  
1968 N N    . GLN A 135 ? 0.1387 0.1336 0.1284 0.0075  -0.0113 -0.0171 135  GLN A N    
1969 C CA   . GLN A 135 ? 0.1468 0.1316 0.1364 -0.0012 -0.0164 -0.0156 135  GLN A CA   
1970 C C    . GLN A 135 ? 0.1631 0.1277 0.1305 0.0065  -0.0227 -0.0122 135  GLN A C    
1971 O O    . GLN A 135 ? 0.1682 0.1355 0.1352 0.0098  -0.0227 -0.0269 135  GLN A O    
1972 C CB   . GLN A 135 ? 0.1573 0.1385 0.1439 -0.0007 -0.0262 -0.0007 135  GLN A CB   
1973 C CG   . GLN A 135 ? 0.1587 0.1554 0.1607 -0.0173 -0.0256 0.0015  135  GLN A CG   
1974 C CD   . GLN A 135 ? 0.1838 0.1819 0.1572 -0.0384 -0.0217 -0.0072 135  GLN A CD   
1975 O OE1  . GLN A 135 ? 0.2525 0.2055 0.2811 -0.0634 0.0465  -0.0437 135  GLN A OE1  
1976 N NE2  . GLN A 135 ? 0.2512 0.2376 0.2059 -0.0702 0.0447  -0.0248 135  GLN A NE2  
1977 H H    . GLN A 135 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  135  GLN A H    
1978 H HA   . GLN A 135 ? 0.1659 0.1659 0.1659 0.0000  0.0000  0.0000  135  GLN A HA   
1979 H HB2  . GLN A 135 ? 0.1759 0.1759 0.1759 0.0000  0.0000  0.0000  135  GLN A HB2  
1980 H HB3  . GLN A 135 ? 0.1759 0.1759 0.1759 0.0000  0.0000  0.0000  135  GLN A HB3  
1981 H HG2  . GLN A 135 ? 0.1900 0.1900 0.1900 0.0000  0.0000  0.0000  135  GLN A HG2  
1982 H HG3  . GLN A 135 ? 0.1900 0.1900 0.1900 0.0000  0.0000  0.0000  135  GLN A HG3  
1983 H HE21 . GLN A 135 ? 0.2779 0.2779 0.2779 0.0000  0.0000  0.0000  135  GLN A HE21 
1984 H HE22 . GLN A 135 ? 0.2779 0.2779 0.2779 0.0000  0.0000  0.0000  135  GLN A HE22 
1985 N N    . SER A 136 ? 0.1591 0.1338 0.1298 0.0066  -0.0190 -0.0273 136  SER A N    
1986 C CA   . SER A 136 ? 0.1544 0.1320 0.1347 -0.0030 -0.0209 -0.0180 136  SER A CA   
1987 C C    . SER A 136 ? 0.1348 0.1218 0.1346 0.0044  -0.0218 -0.0163 136  SER A C    
1988 O O    . SER A 136 ? 0.1540 0.1395 0.1693 -0.0159 -0.0302 -0.0126 136  SER A O    
1989 C CB   . SER A 136 ? 0.1434 0.1824 0.1540 -0.0088 -0.0108 -0.0362 136  SER A CB   
1990 O OG   . SER A 136 ? 0.1651 0.1886 0.2262 0.0372  -0.0558 -0.0702 136  SER A OG   
1991 H H    . SER A 136 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  136  SER A H    
1992 H HA   . SER A 136 ? 0.1684 0.1684 0.1684 0.0000  0.0000  0.0000  136  SER A HA   
1993 H HB2  . SER A 136 ? 0.1919 0.1919 0.1919 0.0000  0.0000  0.0000  136  SER A HB2  
1994 H HB3  . SER A 136 ? 0.1919 0.1919 0.1919 0.0000  0.0000  0.0000  136  SER A HB3  
1995 H HG   . SER A 136 ? 0.2899 0.2899 0.2899 0.0000  0.0000  0.0000  136  SER A HG   
1996 N N    . GLN A 137 ? 0.1086 0.1366 0.1313 -0.0030 -0.0095 -0.0144 137  GLN A N    
1997 C CA   . GLN A 137 ? 0.1260 0.1385 0.1306 0.0087  0.0032  -0.0098 137  GLN A CA   
1998 C C    . GLN A 137 ? 0.1429 0.1243 0.1302 0.0048  -0.0001 -0.0059 137  GLN A C    
1999 O O    . GLN A 137 ? 0.1431 0.1889 0.1493 0.0241  0.0010  0.0307  137  GLN A O    
2000 C CB   . GLN A 137 ? 0.1431 0.1378 0.1351 0.0103  -0.0015 -0.0104 137  GLN A CB   
2001 C CG   . GLN A 137 ? 0.1534 0.1403 0.1354 0.0263  0.0014  -0.0062 137  GLN A CG   
2002 C CD   . GLN A 137 ? 0.1276 0.1936 0.1610 0.0307  0.0118  -0.0006 137  GLN A CD   
2003 O OE1  . GLN A 137 ? 0.1465 0.2462 0.1833 0.0207  0.0376  0.0212  137  GLN A OE1  
2004 N NE2  . GLN A 137 ? 0.1459 0.1960 0.1813 0.0178  -0.0074 -0.0090 137  GLN A NE2  
2005 H H    . GLN A 137 ? 0.1506 0.1506 0.1506 0.0000  0.0000  0.0000  137  GLN A H    
2006 H HA   . GLN A 137 ? 0.1581 0.1581 0.1581 0.0000  0.0000  0.0000  137  GLN A HA   
2007 H HB2  . GLN A 137 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  137  GLN A HB2  
2008 H HB3  . GLN A 137 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  137  GLN A HB3  
2009 H HG2  . GLN A 137 ? 0.1716 0.1716 0.1716 0.0000  0.0000  0.0000  137  GLN A HG2  
2010 H HG3  . GLN A 137 ? 0.1716 0.1716 0.1716 0.0000  0.0000  0.0000  137  GLN A HG3  
2011 H HE21 . GLN A 137 ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  137  GLN A HE21 
2012 H HE22 . GLN A 137 ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  137  GLN A HE22 
2013 N N    . THR A 138 ? 0.1510 0.1446 0.1327 0.0146  0.0096  -0.0058 138  THR A N    
2014 C CA   . THR A 138 ? 0.1722 0.1313 0.1427 0.0320  -0.0022 0.0018  138  THR A CA   
2015 C C    . THR A 138 ? 0.1643 0.1284 0.1228 0.0177  0.0026  0.0057  138  THR A C    
2016 O O    . THR A 138 ? 0.1703 0.1317 0.1312 0.0370  0.0023  -0.0086 138  THR A O    
2017 C CB   . THR A 138 ? 0.1576 0.1492 0.1662 0.0011  -0.0104 -0.0050 138  THR A CB   
2018 O OG1  . THR A 138 ? 0.1609 0.1606 0.1938 0.0017  0.0057  0.0194  138  THR A OG1  
2019 C CG2  . THR A 138 ? 0.2195 0.1656 0.2377 -0.0393 0.0240  -0.0338 138  THR A CG2  
2020 H H    . THR A 138 ? 0.1714 0.1714 0.1714 0.0000  0.0000  0.0000  138  THR A H    
2021 H HA   . THR A 138 ? 0.1785 0.1785 0.1785 0.0000  0.0000  0.0000  138  THR A HA   
2022 H HB   . THR A 138 ? 0.1892 0.1892 0.1892 0.0000  0.0000  0.0000  138  THR A HB   
2023 H HG1  . THR A 138 ? 0.2576 0.2576 0.2576 0.0000  0.0000  0.0000  138  THR A HG1  
2024 H HG21 . THR A 138 ? 0.3114 0.3114 0.3114 0.0000  0.0000  0.0000  138  THR A HG21 
2025 H HG22 . THR A 138 ? 0.3114 0.3114 0.3114 0.0000  0.0000  0.0000  138  THR A HG22 
2026 H HG23 . THR A 138 ? 0.3114 0.3114 0.3114 0.0000  0.0000  0.0000  138  THR A HG23 
2027 N N    . THR A 139 ? 0.1624 0.1279 0.1280 0.0347  0.0026  0.0149  139  THR A N    
2028 C CA   . THR A 139 ? 0.1580 0.1222 0.1247 0.0266  0.0016  0.0073  139  THR A CA   
2029 C C    . THR A 139 ? 0.1420 0.1162 0.1303 0.0256  0.0087  0.0163  139  THR A C    
2030 O O    . THR A 139 ? 0.1504 0.1210 0.1243 0.0179  0.0016  0.0025  139  THR A O    
2031 C CB   . THR A 139 ? 0.1679 0.1112 0.1418 0.0131  0.0193  0.0076  139  THR A CB   
2032 O OG1  . THR A 139 ? 0.1624 0.1249 0.1506 0.0173  0.0240  0.0243  139  THR A OG1  
2033 C CG2  . THR A 139 ? 0.1594 0.1359 0.1471 0.0180  0.0251  0.0165  139  THR A CG2  
2034 H H    . THR A 139 ? 0.1673 0.1673 0.1673 0.0000  0.0000  0.0000  139  THR A H    
2035 H HA   . THR A 139 ? 0.1620 0.1620 0.1620 0.0000  0.0000  0.0000  139  THR A HA   
2036 H HB   . THR A 139 ? 0.1683 0.1683 0.1683 0.0000  0.0000  0.0000  139  THR A HB   
2037 H HG1  . THR A 139 ? 0.2190 0.2190 0.2190 0.0000  0.0000  0.0000  139  THR A HG1  
2038 H HG21 . THR A 139 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  139  THR A HG21 
2039 H HG22 . THR A 139 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  139  THR A HG22 
2040 H HG23 . THR A 139 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  139  THR A HG23 
2041 N N    . PHE A 140 ? 0.1401 0.1099 0.1349 0.0194  0.0158  0.0074  140  PHE A N    
2042 C CA   . PHE A 140 ? 0.1317 0.1174 0.1256 0.0124  0.0054  0.0158  140  PHE A CA   
2043 C C    . PHE A 140 ? 0.1133 0.1257 0.1233 0.0089  -0.0015 0.0072  140  PHE A C    
2044 O O    . PHE A 140 ? 0.1235 0.1180 0.1319 0.0012  -0.0030 0.0101  140  PHE A O    
2045 C CB   . PHE A 140 ? 0.1388 0.1172 0.1385 0.0079  0.0096  -0.0049 140  PHE A CB   
2046 C CG   . PHE A 140 ? 0.1461 0.1235 0.1310 0.0072  0.0061  0.0006  140  PHE A CG   
2047 C CD1  . PHE A 140 ? 0.1492 0.1346 0.1426 0.0111  0.0050  -0.0008 140  PHE A CD1  
2048 C CD2  . PHE A 140 ? 0.1349 0.1283 0.1439 0.0066  -0.0083 -0.0045 140  PHE A CD2  
2049 C CE1  . PHE A 140 ? 0.1745 0.1471 0.1444 -0.0103 0.0193  -0.0118 140  PHE A CE1  
2050 C CE2  . PHE A 140 ? 0.1740 0.1385 0.1366 0.0067  -0.0119 -0.0036 140  PHE A CE2  
2051 C CZ   . PHE A 140 ? 0.1867 0.1446 0.1364 -0.0134 -0.0011 0.0056  140  PHE A CZ   
2052 H H    . PHE A 140 ? 0.1540 0.1540 0.1540 0.0000  0.0000  0.0000  140  PHE A H    
2053 H HA   . PHE A 140 ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  140  PHE A HA   
2054 H HB2  . PHE A 140 ? 0.1578 0.1578 0.1578 0.0000  0.0000  0.0000  140  PHE A HB2  
2055 H HB3  . PHE A 140 ? 0.1578 0.1578 0.1578 0.0000  0.0000  0.0000  140  PHE A HB3  
2056 H HD1  . PHE A 140 ? 0.1706 0.1706 0.1706 0.0000  0.0000  0.0000  140  PHE A HD1  
2057 H HD2  . PHE A 140 ? 0.1629 0.1629 0.1629 0.0000  0.0000  0.0000  140  PHE A HD2  
2058 H HE1  . PHE A 140 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  140  PHE A HE1  
2059 H HE2  . PHE A 140 ? 0.1796 0.1796 0.1796 0.0000  0.0000  0.0000  140  PHE A HE2  
2060 H HZ   . PHE A 140 ? 0.1871 0.1871 0.1871 0.0000  0.0000  0.0000  140  PHE A HZ   
2061 N N    . PHE A 141 ? 0.1229 0.1077 0.1325 0.0036  0.0045  0.0100  141  PHE A N    
2062 C CA   . PHE A 141 ? 0.1191 0.1123 0.1315 0.0063  -0.0037 0.0117  141  PHE A CA   
2063 C C    . PHE A 141 ? 0.1161 0.1133 0.1321 0.0126  -0.0036 0.0174  141  PHE A C    
2064 O O    . PHE A 141 ? 0.1178 0.1213 0.1475 0.0025  -0.0127 0.0185  141  PHE A O    
2065 C CB   . PHE A 141 ? 0.1253 0.1211 0.1352 0.0124  -0.0083 0.0088  141  PHE A CB   
2066 C CG   . PHE A 141 ? 0.1038 0.1223 0.1660 0.0026  -0.0154 0.0149  141  PHE A CG   
2067 C CD1  . PHE A 141 ? 0.1005 0.1444 0.1799 0.0024  -0.0178 0.0327  141  PHE A CD1  
2068 C CD2  . PHE A 141 ? 0.1522 0.1370 0.1798 0.0243  -0.0237 -0.0056 141  PHE A CD2  
2069 C CE1  . PHE A 141 ? 0.1053 0.1517 0.1916 -0.0004 -0.0054 0.0415  141  PHE A CE1  
2070 C CE2  . PHE A 141 ? 0.1787 0.1515 0.1870 0.0354  -0.0234 0.0042  141  PHE A CE2  
2071 C CZ   . PHE A 141 ? 0.1841 0.1381 0.1932 0.0045  -0.0188 0.0152  141  PHE A CZ   
2072 H H    . PHE A 141 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  141  PHE A H    
2073 H HA   . PHE A 141 ? 0.1451 0.1451 0.1451 0.0000  0.0000  0.0000  141  PHE A HA   
2074 H HB2  . PHE A 141 ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  141  PHE A HB2  
2075 H HB3  . PHE A 141 ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  141  PHE A HB3  
2076 H HD1  . PHE A 141 ? 0.1700 0.1700 0.1700 0.0000  0.0000  0.0000  141  PHE A HD1  
2077 H HD2  . PHE A 141 ? 0.1876 0.1876 0.1876 0.0000  0.0000  0.0000  141  PHE A HD2  
2078 H HE1  . PHE A 141 ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  141  PHE A HE1  
2079 H HE2  . PHE A 141 ? 0.2068 0.2068 0.2068 0.0000  0.0000  0.0000  141  PHE A HE2  
2080 H HZ   . PHE A 141 ? 0.2062 0.2062 0.2062 0.0000  0.0000  0.0000  141  PHE A HZ   
2081 N N    . ASP A 142 ? 0.1307 0.1075 0.1413 0.0098  -0.0093 0.0087  142  ASP A N    
2082 C CA   . ASP A 142 ? 0.1447 0.1144 0.1340 0.0062  -0.0191 0.0040  142  ASP A CA   
2083 C C    . ASP A 142 ? 0.1424 0.1215 0.1420 -0.0007 -0.0193 -0.0052 142  ASP A C    
2084 O O    . ASP A 142 ? 0.1567 0.1337 0.1771 -0.0083 -0.0111 -0.0059 142  ASP A O    
2085 C CB   . ASP A 142 ? 0.1880 0.1291 0.1418 0.0282  -0.0146 -0.0021 142  ASP A CB   
2086 C CG   . ASP A 142 ? 0.2293 0.1559 0.1500 0.0531  0.0071  -0.0001 142  ASP A CG   
2087 O OD1  . ASP A 142 ? 0.2362 0.1828 0.1946 0.0801  0.0237  0.0218  142  ASP A OD1  
2088 O OD2  . ASP A 142 ? 0.3356 0.1917 0.2088 0.1076  0.0760  0.0345  142  ASP A OD2  
2089 H H    . ASP A 142 ? 0.1519 0.1519 0.1519 0.0000  0.0000  0.0000  142  ASP A H    
2090 H HA   . ASP A 142 ? 0.1572 0.1572 0.1572 0.0000  0.0000  0.0000  142  ASP A HA   
2091 H HB2  . ASP A 142 ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  142  ASP A HB2  
2092 H HB3  . ASP A 142 ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  142  ASP A HB3  
2093 N N    . THR A 143 ? 0.1269 0.1282 0.1411 -0.0001 -0.0134 -0.0038 143  THR A N    
2094 C CA   . THR A 143 ? 0.1188 0.1431 0.1560 0.0019  -0.0193 -0.0047 143  THR A CA   
2095 C C    . THR A 143 ? 0.1158 0.1483 0.1593 -0.0073 -0.0074 0.0049  143  THR A C    
2096 O O    . THR A 143 ? 0.1349 0.1740 0.1863 -0.0238 -0.0195 0.0186  143  THR A O    
2097 C CB   . THR A 143 ? 0.1286 0.1463 0.1508 0.0105  -0.0201 -0.0067 143  THR A CB   
2098 O OG1  . THR A 143 ? 0.1459 0.1601 0.1451 0.0321  -0.0220 -0.0003 143  THR A OG1  
2099 C CG2  . THR A 143 ? 0.1273 0.1747 0.1694 0.0057  -0.0168 -0.0096 143  THR A CG2  
2100 H H    . THR A 143 ? 0.1584 0.1584 0.1584 0.0000  0.0000  0.0000  143  THR A H    
2101 H HA   . THR A 143 ? 0.1672 0.1672 0.1672 0.0000  0.0000  0.0000  143  THR A HA   
2102 H HB   . THR A 143 ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  143  THR A HB   
2103 H HG1  . THR A 143 ? 0.2256 0.2256 0.2256 0.0000  0.0000  0.0000  143  THR A HG1  
2104 H HG21 . THR A 143 ? 0.2357 0.2357 0.2357 0.0000  0.0000  0.0000  143  THR A HG21 
2105 H HG22 . THR A 143 ? 0.2357 0.2357 0.2357 0.0000  0.0000  0.0000  143  THR A HG22 
2106 H HG23 . THR A 143 ? 0.2357 0.2357 0.2357 0.0000  0.0000  0.0000  143  THR A HG23 
2107 N N    . VAL A 144 ? 0.1168 0.1405 0.1473 -0.0039 -0.0041 0.0164  144  VAL A N    
2108 C CA   . VAL A 144 ? 0.1201 0.1380 0.1482 -0.0105 0.0037  0.0141  144  VAL A CA   
2109 C C    . VAL A 144 ? 0.1303 0.1230 0.1399 -0.0165 -0.0031 0.0085  144  VAL A C    
2110 O O    . VAL A 144 ? 0.1395 0.1301 0.1496 -0.0170 0.0007  0.0137  144  VAL A O    
2111 C CB   . VAL A 144 ? 0.1508 0.1305 0.1353 0.0042  0.0081  0.0065  144  VAL A CB   
2112 C CG1  . VAL A 144 ? 0.1820 0.1560 0.1690 0.0279  0.0040  -0.0012 144  VAL A CG1  
2113 C CG2  . VAL A 144 ? 0.1409 0.1279 0.1362 -0.0093 -0.0177 0.0054  144  VAL A CG2  
2114 H H    . VAL A 144 ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  144  VAL A H    
2115 H HA   . VAL A 144 ? 0.1625 0.1625 0.1625 0.0000  0.0000  0.0000  144  VAL A HA   
2116 H HB   . VAL A 144 ? 0.1667 0.1667 0.1667 0.0000  0.0000  0.0000  144  VAL A HB   
2117 H HG11 . VAL A 144 ? 0.2536 0.2536 0.2536 0.0000  0.0000  0.0000  144  VAL A HG11 
2118 H HG12 . VAL A 144 ? 0.2536 0.2536 0.2536 0.0000  0.0000  0.0000  144  VAL A HG12 
2119 H HG13 . VAL A 144 ? 0.2536 0.2536 0.2536 0.0000  0.0000  0.0000  144  VAL A HG13 
2120 H HG21 . VAL A 144 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  144  VAL A HG21 
2121 H HG22 . VAL A 144 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  144  VAL A HG22 
2122 H HG23 . VAL A 144 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  144  VAL A HG23 
2123 N N    . LYS A 145 ? 0.1486 0.1297 0.1451 -0.0063 -0.0042 0.0165  145  LYS A N    
2124 C CA   . LYS A 145 ? 0.1807 0.1127 0.1897 0.0018  0.0183  0.0024  145  LYS A CA   
2125 C C    . LYS A 145 ? 0.1888 0.1293 0.1677 -0.0141 -0.0009 0.0095  145  LYS A C    
2126 O O    . LYS A 145 ? 0.2085 0.1367 0.1681 -0.0032 0.0039  0.0135  145  LYS A O    
2127 C CB   . LYS A 145 ? 0.2107 0.1361 0.1937 -0.0054 0.0325  0.0062  145  LYS A CB   
2128 C CG   . LYS A 145 ? 0.2063 0.1621 0.1872 -0.0208 0.0047  0.0265  145  LYS A CG   
2129 C CD   . LYS A 145 ? 0.2542 0.2028 0.1901 0.0283  0.0249  0.0274  145  LYS A CD   
2130 C CE   . LYS A 145 ? 0.4063 0.2770 0.2148 -0.0349 0.0491  -0.0408 145  LYS A CE   
2131 N NZ   . LYS A 145 ? 0.7695 0.4028 0.2929 -0.1540 -0.2437 0.1442  145  LYS A NZ   
2132 H H    . LYS A 145 ? 0.1693 0.1693 0.1693 0.0000  0.0000  0.0000  145  LYS A H    
2133 H HA   . LYS A 145 ? 0.1933 0.1933 0.1933 0.0000  0.0000  0.0000  145  LYS A HA   
2134 H HB2  . LYS A 145 ? 0.2162 0.2162 0.2162 0.0000  0.0000  0.0000  145  LYS A HB2  
2135 H HB3  . LYS A 145 ? 0.2162 0.2162 0.2162 0.0000  0.0000  0.0000  145  LYS A HB3  
2136 H HG2  . LYS A 145 ? 0.2223 0.2223 0.2223 0.0000  0.0000  0.0000  145  LYS A HG2  
2137 H HG3  . LYS A 145 ? 0.2223 0.2223 0.2223 0.0000  0.0000  0.0000  145  LYS A HG3  
2138 H HD2  . LYS A 145 ? 0.2589 0.2589 0.2589 0.0000  0.0000  0.0000  145  LYS A HD2  
2139 H HD3  . LYS A 145 ? 0.2589 0.2589 0.2589 0.0000  0.0000  0.0000  145  LYS A HD3  
2140 H HE2  . LYS A 145 ? 0.3592 0.3592 0.3592 0.0000  0.0000  0.0000  145  LYS A HE2  
2141 H HE3  . LYS A 145 ? 0.3592 0.3592 0.3592 0.0000  0.0000  0.0000  145  LYS A HE3  
2142 H HZ1  . LYS A 145 ? 0.7326 0.7326 0.7326 0.0000  0.0000  0.0000  145  LYS A HZ1  
2143 H HZ2  . LYS A 145 ? 0.7326 0.7326 0.7326 0.0000  0.0000  0.0000  145  LYS A HZ2  
2144 H HZ3  . LYS A 145 ? 0.7326 0.7326 0.7326 0.0000  0.0000  0.0000  145  LYS A HZ3  
2145 N N    . SER A 146 ? 0.2045 0.1271 0.1667 -0.0331 -0.0081 0.0070  146  SER A N    
2146 C CA   . SER A 146 ? 0.2016 0.1407 0.1893 -0.0325 -0.0066 0.0110  146  SER A CA   
2147 C C    . SER A 146 ? 0.1914 0.1465 0.1845 -0.0455 -0.0211 0.0237  146  SER A C    
2148 O O    . SER A 146 ? 0.2505 0.1501 0.2205 -0.0465 -0.0083 0.0394  146  SER A O    
2149 C CB   . SER A 146 ? 0.2859 0.1960 0.2100 -0.0901 -0.0559 0.0064  146  SER A CB   
2150 O OG   . SER A 146 ? 0.2142 0.2444 0.2752 -0.0886 -0.1027 0.0773  146  SER A OG   
2151 H H    . SER A 146 ? 0.1993 0.1993 0.1993 0.0000  0.0000  0.0000  146  SER A H    
2152 H HA   . SER A 146 ? 0.2126 0.2126 0.2126 0.0000  0.0000  0.0000  146  SER A HA   
2153 H HB2  . SER A 146 ? 0.2767 0.2767 0.2767 0.0000  0.0000  0.0000  146  SER A HB2  
2154 H HB3  . SER A 146 ? 0.2767 0.2767 0.2767 0.0000  0.0000  0.0000  146  SER A HB3  
2155 H HG   . SER A 146 ? 0.3669 0.3669 0.3669 0.0000  0.0000  0.0000  146  SER A HG   
2156 N N    . SER A 147 ? 0.1400 0.1465 0.1666 -0.0246 -0.0206 0.0269  147  SER A N    
2157 C CA   . SER A 147 ? 0.1286 0.1863 0.1796 -0.0184 -0.0133 0.0341  147  SER A CA   
2158 C C    . SER A 147 ? 0.1365 0.1735 0.1585 -0.0246 -0.0056 0.0337  147  SER A C    
2159 O O    . SER A 147 ? 0.1735 0.2331 0.1721 -0.0503 -0.0128 0.0554  147  SER A O    
2160 C CB   A SER A 147 ? 0.1607 0.2194 0.2040 0.0161  0.0341  0.0370  147  SER A CB   
2161 C CB   B SER A 147 ? 0.1703 0.2342 0.1792 0.0274  -0.0119 0.0155  147  SER A CB   
2162 O OG   A SER A 147 ? 0.2161 0.2022 0.2714 0.0059  0.0703  0.0026  147  SER A OG   
2163 O OG   B SER A 147 ? 0.1369 0.2249 0.2211 0.0180  0.0020  0.0393  147  SER A OG   
2164 H H    . SER A 147 ? 0.1812 0.1812 0.1812 0.0000  0.0000  0.0000  147  SER A H    
2165 H HA   A SER A 147 ? 0.1978 0.1978 0.1978 0.0000  0.0000  0.0000  147  SER A HA   
2166 H HB2  A SER A 147 ? 0.2337 0.2337 0.2337 0.0000  0.0000  0.0000  147  SER A HB2  
2167 H HB2  B SER A 147 ? 0.2334 0.2334 0.2334 0.0000  0.0000  0.0000  147  SER A HB2  
2168 H HB3  A SER A 147 ? 0.2337 0.2337 0.2337 0.0000  0.0000  0.0000  147  SER A HB3  
2169 H HB3  B SER A 147 ? 0.2334 0.2334 0.2334 0.0000  0.0000  0.0000  147  SER A HB3  
2170 H HG   A SER A 147 ? 0.3449 0.3449 0.3449 0.0000  0.0000  0.0000  147  SER A HG   
2171 H HG   B SER A 147 ? 0.2914 0.2914 0.2914 0.0000  0.0000  0.0000  147  SER A HG   
2172 N N    . LEU A 148 ? 0.1287 0.1806 0.1564 -0.0163 -0.0068 0.0217  148  LEU A N    
2173 C CA   . LEU A 148 ? 0.1329 0.1593 0.1562 -0.0027 -0.0070 0.0090  148  LEU A CA   
2174 C C    . LEU A 148 ? 0.1622 0.1563 0.1391 -0.0165 -0.0160 0.0174  148  LEU A C    
2175 O O    . LEU A 148 ? 0.1893 0.1517 0.1672 -0.0246 -0.0228 0.0116  148  LEU A O    
2176 C CB   . LEU A 148 ? 0.1371 0.1411 0.1891 -0.0102 -0.0043 0.0202  148  LEU A CB   
2177 C CG   . LEU A 148 ? 0.1333 0.1452 0.1917 0.0073  -0.0234 0.0221  148  LEU A CG   
2178 C CD1  . LEU A 148 ? 0.1441 0.1548 0.2166 -0.0121 -0.0141 0.0464  148  LEU A CD1  
2179 C CD2  . LEU A 148 ? 0.2020 0.1570 0.2065 0.0228  -0.0286 0.0092  148  LEU A CD2  
2180 H H    . LEU A 148 ? 0.1863 0.1863 0.1863 0.0000  0.0000  0.0000  148  LEU A H    
2181 H HA   . LEU A 148 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  148  LEU A HA   
2182 H HB2  . LEU A 148 ? 0.1869 0.1869 0.1869 0.0000  0.0000  0.0000  148  LEU A HB2  
2183 H HB3  . LEU A 148 ? 0.1869 0.1869 0.1869 0.0000  0.0000  0.0000  148  LEU A HB3  
2184 H HG   . LEU A 148 ? 0.1881 0.1881 0.1881 0.0000  0.0000  0.0000  148  LEU A HG   
2185 H HD11 . LEU A 148 ? 0.2577 0.2577 0.2577 0.0000  0.0000  0.0000  148  LEU A HD11 
2186 H HD12 . LEU A 148 ? 0.2577 0.2577 0.2577 0.0000  0.0000  0.0000  148  LEU A HD12 
2187 H HD13 . LEU A 148 ? 0.2577 0.2577 0.2577 0.0000  0.0000  0.0000  148  LEU A HD13 
2188 H HD21 . LEU A 148 ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  148  LEU A HD21 
2189 H HD22 . LEU A 148 ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  148  LEU A HD22 
2190 H HD23 . LEU A 148 ? 0.2828 0.2828 0.2828 0.0000  0.0000  0.0000  148  LEU A HD23 
2191 N N    . ALA A 149 ? 0.1551 0.1526 0.1511 -0.0121 -0.0088 0.0249  149  ALA A N    
2192 C CA   . ALA A 149 ? 0.1767 0.1683 0.1703 0.0006  0.0009  0.0493  149  ALA A CA   
2193 C C    . ALA A 149 ? 0.1818 0.1439 0.1783 -0.0045 0.0035  0.0389  149  ALA A C    
2194 O O    . ALA A 149 ? 0.2182 0.1464 0.2088 -0.0272 0.0029  0.0420  149  ALA A O    
2195 C CB   . ALA A 149 ? 0.2208 0.2358 0.1582 0.0331  -0.0090 0.0549  149  ALA A CB   
2196 H H    . ALA A 149 ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  149  ALA A H    
2197 H HA   . ALA A 149 ? 0.2061 0.2061 0.2061 0.0000  0.0000  0.0000  149  ALA A HA   
2198 H HB1  . ALA A 149 ? 0.3074 0.3074 0.3074 0.0000  0.0000  0.0000  149  ALA A HB1  
2199 H HB2  . ALA A 149 ? 0.3074 0.3074 0.3074 0.0000  0.0000  0.0000  149  ALA A HB2  
2200 H HB3  . ALA A 149 ? 0.3074 0.3074 0.3074 0.0000  0.0000  0.0000  149  ALA A HB3  
2201 N N    . GLN A 150 ? 0.1678 0.1309 0.1600 -0.0065 -0.0022 0.0234  150  GLN A N    
2202 C CA   . GLN A 150 ? 0.1580 0.1251 0.1576 -0.0034 -0.0064 0.0183  150  GLN A CA   
2203 C C    . GLN A 150 ? 0.1304 0.1191 0.1612 -0.0014 -0.0035 0.0214  150  GLN A C    
2204 O O    . GLN A 150 ? 0.1494 0.1214 0.1396 -0.0073 -0.0036 0.0127  150  GLN A O    
2205 C CB   A GLN A 150 ? 0.1617 0.1425 0.1998 0.0180  -0.0139 0.0349  150  GLN A CB   
2206 C CB   B GLN A 150 ? 0.1587 0.1852 0.1910 0.0119  -0.0064 0.0539  150  GLN A CB   
2207 C CG   A GLN A 150 ? 0.3093 0.1535 0.2725 0.0671  -0.0681 0.0513  150  GLN A CG   
2208 C CG   B GLN A 150 ? 0.1710 0.1912 0.2043 0.0213  0.0174  0.0694  150  GLN A CG   
2209 C CD   A GLN A 150 ? 0.3166 0.2104 0.2792 0.0823  -0.0623 0.1126  150  GLN A CD   
2210 C CD   B GLN A 150 ? 0.1794 0.1966 0.3504 0.0159  0.0111  0.1287  150  GLN A CD   
2211 O OE1  A GLN A 150 ? 0.3258 0.4870 0.4381 0.0182  -0.1090 -0.0138 150  GLN A OE1  
2212 O OE1  B GLN A 150 ? 0.2643 0.1940 0.3808 0.0520  -0.0149 0.1050  150  GLN A OE1  
2213 N NE2  A GLN A 150 ? 0.3619 0.2537 0.4782 0.0992  0.0465  0.0709  150  GLN A NE2  
2214 N NE2  B GLN A 150 ? 0.1717 0.2389 0.2414 -0.0073 0.0001  0.1065  150  GLN A NE2  
2215 H H    . GLN A 150 ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  150  GLN A H    
2216 H HA   A GLN A 150 ? 0.1763 0.1763 0.1763 0.0000  0.0000  0.0000  150  GLN A HA   
2217 H HB2  A GLN A 150 ? 0.2016 0.2016 0.2016 0.0000  0.0000  0.0000  150  GLN A HB2  
2218 H HB2  B GLN A 150 ? 0.2139 0.2139 0.2139 0.0000  0.0000  0.0000  150  GLN A HB2  
2219 H HB3  A GLN A 150 ? 0.2016 0.2016 0.2016 0.0000  0.0000  0.0000  150  GLN A HB3  
2220 H HB3  B GLN A 150 ? 0.2139 0.2139 0.2139 0.0000  0.0000  0.0000  150  GLN A HB3  
2221 H HG2  A GLN A 150 ? 0.2941 0.2941 0.2941 0.0000  0.0000  0.0000  150  GLN A HG2  
2222 H HG2  B GLN A 150 ? 0.2266 0.2266 0.2266 0.0000  0.0000  0.0000  150  GLN A HG2  
2223 H HG3  A GLN A 150 ? 0.2941 0.2941 0.2941 0.0000  0.0000  0.0000  150  GLN A HG3  
2224 H HG3  B GLN A 150 ? 0.2266 0.2266 0.2266 0.0000  0.0000  0.0000  150  GLN A HG3  
2225 H HE21 A GLN A 150 ? 0.4376 0.4376 0.4376 0.0000  0.0000  0.0000  150  GLN A HE21 
2226 H HE21 B GLN A 150 ? 0.2608 0.2608 0.2608 0.0000  0.0000  0.0000  150  GLN A HE21 
2227 H HE22 A GLN A 150 ? 0.4376 0.4376 0.4376 0.0000  0.0000  0.0000  150  GLN A HE22 
2228 H HE22 B GLN A 150 ? 0.2608 0.2608 0.2608 0.0000  0.0000  0.0000  150  GLN A HE22 
2229 N N    . PRO A 151 ? 0.1432 0.1155 0.1582 -0.0087 -0.0101 0.0066  151  PRO A N    
2230 C CA   . PRO A 151 ? 0.1224 0.1120 0.1566 -0.0081 -0.0148 0.0052  151  PRO A CA   
2231 C C    . PRO A 151 ? 0.1150 0.1078 0.1443 -0.0057 -0.0165 0.0068  151  PRO A C    
2232 O O    . PRO A 151 ? 0.1187 0.1202 0.1494 -0.0057 -0.0103 -0.0033 151  PRO A O    
2233 C CB   . PRO A 151 ? 0.1399 0.1279 0.1775 -0.0263 -0.0218 0.0011  151  PRO A CB   
2234 C CG   . PRO A 151 ? 0.1566 0.1366 0.1794 -0.0233 -0.0092 -0.0109 151  PRO A CG   
2235 C CD   . PRO A 151 ? 0.1490 0.1101 0.1949 -0.0160 -0.0134 0.0076  151  PRO A CD   
2236 H HA   . PRO A 151 ? 0.1564 0.1564 0.1564 0.0000  0.0000  0.0000  151  PRO A HA   
2237 H HB2  . PRO A 151 ? 0.1781 0.1781 0.1781 0.0000  0.0000  0.0000  151  PRO A HB2  
2238 H HB3  . PRO A 151 ? 0.1781 0.1781 0.1781 0.0000  0.0000  0.0000  151  PRO A HB3  
2239 H HG2  . PRO A 151 ? 0.1891 0.1891 0.1891 0.0000  0.0000  0.0000  151  PRO A HG2  
2240 H HG3  . PRO A 151 ? 0.1891 0.1891 0.1891 0.0000  0.0000  0.0000  151  PRO A HG3  
2241 H HD2  . PRO A 151 ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  151  PRO A HD2  
2242 H HD3  . PRO A 151 ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  151  PRO A HD3  
2243 N N    . LEU A 152 ? 0.1130 0.1215 0.1398 -0.0147 -0.0069 0.0059  152  LEU A N    
2244 C CA   . LEU A 152 ? 0.1049 0.1144 0.1318 -0.0045 -0.0087 0.0011  152  LEU A CA   
2245 C C    . LEU A 152 ? 0.0986 0.1159 0.1326 -0.0043 -0.0099 0.0051  152  LEU A C    
2246 O O    . LEU A 152 ? 0.1138 0.1231 0.1235 -0.0072 0.0013  0.0045  152  LEU A O    
2247 C CB   . LEU A 152 ? 0.1195 0.1171 0.1405 0.0018  -0.0088 0.0065  152  LEU A CB   
2248 C CG   . LEU A 152 ? 0.1270 0.1509 0.1534 0.0080  -0.0004 0.0294  152  LEU A CG   
2249 C CD1  . LEU A 152 ? 0.1698 0.1750 0.1295 0.0254  -0.0030 0.0041  152  LEU A CD1  
2250 C CD2  . LEU A 152 ? 0.1541 0.1516 0.1840 0.0200  -0.0094 0.0276  152  LEU A CD2  
2251 H H    . LEU A 152 ? 0.1497 0.1497 0.1497 0.0000  0.0000  0.0000  152  LEU A H    
2252 H HA   . LEU A 152 ? 0.1405 0.1405 0.1405 0.0000  0.0000  0.0000  152  LEU A HA   
2253 H HB2  . LEU A 152 ? 0.1508 0.1508 0.1508 0.0000  0.0000  0.0000  152  LEU A HB2  
2254 H HB3  . LEU A 152 ? 0.1508 0.1508 0.1508 0.0000  0.0000  0.0000  152  LEU A HB3  
2255 H HG   . LEU A 152 ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  152  LEU A HG   
2256 H HD11 . LEU A 152 ? 0.2371 0.2371 0.2371 0.0000  0.0000  0.0000  152  LEU A HD11 
2257 H HD12 . LEU A 152 ? 0.2371 0.2371 0.2371 0.0000  0.0000  0.0000  152  LEU A HD12 
2258 H HD13 . LEU A 152 ? 0.2371 0.2371 0.2371 0.0000  0.0000  0.0000  152  LEU A HD13 
2259 H HD21 . LEU A 152 ? 0.2448 0.2448 0.2448 0.0000  0.0000  0.0000  152  LEU A HD21 
2260 H HD22 . LEU A 152 ? 0.2448 0.2448 0.2448 0.0000  0.0000  0.0000  152  LEU A HD22 
2261 H HD23 . LEU A 152 ? 0.2448 0.2448 0.2448 0.0000  0.0000  0.0000  152  LEU A HD23 
2262 N N    . PHE A 153 ? 0.1080 0.1161 0.1130 -0.0026 -0.0033 -0.0004 153  PHE A N    
2263 C CA   . PHE A 153 ? 0.1035 0.1204 0.1107 -0.0058 -0.0038 -0.0035 153  PHE A CA   
2264 C C    . PHE A 153 ? 0.1040 0.1116 0.1198 -0.0033 -0.0061 0.0025  153  PHE A C    
2265 O O    . PHE A 153 ? 0.1056 0.1519 0.1292 0.0019  -0.0009 -0.0166 153  PHE A O    
2266 C CB   . PHE A 153 ? 0.1098 0.1195 0.1220 0.0075  0.0032  -0.0013 153  PHE A CB   
2267 C CG   . PHE A 153 ? 0.1013 0.1141 0.1262 0.0065  0.0011  0.0003  153  PHE A CG   
2268 C CD1  . PHE A 153 ? 0.1014 0.1324 0.1342 0.0025  -0.0049 0.0078  153  PHE A CD1  
2269 C CD2  . PHE A 153 ? 0.1056 0.1106 0.1359 0.0065  -0.0060 0.0055  153  PHE A CD2  
2270 C CE1  . PHE A 153 ? 0.1133 0.1293 0.1290 0.0161  -0.0067 0.0036  153  PHE A CE1  
2271 C CE2  . PHE A 153 ? 0.1132 0.1130 0.1378 0.0066  0.0024  0.0137  153  PHE A CE2  
2272 C CZ   . PHE A 153 ? 0.1120 0.1188 0.1302 0.0206  -0.0004 0.0144  153  PHE A CZ   
2273 H H    . PHE A 153 ? 0.1349 0.1349 0.1349 0.0000  0.0000  0.0000  153  PHE A H    
2274 H HA   . PHE A 153 ? 0.1339 0.1339 0.1339 0.0000  0.0000  0.0000  153  PHE A HA   
2275 H HB2  . PHE A 153 ? 0.1405 0.1405 0.1405 0.0000  0.0000  0.0000  153  PHE A HB2  
2276 H HB3  . PHE A 153 ? 0.1405 0.1405 0.1405 0.0000  0.0000  0.0000  153  PHE A HB3  
2277 H HD1  . PHE A 153 ? 0.1472 0.1472 0.1472 0.0000  0.0000  0.0000  153  PHE A HD1  
2278 H HD2  . PHE A 153 ? 0.1408 0.1408 0.1408 0.0000  0.0000  0.0000  153  PHE A HD2  
2279 H HE1  . PHE A 153 ? 0.1487 0.1487 0.1487 0.0000  0.0000  0.0000  153  PHE A HE1  
2280 H HE2  . PHE A 153 ? 0.1456 0.1456 0.1456 0.0000  0.0000  0.0000  153  PHE A HE2  
2281 H HZ   . PHE A 153 ? 0.1444 0.1444 0.1444 0.0000  0.0000  0.0000  153  PHE A HZ   
2282 N N    . ALA A 154 ? 0.1067 0.1268 0.1233 -0.0058 -0.0077 -0.0077 154  ALA A N    
2283 C CA   . ALA A 154 ? 0.1014 0.1332 0.1293 -0.0081 0.0045  -0.0148 154  ALA A CA   
2284 C C    . ALA A 154 ? 0.1042 0.1405 0.1339 -0.0103 0.0037  -0.0199 154  ALA A C    
2285 O O    . ALA A 154 ? 0.1211 0.1522 0.1687 -0.0231 0.0245  -0.0333 154  ALA A O    
2286 C CB   . ALA A 154 ? 0.1194 0.1633 0.1326 0.0075  -0.0080 -0.0036 154  ALA A CB   
2287 H H    . ALA A 154 ? 0.1427 0.1427 0.1427 0.0000  0.0000  0.0000  154  ALA A H    
2288 H HA   . ALA A 154 ? 0.1455 0.1455 0.1455 0.0000  0.0000  0.0000  154  ALA A HA   
2289 H HB1  . ALA A 154 ? 0.2077 0.2077 0.2077 0.0000  0.0000  0.0000  154  ALA A HB1  
2290 H HB2  . ALA A 154 ? 0.2077 0.2077 0.2077 0.0000  0.0000  0.0000  154  ALA A HB2  
2291 H HB3  . ALA A 154 ? 0.2077 0.2077 0.2077 0.0000  0.0000  0.0000  154  ALA A HB3  
2292 N N    . VAL A 155 ? 0.1038 0.1270 0.1296 -0.0061 0.0005  -0.0068 155  VAL A N    
2293 C CA   . VAL A 155 ? 0.1029 0.1224 0.1433 -0.0037 -0.0067 0.0001  155  VAL A CA   
2294 C C    . VAL A 155 ? 0.1064 0.1110 0.1254 -0.0021 -0.0011 0.0027  155  VAL A C    
2295 O O    . VAL A 155 ? 0.1054 0.1155 0.1205 -0.0021 -0.0034 0.0039  155  VAL A O    
2296 C CB   A VAL A 155 ? 0.1041 0.1142 0.1417 -0.0011 -0.0148 -0.0048 155  VAL A CB   
2297 C CB   B VAL A 155 ? 0.1082 0.1201 0.1400 0.0168  -0.0134 -0.0062 155  VAL A CB   
2298 C CG1  A VAL A 155 ? 0.1785 0.1109 0.1866 -0.0184 -0.0628 0.0084  155  VAL A CG1  
2299 C CG1  B VAL A 155 ? 0.1254 0.1767 0.1114 0.0268  -0.0159 0.0051  155  VAL A CG1  
2300 C CG2  A VAL A 155 ? 0.1236 0.1225 0.1557 0.0114  -0.0377 -0.0266 155  VAL A CG2  
2301 C CG2  B VAL A 155 ? 0.1268 0.1114 0.1454 -0.0128 -0.0106 0.0207  155  VAL A CG2  
2302 H H    . VAL A 155 ? 0.1441 0.1441 0.1441 0.0000  0.0000  0.0000  155  VAL A H    
2303 H HA   A VAL A 155 ? 0.1474 0.1474 0.1474 0.0000  0.0000  0.0000  155  VAL A HA   
2304 H HB   A VAL A 155 ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  155  VAL A HB   
2305 H HB   B VAL A 155 ? 0.1473 0.1473 0.1473 0.0000  0.0000  0.0000  155  VAL A HB   
2306 H HG11 A VAL A 155 ? 0.2380 0.2380 0.2380 0.0000  0.0000  0.0000  155  VAL A HG11 
2307 H HG11 B VAL A 155 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  155  VAL A HG11 
2308 H HG12 A VAL A 155 ? 0.2380 0.2380 0.2380 0.0000  0.0000  0.0000  155  VAL A HG12 
2309 H HG12 B VAL A 155 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  155  VAL A HG12 
2310 H HG13 A VAL A 155 ? 0.2380 0.2380 0.2380 0.0000  0.0000  0.0000  155  VAL A HG13 
2311 H HG13 B VAL A 155 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  155  VAL A HG13 
2312 H HG21 A VAL A 155 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  155  VAL A HG21 
2313 H HG21 B VAL A 155 ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  155  VAL A HG21 
2314 H HG22 A VAL A 155 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  155  VAL A HG22 
2315 H HG22 B VAL A 155 ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  155  VAL A HG22 
2316 H HG23 A VAL A 155 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  155  VAL A HG23 
2317 H HG23 B VAL A 155 ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  155  VAL A HG23 
2318 N N    . ALA A 156 ? 0.1046 0.1217 0.1262 -0.0037 -0.0008 -0.0019 156  ALA A N    
2319 C CA   . ALA A 156 ? 0.1069 0.1343 0.1202 0.0030  -0.0117 0.0017  156  ALA A CA   
2320 C C    . ALA A 156 ? 0.1086 0.1364 0.1165 -0.0071 -0.0066 -0.0121 156  ALA A C    
2321 O O    . ALA A 156 ? 0.1412 0.1359 0.1345 -0.0101 0.0187  -0.0117 156  ALA A O    
2322 C CB   . ALA A 156 ? 0.1526 0.1617 0.1290 0.0059  -0.0139 0.0112  156  ALA A CB   
2323 H H    . ALA A 156 ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  156  ALA A H    
2324 H HA   . ALA A 156 ? 0.1445 0.1445 0.1445 0.0000  0.0000  0.0000  156  ALA A HA   
2325 H HB1  . ALA A 156 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  156  ALA A HB1  
2326 H HB2  . ALA A 156 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  156  ALA A HB2  
2327 H HB3  . ALA A 156 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  156  ALA A HB3  
2328 N N    . LEU A 157 ? 0.1154 0.1206 0.1214 0.0018  0.0049  -0.0080 157  LEU A N    
2329 C CA   . LEU A 157 ? 0.1124 0.1219 0.1192 -0.0021 0.0007  -0.0064 157  LEU A CA   
2330 C C    . LEU A 157 ? 0.1199 0.1180 0.1245 0.0021  0.0042  -0.0085 157  LEU A C    
2331 O O    . LEU A 157 ? 0.1167 0.1277 0.1489 0.0037  0.0040  -0.0174 157  LEU A O    
2332 C CB   . LEU A 157 ? 0.1314 0.1217 0.1204 0.0012  0.0019  -0.0061 157  LEU A CB   
2333 C CG   . LEU A 157 ? 0.1339 0.1166 0.1169 -0.0040 -0.0079 -0.0053 157  LEU A CG   
2334 C CD1  . LEU A 157 ? 0.1474 0.1412 0.1243 -0.0062 -0.0098 0.0048  157  LEU A CD1  
2335 C CD2  . LEU A 157 ? 0.1322 0.1431 0.1317 0.0054  -0.0062 -0.0064 157  LEU A CD2  
2336 H H    . LEU A 157 ? 0.1430 0.1430 0.1430 0.0000  0.0000  0.0000  157  LEU A H    
2337 H HA   . LEU A 157 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  157  LEU A HA   
2338 H HB2  . LEU A 157 ? 0.1494 0.1494 0.1494 0.0000  0.0000  0.0000  157  LEU A HB2  
2339 H HB3  . LEU A 157 ? 0.1494 0.1494 0.1494 0.0000  0.0000  0.0000  157  LEU A HB3  
2340 H HG   . LEU A 157 ? 0.1469 0.1469 0.1469 0.0000  0.0000  0.0000  157  LEU A HG   
2341 H HD11 . LEU A 157 ? 0.2064 0.2064 0.2064 0.0000  0.0000  0.0000  157  LEU A HD11 
2342 H HD12 . LEU A 157 ? 0.2064 0.2064 0.2064 0.0000  0.0000  0.0000  157  LEU A HD12 
2343 H HD13 . LEU A 157 ? 0.2064 0.2064 0.2064 0.0000  0.0000  0.0000  157  LEU A HD13 
2344 H HD21 . LEU A 157 ? 0.2035 0.2035 0.2035 0.0000  0.0000  0.0000  157  LEU A HD21 
2345 H HD22 . LEU A 157 ? 0.2035 0.2035 0.2035 0.0000  0.0000  0.0000  157  LEU A HD22 
2346 H HD23 . LEU A 157 ? 0.2035 0.2035 0.2035 0.0000  0.0000  0.0000  157  LEU A HD23 
2347 N N    . LYS A 158 ? 0.1080 0.1306 0.1314 0.0084  -0.0095 -0.0147 158  LYS A N    
2348 C CA   . LYS A 158 ? 0.1133 0.1388 0.1297 0.0163  -0.0123 -0.0170 158  LYS A CA   
2349 C C    . LYS A 158 ? 0.1154 0.1385 0.1289 0.0085  -0.0230 -0.0220 158  LYS A C    
2350 O O    . LYS A 158 ? 0.1153 0.1361 0.1556 0.0047  -0.0198 -0.0120 158  LYS A O    
2351 C CB   . LYS A 158 ? 0.1272 0.1519 0.1417 0.0154  -0.0210 -0.0012 158  LYS A CB   
2352 C CG   . LYS A 158 ? 0.1628 0.1681 0.1625 -0.0007 -0.0119 0.0055  158  LYS A CG   
2353 C CD   . LYS A 158 ? 0.2019 0.2301 0.1634 0.0352  0.0110  0.0342  158  LYS A CD   
2354 C CE   . LYS A 158 ? 0.6817 0.2871 0.3096 -0.0592 -0.0413 0.1381  158  LYS A CE   
2355 N NZ   . LYS A 158 ? 1.1464 0.6482 0.6737 0.2421  -0.2938 0.3834  158  LYS A NZ   
2356 H H    . LYS A 158 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  158  LYS A H    
2357 H HA   . LYS A 158 ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  158  LYS A HA   
2358 H HB2  . LYS A 158 ? 0.1683 0.1683 0.1683 0.0000  0.0000  0.0000  158  LYS A HB2  
2359 H HB3  . LYS A 158 ? 0.1683 0.1683 0.1683 0.0000  0.0000  0.0000  158  LYS A HB3  
2360 H HG2  . LYS A 158 ? 0.1973 0.1973 0.1973 0.0000  0.0000  0.0000  158  LYS A HG2  
2361 H HG3  . LYS A 158 ? 0.1973 0.1973 0.1973 0.0000  0.0000  0.0000  158  LYS A HG3  
2362 H HD2  . LYS A 158 ? 0.2381 0.2381 0.2381 0.0000  0.0000  0.0000  158  LYS A HD2  
2363 H HD3  . LYS A 158 ? 0.2381 0.2381 0.2381 0.0000  0.0000  0.0000  158  LYS A HD3  
2364 H HE2  . LYS A 158 ? 0.5114 0.5114 0.5114 0.0000  0.0000  0.0000  158  LYS A HE2  
2365 H HE3  . LYS A 158 ? 0.5114 0.5114 0.5114 0.0000  0.0000  0.0000  158  LYS A HE3  
2366 H HZ1  . LYS A 158 ? 1.2341 1.2341 1.2341 0.0000  0.0000  0.0000  158  LYS A HZ1  
2367 H HZ2  . LYS A 158 ? 1.2341 1.2341 1.2341 0.0000  0.0000  0.0000  158  LYS A HZ2  
2368 H HZ3  . LYS A 158 ? 1.2341 1.2341 1.2341 0.0000  0.0000  0.0000  158  LYS A HZ3  
2369 N N    . HIS A 159 ? 0.1146 0.1467 0.1453 0.0156  -0.0281 -0.0178 159  HIS A N    
2370 C CA   . HIS A 159 ? 0.1242 0.1457 0.1407 -0.0010 -0.0181 -0.0151 159  HIS A CA   
2371 C C    . HIS A 159 ? 0.1325 0.1551 0.1397 -0.0002 -0.0145 -0.0162 159  HIS A C    
2372 O O    . HIS A 159 ? 0.1394 0.1715 0.1430 0.0041  -0.0359 -0.0092 159  HIS A O    
2373 C CB   . HIS A 159 ? 0.1260 0.1992 0.1545 0.0040  -0.0143 -0.0290 159  HIS A CB   
2374 C CG   . HIS A 159 ? 0.1341 0.2305 0.1755 -0.0339 -0.0189 -0.0196 159  HIS A CG   
2375 N ND1  . HIS A 159 ? 0.1620 0.2129 0.1783 -0.0352 -0.0101 -0.0166 159  HIS A ND1  
2376 C CD2  . HIS A 159 ? 0.1712 0.2574 0.2466 -0.0436 -0.0505 -0.0165 159  HIS A CD2  
2377 C CE1  . HIS A 159 ? 0.1854 0.2324 0.2122 -0.0587 -0.0090 -0.0217 159  HIS A CE1  
2378 N NE2  . HIS A 159 ? 0.1812 0.2903 0.2369 -0.0889 -0.0191 -0.0036 159  HIS A NE2  
2379 H H    . HIS A 159 ? 0.1626 0.1626 0.1626 0.0000  0.0000  0.0000  159  HIS A H    
2380 H HA   . HIS A 159 ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  159  HIS A HA   
2381 H HB2  . HIS A 159 ? 0.1919 0.1919 0.1919 0.0000  0.0000  0.0000  159  HIS A HB2  
2382 H HB3  . HIS A 159 ? 0.1919 0.1919 0.1919 0.0000  0.0000  0.0000  159  HIS A HB3  
2383 H HD1  . HIS A 159 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  159  HIS A HD1  
2384 H HD2  . HIS A 159 ? 0.2700 0.2700 0.2700 0.0000  0.0000  0.0000  159  HIS A HD2  
2385 H HE1  . HIS A 159 ? 0.2520 0.2520 0.2520 0.0000  0.0000  0.0000  159  HIS A HE1  
2386 N N    . GLN A 160 ? 0.1364 0.1442 0.1396 -0.0032 -0.0175 -0.0131 160  GLN A N    
2387 C CA   . GLN A 160 ? 0.1460 0.1506 0.1450 -0.0036 -0.0157 -0.0206 160  GLN A CA   
2388 C C    . GLN A 160 ? 0.1353 0.1479 0.1463 0.0040  -0.0209 -0.0228 160  GLN A C    
2389 O O    . GLN A 160 ? 0.1639 0.1839 0.1466 -0.0179 -0.0259 -0.0283 160  GLN A O    
2390 C CB   . GLN A 160 ? 0.1458 0.1627 0.1838 -0.0114 -0.0166 -0.0256 160  GLN A CB   
2391 C CG   . GLN A 160 ? 0.2115 0.1980 0.1989 -0.0355 0.0183  -0.0204 160  GLN A CG   
2392 C CD   . GLN A 160 ? 0.3082 0.2466 0.2568 -0.1201 -0.0233 -0.0088 160  GLN A CD   
2393 O OE1  . GLN A 160 ? 0.3885 0.3140 0.4478 -0.1609 -0.0264 0.0846  160  GLN A OE1  
2394 N NE2  . GLN A 160 ? 0.3697 0.4459 0.3392 -0.2441 -0.1361 0.0644  160  GLN A NE2  
2395 H H    . GLN A 160 ? 0.1681 0.1681 0.1681 0.0000  0.0000  0.0000  160  GLN A H    
2396 H HA   . GLN A 160 ? 0.1767 0.1767 0.1767 0.0000  0.0000  0.0000  160  GLN A HA   
2397 H HB2  . GLN A 160 ? 0.1969 0.1969 0.1969 0.0000  0.0000  0.0000  160  GLN A HB2  
2398 H HB3  . GLN A 160 ? 0.1969 0.1969 0.1969 0.0000  0.0000  0.0000  160  GLN A HB3  
2399 H HG2  . GLN A 160 ? 0.2433 0.2433 0.2433 0.0000  0.0000  0.0000  160  GLN A HG2  
2400 H HG3  . GLN A 160 ? 0.2433 0.2433 0.2433 0.0000  0.0000  0.0000  160  GLN A HG3  
2401 H HE21 . GLN A 160 ? 0.4619 0.4619 0.4619 0.0000  0.0000  0.0000  160  GLN A HE21 
2402 H HE22 . GLN A 160 ? 0.4619 0.4619 0.4619 0.0000  0.0000  0.0000  160  GLN A HE22 
2403 N N    . GLN A 161 ? 0.1387 0.1594 0.1345 -0.0040 -0.0233 -0.0179 161  GLN A N    
2404 C CA   . GLN A 161 ? 0.1384 0.1584 0.1349 0.0007  -0.0163 -0.0218 161  GLN A CA   
2405 C C    . GLN A 161 ? 0.1341 0.1365 0.1226 0.0111  -0.0201 -0.0172 161  GLN A C    
2406 O O    . GLN A 161 ? 0.1301 0.1494 0.1300 0.0026  -0.0201 -0.0180 161  GLN A O    
2407 C CB   . GLN A 161 ? 0.1431 0.2114 0.1684 0.0058  -0.0300 0.0171  161  GLN A CB   
2408 C CG   . GLN A 161 ? 0.1715 0.2537 0.2487 -0.0001 -0.0737 0.0221  161  GLN A CG   
2409 C CD   . GLN A 161 ? 0.2358 0.3433 0.5654 0.1111  -0.1019 0.0012  161  GLN A CD   
2410 O OE1  . GLN A 161 ? 0.5791 0.2836 0.4757 0.0925  -0.2443 0.0572  161  GLN A OE1  
2411 N NE2  . GLN A 161 ? 0.4127 0.6918 0.7726 0.3016  0.0151  -0.0992 161  GLN A NE2  
2412 H H    . GLN A 161 ? 0.1730 0.1730 0.1730 0.0000  0.0000  0.0000  161  GLN A H    
2413 H HA   . GLN A 161 ? 0.1726 0.1726 0.1726 0.0000  0.0000  0.0000  161  GLN A HA   
2414 H HB2  . GLN A 161 ? 0.2091 0.2091 0.2091 0.0000  0.0000  0.0000  161  GLN A HB2  
2415 H HB3  . GLN A 161 ? 0.2091 0.2091 0.2091 0.0000  0.0000  0.0000  161  GLN A HB3  
2416 H HG2  . GLN A 161 ? 0.2695 0.2695 0.2695 0.0000  0.0000  0.0000  161  GLN A HG2  
2417 H HG3  . GLN A 161 ? 0.2695 0.2695 0.2695 0.0000  0.0000  0.0000  161  GLN A HG3  
2418 H HE21 . GLN A 161 ? 0.7508 0.7508 0.7508 0.0000  0.0000  0.0000  161  GLN A HE21 
2419 H HE22 . GLN A 161 ? 0.7508 0.7508 0.7508 0.0000  0.0000  0.0000  161  GLN A HE22 
2420 N N    . PRO A 162 ? 0.1471 0.1384 0.1257 0.0086  -0.0203 -0.0208 162  PRO A N    
2421 C CA   . PRO A 162 ? 0.1310 0.1516 0.1400 0.0063  -0.0115 -0.0235 162  PRO A CA   
2422 C C    . PRO A 162 ? 0.1169 0.1451 0.1293 0.0059  -0.0104 -0.0068 162  PRO A C    
2423 O O    . PRO A 162 ? 0.1648 0.1537 0.1727 0.0188  -0.0554 -0.0101 162  PRO A O    
2424 C CB   . PRO A 162 ? 0.1567 0.2111 0.1600 0.0191  0.0079  -0.0440 162  PRO A CB   
2425 C CG   . PRO A 162 ? 0.2199 0.3226 0.1587 -0.0778 0.0251  -0.0642 162  PRO A CG   
2426 C CD   . PRO A 162 ? 0.1802 0.1652 0.1313 -0.0116 -0.0170 -0.0293 162  PRO A CD   
2427 H HA   . PRO A 162 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  162  PRO A HA   
2428 H HB2  . PRO A 162 ? 0.2111 0.2111 0.2111 0.0000  0.0000  0.0000  162  PRO A HB2  
2429 H HB3  . PRO A 162 ? 0.2111 0.2111 0.2111 0.0000  0.0000  0.0000  162  PRO A HB3  
2430 H HG2  . PRO A 162 ? 0.2805 0.2805 0.2805 0.0000  0.0000  0.0000  162  PRO A HG2  
2431 H HG3  . PRO A 162 ? 0.2805 0.2805 0.2805 0.0000  0.0000  0.0000  162  PRO A HG3  
2432 H HD2  . PRO A 162 ? 0.1907 0.1907 0.1907 0.0000  0.0000  0.0000  162  PRO A HD2  
2433 H HD3  . PRO A 162 ? 0.1907 0.1907 0.1907 0.0000  0.0000  0.0000  162  PRO A HD3  
2434 N N    . GLY A 163 ? 0.1189 0.1346 0.1211 0.0034  -0.0085 -0.0027 163  GLY A N    
2435 C CA   . GLY A 163 ? 0.1143 0.1241 0.1368 0.0023  -0.0107 0.0002  163  GLY A CA   
2436 C C    . GLY A 163 ? 0.1202 0.1273 0.1118 0.0065  -0.0100 0.0050  163  GLY A C    
2437 O O    . GLY A 163 ? 0.1223 0.1456 0.1316 0.0059  0.0039  -0.0058 163  GLY A O    
2438 H H    . GLY A 163 ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  163  GLY A H    
2439 H HA2  . GLY A 163 ? 0.1501 0.1501 0.1501 0.0000  0.0000  0.0000  163  GLY A HA2  
2440 H HA3  . GLY A 163 ? 0.1501 0.1501 0.1501 0.0000  0.0000  0.0000  163  GLY A HA3  
2441 N N    . VAL A 164 ? 0.1155 0.1318 0.1247 -0.0040 -0.0032 0.0027  164  VAL A N    
2442 C CA   . VAL A 164 ? 0.1127 0.1380 0.1321 -0.0046 0.0036  -0.0040 164  VAL A CA   
2443 C C    . VAL A 164 ? 0.1090 0.1283 0.1321 0.0060  -0.0024 -0.0060 164  VAL A C    
2444 O O    . VAL A 164 ? 0.1140 0.1411 0.1367 0.0016  0.0005  -0.0114 164  VAL A O    
2445 C CB   . VAL A 164 ? 0.1409 0.1494 0.1401 -0.0149 -0.0003 0.0189  164  VAL A CB   
2446 C CG1  . VAL A 164 ? 0.1602 0.1858 0.1446 -0.0154 -0.0071 0.0193  164  VAL A CG1  
2447 C CG2  . VAL A 164 ? 0.1718 0.1495 0.1753 0.0100  -0.0100 0.0275  164  VAL A CG2  
2448 H H    . VAL A 164 ? 0.1488 0.1488 0.1488 0.0000  0.0000  0.0000  164  VAL A H    
2449 H HA   . VAL A 164 ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  164  VAL A HA   
2450 H HB   . VAL A 164 ? 0.1721 0.1721 0.1721 0.0000  0.0000  0.0000  164  VAL A HB   
2451 H HG11 . VAL A 164 ? 0.2453 0.2453 0.2453 0.0000  0.0000  0.0000  164  VAL A HG11 
2452 H HG12 . VAL A 164 ? 0.2453 0.2453 0.2453 0.0000  0.0000  0.0000  164  VAL A HG12 
2453 H HG13 . VAL A 164 ? 0.2453 0.2453 0.2453 0.0000  0.0000  0.0000  164  VAL A HG13 
2454 H HG21 . VAL A 164 ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  164  VAL A HG21 
2455 H HG22 . VAL A 164 ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  164  VAL A HG22 
2456 H HG23 . VAL A 164 ? 0.2484 0.2484 0.2484 0.0000  0.0000  0.0000  164  VAL A HG23 
2457 N N    . TYR A 165 ? 0.1093 0.1378 0.1334 -0.0037 0.0059  -0.0098 165  TYR A N    
2458 C CA   . TYR A 165 ? 0.1114 0.1453 0.1326 -0.0106 -0.0018 -0.0073 165  TYR A CA   
2459 C C    . TYR A 165 ? 0.1168 0.1491 0.1252 -0.0149 0.0089  -0.0150 165  TYR A C    
2460 O O    . TYR A 165 ? 0.1518 0.1525 0.1675 -0.0180 0.0389  -0.0217 165  TYR A O    
2461 C CB   . TYR A 165 ? 0.1281 0.1787 0.1477 0.0000  -0.0189 -0.0056 165  TYR A CB   
2462 C CG   . TYR A 165 ? 0.1149 0.1851 0.1390 0.0206  -0.0062 -0.0021 165  TYR A CG   
2463 C CD1  . TYR A 165 ? 0.1332 0.1976 0.1284 -0.0024 -0.0256 0.0006  165  TYR A CD1  
2464 C CD2  . TYR A 165 ? 0.1770 0.1822 0.1469 0.0373  0.0061  -0.0086 165  TYR A CD2  
2465 C CE1  . TYR A 165 ? 0.1228 0.2043 0.1235 0.0218  -0.0148 0.0104  165  TYR A CE1  
2466 C CE2  . TYR A 165 ? 0.1839 0.2007 0.1322 0.0427  0.0053  -0.0030 165  TYR A CE2  
2467 C CZ   . TYR A 165 ? 0.1439 0.1873 0.1359 0.0508  0.0047  0.0131  165  TYR A CZ   
2468 O OH   . TYR A 165 ? 0.2027 0.2096 0.1367 0.0699  0.0182  0.0307  165  TYR A OH   
2469 H H    . TYR A 165 ? 0.1522 0.1522 0.1522 0.0000  0.0000  0.0000  165  TYR A H    
2470 H HA   . TYR A 165 ? 0.1558 0.1558 0.1558 0.0000  0.0000  0.0000  165  TYR A HA   
2471 H HB2  . TYR A 165 ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  165  TYR A HB2  
2472 H HB3  . TYR A 165 ? 0.1817 0.1817 0.1817 0.0000  0.0000  0.0000  165  TYR A HB3  
2473 H HD1  . TYR A 165 ? 0.1836 0.1836 0.1836 0.0000  0.0000  0.0000  165  TYR A HD1  
2474 H HD2  . TYR A 165 ? 0.2024 0.2024 0.2024 0.0000  0.0000  0.0000  165  TYR A HD2  
2475 H HE1  . TYR A 165 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  165  TYR A HE1  
2476 H HE2  . TYR A 165 ? 0.2067 0.2067 0.2067 0.0000  0.0000  0.0000  165  TYR A HE2  
2477 H HH   . TYR A 165 ? 0.2745 0.2745 0.2745 0.0000  0.0000  0.0000  165  TYR A HH   
2478 N N    . ASP A 166 ? 0.1159 0.1465 0.1157 -0.0058 0.0000  -0.0010 166  ASP A N    
2479 C CA   . ASP A 166 ? 0.1037 0.1466 0.1156 -0.0039 0.0060  -0.0061 166  ASP A CA   
2480 C C    . ASP A 166 ? 0.1203 0.1575 0.1181 -0.0113 0.0044  -0.0060 166  ASP A C    
2481 O O    . ASP A 166 ? 0.1191 0.2472 0.1361 -0.0254 0.0132  -0.0489 166  ASP A O    
2482 C CB   . ASP A 166 ? 0.1264 0.1461 0.1363 -0.0075 -0.0026 0.0002  166  ASP A CB   
2483 C CG   . ASP A 166 ? 0.1173 0.1556 0.1334 -0.0027 0.0035  0.0101  166  ASP A CG   
2484 O OD1  . ASP A 166 ? 0.1319 0.1786 0.1265 0.0052  -0.0032 -0.0062 166  ASP A OD1  
2485 O OD2  . ASP A 166 ? 0.1226 0.1595 0.1318 -0.0029 -0.0015 0.0164  166  ASP A OD2  
2486 H H    . ASP A 166 ? 0.1512 0.1512 0.1512 0.0000  0.0000  0.0000  166  ASP A H    
2487 H HA   . ASP A 166 ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  166  ASP A HA   
2488 H HB2  . ASP A 166 ? 0.1635 0.1635 0.1635 0.0000  0.0000  0.0000  166  ASP A HB2  
2489 H HB3  . ASP A 166 ? 0.1635 0.1635 0.1635 0.0000  0.0000  0.0000  166  ASP A HB3  
2490 N N    . PHE A 167 ? 0.1059 0.1345 0.1160 -0.0034 0.0049  0.0021  167  PHE A N    
2491 C CA   . PHE A 167 ? 0.1082 0.1290 0.1222 0.0004  -0.0069 0.0085  167  PHE A CA   
2492 C C    . PHE A 167 ? 0.0903 0.1383 0.1227 -0.0004 0.0010  0.0076  167  PHE A C    
2493 O O    . PHE A 167 ? 0.1262 0.1323 0.1250 -0.0069 0.0007  0.0177  167  PHE A O    
2494 C CB   . PHE A 167 ? 0.1140 0.1421 0.1303 0.0063  -0.0018 0.0071  167  PHE A CB   
2495 C CG   . PHE A 167 ? 0.1115 0.1342 0.1373 0.0082  0.0037  0.0083  167  PHE A CG   
2496 C CD1  . PHE A 167 ? 0.1412 0.1390 0.1438 0.0155  -0.0175 0.0092  167  PHE A CD1  
2497 C CD2  . PHE A 167 ? 0.1443 0.1337 0.1349 0.0217  0.0019  0.0072  167  PHE A CD2  
2498 C CE1  . PHE A 167 ? 0.1291 0.1325 0.1991 0.0024  -0.0089 0.0160  167  PHE A CE1  
2499 C CE2  . PHE A 167 ? 0.1836 0.1562 0.1329 0.0222  0.0100  0.0198  167  PHE A CE2  
2500 C CZ   . PHE A 167 ? 0.1424 0.1456 0.1781 0.0175  0.0134  0.0318  167  PHE A CZ   
2501 H H    . PHE A 167 ? 0.1426 0.1426 0.1426 0.0000  0.0000  0.0000  167  PHE A H    
2502 H HA   . PHE A 167 ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  167  PHE A HA   
2503 H HB2  . PHE A 167 ? 0.1545 0.1545 0.1545 0.0000  0.0000  0.0000  167  PHE A HB2  
2504 H HB3  . PHE A 167 ? 0.1545 0.1545 0.1545 0.0000  0.0000  0.0000  167  PHE A HB3  
2505 H HD1  . PHE A 167 ? 0.1696 0.1696 0.1696 0.0000  0.0000  0.0000  167  PHE A HD1  
2506 H HD2  . PHE A 167 ? 0.1652 0.1652 0.1652 0.0000  0.0000  0.0000  167  PHE A HD2  
2507 H HE1  . PHE A 167 ? 0.1843 0.1843 0.1843 0.0000  0.0000  0.0000  167  PHE A HE1  
2508 H HE2  . PHE A 167 ? 0.1891 0.1891 0.1891 0.0000  0.0000  0.0000  167  PHE A HE2  
2509 H HZ   . PHE A 167 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  167  PHE A HZ   
2510 N N    . GLY A 168 ? 0.1125 0.1349 0.1271 0.0013  0.0030  0.0112  168  GLY A N    
2511 C CA   . GLY A 168 ? 0.1132 0.1327 0.1514 -0.0062 -0.0092 0.0081  168  GLY A CA   
2512 C C    . GLY A 168 ? 0.1131 0.1345 0.1448 0.0041  -0.0063 0.0072  168  GLY A C    
2513 O O    . GLY A 168 ? 0.1314 0.1401 0.1917 -0.0111 -0.0153 0.0267  168  GLY A O    
2514 H H    . GLY A 168 ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  168  GLY A H    
2515 H HA2  . GLY A 168 ? 0.1589 0.1589 0.1589 0.0000  0.0000  0.0000  168  GLY A HA2  
2516 H HA3  . GLY A 168 ? 0.1589 0.1589 0.1589 0.0000  0.0000  0.0000  168  GLY A HA3  
2517 N N    . PHE A 169 ? 0.1144 0.1333 0.1553 0.0034  -0.0088 0.0122  169  PHE A N    
2518 C CA   . PHE A 169 ? 0.1157 0.1427 0.1615 -0.0069 -0.0160 0.0259  169  PHE A CA   
2519 C C    . PHE A 169 ? 0.1111 0.1401 0.1332 -0.0027 -0.0119 0.0083  169  PHE A C    
2520 O O    . PHE A 169 ? 0.1297 0.1483 0.1503 0.0008  -0.0063 0.0186  169  PHE A O    
2521 C CB   . PHE A 169 ? 0.1136 0.1640 0.1624 0.0072  -0.0050 0.0362  169  PHE A CB   
2522 C CG   . PHE A 169 ? 0.1280 0.1696 0.1422 0.0055  0.0061  0.0271  169  PHE A CG   
2523 C CD1  . PHE A 169 ? 0.1277 0.1708 0.1429 0.0121  0.0023  0.0207  169  PHE A CD1  
2524 C CD2  . PHE A 169 ? 0.1445 0.1941 0.1605 0.0278  -0.0139 0.0116  169  PHE A CD2  
2525 C CE1  . PHE A 169 ? 0.1689 0.1709 0.1433 0.0172  0.0045  0.0071  169  PHE A CE1  
2526 C CE2  . PHE A 169 ? 0.1654 0.2088 0.1616 0.0207  -0.0197 0.0022  169  PHE A CE2  
2527 C CZ   . PHE A 169 ? 0.1644 0.1980 0.1407 0.0088  -0.0007 -0.0031 169  PHE A CZ   
2528 H H    . PHE A 169 ? 0.1612 0.1612 0.1612 0.0000  0.0000  0.0000  169  PHE A H    
2529 H HA   . PHE A 169 ? 0.1679 0.1679 0.1679 0.0000  0.0000  0.0000  169  PHE A HA   
2530 H HB2  . PHE A 169 ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  169  PHE A HB2  
2531 H HB3  . PHE A 169 ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  169  PHE A HB3  
2532 H HD1  . PHE A 169 ? 0.1766 0.1766 0.1766 0.0000  0.0000  0.0000  169  PHE A HD1  
2533 H HD2  . PHE A 169 ? 0.1996 0.1996 0.1996 0.0000  0.0000  0.0000  169  PHE A HD2  
2534 H HE1  . PHE A 169 ? 0.1933 0.1933 0.1933 0.0000  0.0000  0.0000  169  PHE A HE1  
2535 H HE2  . PHE A 169 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  169  PHE A HE2  
2536 H HZ   . PHE A 169 ? 0.2012 0.2012 0.2012 0.0000  0.0000  0.0000  169  PHE A HZ   
2537 N N    . ILE A 170 ? 0.1084 0.1447 0.1473 -0.0026 -0.0113 0.0195  170  ILE A N    
2538 C CA   . ILE A 170 ? 0.0996 0.1432 0.1431 -0.0099 -0.0133 0.0174  170  ILE A CA   
2539 C C    . ILE A 170 ? 0.1175 0.1459 0.1447 -0.0043 -0.0153 0.0227  170  ILE A C    
2540 O O    . ILE A 170 ? 0.1456 0.1563 0.1516 -0.0014 -0.0163 0.0356  170  ILE A O    
2541 C CB   . ILE A 170 ? 0.1141 0.1381 0.1492 -0.0065 -0.0071 0.0136  170  ILE A CB   
2542 C CG1  . ILE A 170 ? 0.1512 0.1641 0.1388 0.0005  -0.0086 0.0117  170  ILE A CG1  
2543 C CG2  . ILE A 170 ? 0.1222 0.1569 0.1842 0.0000  0.0014  0.0011  170  ILE A CG2  
2544 C CD1  . ILE A 170 ? 0.1554 0.1849 0.1533 0.0090  -0.0064 -0.0013 170  ILE A CD1  
2545 H H    . ILE A 170 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  170  ILE A H    
2546 H HA   . ILE A 170 ? 0.1544 0.1544 0.1544 0.0000  0.0000  0.0000  170  ILE A HA   
2547 H HB   . ILE A 170 ? 0.1606 0.1606 0.1606 0.0000  0.0000  0.0000  170  ILE A HB   
2548 H HG12 . ILE A 170 ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  170  ILE A HG12 
2549 H HG13 . ILE A 170 ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  170  ILE A HG13 
2550 H HG21 . ILE A 170 ? 0.2316 0.2316 0.2316 0.0000  0.0000  0.0000  170  ILE A HG21 
2551 H HG22 . ILE A 170 ? 0.2316 0.2316 0.2316 0.0000  0.0000  0.0000  170  ILE A HG22 
2552 H HG23 . ILE A 170 ? 0.2316 0.2316 0.2316 0.0000  0.0000  0.0000  170  ILE A HG23 
2553 H HD11 . ILE A 170 ? 0.2468 0.2468 0.2468 0.0000  0.0000  0.0000  170  ILE A HD11 
2554 H HD12 . ILE A 170 ? 0.2468 0.2468 0.2468 0.0000  0.0000  0.0000  170  ILE A HD12 
2555 H HD13 . ILE A 170 ? 0.2468 0.2468 0.2468 0.0000  0.0000  0.0000  170  ILE A HD13 
2556 N N    . ASP A 171 ? 0.1143 0.1469 0.1325 -0.0017 -0.0109 0.0180  171  ASP A N    
2557 C CA   . ASP A 171 ? 0.1176 0.1572 0.1216 0.0036  -0.0110 0.0176  171  ASP A CA   
2558 C C    . ASP A 171 ? 0.1258 0.1435 0.1143 0.0002  -0.0124 0.0133  171  ASP A C    
2559 O O    . ASP A 171 ? 0.1275 0.1566 0.1247 0.0058  -0.0099 0.0295  171  ASP A O    
2560 C CB   . ASP A 171 ? 0.1222 0.1643 0.1374 0.0144  -0.0210 0.0125  171  ASP A CB   
2561 C CG   . ASP A 171 ? 0.1220 0.1679 0.1307 0.0125  -0.0042 0.0081  171  ASP A CG   
2562 O OD1  . ASP A 171 ? 0.1258 0.1670 0.1179 0.0085  -0.0100 0.0130  171  ASP A OD1  
2563 O OD2  . ASP A 171 ? 0.1800 0.1807 0.1312 0.0374  -0.0168 0.0006  171  ASP A OD2  
2564 H H    . ASP A 171 ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  171  ASP A H    
2565 H HA   . ASP A 171 ? 0.1586 0.1586 0.1586 0.0000  0.0000  0.0000  171  ASP A HA   
2566 H HB2  . ASP A 171 ? 0.1696 0.1696 0.1696 0.0000  0.0000  0.0000  171  ASP A HB2  
2567 H HB3  . ASP A 171 ? 0.1696 0.1696 0.1696 0.0000  0.0000  0.0000  171  ASP A HB3  
2568 N N    . SER A 172 ? 0.1175 0.1482 0.1291 -0.0010 -0.0106 0.0221  172  SER A N    
2569 C CA   . SER A 172 ? 0.1203 0.1589 0.1206 0.0079  -0.0073 0.0148  172  SER A CA   
2570 C C    . SER A 172 ? 0.1268 0.1412 0.1178 0.0093  -0.0003 0.0191  172  SER A C    
2571 O O    . SER A 172 ? 0.1256 0.1657 0.1406 0.0053  -0.0063 0.0075  172  SER A O    
2572 C CB   A SER A 172 ? 0.1640 0.1383 0.2521 0.0143  -0.0621 -0.0280 172  SER A CB   
2573 C CB   B SER A 172 ? 0.1296 0.1547 0.1343 0.0095  -0.0110 0.0161  172  SER A CB   
2574 O OG   A SER A 172 ? 0.1961 0.1846 0.2005 0.0323  -0.0116 0.0120  172  SER A OG   
2575 O OG   B SER A 172 ? 0.1363 0.1559 0.1576 -0.0032 -0.0099 0.0196  172  SER A OG   
2576 H H    . SER A 172 ? 0.1579 0.1579 0.1579 0.0000  0.0000  0.0000  172  SER A H    
2577 H HA   A SER A 172 ? 0.1600 0.1600 0.1600 0.0000  0.0000  0.0000  172  SER A HA   
2578 H HB2  A SER A 172 ? 0.2218 0.2218 0.2218 0.0000  0.0000  0.0000  172  SER A HB2  
2579 H HB2  B SER A 172 ? 0.1674 0.1674 0.1674 0.0000  0.0000  0.0000  172  SER A HB2  
2580 H HB3  A SER A 172 ? 0.2218 0.2218 0.2218 0.0000  0.0000  0.0000  172  SER A HB3  
2581 H HB3  B SER A 172 ? 0.1674 0.1674 0.1674 0.0000  0.0000  0.0000  172  SER A HB3  
2582 H HG   A SER A 172 ? 0.2907 0.2907 0.2907 0.0000  0.0000  0.0000  172  SER A HG   
2583 H HG   B SER A 172 ? 0.2249 0.2249 0.2249 0.0000  0.0000  0.0000  172  SER A HG   
2584 N N    . SER A 173 ? 0.1078 0.1508 0.1246 -0.0001 -0.0058 0.0184  173  SER A N    
2585 C CA   . SER A 173 ? 0.1239 0.1402 0.1204 -0.0041 -0.0096 0.0186  173  SER A CA   
2586 C C    . SER A 173 ? 0.1113 0.1442 0.1283 0.0024  -0.0135 0.0163  173  SER A C    
2587 O O    . SER A 173 ? 0.1372 0.1563 0.1346 -0.0147 -0.0145 0.0272  173  SER A O    
2588 C CB   . SER A 173 ? 0.1292 0.1654 0.1274 0.0046  -0.0088 0.0239  173  SER A CB   
2589 O OG   . SER A 173 ? 0.1368 0.1721 0.1301 0.0043  -0.0051 0.0063  173  SER A OG   
2590 H H    . SER A 173 ? 0.1532 0.1532 0.1532 0.0000  0.0000  0.0000  173  SER A H    
2591 H HA   . SER A 173 ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  173  SER A HA   
2592 H HB2  . SER A 173 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  173  SER A HB2  
2593 H HB3  . SER A 173 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  173  SER A HB3  
2594 H HG   . SER A 173 ? 0.2195 0.2195 0.2195 0.0000  0.0000  0.0000  173  SER A HG   
2595 N N    . LYS A 174 ? 0.1304 0.1342 0.1187 0.0063  -0.0081 0.0194  174  LYS A N    
2596 C CA   . LYS A 174 ? 0.1294 0.1407 0.1265 0.0060  -0.0013 0.0229  174  LYS A CA   
2597 C C    . LYS A 174 ? 0.1266 0.1440 0.1390 0.0124  -0.0025 0.0350  174  LYS A C    
2598 O O    . LYS A 174 ? 0.1533 0.1569 0.1826 0.0224  0.0294  0.0542  174  LYS A O    
2599 C CB   . LYS A 174 ? 0.1404 0.1474 0.1386 0.0167  -0.0019 0.0285  174  LYS A CB   
2600 C CG   . LYS A 174 ? 0.1439 0.1707 0.1564 0.0241  0.0017  0.0234  174  LYS A CG   
2601 C CD   . LYS A 174 ? 0.1633 0.2149 0.2076 0.0153  -0.0004 -0.0391 174  LYS A CD   
2602 C CE   A LYS A 174 ? 0.1704 0.2290 0.1960 0.0035  -0.0091 -0.0456 174  LYS A CE   
2603 C CE   B LYS A 174 ? 0.2417 0.2540 0.1910 0.1052  -0.0313 -0.0342 174  LYS A CE   
2604 N NZ   A LYS A 174 ? 0.2366 0.1861 0.1916 0.0316  -0.0182 -0.0300 174  LYS A NZ   
2605 N NZ   B LYS A 174 ? 0.1712 0.2516 0.1983 0.0175  0.0015  -0.0356 174  LYS A NZ   
2606 H H    . LYS A 174 ? 0.1534 0.1534 0.1534 0.0000  0.0000  0.0000  174  LYS A H    
2607 H HA   . LYS A 174 ? 0.1587 0.1587 0.1587 0.0000  0.0000  0.0000  174  LYS A HA   
2608 H HB2  . LYS A 174 ? 0.1706 0.1706 0.1706 0.0000  0.0000  0.0000  174  LYS A HB2  
2609 H HB3  . LYS A 174 ? 0.1706 0.1706 0.1706 0.0000  0.0000  0.0000  174  LYS A HB3  
2610 H HG2  . LYS A 174 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  174  LYS A HG2  
2611 H HG3  . LYS A 174 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  174  LYS A HG3  
2612 H HD2  A LYS A 174 ? 0.2343 0.2343 0.2343 0.0000  0.0000  0.0000  174  LYS A HD2  
2613 H HD3  A LYS A 174 ? 0.2343 0.2343 0.2343 0.0000  0.0000  0.0000  174  LYS A HD3  
2614 H HE2  A LYS A 174 ? 0.2381 0.2381 0.2381 0.0000  0.0000  0.0000  174  LYS A HE2  
2615 H HE2  B LYS A 174 ? 0.2747 0.2747 0.2747 0.0000  0.0000  0.0000  174  LYS A HE2  
2616 H HE3  A LYS A 174 ? 0.2381 0.2381 0.2381 0.0000  0.0000  0.0000  174  LYS A HE3  
2617 H HE3  B LYS A 174 ? 0.2747 0.2747 0.2747 0.0000  0.0000  0.0000  174  LYS A HE3  
2618 H HZ1  A LYS A 174 ? 0.3071 0.3071 0.3071 0.0000  0.0000  0.0000  174  LYS A HZ1  
2619 H HZ1  B LYS A 174 ? 0.3105 0.3105 0.3105 0.0000  0.0000  0.0000  174  LYS A HZ1  
2620 H HZ2  A LYS A 174 ? 0.3071 0.3071 0.3071 0.0000  0.0000  0.0000  174  LYS A HZ2  
2621 H HZ2  B LYS A 174 ? 0.3105 0.3105 0.3105 0.0000  0.0000  0.0000  174  LYS A HZ2  
2622 H HZ3  A LYS A 174 ? 0.3071 0.3071 0.3071 0.0000  0.0000  0.0000  174  LYS A HZ3  
2623 H HZ3  B LYS A 174 ? 0.3105 0.3105 0.3105 0.0000  0.0000  0.0000  174  LYS A HZ3  
2624 N N    . TYR A 175 ? 0.1211 0.1426 0.1245 0.0103  -0.0006 0.0223  175  TYR A N    
2625 C CA   . TYR A 175 ? 0.1264 0.1488 0.1168 0.0128  -0.0002 0.0248  175  TYR A CA   
2626 C C    . TYR A 175 ? 0.1168 0.1426 0.1258 0.0044  -0.0051 0.0220  175  TYR A C    
2627 O O    . TYR A 175 ? 0.1311 0.1542 0.1291 0.0079  -0.0033 0.0369  175  TYR A O    
2628 C CB   . TYR A 175 ? 0.1345 0.1542 0.1227 0.0152  -0.0057 0.0244  175  TYR A CB   
2629 C CG   . TYR A 175 ? 0.1342 0.1575 0.1120 0.0145  -0.0092 0.0181  175  TYR A CG   
2630 C CD1  . TYR A 175 ? 0.1450 0.1573 0.1181 0.0155  -0.0099 0.0173  175  TYR A CD1  
2631 C CD2  . TYR A 175 ? 0.1365 0.1532 0.1201 0.0113  -0.0003 0.0242  175  TYR A CD2  
2632 C CE1  . TYR A 175 ? 0.1260 0.1796 0.1175 0.0044  -0.0047 0.0098  175  TYR A CE1  
2633 C CE2  . TYR A 175 ? 0.1507 0.1635 0.1254 0.0079  0.0012  0.0186  175  TYR A CE2  
2634 C CZ   . TYR A 175 ? 0.1493 0.1689 0.1238 -0.0059 0.0027  0.0239  175  TYR A CZ   
2635 O OH   . TYR A 175 ? 0.1548 0.1826 0.1474 -0.0137 0.0025  0.0198  175  TYR A OH   
2636 H H    . TYR A 175 ? 0.1553 0.1553 0.1553 0.0000  0.0000  0.0000  175  TYR A H    
2637 H HA   . TYR A 175 ? 0.1568 0.1568 0.1568 0.0000  0.0000  0.0000  175  TYR A HA   
2638 H HB2  . TYR A 175 ? 0.1645 0.1645 0.1645 0.0000  0.0000  0.0000  175  TYR A HB2  
2639 H HB3  . TYR A 175 ? 0.1645 0.1645 0.1645 0.0000  0.0000  0.0000  175  TYR A HB3  
2640 H HD1  . TYR A 175 ? 0.1682 0.1682 0.1682 0.0000  0.0000  0.0000  175  TYR A HD1  
2641 H HD2  . TYR A 175 ? 0.1639 0.1639 0.1639 0.0000  0.0000  0.0000  175  TYR A HD2  
2642 H HE1  . TYR A 175 ? 0.1692 0.1692 0.1692 0.0000  0.0000  0.0000  175  TYR A HE1  
2643 H HE2  . TYR A 175 ? 0.1758 0.1758 0.1758 0.0000  0.0000  0.0000  175  TYR A HE2  
2644 H HH   . TYR A 175 ? 0.2424 0.2424 0.2424 0.0000  0.0000  0.0000  175  TYR A HH   
2645 N N    . THR A 176 ? 0.1201 0.1388 0.1377 0.0123  0.0002  0.0293  176  THR A N    
2646 C CA   . THR A 176 ? 0.1244 0.1512 0.1302 0.0202  -0.0042 0.0242  176  THR A CA   
2647 C C    . THR A 176 ? 0.1259 0.1531 0.1295 0.0191  -0.0033 0.0222  176  THR A C    
2648 O O    . THR A 176 ? 0.1755 0.1616 0.1362 0.0305  0.0032  0.0178  176  THR A O    
2649 C CB   A THR A 176 ? 0.1310 0.1793 0.1868 0.0042  -0.0317 0.0321  176  THR A CB   
2650 C CB   B THR A 176 ? 0.1200 0.1699 0.1770 0.0226  0.0050  -0.0112 176  THR A CB   
2651 O OG1  A THR A 176 ? 0.1765 0.2354 0.2692 0.0134  0.0485  0.1014  176  THR A OG1  
2652 O OG1  B THR A 176 ? 0.1585 0.1554 0.1672 -0.0030 0.0086  0.0224  176  THR A OG1  
2653 C CG2  A THR A 176 ? 0.1402 0.3078 0.5611 -0.0380 -0.0254 -0.1988 176  THR A CG2  
2654 C CG2  B THR A 176 ? 0.1155 0.1733 0.1772 0.0088  -0.0028 -0.0001 176  THR A CG2  
2655 H H    . THR A 176 ? 0.1587 0.1587 0.1587 0.0000  0.0000  0.0000  176  THR A H    
2656 H HA   A THR A 176 ? 0.1624 0.1624 0.1624 0.0000  0.0000  0.0000  176  THR A HA   
2657 H HB   A THR A 176 ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  176  THR A HB   
2658 H HB   B THR A 176 ? 0.1868 0.1868 0.1868 0.0000  0.0000  0.0000  176  THR A HB   
2659 H HG1  A THR A 176 ? 0.3406 0.3406 0.3406 0.0000  0.0000  0.0000  176  THR A HG1  
2660 H HG1  B THR A 176 ? 0.2405 0.2405 0.2405 0.0000  0.0000  0.0000  176  THR A HG1  
2661 H HG21 A THR A 176 ? 0.5046 0.5046 0.5046 0.0000  0.0000  0.0000  176  THR A HG21 
2662 H HG21 B THR A 176 ? 0.2330 0.2330 0.2330 0.0000  0.0000  0.0000  176  THR A HG21 
2663 H HG22 A THR A 176 ? 0.5046 0.5046 0.5046 0.0000  0.0000  0.0000  176  THR A HG22 
2664 H HG22 B THR A 176 ? 0.2330 0.2330 0.2330 0.0000  0.0000  0.0000  176  THR A HG22 
2665 H HG23 A THR A 176 ? 0.5046 0.5046 0.5046 0.0000  0.0000  0.0000  176  THR A HG23 
2666 H HG23 B THR A 176 ? 0.2330 0.2330 0.2330 0.0000  0.0000  0.0000  176  THR A HG23 
2667 N N    . GLY A 177 ? 0.1870 0.1588 0.1463 0.0320  -0.0350 0.0185  177  GLY A N    
2668 C CA   . GLY A 177 ? 0.1841 0.1512 0.1700 0.0403  -0.0479 0.0172  177  GLY A CA   
2669 C C    . GLY A 177 ? 0.1761 0.1408 0.1395 0.0251  -0.0201 0.0229  177  GLY A C    
2670 O O    . GLY A 177 ? 0.1849 0.1963 0.1502 0.0081  0.0000  -0.0050 177  GLY A O    
2671 H H    . GLY A 177 ? 0.1968 0.1968 0.1968 0.0000  0.0000  0.0000  177  GLY A H    
2672 H HA2  . GLY A 177 ? 0.2021 0.2021 0.2021 0.0000  0.0000  0.0000  177  GLY A HA2  
2673 H HA3  . GLY A 177 ? 0.2021 0.2021 0.2021 0.0000  0.0000  0.0000  177  GLY A HA3  
2674 N N    . SER A 178 ? 0.1647 0.1600 0.1466 0.0344  -0.0231 0.0069  178  SER A N    
2675 C CA   . SER A 178 ? 0.1678 0.1553 0.1424 0.0199  -0.0161 0.0154  178  SER A CA   
2676 C C    . SER A 178 ? 0.1414 0.1403 0.1461 0.0131  -0.0089 0.0122  178  SER A C    
2677 O O    . SER A 178 ? 0.1355 0.1943 0.1579 0.0237  -0.0026 0.0376  178  SER A O    
2678 C CB   . SER A 178 ? 0.2157 0.1483 0.1893 0.0064  -0.0457 0.0265  178  SER A CB   
2679 O OG   . SER A 178 ? 0.5076 0.1943 0.2861 0.0123  -0.1048 0.0768  178  SER A OG   
2680 H H    . SER A 178 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  178  SER A H    
2681 H HA   . SER A 178 ? 0.1862 0.1862 0.1862 0.0000  0.0000  0.0000  178  SER A HA   
2682 H HB2  . SER A 178 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  178  SER A HB2  
2683 H HB3  . SER A 178 ? 0.2213 0.2213 0.2213 0.0000  0.0000  0.0000  178  SER A HB3  
2684 H HG   . SER A 178 ? 0.4939 0.4939 0.4939 0.0000  0.0000  0.0000  178  SER A HG   
2685 N N    . LEU A 179 ? 0.1383 0.1422 0.1425 0.0068  -0.0093 0.0181  179  LEU A N    
2686 C CA   . LEU A 179 ? 0.1371 0.1337 0.1318 0.0036  -0.0082 0.0094  179  LEU A CA   
2687 C C    . LEU A 179 ? 0.1402 0.1348 0.1429 0.0096  -0.0162 0.0099  179  LEU A C    
2688 O O    . LEU A 179 ? 0.1865 0.1303 0.1638 0.0117  -0.0016 0.0116  179  LEU A O    
2689 C CB   . LEU A 179 ? 0.1367 0.1419 0.1386 0.0015  -0.0115 0.0061  179  LEU A CB   
2690 C CG   . LEU A 179 ? 0.1372 0.1650 0.1401 0.0135  -0.0080 0.0052  179  LEU A CG   
2691 C CD1  . LEU A 179 ? 0.1393 0.1809 0.1670 0.0083  0.0029  0.0211  179  LEU A CD1  
2692 C CD2  . LEU A 179 ? 0.1462 0.1497 0.1740 0.0053  0.0199  -0.0124 179  LEU A CD2  
2693 H H    . LEU A 179 ? 0.1692 0.1692 0.1692 0.0000  0.0000  0.0000  179  LEU A H    
2694 H HA   . LEU A 179 ? 0.1611 0.1611 0.1611 0.0000  0.0000  0.0000  179  LEU A HA   
2695 H HB2  . LEU A 179 ? 0.1669 0.1669 0.1669 0.0000  0.0000  0.0000  179  LEU A HB2  
2696 H HB3  . LEU A 179 ? 0.1669 0.1669 0.1669 0.0000  0.0000  0.0000  179  LEU A HB3  
2697 H HG   . LEU A 179 ? 0.1769 0.1769 0.1769 0.0000  0.0000  0.0000  179  LEU A HG   
2698 H HD11 . LEU A 179 ? 0.2436 0.2436 0.2436 0.0000  0.0000  0.0000  179  LEU A HD11 
2699 H HD12 . LEU A 179 ? 0.2436 0.2436 0.2436 0.0000  0.0000  0.0000  179  LEU A HD12 
2700 H HD13 . LEU A 179 ? 0.2436 0.2436 0.2436 0.0000  0.0000  0.0000  179  LEU A HD13 
2701 H HD21 . LEU A 179 ? 0.2349 0.2349 0.2349 0.0000  0.0000  0.0000  179  LEU A HD21 
2702 H HD22 . LEU A 179 ? 0.2349 0.2349 0.2349 0.0000  0.0000  0.0000  179  LEU A HD22 
2703 H HD23 . LEU A 179 ? 0.2349 0.2349 0.2349 0.0000  0.0000  0.0000  179  LEU A HD23 
2704 N N    . THR A 180 ? 0.1292 0.1196 0.1404 0.0128  -0.0114 0.0086  180  THR A N    
2705 C CA   . THR A 180 ? 0.1347 0.1219 0.1422 0.0188  -0.0140 0.0019  180  THR A CA   
2706 C C    . THR A 180 ? 0.1373 0.1161 0.1309 0.0140  -0.0095 0.0010  180  THR A C    
2707 O O    . THR A 180 ? 0.1408 0.1173 0.1456 0.0158  -0.0156 -0.0013 180  THR A O    
2708 C CB   . THR A 180 ? 0.1354 0.1444 0.1450 0.0197  -0.0098 0.0065  180  THR A CB   
2709 O OG1  . THR A 180 ? 0.1429 0.1662 0.1777 0.0339  -0.0199 0.0122  180  THR A OG1  
2710 C CG2  . THR A 180 ? 0.1582 0.1613 0.1645 0.0205  0.0009  -0.0222 180  THR A CG2  
2711 H H    . THR A 180 ? 0.1557 0.1557 0.1557 0.0000  0.0000  0.0000  180  THR A H    
2712 H HA   . THR A 180 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  180  THR A HA   
2713 H HB   . THR A 180 ? 0.1700 0.1700 0.1700 0.0000  0.0000  0.0000  180  THR A HB   
2714 H HG1  . THR A 180 ? 0.2434 0.2434 0.2434 0.0000  0.0000  0.0000  180  THR A HG1  
2715 H HG21 . THR A 180 ? 0.2420 0.2420 0.2420 0.0000  0.0000  0.0000  180  THR A HG21 
2716 H HG22 . THR A 180 ? 0.2420 0.2420 0.2420 0.0000  0.0000  0.0000  180  THR A HG22 
2717 H HG23 . THR A 180 ? 0.2420 0.2420 0.2420 0.0000  0.0000  0.0000  180  THR A HG23 
2718 N N    . TYR A 181 ? 0.1335 0.1103 0.1441 0.0174  -0.0153 0.0085  181  TYR A N    
2719 C CA   . TYR A 181 ? 0.1262 0.1233 0.1397 0.0187  -0.0084 -0.0024 181  TYR A CA   
2720 C C    . TYR A 181 ? 0.1324 0.1166 0.1435 0.0173  -0.0109 -0.0035 181  TYR A C    
2721 O O    . TYR A 181 ? 0.1735 0.1383 0.1477 0.0450  -0.0064 -0.0055 181  TYR A O    
2722 C CB   . TYR A 181 ? 0.1385 0.1294 0.1489 0.0097  -0.0108 -0.0005 181  TYR A CB   
2723 C CG   . TYR A 181 ? 0.1365 0.1359 0.1478 0.0001  -0.0085 -0.0029 181  TYR A CG   
2724 C CD1  . TYR A 181 ? 0.1671 0.1599 0.1583 0.0212  -0.0061 0.0089  181  TYR A CD1  
2725 C CD2  . TYR A 181 ? 0.1240 0.1439 0.1545 0.0000  0.0010  0.0065  181  TYR A CD2  
2726 C CE1  . TYR A 181 ? 0.1564 0.1930 0.1475 0.0127  -0.0109 0.0204  181  TYR A CE1  
2727 C CE2  . TYR A 181 ? 0.1394 0.1421 0.1586 0.0057  0.0008  -0.0083 181  TYR A CE2  
2728 C CZ   . TYR A 181 ? 0.1407 0.1714 0.1513 -0.0100 0.0036  -0.0070 181  TYR A CZ   
2729 O OH   . TYR A 181 ? 0.1754 0.2182 0.1569 -0.0033 0.0066  -0.0061 181  TYR A OH   
2730 H H    . TYR A 181 ? 0.1551 0.1551 0.1551 0.0000  0.0000  0.0000  181  TYR A H    
2731 H HA   . TYR A 181 ? 0.1557 0.1557 0.1557 0.0000  0.0000  0.0000  181  TYR A HA   
2732 H HB2  . TYR A 181 ? 0.1667 0.1667 0.1667 0.0000  0.0000  0.0000  181  TYR A HB2  
2733 H HB3  . TYR A 181 ? 0.1667 0.1667 0.1667 0.0000  0.0000  0.0000  181  TYR A HB3  
2734 H HD1  . TYR A 181 ? 0.1942 0.1942 0.1942 0.0000  0.0000  0.0000  181  TYR A HD1  
2735 H HD2  . TYR A 181 ? 0.1690 0.1690 0.1690 0.0000  0.0000  0.0000  181  TYR A HD2  
2736 H HE1  . TYR A 181 ? 0.1987 0.1987 0.1987 0.0000  0.0000  0.0000  181  TYR A HE1  
2737 H HE2  . TYR A 181 ? 0.1760 0.1760 0.1760 0.0000  0.0000  0.0000  181  TYR A HE2  
2738 H HH   . TYR A 181 ? 0.2752 0.2752 0.2752 0.0000  0.0000  0.0000  181  TYR A HH   
2739 N N    . THR A 182 ? 0.1299 0.1200 0.1300 0.0227  -0.0083 -0.0029 182  THR A N    
2740 C CA   . THR A 182 ? 0.1328 0.1255 0.1357 0.0246  -0.0064 -0.0014 182  THR A CA   
2741 C C    . THR A 182 ? 0.1341 0.1152 0.1290 0.0123  -0.0073 -0.0045 182  THR A C    
2742 O O    . THR A 182 ? 0.1238 0.1264 0.1406 0.0185  -0.0072 -0.0102 182  THR A O    
2743 C CB   . THR A 182 ? 0.1242 0.1472 0.1447 0.0175  -0.0097 0.0052  182  THR A CB   
2744 O OG1  . THR A 182 ? 0.1515 0.1671 0.1491 0.0284  0.0063  0.0098  182  THR A OG1  
2745 C CG2  . THR A 182 ? 0.1312 0.1310 0.1553 0.0049  -0.0158 0.0091  182  THR A CG2  
2746 H H    . THR A 182 ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  182  THR A H    
2747 H HA   . THR A 182 ? 0.1576 0.1576 0.1576 0.0000  0.0000  0.0000  182  THR A HA   
2748 H HB   . THR A 182 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  182  THR A HB   
2749 H HG1  . THR A 182 ? 0.2338 0.2338 0.2338 0.0000  0.0000  0.0000  182  THR A HG1  
2750 H HG21 . THR A 182 ? 0.2087 0.2087 0.2087 0.0000  0.0000  0.0000  182  THR A HG21 
2751 H HG22 . THR A 182 ? 0.2087 0.2087 0.2087 0.0000  0.0000  0.0000  182  THR A HG22 
2752 H HG23 . THR A 182 ? 0.2087 0.2087 0.2087 0.0000  0.0000  0.0000  182  THR A HG23 
2753 N N    . GLY A 183 ? 0.1413 0.1151 0.1436 0.0208  -0.0154 -0.0147 183  GLY A N    
2754 C CA   . GLY A 183 ? 0.1445 0.1143 0.1368 0.0251  -0.0132 -0.0166 183  GLY A CA   
2755 C C    . GLY A 183 ? 0.1302 0.1191 0.1370 0.0108  -0.0070 -0.0092 183  GLY A C    
2756 O O    . GLY A 183 ? 0.1297 0.1394 0.1855 0.0155  0.0012  0.0187  183  GLY A O    
2757 H H    . GLY A 183 ? 0.1600 0.1600 0.1600 0.0000  0.0000  0.0000  183  GLY A H    
2758 H HA2  . GLY A 183 ? 0.1582 0.1582 0.1582 0.0000  0.0000  0.0000  183  GLY A HA2  
2759 H HA3  . GLY A 183 ? 0.1582 0.1582 0.1582 0.0000  0.0000  0.0000  183  GLY A HA3  
2760 N N    . VAL A 184 ? 0.1252 0.1083 0.1399 0.0099  -0.0192 -0.0053 184  VAL A N    
2761 C CA   . VAL A 184 ? 0.1127 0.1081 0.1336 0.0102  -0.0176 -0.0036 184  VAL A CA   
2762 C C    . VAL A 184 ? 0.1207 0.1111 0.1317 0.0090  -0.0137 -0.0096 184  VAL A C    
2763 O O    . VAL A 184 ? 0.1386 0.1204 0.1440 -0.0050 -0.0295 -0.0026 184  VAL A O    
2764 C CB   . VAL A 184 ? 0.1149 0.1183 0.1358 0.0077  -0.0096 -0.0034 184  VAL A CB   
2765 C CG1  . VAL A 184 ? 0.1306 0.1228 0.1345 0.0162  -0.0139 -0.0047 184  VAL A CG1  
2766 C CG2  . VAL A 184 ? 0.1623 0.1263 0.1322 0.0214  -0.0238 -0.0108 184  VAL A CG2  
2767 H H    . VAL A 184 ? 0.1493 0.1493 0.1493 0.0000  0.0000  0.0000  184  VAL A H    
2768 H HA   . VAL A 184 ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  184  VAL A HA   
2769 H HB   . VAL A 184 ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  184  VAL A HB   
2770 H HG11 . VAL A 184 ? 0.1939 0.1939 0.1939 0.0000  0.0000  0.0000  184  VAL A HG11 
2771 H HG12 . VAL A 184 ? 0.1939 0.1939 0.1939 0.0000  0.0000  0.0000  184  VAL A HG12 
2772 H HG13 . VAL A 184 ? 0.1939 0.1939 0.1939 0.0000  0.0000  0.0000  184  VAL A HG13 
2773 H HG21 . VAL A 184 ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  184  VAL A HG21 
2774 H HG22 . VAL A 184 ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  184  VAL A HG22 
2775 H HG23 . VAL A 184 ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  184  VAL A HG23 
2776 N N    . ASP A 185 ? 0.1246 0.1192 0.1307 0.0048  -0.0150 -0.0085 185  ASP A N    
2777 C CA   . ASP A 185 ? 0.1248 0.1182 0.1352 0.0111  -0.0191 -0.0004 185  ASP A CA   
2778 C C    . ASP A 185 ? 0.1242 0.1239 0.1193 0.0091  -0.0168 -0.0123 185  ASP A C    
2779 O O    . ASP A 185 ? 0.1343 0.1151 0.1620 0.0077  -0.0154 -0.0065 185  ASP A O    
2780 C CB   . ASP A 185 ? 0.1336 0.1455 0.1368 0.0181  -0.0039 -0.0112 185  ASP A CB   
2781 C CG   . ASP A 185 ? 0.1532 0.1970 0.1324 0.0154  -0.0139 -0.0061 185  ASP A CG   
2782 O OD1  . ASP A 185 ? 0.1544 0.1980 0.1441 0.0363  -0.0201 -0.0223 185  ASP A OD1  
2783 O OD2  . ASP A 185 ? 0.1641 0.4619 0.1456 -0.0324 -0.0141 0.0524  185  ASP A OD2  
2784 H H    . ASP A 185 ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  185  ASP A H    
2785 H HA   . ASP A 185 ? 0.1512 0.1512 0.1512 0.0000  0.0000  0.0000  185  ASP A HA   
2786 H HB2  . ASP A 185 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  185  ASP A HB2  
2787 H HB3  . ASP A 185 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  185  ASP A HB3  
2788 N N    . ASN A 186 ? 0.1241 0.1206 0.1356 0.0117  -0.0160 -0.0028 186  ASN A N    
2789 C CA   . ASN A 186 ? 0.1238 0.1319 0.1421 0.0150  -0.0099 -0.0083 186  ASN A CA   
2790 C C    . ASN A 186 ? 0.1036 0.1298 0.1475 0.0029  -0.0092 0.0022  186  ASN A C    
2791 O O    . ASN A 186 ? 0.1220 0.1367 0.1635 0.0072  -0.0166 0.0005  186  ASN A O    
2792 C CB   . ASN A 186 ? 0.1604 0.1737 0.1483 0.0291  0.0086  0.0110  186  ASN A CB   
2793 C CG   . ASN A 186 ? 0.1589 0.1582 0.2499 0.0136  0.0401  0.0205  186  ASN A CG   
2794 O OD1  . ASN A 186 ? 0.1683 0.1544 0.2842 -0.0213 0.0012  -0.0255 186  ASN A OD1  
2795 N ND2  . ASN A 186 ? 0.1712 0.3021 0.3296 -0.0026 0.0488  0.1068  186  ASN A ND2  
2796 H H    . ASN A 186 ? 0.1521 0.1521 0.1521 0.0000  0.0000  0.0000  186  ASN A H    
2797 H HA   . ASN A 186 ? 0.1591 0.1591 0.1591 0.0000  0.0000  0.0000  186  ASN A HA   
2798 H HB2  . ASN A 186 ? 0.1930 0.1930 0.1930 0.0000  0.0000  0.0000  186  ASN A HB2  
2799 H HB3  . ASN A 186 ? 0.1930 0.1930 0.1930 0.0000  0.0000  0.0000  186  ASN A HB3  
2800 H HD21 . ASN A 186 ? 0.3212 0.3212 0.3212 0.0000  0.0000  0.0000  186  ASN A HD21 
2801 H HD22 . ASN A 186 ? 0.3212 0.3212 0.3212 0.0000  0.0000  0.0000  186  ASN A HD22 
2802 N N    . SER A 187 ? 0.1284 0.1265 0.1397 0.0121  -0.0189 -0.0063 187  SER A N    
2803 C CA   . SER A 187 ? 0.1440 0.1417 0.1480 0.0071  -0.0359 -0.0144 187  SER A CA   
2804 C C    . SER A 187 ? 0.1344 0.1453 0.1362 0.0108  -0.0271 -0.0127 187  SER A C    
2805 O O    . SER A 187 ? 0.1908 0.1587 0.1932 0.0197  -0.0875 -0.0140 187  SER A O    
2806 C CB   . SER A 187 ? 0.2071 0.1836 0.1505 0.0434  -0.0337 -0.0321 187  SER A CB   
2807 O OG   . SER A 187 ? 0.2000 0.2597 0.1536 0.0612  -0.0143 -0.0086 187  SER A OG   
2808 H H    . SER A 187 ? 0.1578 0.1578 0.1578 0.0000  0.0000  0.0000  187  SER A H    
2809 H HA   . SER A 187 ? 0.1735 0.1735 0.1735 0.0000  0.0000  0.0000  187  SER A HA   
2810 H HB2  . SER A 187 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  187  SER A HB2  
2811 H HB3  . SER A 187 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  187  SER A HB3  
2812 H HG   . SER A 187 ? 0.3066 0.3066 0.3066 0.0000  0.0000  0.0000  187  SER A HG   
2813 N N    . GLN A 188 ? 0.1191 0.1312 0.1156 0.0125  -0.0087 -0.0052 188  GLN A N    
2814 C CA   . GLN A 188 ? 0.1162 0.1349 0.1121 0.0138  -0.0113 0.0062  188  GLN A CA   
2815 C C    . GLN A 188 ? 0.1119 0.1234 0.1150 0.0180  -0.0139 0.0009  188  GLN A C    
2816 O O    . GLN A 188 ? 0.1295 0.1250 0.1314 0.0136  -0.0068 0.0004  188  GLN A O    
2817 C CB   . GLN A 188 ? 0.1186 0.1361 0.1246 0.0195  0.0026  0.0103  188  GLN A CB   
2818 C CG   . GLN A 188 ? 0.1397 0.1407 0.1318 0.0252  0.0045  -0.0013 188  GLN A CG   
2819 C CD   . GLN A 188 ? 0.1426 0.1375 0.1143 0.0123  0.0005  0.0043  188  GLN A CD   
2820 O OE1  . GLN A 188 ? 0.1525 0.1345 0.1257 0.0122  -0.0122 0.0145  188  GLN A OE1  
2821 N NE2  . GLN A 188 ? 0.2329 0.1681 0.1401 0.0173  -0.0414 -0.0171 188  GLN A NE2  
2822 H H    . GLN A 188 ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  188  GLN A H    
2823 H HA   . GLN A 188 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  188  GLN A HA   
2824 H HB2  . GLN A 188 ? 0.1517 0.1517 0.1517 0.0000  0.0000  0.0000  188  GLN A HB2  
2825 H HB3  . GLN A 188 ? 0.1517 0.1517 0.1517 0.0000  0.0000  0.0000  188  GLN A HB3  
2826 H HG2  . GLN A 188 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  188  GLN A HG2  
2827 H HG3  . GLN A 188 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  188  GLN A HG3  
2828 H HE21 . GLN A 188 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  188  GLN A HE21 
2829 H HE22 . GLN A 188 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  188  GLN A HE22 
2830 N N    . GLY A 189 ? 0.1097 0.1240 0.1133 0.0093  -0.0092 -0.0058 189  GLY A N    
2831 C CA   . GLY A 189 ? 0.0981 0.1280 0.1156 0.0110  -0.0080 0.0032  189  GLY A CA   
2832 C C    . GLY A 189 ? 0.1057 0.1079 0.1103 0.0058  -0.0045 0.0015  189  GLY A C    
2833 O O    . GLY A 189 ? 0.1120 0.1286 0.1184 0.0065  0.0000  -0.0102 189  GLY A O    
2834 H H    . GLY A 189 ? 0.1388 0.1388 0.1388 0.0000  0.0000  0.0000  189  GLY A H    
2835 H HA2  . GLY A 189 ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  189  GLY A HA2  
2836 H HA3  . GLY A 189 ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  189  GLY A HA3  
2837 N N    . PHE A 190 ? 0.0935 0.1267 0.1128 0.0119  -0.0041 -0.0040 190  PHE A N    
2838 C CA   . PHE A 190 ? 0.1025 0.1130 0.1082 0.0055  -0.0094 -0.0040 190  PHE A CA   
2839 C C    . PHE A 190 ? 0.0942 0.1140 0.1170 0.0047  -0.0037 -0.0063 190  PHE A C    
2840 O O    . PHE A 190 ? 0.1236 0.1123 0.1223 0.0044  -0.0160 -0.0071 190  PHE A O    
2841 C CB   . PHE A 190 ? 0.1100 0.1246 0.1213 0.0023  -0.0111 0.0005  190  PHE A CB   
2842 C CG   . PHE A 190 ? 0.0985 0.1283 0.1177 0.0017  -0.0115 0.0048  190  PHE A CG   
2843 C CD1  . PHE A 190 ? 0.1303 0.1234 0.1201 0.0015  -0.0095 0.0010  190  PHE A CD1  
2844 C CD2  . PHE A 190 ? 0.1294 0.1349 0.1143 0.0002  -0.0047 0.0042  190  PHE A CD2  
2845 C CE1  . PHE A 190 ? 0.1311 0.1241 0.1453 0.0027  -0.0100 0.0029  190  PHE A CE1  
2846 C CE2  . PHE A 190 ? 0.1726 0.1387 0.1193 -0.0100 -0.0073 0.0135  190  PHE A CE2  
2847 C CZ   . PHE A 190 ? 0.1580 0.1313 0.1389 0.0011  -0.0016 0.0146  190  PHE A CZ   
2848 H H    . PHE A 190 ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  190  PHE A H    
2849 H HA   . PHE A 190 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  190  PHE A HA   
2850 H HB2  . PHE A 190 ? 0.1424 0.1424 0.1424 0.0000  0.0000  0.0000  190  PHE A HB2  
2851 H HB3  . PHE A 190 ? 0.1424 0.1424 0.1424 0.0000  0.0000  0.0000  190  PHE A HB3  
2852 H HD1  . PHE A 190 ? 0.1496 0.1496 0.1496 0.0000  0.0000  0.0000  190  PHE A HD1  
2853 H HD2  . PHE A 190 ? 0.1515 0.1515 0.1515 0.0000  0.0000  0.0000  190  PHE A HD2  
2854 H HE1  . PHE A 190 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  190  PHE A HE1  
2855 H HE2  . PHE A 190 ? 0.1722 0.1722 0.1722 0.0000  0.0000  0.0000  190  PHE A HE2  
2856 H HZ   . PHE A 190 ? 0.1712 0.1712 0.1712 0.0000  0.0000  0.0000  190  PHE A HZ   
2857 N N    . TRP A 191 ? 0.1013 0.1104 0.1147 0.0140  -0.0141 -0.0036 191  TRP A N    
2858 C CA   . TRP A 191 ? 0.0994 0.1052 0.1148 0.0117  -0.0058 0.0013  191  TRP A CA   
2859 C C    . TRP A 191 ? 0.1024 0.1002 0.1206 0.0078  -0.0062 -0.0048 191  TRP A C    
2860 O O    . TRP A 191 ? 0.1112 0.1114 0.1223 0.0057  -0.0048 -0.0044 191  TRP A O    
2861 C CB   . TRP A 191 ? 0.1106 0.1063 0.1175 0.0098  -0.0119 -0.0030 191  TRP A CB   
2862 C CG   . TRP A 191 ? 0.1080 0.1142 0.1089 0.0089  -0.0095 0.0017  191  TRP A CG   
2863 C CD1  . TRP A 191 ? 0.1072 0.1135 0.1126 0.0115  -0.0039 -0.0057 191  TRP A CD1  
2864 C CD2  . TRP A 191 ? 0.1201 0.1146 0.1129 0.0074  -0.0068 0.0007  191  TRP A CD2  
2865 N NE1  . TRP A 191 ? 0.1109 0.1201 0.1248 0.0088  0.0013  -0.0043 191  TRP A NE1  
2866 C CE2  . TRP A 191 ? 0.1194 0.1192 0.1210 0.0005  -0.0004 -0.0064 191  TRP A CE2  
2867 C CE3  . TRP A 191 ? 0.1342 0.1167 0.1229 0.0100  -0.0037 -0.0018 191  TRP A CE3  
2868 C CZ2  . TRP A 191 ? 0.1257 0.1319 0.1263 -0.0174 -0.0040 -0.0013 191  TRP A CZ2  
2869 C CZ3  . TRP A 191 ? 0.1594 0.1109 0.1366 -0.0009 -0.0107 -0.0022 191  TRP A CZ3  
2870 C CH2  . TRP A 191 ? 0.1418 0.1311 0.1356 -0.0188 0.0003  0.0023  191  TRP A CH2  
2871 H H    . TRP A 191 ? 0.1306 0.1306 0.1306 0.0000  0.0000  0.0000  191  TRP A H    
2872 H HA   . TRP A 191 ? 0.1278 0.1278 0.1278 0.0000  0.0000  0.0000  191  TRP A HA   
2873 H HB2  . TRP A 191 ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  191  TRP A HB2  
2874 H HB3  . TRP A 191 ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  191  TRP A HB3  
2875 H HD1  . TRP A 191 ? 0.1334 0.1334 0.1334 0.0000  0.0000  0.0000  191  TRP A HD1  
2876 H HE1  . TRP A 191 ? 0.1424 0.1424 0.1424 0.0000  0.0000  0.0000  191  TRP A HE1  
2877 H HE3  . TRP A 191 ? 0.1496 0.1496 0.1496 0.0000  0.0000  0.0000  191  TRP A HE3  
2878 H HZ2  . TRP A 191 ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  191  TRP A HZ2  
2879 H HZ3  . TRP A 191 ? 0.1627 0.1627 0.1627 0.0000  0.0000  0.0000  191  TRP A HZ3  
2880 H HH2  . TRP A 191 ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  191  TRP A HH2  
2881 N N    . SER A 192 ? 0.1062 0.1166 0.1217 0.0109  -0.0048 -0.0065 192  SER A N    
2882 C CA   . SER A 192 ? 0.1052 0.1095 0.1189 0.0066  -0.0048 -0.0089 192  SER A CA   
2883 C C    . SER A 192 ? 0.1051 0.1129 0.1198 0.0085  -0.0054 -0.0078 192  SER A C    
2884 O O    . SER A 192 ? 0.1184 0.1085 0.1530 0.0048  -0.0049 -0.0027 192  SER A O    
2885 C CB   . SER A 192 ? 0.1299 0.1177 0.1263 0.0070  -0.0048 0.0020  192  SER A CB   
2886 O OG   . SER A 192 ? 0.1523 0.1579 0.1269 0.0152  0.0108  0.0038  192  SER A OG   
2887 H H    . SER A 192 ? 0.1378 0.1378 0.1378 0.0000  0.0000  0.0000  192  SER A H    
2888 H HA   . SER A 192 ? 0.1335 0.1335 0.1335 0.0000  0.0000  0.0000  192  SER A HA   
2889 H HB2  . SER A 192 ? 0.1496 0.1496 0.1496 0.0000  0.0000  0.0000  192  SER A HB2  
2890 H HB3  . SER A 192 ? 0.1496 0.1496 0.1496 0.0000  0.0000  0.0000  192  SER A HB3  
2891 H HG   . SER A 192 ? 0.2186 0.2186 0.2186 0.0000  0.0000  0.0000  192  SER A HG   
2892 N N    . PHE A 193 ? 0.1096 0.1097 0.1371 0.0069  -0.0015 0.0003  193  PHE A N    
2893 C CA   . PHE A 193 ? 0.1099 0.1101 0.1342 0.0158  -0.0001 -0.0013 193  PHE A CA   
2894 C C    . PHE A 193 ? 0.1021 0.1210 0.1301 0.0068  -0.0066 0.0004  193  PHE A C    
2895 O O    . PHE A 193 ? 0.1267 0.1225 0.1394 0.0060  0.0056  -0.0047 193  PHE A O    
2896 C CB   . PHE A 193 ? 0.1316 0.1146 0.1322 0.0149  0.0069  0.0003  193  PHE A CB   
2897 C CG   . PHE A 193 ? 0.1222 0.1173 0.1275 0.0134  0.0017  0.0075  193  PHE A CG   
2898 C CD1  . PHE A 193 ? 0.1260 0.1184 0.1382 0.0141  0.0038  0.0033  193  PHE A CD1  
2899 C CD2  . PHE A 193 ? 0.1302 0.1409 0.1283 0.0215  -0.0094 -0.0089 193  PHE A CD2  
2900 C CE1  . PHE A 193 ? 0.1321 0.1234 0.1397 0.0204  0.0007  -0.0031 193  PHE A CE1  
2901 C CE2  . PHE A 193 ? 0.1313 0.1550 0.1524 0.0222  -0.0168 -0.0168 193  PHE A CE2  
2902 C CZ   . PHE A 193 ? 0.1333 0.1431 0.1492 0.0123  -0.0116 -0.0128 193  PHE A CZ   
2903 H H    . PHE A 193 ? 0.1426 0.1426 0.1426 0.0000  0.0000  0.0000  193  PHE A H    
2904 H HA   . PHE A 193 ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  193  PHE A HA   
2905 H HB2  . PHE A 193 ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  193  PHE A HB2  
2906 H HB3  . PHE A 193 ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  193  PHE A HB3  
2907 H HD1  . PHE A 193 ? 0.1530 0.1530 0.1530 0.0000  0.0000  0.0000  193  PHE A HD1  
2908 H HD2  . PHE A 193 ? 0.1597 0.1597 0.1597 0.0000  0.0000  0.0000  193  PHE A HD2  
2909 H HE1  . PHE A 193 ? 0.1581 0.1581 0.1581 0.0000  0.0000  0.0000  193  PHE A HE1  
2910 H HE2  . PHE A 193 ? 0.1755 0.1755 0.1755 0.0000  0.0000  0.0000  193  PHE A HE2  
2911 H HZ   . PHE A 193 ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  193  PHE A HZ   
2912 N N    . ASN A 194 ? 0.1063 0.1224 0.1327 0.0133  0.0000  -0.0052 194  ASN A N    
2913 C CA   . ASN A 194 ? 0.1060 0.1392 0.1440 0.0197  0.0073  -0.0048 194  ASN A CA   
2914 C C    . ASN A 194 ? 0.1153 0.1132 0.1511 0.0159  0.0027  -0.0055 194  ASN A C    
2915 O O    . ASN A 194 ? 0.1267 0.1538 0.1580 0.0165  -0.0103 0.0147  194  ASN A O    
2916 C CB   . ASN A 194 ? 0.1364 0.2116 0.1779 0.0388  0.0021  -0.0645 194  ASN A CB   
2917 C CG   . ASN A 194 ? 0.1989 0.2113 0.1889 0.0217  -0.0247 -0.0657 194  ASN A CG   
2918 O OD1  . ASN A 194 ? 0.2874 0.2677 0.4228 -0.0417 -0.0939 -0.1165 194  ASN A OD1  
2919 N ND2  . ASN A 194 ? 0.1746 0.2347 0.1726 0.0257  -0.0363 -0.0515 194  ASN A ND2  
2920 H H    . ASN A 194 ? 0.1445 0.1445 0.1445 0.0000  0.0000  0.0000  194  ASN A H    
2921 H HA   . ASN A 194 ? 0.1557 0.1557 0.1557 0.0000  0.0000  0.0000  194  ASN A HA   
2922 H HB2  . ASN A 194 ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  194  ASN A HB2  
2923 H HB3  . ASN A 194 ? 0.2104 0.2104 0.2104 0.0000  0.0000  0.0000  194  ASN A HB3  
2924 H HD21 . ASN A 194 ? 0.2328 0.2328 0.2328 0.0000  0.0000  0.0000  194  ASN A HD21 
2925 H HD22 . ASN A 194 ? 0.2328 0.2328 0.2328 0.0000  0.0000  0.0000  194  ASN A HD22 
2926 N N    . VAL A 195 ? 0.1194 0.1283 0.1608 0.0172  0.0067  -0.0082 195  VAL A N    
2927 C CA   . VAL A 195 ? 0.1121 0.1765 0.1869 0.0210  0.0044  -0.0604 195  VAL A CA   
2928 C C    . VAL A 195 ? 0.1109 0.1345 0.1647 0.0139  -0.0012 -0.0294 195  VAL A C    
2929 O O    . VAL A 195 ? 0.1313 0.1583 0.1645 0.0287  -0.0031 -0.0267 195  VAL A O    
2930 C CB   . VAL A 195 ? 0.1481 0.1755 0.1787 0.0122  -0.0019 -0.0379 195  VAL A CB   
2931 C CG1  . VAL A 195 ? 0.1753 0.1982 0.2090 0.0403  -0.0011 -0.0754 195  VAL A CG1  
2932 C CG2  . VAL A 195 ? 0.3345 0.1419 0.1790 0.0322  0.0548  -0.0314 195  VAL A CG2  
2933 H H    . VAL A 195 ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  195  VAL A H    
2934 H HA   . VAL A 195 ? 0.1902 0.1902 0.1902 0.0000  0.0000  0.0000  195  VAL A HA   
2935 H HB   . VAL A 195 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  195  VAL A HB   
2936 H HG11 . VAL A 195 ? 0.2913 0.2913 0.2913 0.0000  0.0000  0.0000  195  VAL A HG11 
2937 H HG12 . VAL A 195 ? 0.2913 0.2913 0.2913 0.0000  0.0000  0.0000  195  VAL A HG12 
2938 H HG13 . VAL A 195 ? 0.2913 0.2913 0.2913 0.0000  0.0000  0.0000  195  VAL A HG13 
2939 H HG21 . VAL A 195 ? 0.3276 0.3276 0.3276 0.0000  0.0000  0.0000  195  VAL A HG21 
2940 H HG22 . VAL A 195 ? 0.3276 0.3276 0.3276 0.0000  0.0000  0.0000  195  VAL A HG22 
2941 H HG23 . VAL A 195 ? 0.3276 0.3276 0.3276 0.0000  0.0000  0.0000  195  VAL A HG23 
2942 N N    . ASP A 196 ? 0.1225 0.1423 0.1430 0.0125  0.0069  -0.0294 196  ASP A N    
2943 C CA   . ASP A 196 ? 0.1258 0.1354 0.1431 0.0154  -0.0015 -0.0265 196  ASP A CA   
2944 C C    . ASP A 196 ? 0.1206 0.1307 0.1667 0.0194  0.0029  -0.0237 196  ASP A C    
2945 O O    . ASP A 196 ? 0.1628 0.1576 0.1886 0.0036  0.0368  -0.0438 196  ASP A O    
2946 C CB   . ASP A 196 ? 0.1411 0.1401 0.1500 0.0072  0.0039  -0.0185 196  ASP A CB   
2947 C CG   . ASP A 196 ? 0.1614 0.1633 0.1590 -0.0146 -0.0150 -0.0203 196  ASP A CG   
2948 O OD1  . ASP A 196 ? 0.2036 0.1930 0.1895 -0.0361 -0.0388 -0.0169 196  ASP A OD1  
2949 O OD2  . ASP A 196 ? 0.2691 0.2650 0.1736 -0.1086 -0.0332 0.0118  196  ASP A OD2  
2950 H H    . ASP A 196 ? 0.1631 0.1631 0.1631 0.0000  0.0000  0.0000  196  ASP A H    
2951 H HA   . ASP A 196 ? 0.1617 0.1617 0.1617 0.0000  0.0000  0.0000  196  ASP A HA   
2952 H HB2  . ASP A 196 ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  196  ASP A HB2  
2953 H HB3  . ASP A 196 ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  196  ASP A HB3  
2954 N N    . SER A 197 ? 0.1160 0.1334 0.1655 0.0195  -0.0053 -0.0242 197  SER A N    
2955 C CA   . SER A 197 ? 0.1243 0.1447 0.1861 0.0062  0.0037  -0.0283 197  SER A CA   
2956 C C    . SER A 197 ? 0.1053 0.1476 0.1632 0.0073  -0.0054 -0.0095 197  SER A C    
2957 O O    . SER A 197 ? 0.1312 0.1418 0.1568 -0.0044 -0.0042 -0.0155 197  SER A O    
2958 C CB   . SER A 197 ? 0.1315 0.1831 0.2927 0.0247  -0.0170 -0.0283 197  SER A CB   
2959 O OG   . SER A 197 ? 0.1724 0.2377 0.3222 0.0261  -0.0239 0.0436  197  SER A OG   
2960 H H    . SER A 197 ? 0.1659 0.1659 0.1659 0.0000  0.0000  0.0000  197  SER A H    
2961 H HA   . SER A 197 ? 0.1820 0.1820 0.1820 0.0000  0.0000  0.0000  197  SER A HA   
2962 H HB2  . SER A 197 ? 0.2429 0.2429 0.2429 0.0000  0.0000  0.0000  197  SER A HB2  
2963 H HB3  . SER A 197 ? 0.2429 0.2429 0.2429 0.0000  0.0000  0.0000  197  SER A HB3  
2964 H HG   . SER A 197 ? 0.3661 0.3661 0.3661 0.0000  0.0000  0.0000  197  SER A HG   
2965 N N    . TYR A 198 ? 0.1233 0.1536 0.1433 -0.0014 -0.0031 -0.0175 198  TYR A N    
2966 C CA   . TYR A 198 ? 0.1170 0.1538 0.1462 0.0000  0.0000  -0.0172 198  TYR A CA   
2967 C C    . TYR A 198 ? 0.1162 0.1340 0.1426 -0.0002 -0.0082 -0.0027 198  TYR A C    
2968 O O    . TYR A 198 ? 0.1180 0.1477 0.1494 0.0157  -0.0074 -0.0183 198  TYR A O    
2969 C CB   . TYR A 198 ? 0.1188 0.1654 0.1520 0.0176  -0.0063 -0.0213 198  TYR A CB   
2970 C CG   . TYR A 198 ? 0.1153 0.1555 0.1523 0.0252  -0.0105 -0.0137 198  TYR A CG   
2971 C CD1  . TYR A 198 ? 0.1246 0.1770 0.1478 0.0165  -0.0113 -0.0147 198  TYR A CD1  
2972 C CD2  . TYR A 198 ? 0.1343 0.1409 0.1569 0.0175  -0.0163 -0.0044 198  TYR A CD2  
2973 C CE1  . TYR A 198 ? 0.1383 0.2094 0.1500 0.0318  0.0005  -0.0131 198  TYR A CE1  
2974 C CE2  . TYR A 198 ? 0.1565 0.1472 0.1721 0.0238  -0.0082 0.0170  198  TYR A CE2  
2975 C CZ   . TYR A 198 ? 0.1504 0.1801 0.1704 0.0308  0.0159  0.0125  198  TYR A CZ   
2976 O OH   . TYR A 198 ? 0.2027 0.2413 0.1829 0.0286  0.0432  0.0332  198  TYR A OH   
2977 H H    . TYR A 198 ? 0.1681 0.1681 0.1681 0.0000  0.0000  0.0000  198  TYR A H    
2978 H HA   . TYR A 198 ? 0.1668 0.1668 0.1668 0.0000  0.0000  0.0000  198  TYR A HA   
2979 H HB2  . TYR A 198 ? 0.1745 0.1745 0.1745 0.0000  0.0000  0.0000  198  TYR A HB2  
2980 H HB3  . TYR A 198 ? 0.1745 0.1745 0.1745 0.0000  0.0000  0.0000  198  TYR A HB3  
2981 H HD1  . TYR A 198 ? 0.1797 0.1797 0.1797 0.0000  0.0000  0.0000  198  TYR A HD1  
2982 H HD2  . TYR A 198 ? 0.1729 0.1729 0.1729 0.0000  0.0000  0.0000  198  TYR A HD2  
2983 H HE1  . TYR A 198 ? 0.1991 0.1991 0.1991 0.0000  0.0000  0.0000  198  TYR A HE1  
2984 H HE2  . TYR A 198 ? 0.1904 0.1904 0.1904 0.0000  0.0000  0.0000  198  TYR A HE2  
2985 H HH   . TYR A 198 ? 0.3135 0.3135 0.3135 0.0000  0.0000  0.0000  198  TYR A HH   
2986 N N    . THR A 199 ? 0.1131 0.1394 0.1496 0.0008  -0.0020 -0.0094 199  THR A N    
2987 C CA   . THR A 199 ? 0.1053 0.1500 0.1531 0.0049  -0.0069 -0.0175 199  THR A CA   
2988 C C    . THR A 199 ? 0.1138 0.1520 0.1601 -0.0027 0.0038  -0.0184 199  THR A C    
2989 O O    . THR A 199 ? 0.1608 0.1430 0.1872 -0.0075 0.0395  -0.0229 199  THR A O    
2990 C CB   . THR A 199 ? 0.1273 0.1603 0.1694 0.0076  -0.0200 -0.0109 199  THR A CB   
2991 O OG1  . THR A 199 ? 0.1961 0.1723 0.2156 0.0460  -0.0489 -0.0305 199  THR A OG1  
2992 C CG2  . THR A 199 ? 0.1196 0.2595 0.1782 0.0144  -0.0274 -0.0250 199  THR A CG2  
2993 H H    . THR A 199 ? 0.1608 0.1608 0.1608 0.0000  0.0000  0.0000  199  THR A H    
2994 H HA   . THR A 199 ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  199  THR A HA   
2995 H HB   . THR A 199 ? 0.1828 0.1828 0.1828 0.0000  0.0000  0.0000  199  THR A HB   
2996 H HG1  . THR A 199 ? 0.2921 0.2921 0.2921 0.0000  0.0000  0.0000  199  THR A HG1  
2997 H HG21 . THR A 199 ? 0.2786 0.2786 0.2786 0.0000  0.0000  0.0000  199  THR A HG21 
2998 H HG22 . THR A 199 ? 0.2786 0.2786 0.2786 0.0000  0.0000  0.0000  199  THR A HG22 
2999 H HG23 . THR A 199 ? 0.2786 0.2786 0.2786 0.0000  0.0000  0.0000  199  THR A HG23 
3000 N N    . ALA A 200 ? 0.1206 0.1431 0.1624 0.0056  0.0111  -0.0115 200  ALA A N    
3001 C CA   . ALA A 200 ? 0.1246 0.1395 0.1563 0.0090  0.0110  -0.0073 200  ALA A CA   
3002 C C    . ALA A 200 ? 0.1311 0.1298 0.1590 0.0061  0.0133  -0.0027 200  ALA A C    
3003 O O    . ALA A 200 ? 0.1189 0.1461 0.1559 -0.0001 0.0087  0.0015  200  ALA A O    
3004 C CB   . ALA A 200 ? 0.1316 0.1730 0.1727 0.0165  0.0001  0.0112  200  ALA A CB   
3005 H H    . ALA A 200 ? 0.1705 0.1705 0.1705 0.0000  0.0000  0.0000  200  ALA A H    
3006 H HA   . ALA A 200 ? 0.1682 0.1682 0.1682 0.0000  0.0000  0.0000  200  ALA A HA   
3007 H HB1  . ALA A 200 ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  200  ALA A HB1  
3008 H HB2  . ALA A 200 ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  200  ALA A HB2  
3009 H HB3  . ALA A 200 ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  200  ALA A HB3  
3010 N N    . GLY A 201 ? 0.1317 0.1473 0.1640 0.0040  0.0011  0.0063  201  GLY A N    
3011 C CA   . GLY A 201 ? 0.1442 0.1431 0.1424 0.0063  -0.0005 0.0027  201  GLY A CA   
3012 C C    . GLY A 201 ? 0.1311 0.1328 0.1442 0.0018  -0.0149 0.0053  201  GLY A C    
3013 O O    . GLY A 201 ? 0.1291 0.1369 0.1796 0.0011  -0.0047 0.0114  201  GLY A O    
3014 H H    . GLY A 201 ? 0.1772 0.1772 0.1772 0.0000  0.0000  0.0000  201  GLY A H    
3015 H HA2  . GLY A 201 ? 0.1719 0.1719 0.1719 0.0000  0.0000  0.0000  201  GLY A HA2  
3016 H HA3  . GLY A 201 ? 0.1719 0.1719 0.1719 0.0000  0.0000  0.0000  201  GLY A HA3  
3017 N N    . SER A 202 ? 0.1339 0.1170 0.1534 0.0133  -0.0036 0.0025  202  SER A N    
3018 C CA   . SER A 202 ? 0.1345 0.1436 0.1623 0.0276  -0.0085 0.0140  202  SER A CA   
3019 C C    . SER A 202 ? 0.1384 0.1401 0.1603 0.0276  0.0057  0.0054  202  SER A C    
3020 O O    . SER A 202 ? 0.1692 0.1943 0.1677 0.0592  0.0038  0.0052  202  SER A O    
3021 C CB   A SER A 202 ? 0.1305 0.1650 0.1872 0.0249  -0.0123 0.0181  202  SER A CB   
3022 C CB   B SER A 202 ? 0.1263 0.1582 0.2252 0.0303  -0.0191 0.0045  202  SER A CB   
3023 O OG   A SER A 202 ? 0.1453 0.1728 0.2157 0.0202  0.0130  0.0453  202  SER A OG   
3024 O OG   B SER A 202 ? 0.1592 0.1406 0.2059 0.0033  -0.0090 0.0296  202  SER A OG   
3025 H H    . SER A 202 ? 0.1617 0.1617 0.1617 0.0000  0.0000  0.0000  202  SER A H    
3026 H HA   A SER A 202 ? 0.1762 0.1762 0.1762 0.0000  0.0000  0.0000  202  SER A HA   
3027 H HB2  A SER A 202 ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  202  SER A HB2  
3028 H HB2  B SER A 202 ? 0.2039 0.2039 0.2039 0.0000  0.0000  0.0000  202  SER A HB2  
3029 H HB3  A SER A 202 ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  202  SER A HB3  
3030 H HB3  B SER A 202 ? 0.2039 0.2039 0.2039 0.0000  0.0000  0.0000  202  SER A HB3  
3031 H HG   A SER A 202 ? 0.2669 0.2669 0.2669 0.0000  0.0000  0.0000  202  SER A HG   
3032 H HG   B SER A 202 ? 0.2528 0.2528 0.2528 0.0000  0.0000  0.0000  202  SER A HG   
3033 N N    . GLN A 203 ? 0.1370 0.1530 0.1497 0.0086  0.0088  -0.0084 203  GLN A N    
3034 C CA   . GLN A 203 ? 0.1397 0.1898 0.1654 0.0027  0.0047  -0.0208 203  GLN A CA   
3035 C C    . GLN A 203 ? 0.1148 0.1946 0.1820 0.0123  0.0121  -0.0372 203  GLN A C    
3036 O O    . GLN A 203 ? 0.2219 0.2911 0.2736 -0.0758 0.1094  -0.1248 203  GLN A O    
3037 C CB   . GLN A 203 ? 0.1872 0.2133 0.1604 0.0062  -0.0026 0.0042  203  GLN A CB   
3038 C CG   A GLN A 203 ? 0.2471 0.2184 0.2064 -0.0225 0.0033  0.0156  203  GLN A CG   
3039 C CG   B GLN A 203 ? 0.1802 0.3009 0.2600 0.0015  0.0023  0.0994  203  GLN A CG   
3040 C CD   A GLN A 203 ? 0.2041 0.2369 0.3083 -0.0426 0.0384  0.0270  203  GLN A CD   
3041 C CD   B GLN A 203 ? 0.4331 0.4018 0.3241 -0.0917 0.0102  0.1867  203  GLN A CD   
3042 O OE1  A GLN A 203 ? 0.2153 0.4063 0.6337 0.0579  -0.1207 -0.0358 203  GLN A OE1  
3043 O OE1  B GLN A 203 ? 0.8183 0.2944 0.3844 0.0889  0.1971  0.1172  203  GLN A OE1  
3044 N NE2  A GLN A 203 ? 0.2560 0.3495 0.2629 -0.0337 0.1114  -0.0197 203  GLN A NE2  
3045 N NE2  B GLN A 203 ? 0.5199 0.5960 0.3133 -0.1768 -0.0551 0.2474  203  GLN A NE2  
3046 H H    . GLN A 203 ? 0.1759 0.1759 0.1759 0.0000  0.0000  0.0000  203  GLN A H    
3047 H HA   . GLN A 203 ? 0.1980 0.1980 0.1980 0.0000  0.0000  0.0000  203  GLN A HA   
3048 H HB2  . GLN A 203 ? 0.2243 0.2243 0.2243 0.0000  0.0000  0.0000  203  GLN A HB2  
3049 H HB3  . GLN A 203 ? 0.2243 0.2243 0.2243 0.0000  0.0000  0.0000  203  GLN A HB3  
3050 H HG2  A GLN A 203 ? 0.2688 0.2688 0.2688 0.0000  0.0000  0.0000  203  GLN A HG2  
3051 H HG2  B GLN A 203 ? 0.2965 0.2965 0.2965 0.0000  0.0000  0.0000  203  GLN A HG2  
3052 H HG3  A GLN A 203 ? 0.2688 0.2688 0.2688 0.0000  0.0000  0.0000  203  GLN A HG3  
3053 H HG3  B GLN A 203 ? 0.2965 0.2965 0.2965 0.0000  0.0000  0.0000  203  GLN A HG3  
3054 H HE21 A GLN A 203 ? 0.3474 0.3474 0.3474 0.0000  0.0000  0.0000  203  GLN A HE21 
3055 H HE21 B GLN A 203 ? 0.5717 0.5717 0.5717 0.0000  0.0000  0.0000  203  GLN A HE21 
3056 H HE22 A GLN A 203 ? 0.3474 0.3474 0.3474 0.0000  0.0000  0.0000  203  GLN A HE22 
3057 H HE22 B GLN A 203 ? 0.5717 0.5717 0.5717 0.0000  0.0000  0.0000  203  GLN A HE22 
3058 N N    . SER A 204 ? 0.1244 0.2130 0.1877 -0.0027 0.0081  -0.0545 204  SER A N    
3059 C CA   . SER A 204 ? 0.1240 0.1974 0.1757 0.0066  -0.0034 -0.0347 204  SER A CA   
3060 C C    . SER A 204 ? 0.1300 0.2243 0.1680 -0.0142 0.0104  -0.0417 204  SER A C    
3061 O O    . SER A 204 ? 0.1676 0.3828 0.1683 -0.0768 0.0202  -0.0527 204  SER A O    
3062 C CB   . SER A 204 ? 0.1419 0.2017 0.1975 0.0128  -0.0041 -0.0369 204  SER A CB   
3063 O OG   . SER A 204 ? 0.1653 0.2234 0.2131 0.0262  -0.0276 -0.0059 204  SER A OG   
3064 H H    . SER A 204 ? 0.2100 0.2100 0.2100 0.0000  0.0000  0.0000  204  SER A H    
3065 H HA   . SER A 204 ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  204  SER A HA   
3066 H HB2  . SER A 204 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  204  SER A HB2  
3067 H HB3  . SER A 204 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  204  SER A HB3  
3068 H HG   . SER A 204 ? 0.3009 0.3009 0.3009 0.0000  0.0000  0.0000  204  SER A HG   
3069 N N    . GLY A 205 ? 0.1184 0.1928 0.1606 0.0140  0.0015  -0.0361 205  GLY A N    
3070 C CA   . GLY A 205 ? 0.1171 0.2098 0.1550 0.0113  0.0018  -0.0345 205  GLY A CA   
3071 C C    . GLY A 205 ? 0.1066 0.2120 0.1631 0.0208  0.0111  -0.0447 205  GLY A C    
3072 O O    . GLY A 205 ? 0.1419 0.1868 0.1641 0.0039  0.0077  -0.0355 205  GLY A O    
3073 H H    . GLY A 205 ? 0.1887 0.1887 0.1887 0.0000  0.0000  0.0000  205  GLY A H    
3074 H HA2  . GLY A 205 ? 0.1928 0.1928 0.1928 0.0000  0.0000  0.0000  205  GLY A HA2  
3075 H HA3  . GLY A 205 ? 0.1928 0.1928 0.1928 0.0000  0.0000  0.0000  205  GLY A HA3  
3076 N N    . ASP A 206 ? 0.1221 0.2607 0.1633 0.0067  -0.0024 -0.0518 206  ASP A N    
3077 C CA   . ASP A 206 ? 0.1239 0.2496 0.2007 0.0144  -0.0024 -0.0788 206  ASP A CA   
3078 C C    . ASP A 206 ? 0.1248 0.2031 0.1542 0.0179  -0.0055 -0.0193 206  ASP A C    
3079 O O    . ASP A 206 ? 0.1453 0.1945 0.1778 0.0077  -0.0021 -0.0356 206  ASP A O    
3080 C CB   . ASP A 206 ? 0.1894 0.4900 0.2007 -0.0778 0.0138  -0.1400 206  ASP A CB   
3081 C CG   . ASP A 206 ? 0.2379 0.7007 0.2591 -0.0152 0.0173  -0.2379 206  ASP A CG   
3082 O OD1  . ASP A 206 ? 0.4220 0.8540 0.5932 0.2221  -0.1761 -0.3654 206  ASP A OD1  
3083 O OD2  . ASP A 206 ? 0.7993 0.7712 0.3226 -0.0363 0.2716  -0.1897 206  ASP A OD2  
3084 H H    . ASP A 206 ? 0.2185 0.2185 0.2185 0.0000  0.0000  0.0000  206  ASP A H    
3085 H HA   . ASP A 206 ? 0.2296 0.2296 0.2296 0.0000  0.0000  0.0000  206  ASP A HA   
3086 H HB2  . ASP A 206 ? 0.3521 0.3521 0.3521 0.0000  0.0000  0.0000  206  ASP A HB2  
3087 H HB3  . ASP A 206 ? 0.3521 0.3521 0.3521 0.0000  0.0000  0.0000  206  ASP A HB3  
3088 N N    . GLY A 207 ? 0.1328 0.1732 0.1831 0.0263  -0.0026 -0.0169 207  GLY A N    
3089 C CA   . GLY A 207 ? 0.1338 0.1926 0.1940 0.0422  0.0086  -0.0029 207  GLY A CA   
3090 C C    . GLY A 207 ? 0.1173 0.1639 0.1677 0.0085  0.0018  -0.0259 207  GLY A C    
3091 O O    . GLY A 207 ? 0.1209 0.1819 0.1589 0.0162  0.0087  -0.0208 207  GLY A O    
3092 H H    . GLY A 207 ? 0.1957 0.1957 0.1957 0.0000  0.0000  0.0000  207  GLY A H    
3093 H HA2  . GLY A 207 ? 0.2082 0.2082 0.2082 0.0000  0.0000  0.0000  207  GLY A HA2  
3094 H HA3  . GLY A 207 ? 0.2082 0.2082 0.2082 0.0000  0.0000  0.0000  207  GLY A HA3  
3095 N N    . PHE A 208 ? 0.1233 0.1487 0.1573 0.0141  -0.0008 -0.0104 208  PHE A N    
3096 C CA   . PHE A 208 ? 0.1249 0.1326 0.1408 0.0167  0.0044  -0.0125 208  PHE A CA   
3097 C C    . PHE A 208 ? 0.1316 0.1196 0.1419 0.0149  -0.0049 -0.0045 208  PHE A C    
3098 O O    . PHE A 208 ? 0.1195 0.1719 0.1849 0.0186  0.0027  0.0325  208  PHE A O    
3099 C CB   . PHE A 208 ? 0.1282 0.1469 0.1357 0.0061  0.0126  -0.0107 208  PHE A CB   
3100 C CG   . PHE A 208 ? 0.1133 0.1340 0.1445 0.0132  0.0038  -0.0073 208  PHE A CG   
3101 C CD1  . PHE A 208 ? 0.1182 0.1494 0.1341 0.0194  -0.0045 -0.0115 208  PHE A CD1  
3102 C CD2  . PHE A 208 ? 0.1159 0.1571 0.1727 0.0164  -0.0011 -0.0197 208  PHE A CD2  
3103 C CE1  . PHE A 208 ? 0.1285 0.1445 0.1456 0.0193  -0.0098 -0.0130 208  PHE A CE1  
3104 C CE2  . PHE A 208 ? 0.1278 0.1696 0.1807 0.0311  -0.0148 -0.0187 208  PHE A CE2  
3105 C CZ   . PHE A 208 ? 0.1338 0.1507 0.1452 0.0152  -0.0245 -0.0031 208  PHE A CZ   
3106 H H    . PHE A 208 ? 0.1717 0.1717 0.1717 0.0000  0.0000  0.0000  208  PHE A H    
3107 H HA   . PHE A 208 ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  208  PHE A HA   
3108 H HB2  . PHE A 208 ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  208  PHE A HB2  
3109 H HB3  . PHE A 208 ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  208  PHE A HB3  
3110 H HD1  . PHE A 208 ? 0.1607 0.1607 0.1607 0.0000  0.0000  0.0000  208  PHE A HD1  
3111 H HD2  . PHE A 208 ? 0.1783 0.1783 0.1783 0.0000  0.0000  0.0000  208  PHE A HD2  
3112 H HE1  . PHE A 208 ? 0.1674 0.1674 0.1674 0.0000  0.0000  0.0000  208  PHE A HE1  
3113 H HE2  . PHE A 208 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  208  PHE A HE2  
3114 H HZ   . PHE A 208 ? 0.1719 0.1719 0.1719 0.0000  0.0000  0.0000  208  PHE A HZ   
3115 N N    . SER A 209 ? 0.1214 0.1319 0.1250 0.0184  0.0107  -0.0088 209  SER A N    
3116 C CA   . SER A 209 ? 0.1308 0.1240 0.1250 0.0209  0.0056  -0.0144 209  SER A CA   
3117 C C    . SER A 209 ? 0.1089 0.1218 0.1089 0.0174  -0.0096 -0.0048 209  SER A C    
3118 O O    . SER A 209 ? 0.1097 0.1171 0.1178 0.0133  0.0017  -0.0045 209  SER A O    
3119 C CB   . SER A 209 ? 0.1381 0.1405 0.1440 -0.0040 0.0127  -0.0324 209  SER A CB   
3120 O OG   . SER A 209 ? 0.1510 0.2081 0.1439 0.0128  -0.0160 -0.0104 209  SER A OG   
3121 H H    . SER A 209 ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  209  SER A H    
3122 H HA   . SER A 209 ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  209  SER A HA   
3123 H HB2  . SER A 209 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  209  SER A HB2  
3124 H HB3  . SER A 209 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  209  SER A HB3  
3125 H HG   . SER A 209 ? 0.2515 0.2515 0.2515 0.0000  0.0000  0.0000  209  SER A HG   
3126 N N    . GLY A 210 ? 0.1290 0.1173 0.1091 0.0103  0.0066  -0.0099 210  GLY A N    
3127 C CA   . GLY A 210 ? 0.1185 0.1217 0.1288 0.0121  0.0151  -0.0112 210  GLY A CA   
3128 C C    . GLY A 210 ? 0.0940 0.1198 0.1143 0.0002  -0.0045 -0.0117 210  GLY A C    
3129 O O    . GLY A 210 ? 0.1235 0.1079 0.1452 0.0081  0.0186  -0.0029 210  GLY A O    
3130 H H    . GLY A 210 ? 0.1421 0.1421 0.1421 0.0000  0.0000  0.0000  210  GLY A H    
3131 H HA2  . GLY A 210 ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  210  GLY A HA2  
3132 H HA3  . GLY A 210 ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  210  GLY A HA3  
3133 N N    . ILE A 211 ? 0.0931 0.1119 0.1187 -0.0039 0.0035  -0.0132 211  ILE A N    
3134 C CA   . ILE A 211 ? 0.0981 0.1177 0.1120 0.0030  -0.0020 -0.0040 211  ILE A CA   
3135 C C    . ILE A 211 ? 0.0920 0.1102 0.1168 0.0069  -0.0022 -0.0018 211  ILE A C    
3136 O O    . ILE A 211 ? 0.1199 0.1159 0.1166 -0.0124 -0.0056 -0.0036 211  ILE A O    
3137 C CB   . ILE A 211 ? 0.1050 0.1211 0.1144 0.0076  0.0004  -0.0028 211  ILE A CB   
3138 C CG1  . ILE A 211 ? 0.1106 0.1224 0.1201 0.0093  -0.0051 -0.0117 211  ILE A CG1  
3139 C CG2  . ILE A 211 ? 0.1198 0.1245 0.1200 0.0049  -0.0096 -0.0075 211  ILE A CG2  
3140 C CD1  . ILE A 211 ? 0.1182 0.1278 0.1461 0.0133  -0.0086 -0.0059 211  ILE A CD1  
3141 H H    . ILE A 211 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  211  ILE A H    
3142 H HA   . ILE A 211 ? 0.1311 0.1311 0.1311 0.0000  0.0000  0.0000  211  ILE A HA   
3143 H HB   . ILE A 211 ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  211  ILE A HB   
3144 H HG12 . ILE A 211 ? 0.1412 0.1412 0.1412 0.0000  0.0000  0.0000  211  ILE A HG12 
3145 H HG13 . ILE A 211 ? 0.1412 0.1412 0.1412 0.0000  0.0000  0.0000  211  ILE A HG13 
3146 H HG21 . ILE A 211 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  211  ILE A HG21 
3147 H HG22 . ILE A 211 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  211  ILE A HG22 
3148 H HG23 . ILE A 211 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  211  ILE A HG23 
3149 H HD11 . ILE A 211 ? 0.1961 0.1961 0.1961 0.0000  0.0000  0.0000  211  ILE A HD11 
3150 H HD12 . ILE A 211 ? 0.1961 0.1961 0.1961 0.0000  0.0000  0.0000  211  ILE A HD12 
3151 H HD13 . ILE A 211 ? 0.1961 0.1961 0.1961 0.0000  0.0000  0.0000  211  ILE A HD13 
3152 N N    . ALA A 212 ? 0.1003 0.1096 0.1103 0.0013  -0.0005 -0.0066 212  ALA A N    
3153 C CA   . ALA A 212 ? 0.1080 0.1088 0.1104 -0.0006 -0.0039 -0.0036 212  ALA A CA   
3154 C C    . ALA A 212 ? 0.1105 0.1119 0.1063 -0.0020 -0.0041 -0.0020 212  ALA A C    
3155 O O    . ALA A 212 ? 0.1111 0.1114 0.1353 -0.0001 0.0019  -0.0148 212  ALA A O    
3156 C CB   . ALA A 212 ? 0.1325 0.1146 0.1207 0.0051  -0.0034 0.0103  212  ALA A CB   
3157 H H    . ALA A 212 ? 0.1280 0.1280 0.1280 0.0000  0.0000  0.0000  212  ALA A H    
3158 H HA   . ALA A 212 ? 0.1308 0.1308 0.1308 0.0000  0.0000  0.0000  212  ALA A HA   
3159 H HB1  . ALA A 212 ? 0.1839 0.1839 0.1839 0.0000  0.0000  0.0000  212  ALA A HB1  
3160 H HB2  . ALA A 212 ? 0.1839 0.1839 0.1839 0.0000  0.0000  0.0000  212  ALA A HB2  
3161 H HB3  . ALA A 212 ? 0.1839 0.1839 0.1839 0.0000  0.0000  0.0000  212  ALA A HB3  
3162 N N    . ASP A 213 ? 0.1083 0.1080 0.1158 0.0048  -0.0050 -0.0053 213  ASP A N    
3163 C CA   . ASP A 213 ? 0.0888 0.1119 0.1143 0.0001  0.0061  -0.0083 213  ASP A CA   
3164 C C    . ASP A 213 ? 0.0955 0.1132 0.1094 0.0044  0.0003  -0.0019 213  ASP A C    
3165 O O    . ASP A 213 ? 0.0979 0.1105 0.1273 -0.0014 0.0028  -0.0019 213  ASP A O    
3166 C CB   . ASP A 213 ? 0.1155 0.1166 0.1181 0.0037  -0.0054 -0.0031 213  ASP A CB   
3167 C CG   . ASP A 213 ? 0.1115 0.1266 0.1138 0.0055  -0.0100 -0.0059 213  ASP A CG   
3168 O OD1  . ASP A 213 ? 0.1140 0.1197 0.1296 0.0072  -0.0153 -0.0110 213  ASP A OD1  
3169 O OD2  . ASP A 213 ? 0.1509 0.1317 0.1155 0.0057  -0.0150 0.0034  213  ASP A OD2  
3170 H H    . ASP A 213 ? 0.1329 0.1329 0.1329 0.0000  0.0000  0.0000  213  ASP A H    
3171 H HA   . ASP A 213 ? 0.1260 0.1260 0.1260 0.0000  0.0000  0.0000  213  ASP A HA   
3172 H HB2  . ASP A 213 ? 0.1401 0.1401 0.1401 0.0000  0.0000  0.0000  213  ASP A HB2  
3173 H HB3  . ASP A 213 ? 0.1401 0.1401 0.1401 0.0000  0.0000  0.0000  213  ASP A HB3  
3174 N N    . THR A 214 ? 0.1025 0.1063 0.1100 0.0047  -0.0024 -0.0039 214  THR A N    
3175 C CA   . THR A 214 ? 0.0936 0.1131 0.1146 0.0054  -0.0110 -0.0110 214  THR A CA   
3176 C C    . THR A 214 ? 0.1020 0.1080 0.1079 -0.0019 -0.0042 -0.0066 214  THR A C    
3177 O O    . THR A 214 ? 0.1114 0.1142 0.1237 0.0113  -0.0125 -0.0101 214  THR A O    
3178 C CB   . THR A 214 ? 0.1087 0.1167 0.1102 0.0036  -0.0071 -0.0025 214  THR A CB   
3179 O OG1  . THR A 214 ? 0.0975 0.1188 0.1180 0.0105  -0.0091 -0.0044 214  THR A OG1  
3180 C CG2  . THR A 214 ? 0.1169 0.1261 0.1157 0.0161  -0.0055 0.0079  214  THR A CG2  
3181 H H    . THR A 214 ? 0.1275 0.1275 0.1275 0.0000  0.0000  0.0000  214  THR A H    
3182 H HA   . THR A 214 ? 0.1286 0.1286 0.1286 0.0000  0.0000  0.0000  214  THR A HA   
3183 H HB   . THR A 214 ? 0.1343 0.1343 0.1343 0.0000  0.0000  0.0000  214  THR A HB   
3184 H HG1  . THR A 214 ? 0.1672 0.1672 0.1672 0.0000  0.0000  0.0000  214  THR A HG1  
3185 H HG21 . THR A 214 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  214  THR A HG21 
3186 H HG22 . THR A 214 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  214  THR A HG22 
3187 H HG23 . THR A 214 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  214  THR A HG23 
3188 N N    . GLY A 215 ? 0.0926 0.1096 0.1211 0.0024  -0.0105 -0.0042 215  GLY A N    
3189 C CA   . GLY A 215 ? 0.1007 0.1160 0.1166 0.0108  -0.0040 -0.0005 215  GLY A CA   
3190 C C    . GLY A 215 ? 0.0976 0.1070 0.1109 0.0014  -0.0106 -0.0047 215  GLY A C    
3191 O O    . GLY A 215 ? 0.1052 0.1113 0.1267 0.0077  -0.0097 0.0008  215  GLY A O    
3192 H H    . GLY A 215 ? 0.1293 0.1293 0.1293 0.0000  0.0000  0.0000  215  GLY A H    
3193 H HA2  . GLY A 215 ? 0.1334 0.1334 0.1334 0.0000  0.0000  0.0000  215  GLY A HA2  
3194 H HA3  . GLY A 215 ? 0.1334 0.1334 0.1334 0.0000  0.0000  0.0000  215  GLY A HA3  
3195 N N    . THR A 216 ? 0.0980 0.1049 0.1125 0.0057  -0.0093 0.0002  216  THR A N    
3196 C CA   . THR A 216 ? 0.0984 0.1026 0.1124 0.0021  -0.0058 0.0041  216  THR A CA   
3197 C C    . THR A 216 ? 0.0955 0.1048 0.1089 0.0006  -0.0025 -0.0005 216  THR A C    
3198 O O    . THR A 216 ? 0.1015 0.1062 0.1138 0.0030  -0.0105 0.0036  216  THR A O    
3199 C CB   . THR A 216 ? 0.0991 0.1117 0.1142 0.0067  -0.0107 0.0005  216  THR A CB   
3200 O OG1  . THR A 216 ? 0.1159 0.1340 0.1076 -0.0006 -0.0130 0.0031  216  THR A OG1  
3201 C CG2  . THR A 216 ? 0.1025 0.1467 0.1189 0.0114  -0.0031 -0.0056 216  THR A CG2  
3202 H H    . THR A 216 ? 0.1261 0.1261 0.1261 0.0000  0.0000  0.0000  216  THR A H    
3203 H HA   . THR A 216 ? 0.1254 0.1254 0.1254 0.0000  0.0000  0.0000  216  THR A HA   
3204 H HB   . THR A 216 ? 0.1299 0.1299 0.1299 0.0000  0.0000  0.0000  216  THR A HB   
3205 H HG1  . THR A 216 ? 0.1787 0.1787 0.1787 0.0000  0.0000  0.0000  216  THR A HG1  
3206 H HG21 . THR A 216 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  216  THR A HG21 
3207 H HG22 . THR A 216 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  216  THR A HG22 
3208 H HG23 . THR A 216 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  216  THR A HG23 
3209 N N    . THR A 217 ? 0.0912 0.1050 0.1106 0.0033  -0.0081 -0.0016 217  THR A N    
3210 C CA   . THR A 217 ? 0.0909 0.1121 0.1115 0.0045  -0.0063 -0.0031 217  THR A CA   
3211 C C    . THR A 217 ? 0.0884 0.1079 0.1192 0.0043  -0.0110 -0.0041 217  THR A C    
3212 O O    . THR A 217 ? 0.0998 0.1098 0.1185 0.0040  -0.0115 0.0016  217  THR A O    
3213 C CB   . THR A 217 ? 0.1051 0.1090 0.1202 -0.0004 -0.0093 -0.0013 217  THR A CB   
3214 O OG1  . THR A 217 ? 0.1101 0.1063 0.1279 0.0099  -0.0150 -0.0067 217  THR A OG1  
3215 C CG2  . THR A 217 ? 0.1153 0.1160 0.1502 0.0058  -0.0228 -0.0093 217  THR A CG2  
3216 H H    . THR A 217 ? 0.1227 0.1227 0.1227 0.0000  0.0000  0.0000  217  THR A H    
3217 H HA   . THR A 217 ? 0.1258 0.1258 0.1258 0.0000  0.0000  0.0000  217  THR A HA   
3218 H HB   . THR A 217 ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  217  THR A HB   
3219 H HG1  . THR A 217 ? 0.1721 0.1721 0.1721 0.0000  0.0000  0.0000  217  THR A HG1  
3220 H HG21 . THR A 217 ? 0.1907 0.1907 0.1907 0.0000  0.0000  0.0000  217  THR A HG21 
3221 H HG22 . THR A 217 ? 0.1907 0.1907 0.1907 0.0000  0.0000  0.0000  217  THR A HG22 
3222 H HG23 . THR A 217 ? 0.1907 0.1907 0.1907 0.0000  0.0000  0.0000  217  THR A HG23 
3223 N N    . LEU A 218 ? 0.0922 0.1083 0.1159 0.0027  -0.0094 0.0002  218  LEU A N    
3224 C CA   . LEU A 218 ? 0.0915 0.1076 0.1236 0.0032  -0.0084 -0.0047 218  LEU A CA   
3225 C C    . LEU A 218 ? 0.0933 0.1149 0.1182 0.0088  -0.0055 0.0056  218  LEU A C    
3226 O O    . LEU A 218 ? 0.0945 0.1237 0.1426 0.0017  -0.0077 -0.0103 218  LEU A O    
3227 C CB   . LEU A 218 ? 0.1122 0.1163 0.1426 0.0019  0.0067  0.0061  218  LEU A CB   
3228 C CG   . LEU A 218 ? 0.1112 0.1178 0.1561 0.0003  0.0113  0.0107  218  LEU A CG   
3229 C CD1  . LEU A 218 ? 0.1763 0.1284 0.2153 -0.0016 0.0511  0.0243  218  LEU A CD1  
3230 C CD2  . LEU A 218 ? 0.1289 0.1185 0.1991 0.0077  -0.0337 -0.0207 218  LEU A CD2  
3231 H H    . LEU A 218 ? 0.1265 0.1265 0.1265 0.0000  0.0000  0.0000  218  LEU A H    
3232 H HA   . LEU A 218 ? 0.1291 0.1291 0.1291 0.0000  0.0000  0.0000  218  LEU A HA   
3233 H HB2  . LEU A 218 ? 0.1484 0.1484 0.1484 0.0000  0.0000  0.0000  218  LEU A HB2  
3234 H HB3  . LEU A 218 ? 0.1484 0.1484 0.1484 0.0000  0.0000  0.0000  218  LEU A HB3  
3235 H HG   . LEU A 218 ? 0.1540 0.1540 0.1540 0.0000  0.0000  0.0000  218  LEU A HG   
3236 H HD11 . LEU A 218 ? 0.2600 0.2600 0.2600 0.0000  0.0000  0.0000  218  LEU A HD11 
3237 H HD12 . LEU A 218 ? 0.2600 0.2600 0.2600 0.0000  0.0000  0.0000  218  LEU A HD12 
3238 H HD13 . LEU A 218 ? 0.2600 0.2600 0.2600 0.0000  0.0000  0.0000  218  LEU A HD13 
3239 H HD21 . LEU A 218 ? 0.2233 0.2233 0.2233 0.0000  0.0000  0.0000  218  LEU A HD21 
3240 H HD22 . LEU A 218 ? 0.2233 0.2233 0.2233 0.0000  0.0000  0.0000  218  LEU A HD22 
3241 H HD23 . LEU A 218 ? 0.2233 0.2233 0.2233 0.0000  0.0000  0.0000  218  LEU A HD23 
3242 N N    . LEU A 219 ? 0.0928 0.1060 0.1202 -0.0038 -0.0081 -0.0025 219  LEU A N    
3243 C CA   . LEU A 219 ? 0.0964 0.1101 0.1156 0.0002  0.0021  -0.0011 219  LEU A CA   
3244 C C    . LEU A 219 ? 0.0997 0.1058 0.1207 0.0007  -0.0011 0.0059  219  LEU A C    
3245 O O    . LEU A 219 ? 0.1080 0.1203 0.1198 -0.0086 -0.0054 0.0102  219  LEU A O    
3246 C CB   . LEU A 219 ? 0.1001 0.1164 0.1134 0.0024  -0.0045 0.0045  219  LEU A CB   
3247 C CG   . LEU A 219 ? 0.1011 0.1222 0.1212 0.0077  0.0006  0.0019  219  LEU A CG   
3248 C CD1  . LEU A 219 ? 0.1201 0.1122 0.1260 0.0029  -0.0056 0.0016  219  LEU A CD1  
3249 C CD2  . LEU A 219 ? 0.1048 0.1235 0.1527 0.0155  -0.0027 0.0077  219  LEU A CD2  
3250 H H    . LEU A 219 ? 0.1277 0.1277 0.1277 0.0000  0.0000  0.0000  219  LEU A H    
3251 H HA   . LEU A 219 ? 0.1288 0.1288 0.1288 0.0000  0.0000  0.0000  219  LEU A HA   
3252 H HB2  . LEU A 219 ? 0.1320 0.1320 0.1320 0.0000  0.0000  0.0000  219  LEU A HB2  
3253 H HB3  . LEU A 219 ? 0.1320 0.1320 0.1320 0.0000  0.0000  0.0000  219  LEU A HB3  
3254 H HG   . LEU A 219 ? 0.1378 0.1378 0.1378 0.0000  0.0000  0.0000  219  LEU A HG   
3255 H HD11 . LEU A 219 ? 0.1792 0.1792 0.1792 0.0000  0.0000  0.0000  219  LEU A HD11 
3256 H HD12 . LEU A 219 ? 0.1792 0.1792 0.1792 0.0000  0.0000  0.0000  219  LEU A HD12 
3257 H HD13 . LEU A 219 ? 0.1792 0.1792 0.1792 0.0000  0.0000  0.0000  219  LEU A HD13 
3258 H HD21 . LEU A 219 ? 0.1905 0.1905 0.1905 0.0000  0.0000  0.0000  219  LEU A HD21 
3259 H HD22 . LEU A 219 ? 0.1905 0.1905 0.1905 0.0000  0.0000  0.0000  219  LEU A HD22 
3260 H HD23 . LEU A 219 ? 0.1905 0.1905 0.1905 0.0000  0.0000  0.0000  219  LEU A HD23 
3261 N N    . LEU A 220 ? 0.0960 0.1110 0.1098 -0.0030 0.0007  0.0010  220  LEU A N    
3262 C CA   . LEU A 220 ? 0.1061 0.1141 0.1081 -0.0058 0.0060  0.0039  220  LEU A CA   
3263 C C    . LEU A 220 ? 0.1065 0.1243 0.1105 0.0008  0.0003  0.0087  220  LEU A C    
3264 O O    . LEU A 220 ? 0.1122 0.1253 0.1294 -0.0116 0.0122  -0.0128 220  LEU A O    
3265 C CB   . LEU A 220 ? 0.1102 0.1123 0.1206 -0.0038 -0.0057 0.0151  220  LEU A CB   
3266 C CG   . LEU A 220 ? 0.1104 0.1202 0.1255 -0.0029 0.0021  0.0097  220  LEU A CG   
3267 C CD1  . LEU A 220 ? 0.1108 0.1363 0.1564 0.0093  -0.0092 0.0004  220  LEU A CD1  
3268 C CD2  . LEU A 220 ? 0.1099 0.1184 0.1322 0.0010  0.0005  -0.0034 220  LEU A CD2  
3269 H H    . LEU A 220 ? 0.1268 0.1268 0.1268 0.0000  0.0000  0.0000  220  LEU A H    
3270 H HA   . LEU A 220 ? 0.1313 0.1313 0.1313 0.0000  0.0000  0.0000  220  LEU A HA   
3271 H HB2  . LEU A 220 ? 0.1373 0.1373 0.1373 0.0000  0.0000  0.0000  220  LEU A HB2  
3272 H HB3  . LEU A 220 ? 0.1373 0.1373 0.1373 0.0000  0.0000  0.0000  220  LEU A HB3  
3273 H HG   . LEU A 220 ? 0.1425 0.1425 0.1425 0.0000  0.0000  0.0000  220  LEU A HG   
3274 H HD11 . LEU A 220 ? 0.2018 0.2018 0.2018 0.0000  0.0000  0.0000  220  LEU A HD11 
3275 H HD12 . LEU A 220 ? 0.2018 0.2018 0.2018 0.0000  0.0000  0.0000  220  LEU A HD12 
3276 H HD13 . LEU A 220 ? 0.2018 0.2018 0.2018 0.0000  0.0000  0.0000  220  LEU A HD13 
3277 H HD21 . LEU A 220 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  220  LEU A HD21 
3278 H HD22 . LEU A 220 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  220  LEU A HD22 
3279 H HD23 . LEU A 220 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  220  LEU A HD23 
3280 N N    . LEU A 221 ? 0.1082 0.1239 0.1242 0.0022  0.0066  0.0026  221  LEU A N    
3281 C CA   . LEU A 221 ? 0.1058 0.1355 0.1264 0.0112  0.0066  -0.0008 221  LEU A CA   
3282 C C    . LEU A 221 ? 0.1199 0.1414 0.1184 -0.0012 -0.0037 0.0011  221  LEU A C    
3283 O O    . LEU A 221 ? 0.1264 0.1440 0.1299 0.0102  0.0040  0.0091  221  LEU A O    
3284 C CB   . LEU A 221 ? 0.1088 0.1401 0.1326 0.0017  0.0051  -0.0058 221  LEU A CB   
3285 C CG   . LEU A 221 ? 0.1189 0.1496 0.1272 0.0179  -0.0034 0.0028  221  LEU A CG   
3286 C CD1  . LEU A 221 ? 0.1319 0.1428 0.1685 0.0095  -0.0304 0.0048  221  LEU A CD1  
3287 C CD2  . LEU A 221 ? 0.1277 0.2231 0.1801 -0.0328 -0.0302 0.0581  221  LEU A CD2  
3288 H H    . LEU A 221 ? 0.1425 0.1425 0.1425 0.0000  0.0000  0.0000  221  LEU A H    
3289 H HA   . LEU A 221 ? 0.1470 0.1470 0.1470 0.0000  0.0000  0.0000  221  LEU A HA   
3290 H HB2  . LEU A 221 ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  221  LEU A HB2  
3291 H HB3  . LEU A 221 ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  221  LEU A HB3  
3292 H HG   . LEU A 221 ? 0.1583 0.1583 0.1583 0.0000  0.0000  0.0000  221  LEU A HG   
3293 H HD11 . LEU A 221 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  221  LEU A HD11 
3294 H HD12 . LEU A 221 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  221  LEU A HD12 
3295 H HD13 . LEU A 221 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  221  LEU A HD13 
3296 H HD21 . LEU A 221 ? 0.2655 0.2655 0.2655 0.0000  0.0000  0.0000  221  LEU A HD21 
3297 H HD22 . LEU A 221 ? 0.2655 0.2655 0.2655 0.0000  0.0000  0.0000  221  LEU A HD22 
3298 H HD23 . LEU A 221 ? 0.2655 0.2655 0.2655 0.0000  0.0000  0.0000  221  LEU A HD23 
3299 N N    . ASP A 222 ? 0.1311 0.1363 0.1243 0.0132  0.0080  0.0050  222  ASP A N    
3300 C CA   . ASP A 222 ? 0.1214 0.1774 0.1096 0.0106  0.0062  -0.0003 222  ASP A CA   
3301 C C    . ASP A 222 ? 0.1168 0.1753 0.1168 0.0133  0.0010  0.0075  222  ASP A C    
3302 O O    . ASP A 222 ? 0.1204 0.1632 0.1205 0.0067  0.0057  0.0074  222  ASP A O    
3303 C CB   . ASP A 222 ? 0.1259 0.1807 0.1263 0.0135  0.0064  0.0009  222  ASP A CB   
3304 C CG   . ASP A 222 ? 0.1458 0.1914 0.1654 0.0133  -0.0042 -0.0284 222  ASP A CG   
3305 O OD1  . ASP A 222 ? 0.1373 0.2326 0.1806 0.0112  -0.0154 -0.0232 222  ASP A OD1  
3306 O OD2  . ASP A 222 ? 0.1974 0.1941 0.1655 0.0117  -0.0051 -0.0245 222  ASP A OD2  
3307 H H    . ASP A 222 ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  222  ASP A H    
3308 H HA   . ASP A 222 ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  222  ASP A HA   
3309 H HB2  . ASP A 222 ? 0.1731 0.1731 0.1731 0.0000  0.0000  0.0000  222  ASP A HB2  
3310 H HB3  . ASP A 222 ? 0.1731 0.1731 0.1731 0.0000  0.0000  0.0000  222  ASP A HB3  
3311 N N    . ASP A 223 ? 0.1284 0.1753 0.1295 0.0100  0.0003  0.0143  223  ASP A N    
3312 C CA   . ASP A 223 ? 0.1227 0.1854 0.1430 0.0067  0.0045  0.0221  223  ASP A CA   
3313 C C    . ASP A 223 ? 0.1275 0.1920 0.1326 0.0004  0.0033  0.0256  223  ASP A C    
3314 O O    . ASP A 223 ? 0.1316 0.2030 0.1397 -0.0061 -0.0016 0.0264  223  ASP A O    
3315 C CB   . ASP A 223 ? 0.1516 0.1967 0.1515 0.0093  0.0008  0.0385  223  ASP A CB   
3316 C CG   . ASP A 223 ? 0.1874 0.1991 0.1630 0.0319  -0.0170 0.0312  223  ASP A CG   
3317 O OD1  . ASP A 223 ? 0.2758 0.4029 0.1799 0.1728  0.0062  0.0319  223  ASP A OD1  
3318 O OD2  . ASP A 223 ? 0.2400 0.2721 0.1953 0.0576  -0.0235 0.0715  223  ASP A OD2  
3319 H H    . ASP A 223 ? 0.1733 0.1733 0.1733 0.0000  0.0000  0.0000  223  ASP A H    
3320 H HA   . ASP A 223 ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  223  ASP A HA   
3321 H HB2  . ASP A 223 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  223  ASP A HB2  
3322 H HB3  . ASP A 223 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  223  ASP A HB3  
3323 N N    . SER A 224 ? 0.1267 0.2077 0.1270 0.0110  0.0029  0.0111  224  SER A N    
3324 C CA   . SER A 224 ? 0.1406 0.2222 0.1372 0.0174  0.0094  0.0114  224  SER A CA   
3325 C C    . SER A 224 ? 0.1214 0.1939 0.1380 0.0105  0.0058  0.0034  224  SER A C    
3326 O O    . SER A 224 ? 0.1183 0.2278 0.1538 0.0132  0.0091  0.0167  224  SER A O    
3327 C CB   . SER A 224 ? 0.1752 0.2652 0.1527 0.0445  0.0130  -0.0299 224  SER A CB   
3328 O OG   . SER A 224 ? 0.2274 0.2512 0.2099 0.0029  0.0086  -0.0611 224  SER A OG   
3329 H H    . SER A 224 ? 0.1845 0.1845 0.1845 0.0000  0.0000  0.0000  224  SER A H    
3330 H HA   . SER A 224 ? 0.2000 0.2000 0.2000 0.0000  0.0000  0.0000  224  SER A HA   
3331 H HB2  . SER A 224 ? 0.2372 0.2372 0.2372 0.0000  0.0000  0.0000  224  SER A HB2  
3332 H HB3  . SER A 224 ? 0.2372 0.2372 0.2372 0.0000  0.0000  0.0000  224  SER A HB3  
3333 H HG   . SER A 224 ? 0.3442 0.3442 0.3442 0.0000  0.0000  0.0000  224  SER A HG   
3334 N N    . VAL A 225 ? 0.1167 0.1701 0.1369 0.0163  0.0039  -0.0025 225  VAL A N    
3335 C CA   . VAL A 225 ? 0.1173 0.1572 0.1435 0.0098  0.0040  0.0033  225  VAL A CA   
3336 C C    . VAL A 225 ? 0.0963 0.1609 0.1348 0.0097  0.0121  0.0090  225  VAL A C    
3337 O O    . VAL A 225 ? 0.1200 0.1542 0.1473 0.0054  -0.0055 0.0183  225  VAL A O    
3338 C CB   . VAL A 225 ? 0.1287 0.1530 0.1551 0.0089  0.0066  0.0040  225  VAL A CB   
3339 C CG1  . VAL A 225 ? 0.1649 0.1419 0.1660 0.0062  -0.0003 0.0220  225  VAL A CG1  
3340 C CG2  . VAL A 225 ? 0.1714 0.1405 0.1905 0.0123  -0.0154 0.0027  225  VAL A CG2  
3341 H H    . VAL A 225 ? 0.1695 0.1695 0.1695 0.0000  0.0000  0.0000  225  VAL A H    
3342 H HA   . VAL A 225 ? 0.1672 0.1672 0.1672 0.0000  0.0000  0.0000  225  VAL A HA   
3343 H HB   . VAL A 225 ? 0.1748 0.1748 0.1748 0.0000  0.0000  0.0000  225  VAL A HB   
3344 H HG11 . VAL A 225 ? 0.2365 0.2365 0.2365 0.0000  0.0000  0.0000  225  VAL A HG11 
3345 H HG12 . VAL A 225 ? 0.2365 0.2365 0.2365 0.0000  0.0000  0.0000  225  VAL A HG12 
3346 H HG13 . VAL A 225 ? 0.2365 0.2365 0.2365 0.0000  0.0000  0.0000  225  VAL A HG13 
3347 H HG21 . VAL A 225 ? 0.2511 0.2511 0.2511 0.0000  0.0000  0.0000  225  VAL A HG21 
3348 H HG22 . VAL A 225 ? 0.2511 0.2511 0.2511 0.0000  0.0000  0.0000  225  VAL A HG22 
3349 H HG23 . VAL A 225 ? 0.2511 0.2511 0.2511 0.0000  0.0000  0.0000  225  VAL A HG23 
3350 N N    . VAL A 226 ? 0.1112 0.1462 0.1369 0.0085  -0.0032 0.0077  226  VAL A N    
3351 C CA   . VAL A 226 ? 0.1229 0.1412 0.1452 -0.0024 -0.0006 0.0118  226  VAL A CA   
3352 C C    . VAL A 226 ? 0.1122 0.1555 0.1422 -0.0007 -0.0083 0.0168  226  VAL A C    
3353 O O    . VAL A 226 ? 0.1174 0.1439 0.1573 -0.0012 -0.0057 0.0205  226  VAL A O    
3354 C CB   . VAL A 226 ? 0.1186 0.1528 0.1398 0.0076  -0.0085 0.0039  226  VAL A CB   
3355 C CG1  . VAL A 226 ? 0.1363 0.1483 0.1768 0.0087  -0.0206 0.0026  226  VAL A CG1  
3356 C CG2  . VAL A 226 ? 0.1258 0.1591 0.1451 -0.0011 0.0016  0.0025  226  VAL A CG2  
3357 H H    . VAL A 226 ? 0.1577 0.1577 0.1577 0.0000  0.0000  0.0000  226  VAL A H    
3358 H HA   . VAL A 226 ? 0.1638 0.1638 0.1638 0.0000  0.0000  0.0000  226  VAL A HA   
3359 H HB   . VAL A 226 ? 0.1645 0.1645 0.1645 0.0000  0.0000  0.0000  226  VAL A HB   
3360 H HG11 . VAL A 226 ? 0.2308 0.2308 0.2308 0.0000  0.0000  0.0000  226  VAL A HG11 
3361 H HG12 . VAL A 226 ? 0.2308 0.2308 0.2308 0.0000  0.0000  0.0000  226  VAL A HG12 
3362 H HG13 . VAL A 226 ? 0.2308 0.2308 0.2308 0.0000  0.0000  0.0000  226  VAL A HG13 
3363 H HG21 . VAL A 226 ? 0.2151 0.2151 0.2151 0.0000  0.0000  0.0000  226  VAL A HG21 
3364 H HG22 . VAL A 226 ? 0.2151 0.2151 0.2151 0.0000  0.0000  0.0000  226  VAL A HG22 
3365 H HG23 . VAL A 226 ? 0.2151 0.2151 0.2151 0.0000  0.0000  0.0000  226  VAL A HG23 
3366 N N    . SER A 227 ? 0.1127 0.2021 0.1501 -0.0161 -0.0027 0.0314  227  SER A N    
3367 C CA   . SER A 227 ? 0.1198 0.2157 0.1727 -0.0165 0.0017  0.0492  227  SER A CA   
3368 C C    . SER A 227 ? 0.1098 0.2216 0.1444 -0.0151 0.0104  0.0313  227  SER A C    
3369 O O    . SER A 227 ? 0.1237 0.2249 0.1667 -0.0204 0.0014  0.0345  227  SER A O    
3370 C CB   A SER A 227 ? 0.1537 0.2729 0.1703 0.0175  0.0239  0.0824  227  SER A CB   
3371 C CB   B SER A 227 ? 0.1383 0.3268 0.1746 -0.0292 0.0090  0.1034  227  SER A CB   
3372 O OG   A SER A 227 ? 0.1845 0.3750 0.1950 -0.0787 0.0138  0.1104  227  SER A OG   
3373 O OG   B SER A 227 ? 0.1967 0.2734 0.1877 -0.0175 0.0030  0.0649  227  SER A OG   
3374 H H    . SER A 227 ? 0.1859 0.1859 0.1859 0.0000  0.0000  0.0000  227  SER A H    
3375 H HA   A SER A 227 ? 0.2033 0.2033 0.2033 0.0000  0.0000  0.0000  227  SER A HA   
3376 H HB2  A SER A 227 ? 0.2387 0.2387 0.2387 0.0000  0.0000  0.0000  227  SER A HB2  
3377 H HB2  B SER A 227 ? 0.2558 0.2558 0.2558 0.0000  0.0000  0.0000  227  SER A HB2  
3378 H HB3  A SER A 227 ? 0.2387 0.2387 0.2387 0.0000  0.0000  0.0000  227  SER A HB3  
3379 H HB3  B SER A 227 ? 0.2558 0.2558 0.2558 0.0000  0.0000  0.0000  227  SER A HB3  
3380 H HG   A SER A 227 ? 0.3773 0.3773 0.3773 0.0000  0.0000  0.0000  227  SER A HG   
3381 H HG   B SER A 227 ? 0.3289 0.3289 0.3289 0.0000  0.0000  0.0000  227  SER A HG   
3382 N N    . GLN A 228 ? 0.1301 0.2121 0.1459 -0.0116 0.0074  0.0197  228  GLN A N    
3383 C CA   . GLN A 228 ? 0.1138 0.2137 0.1598 -0.0057 0.0113  0.0076  228  GLN A CA   
3384 C C    . GLN A 228 ? 0.1093 0.1629 0.1575 0.0074  0.0047  0.0162  228  GLN A C    
3385 O O    . GLN A 228 ? 0.1111 0.1960 0.1654 0.0056  0.0091  0.0236  228  GLN A O    
3386 C CB   A GLN A 228 ? 0.1623 0.2143 0.2122 0.0182  -0.0336 -0.0311 228  GLN A CB   
3387 C CB   B GLN A 228 ? 0.1025 0.2077 0.1867 0.0069  0.0465  -0.0323 228  GLN A CB   
3388 C CG   A GLN A 228 ? 0.1904 0.2266 0.2296 0.0254  0.0139  0.0649  228  GLN A CG   
3389 C CG   B GLN A 228 ? 0.1164 0.1993 0.1496 0.0021  0.0223  0.0051  228  GLN A CG   
3390 C CD   A GLN A 228 ? 0.1800 0.2227 0.2092 0.0525  0.0211  0.0245  228  GLN A CD   
3391 C CD   B GLN A 228 ? 0.1261 0.1923 0.1893 0.0052  0.0089  -0.0170 228  GLN A CD   
3392 O OE1  A GLN A 228 ? 0.2083 0.2375 0.2822 0.0124  0.0414  0.0362  228  GLN A OE1  
3393 O OE1  B GLN A 228 ? 0.2731 0.1866 0.1916 -0.0232 0.0571  0.0106  228  GLN A OE1  
3394 N NE2  A GLN A 228 ? 0.2648 0.3131 0.2121 0.1312  0.0193  0.0082  228  GLN A NE2  
3395 N NE2  B GLN A 228 ? 0.3376 0.2583 0.2864 -0.0545 0.1267  -0.0961 228  GLN A NE2  
3396 H H    . GLN A 228 ? 0.1953 0.1953 0.1953 0.0000  0.0000  0.0000  228  GLN A H    
3397 H HA   A GLN A 228 ? 0.1949 0.1949 0.1949 0.0000  0.0000  0.0000  228  GLN A HA   
3398 H HB2  A GLN A 228 ? 0.2356 0.2356 0.2356 0.0000  0.0000  0.0000  228  GLN A HB2  
3399 H HB2  B GLN A 228 ? 0.1987 0.1987 0.1987 0.0000  0.0000  0.0000  228  GLN A HB2  
3400 H HB3  A GLN A 228 ? 0.2356 0.2356 0.2356 0.0000  0.0000  0.0000  228  GLN A HB3  
3401 H HB3  B GLN A 228 ? 0.1987 0.1987 0.1987 0.0000  0.0000  0.0000  228  GLN A HB3  
3402 H HG2  A GLN A 228 ? 0.2586 0.2586 0.2586 0.0000  0.0000  0.0000  228  GLN A HG2  
3403 H HG2  B GLN A 228 ? 0.1862 0.1862 0.1862 0.0000  0.0000  0.0000  228  GLN A HG2  
3404 H HG3  A GLN A 228 ? 0.2586 0.2586 0.2586 0.0000  0.0000  0.0000  228  GLN A HG3  
3405 H HG3  B GLN A 228 ? 0.1862 0.1862 0.1862 0.0000  0.0000  0.0000  228  GLN A HG3  
3406 H HE21 A GLN A 228 ? 0.3160 0.3160 0.3160 0.0000  0.0000  0.0000  228  GLN A HE21 
3407 H HE21 B GLN A 228 ? 0.3530 0.3530 0.3530 0.0000  0.0000  0.0000  228  GLN A HE21 
3408 H HE22 A GLN A 228 ? 0.3160 0.3160 0.3160 0.0000  0.0000  0.0000  228  GLN A HE22 
3409 H HE22 B GLN A 228 ? 0.3530 0.3530 0.3530 0.0000  0.0000  0.0000  228  GLN A HE22 
3410 N N    . TYR A 229 ? 0.1099 0.1530 0.1507 0.0002  0.0058  0.0170  229  TYR A N    
3411 C CA   . TYR A 229 ? 0.1145 0.1362 0.1458 -0.0015 -0.0037 0.0161  229  TYR A CA   
3412 C C    . TYR A 229 ? 0.0895 0.1406 0.1487 0.0043  0.0062  0.0199  229  TYR A C    
3413 O O    . TYR A 229 ? 0.1186 0.1387 0.1669 0.0007  -0.0095 0.0178  229  TYR A O    
3414 C CB   . TYR A 229 ? 0.1030 0.1340 0.1466 -0.0026 -0.0069 0.0143  229  TYR A CB   
3415 C CG   . TYR A 229 ? 0.1088 0.1258 0.1438 -0.0026 -0.0051 0.0155  229  TYR A CG   
3416 C CD1  . TYR A 229 ? 0.1206 0.1207 0.1442 -0.0006 -0.0070 0.0073  229  TYR A CD1  
3417 C CD2  . TYR A 229 ? 0.1235 0.1236 0.1464 0.0021  0.0001  0.0179  229  TYR A CD2  
3418 C CE1  . TYR A 229 ? 0.1319 0.1192 0.1537 0.0066  -0.0032 0.0151  229  TYR A CE1  
3419 C CE2  . TYR A 229 ? 0.1249 0.1206 0.1580 0.0088  -0.0095 0.0052  229  TYR A CE2  
3420 C CZ   . TYR A 229 ? 0.1287 0.1204 0.1473 0.0008  -0.0018 0.0056  229  TYR A CZ   
3421 O OH   . TYR A 229 ? 0.1471 0.1236 0.1545 0.0180  -0.0152 0.0091  229  TYR A OH   
3422 H H    . TYR A 229 ? 0.1654 0.1654 0.1654 0.0000  0.0000  0.0000  229  TYR A H    
3423 H HA   . TYR A 229 ? 0.1586 0.1586 0.1586 0.0000  0.0000  0.0000  229  TYR A HA   
3424 H HB2  . TYR A 229 ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  229  TYR A HB2  
3425 H HB3  . TYR A 229 ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  229  TYR A HB3  
3426 H HD1  . TYR A 229 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  229  TYR A HD1  
3427 H HD2  . TYR A 229 ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  229  TYR A HD2  
3428 H HE1  . TYR A 229 ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  229  TYR A HE1  
3429 H HE2  . TYR A 229 ? 0.1614 0.1614 0.1614 0.0000  0.0000  0.0000  229  TYR A HE2  
3430 H HH   . TYR A 229 ? 0.2126 0.2126 0.2126 0.0000  0.0000  0.0000  229  TYR A HH   
3431 N N    . TYR A 230 ? 0.1044 0.1353 0.1587 0.0033  0.0005  0.0230  230  TYR A N    
3432 C CA   . TYR A 230 ? 0.1074 0.1370 0.1769 0.0018  -0.0047 0.0168  230  TYR A CA   
3433 C C    . TYR A 230 ? 0.1076 0.1550 0.1659 -0.0061 -0.0109 0.0346  230  TYR A C    
3434 O O    . TYR A 230 ? 0.1154 0.1395 0.2036 -0.0049 -0.0071 0.0317  230  TYR A O    
3435 C CB   . TYR A 230 ? 0.1186 0.1333 0.1743 0.0051  -0.0006 0.0301  230  TYR A CB   
3436 C CG   . TYR A 230 ? 0.1124 0.1193 0.1715 0.0029  -0.0054 0.0247  230  TYR A CG   
3437 C CD1  . TYR A 230 ? 0.1110 0.1304 0.1726 -0.0016 -0.0078 0.0178  230  TYR A CD1  
3438 C CD2  . TYR A 230 ? 0.1144 0.1243 0.1604 0.0039  -0.0006 0.0105  230  TYR A CD2  
3439 C CE1  . TYR A 230 ? 0.1155 0.1198 0.1648 0.0004  -0.0132 0.0059  230  TYR A CE1  
3440 C CE2  . TYR A 230 ? 0.1136 0.1200 0.1502 0.0035  -0.0085 0.0066  230  TYR A CE2  
3441 C CZ   . TYR A 230 ? 0.1022 0.1207 0.1575 0.0073  -0.0005 0.0048  230  TYR A CZ   
3442 O OH   . TYR A 230 ? 0.1138 0.1366 0.1469 -0.0034 -0.0101 0.0041  230  TYR A OH   
3443 H H    . TYR A 230 ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  230  TYR A H    
3444 H HA   . TYR A 230 ? 0.1686 0.1686 0.1686 0.0000  0.0000  0.0000  230  TYR A HA   
3445 H HB2  . TYR A 230 ? 0.1705 0.1705 0.1705 0.0000  0.0000  0.0000  230  TYR A HB2  
3446 H HB3  . TYR A 230 ? 0.1705 0.1705 0.1705 0.0000  0.0000  0.0000  230  TYR A HB3  
3447 H HD1  . TYR A 230 ? 0.1657 0.1657 0.1657 0.0000  0.0000  0.0000  230  TYR A HD1  
3448 H HD2  . TYR A 230 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  230  TYR A HD2  
3449 H HE1  . TYR A 230 ? 0.1601 0.1601 0.1601 0.0000  0.0000  0.0000  230  TYR A HE1  
3450 H HE2  . TYR A 230 ? 0.1535 0.1535 0.1535 0.0000  0.0000  0.0000  230  TYR A HE2  
3451 H HH   . TYR A 230 ? 0.1986 0.1986 0.1986 0.0000  0.0000  0.0000  230  TYR A HH   
3452 N N    . SER A 231 ? 0.1150 0.1653 0.1784 0.0036  0.0089  0.0262  231  SER A N    
3453 C CA   . SER A 231 ? 0.1142 0.1755 0.2066 -0.0154 0.0180  0.0371  231  SER A CA   
3454 C C    . SER A 231 ? 0.1054 0.1519 0.2404 -0.0042 0.0073  0.0277  231  SER A C    
3455 O O    . SER A 231 ? 0.1048 0.2309 0.2571 -0.0090 0.0077  0.0433  231  SER A O    
3456 C CB   . SER A 231 ? 0.1482 0.2181 0.2030 0.0092  0.0444  0.0277  231  SER A CB   
3457 O OG   . SER A 231 ? 0.1685 0.2037 0.2409 -0.0081 0.0208  0.0052  231  SER A OG   
3458 H H    . SER A 231 ? 0.1835 0.1835 0.1835 0.0000  0.0000  0.0000  231  SER A H    
3459 H HA   . SER A 231 ? 0.1985 0.1985 0.1985 0.0000  0.0000  0.0000  231  SER A HA   
3460 H HB2  . SER A 231 ? 0.2277 0.2277 0.2277 0.0000  0.0000  0.0000  231  SER A HB2  
3461 H HB3  . SER A 231 ? 0.2277 0.2277 0.2277 0.0000  0.0000  0.0000  231  SER A HB3  
3462 H HG   . SER A 231 ? 0.3065 0.3065 0.3065 0.0000  0.0000  0.0000  231  SER A HG   
3463 N N    . GLN A 232 ? 0.1154 0.1316 0.2122 -0.0025 -0.0076 0.0203  232  GLN A N    
3464 C CA   . GLN A 232 ? 0.1225 0.1325 0.2347 0.0087  -0.0285 0.0130  232  GLN A CA   
3465 C C    . GLN A 232 ? 0.1613 0.1374 0.2555 0.0227  -0.0667 0.0019  232  GLN A C    
3466 O O    . GLN A 232 ? 0.3360 0.1778 0.3200 0.0975  -0.1785 -0.0545 232  GLN A O    
3467 C CB   . GLN A 232 ? 0.1234 0.1346 0.2021 0.0126  -0.0065 0.0183  232  GLN A CB   
3468 C CG   . GLN A 232 ? 0.1377 0.1245 0.2348 0.0038  0.0070  0.0106  232  GLN A CG   
3469 C CD   . GLN A 232 ? 0.1394 0.1212 0.2173 0.0119  -0.0200 0.0222  232  GLN A CD   
3470 O OE1  . GLN A 232 ? 0.2210 0.1495 0.2406 -0.0250 -0.0776 0.0409  232  GLN A OE1  
3471 N NE2  . GLN A 232 ? 0.1306 0.1472 0.1866 -0.0007 -0.0050 0.0234  232  GLN A NE2  
3472 H H    . GLN A 232 ? 0.1836 0.1836 0.1836 0.0000  0.0000  0.0000  232  GLN A H    
3473 H HA   . GLN A 232 ? 0.1959 0.1959 0.1959 0.0000  0.0000  0.0000  232  GLN A HA   
3474 H HB2  . GLN A 232 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  232  GLN A HB2  
3475 H HB3  . GLN A 232 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  232  GLN A HB3  
3476 H HG2  . GLN A 232 ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  232  GLN A HG2  
3477 H HG3  . GLN A 232 ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  232  GLN A HG3  
3478 H HE21 . GLN A 232 ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  232  GLN A HE21 
3479 H HE22 . GLN A 232 ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  232  GLN A HE22 
3480 N N    . VAL A 233 ? 0.1490 0.1204 0.2403 0.0010  -0.0445 0.0099  233  VAL A N    
3481 C CA   . VAL A 233 ? 0.1669 0.1354 0.2172 0.0056  -0.0551 0.0036  233  VAL A CA   
3482 C C    . VAL A 233 ? 0.1578 0.1331 0.2765 0.0034  -0.0567 -0.0154 233  VAL A C    
3483 O O    . VAL A 233 ? 0.1582 0.1335 0.2882 -0.0012 -0.0436 0.0157  233  VAL A O    
3484 C CB   . VAL A 233 ? 0.1724 0.1387 0.1946 0.0041  -0.0394 0.0060  233  VAL A CB   
3485 C CG1  . VAL A 233 ? 0.2235 0.1460 0.2011 0.0064  -0.0331 0.0001  233  VAL A CG1  
3486 C CG2  . VAL A 233 ? 0.1888 0.1384 0.1890 0.0016  -0.0268 0.0179  233  VAL A CG2  
3487 H H    . VAL A 233 ? 0.2039 0.2039 0.2039 0.0000  0.0000  0.0000  233  VAL A H    
3488 H HA   . VAL A 233 ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  233  VAL A HA   
3489 H HB   . VAL A 233 ? 0.2023 0.2023 0.2023 0.0000  0.0000  0.0000  233  VAL A HB   
3490 H HG11 . VAL A 233 ? 0.2853 0.2853 0.2853 0.0000  0.0000  0.0000  233  VAL A HG11 
3491 H HG12 . VAL A 233 ? 0.2853 0.2853 0.2853 0.0000  0.0000  0.0000  233  VAL A HG12 
3492 H HG13 . VAL A 233 ? 0.2853 0.2853 0.2853 0.0000  0.0000  0.0000  233  VAL A HG13 
3493 H HG21 . VAL A 233 ? 0.2581 0.2581 0.2581 0.0000  0.0000  0.0000  233  VAL A HG21 
3494 H HG22 . VAL A 233 ? 0.2581 0.2581 0.2581 0.0000  0.0000  0.0000  233  VAL A HG22 
3495 H HG23 . VAL A 233 ? 0.2581 0.2581 0.2581 0.0000  0.0000  0.0000  233  VAL A HG23 
3496 N N    . SER A 234 ? 0.1713 0.1395 0.3492 0.0112  -0.0905 -0.0232 234  SER A N    
3497 C CA   . SER A 234 ? 0.1662 0.1475 0.4207 0.0040  -0.0759 -0.0210 234  SER A CA   
3498 C C    . SER A 234 ? 0.1460 0.1620 0.2893 -0.0005 -0.0358 -0.0088 234  SER A C    
3499 O O    . SER A 234 ? 0.2139 0.1611 0.2613 -0.0035 -0.0456 -0.0214 234  SER A O    
3500 C CB   A SER A 234 ? 0.2027 0.1798 0.5795 -0.0082 -0.1601 0.0050  234  SER A CB   
3501 C CB   B SER A 234 ? 0.1158 0.1791 0.4137 0.0296  -0.0341 -0.0580 234  SER A CB   
3502 O OG   A SER A 234 ? 0.6677 0.4631 0.6369 -0.2253 -0.4033 0.1801  234  SER A OG   
3503 O OG   B SER A 234 ? 0.1870 0.1468 0.4654 -0.0065 -0.1105 -0.0247 234  SER A OG   
3504 H H    . SER A 234 ? 0.2639 0.2639 0.2639 0.0000  0.0000  0.0000  234  SER A H    
3505 H HA   A SER A 234 ? 0.2937 0.2937 0.2937 0.0000  0.0000  0.0000  234  SER A HA   
3506 H HB2  A SER A 234 ? 0.3848 0.3848 0.3848 0.0000  0.0000  0.0000  234  SER A HB2  
3507 H HB2  B SER A 234 ? 0.2834 0.2834 0.2834 0.0000  0.0000  0.0000  234  SER A HB2  
3508 H HB3  A SER A 234 ? 0.3848 0.3848 0.3848 0.0000  0.0000  0.0000  234  SER A HB3  
3509 H HB3  B SER A 234 ? 0.2834 0.2834 0.2834 0.0000  0.0000  0.0000  234  SER A HB3  
3510 H HG   A SER A 234 ? 0.8839 0.8839 0.8839 0.0000  0.0000  0.0000  234  SER A HG   
3511 H HG   B SER A 234 ? 0.3996 0.3996 0.3996 0.0000  0.0000  0.0000  234  SER A HG   
3512 N N    . GLY A 235 ? 0.1693 0.1594 0.3193 -0.0088 -0.0029 0.0064  235  GLY A N    
3513 C CA   . GLY A 235 ? 0.1708 0.1494 0.3824 -0.0217 -0.0296 0.0088  235  GLY A CA   
3514 C C    . GLY A 235 ? 0.1672 0.1341 0.3097 -0.0119 0.0036  0.0096  235  GLY A C    
3515 O O    . GLY A 235 ? 0.1813 0.1454 0.3387 -0.0006 0.0047  0.0195  235  GLY A O    
3516 H H    . GLY A 235 ? 0.2593 0.2593 0.2593 0.0000  0.0000  0.0000  235  GLY A H    
3517 H HA2  . GLY A 235 ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  235  GLY A HA2  
3518 H HA3  . GLY A 235 ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  235  GLY A HA3  
3519 N N    . ALA A 236 ? 0.1456 0.1387 0.2567 0.0007  -0.0243 0.0222  236  ALA A N    
3520 C CA   . ALA A 236 ? 0.1435 0.1437 0.2098 -0.0002 -0.0039 0.0203  236  ALA A CA   
3521 C C    . ALA A 236 ? 0.1644 0.1458 0.1904 0.0186  0.0069  0.0221  236  ALA A C    
3522 O O    . ALA A 236 ? 0.1661 0.1995 0.2177 0.0262  0.0290  0.0347  236  ALA A O    
3523 C CB   . ALA A 236 ? 0.1641 0.1424 0.2543 -0.0044 -0.0276 0.0325  236  ALA A CB   
3524 H H    . ALA A 236 ? 0.2164 0.2164 0.2164 0.0000  0.0000  0.0000  236  ALA A H    
3525 H HA   . ALA A 236 ? 0.1988 0.1988 0.1988 0.0000  0.0000  0.0000  236  ALA A HA   
3526 H HB1  . ALA A 236 ? 0.2804 0.2804 0.2804 0.0000  0.0000  0.0000  236  ALA A HB1  
3527 H HB2  . ALA A 236 ? 0.2804 0.2804 0.2804 0.0000  0.0000  0.0000  236  ALA A HB2  
3528 H HB3  . ALA A 236 ? 0.2804 0.2804 0.2804 0.0000  0.0000  0.0000  236  ALA A HB3  
3529 N N    . GLN A 237 ? 0.1458 0.1655 0.2018 0.0029  0.0160  0.0402  237  GLN A N    
3530 C CA   . GLN A 237 ? 0.1456 0.1775 0.2512 0.0321  0.0446  0.0879  237  GLN A CA   
3531 C C    . GLN A 237 ? 0.1525 0.1530 0.1735 0.0071  0.0252  0.0360  237  GLN A C    
3532 O O    . GLN A 237 ? 0.1416 0.1697 0.1684 -0.0187 0.0112  0.0220  237  GLN A O    
3533 C CB   A GLN A 237 ? 0.1384 0.1638 0.1836 0.0140  -0.0141 0.0400  237  GLN A CB   
3534 C CB   B GLN A 237 ? 0.1965 0.2402 0.3616 -0.0620 -0.0012 0.1546  237  GLN A CB   
3535 C CG   A GLN A 237 ? 0.1495 0.1842 0.1778 -0.0123 0.0090  0.0301  237  GLN A CG   
3536 C CG   B GLN A 237 ? 0.1583 0.2842 0.3206 -0.0183 0.0748  0.0620  237  GLN A CG   
3537 C CD   A GLN A 237 ? 0.1501 0.1434 0.1799 -0.0057 0.0092  0.0465  237  GLN A CD   
3538 C CD   B GLN A 237 ? 0.1663 0.3864 0.3559 -0.0845 0.0802  -0.0133 237  GLN A CD   
3539 O OE1  A GLN A 237 ? 0.1530 0.2110 0.1846 0.0199  0.0063  0.0357  237  GLN A OE1  
3540 O OE1  B GLN A 237 ? 0.1864 0.6982 0.3391 -0.1408 0.0598  -0.1526 237  GLN A OE1  
3541 N NE2  A GLN A 237 ? 0.1297 0.2203 0.1546 0.0172  0.0274  0.0341  237  GLN A NE2  
3542 N NE2  B GLN A 237 ? 0.2397 0.2641 0.2989 -0.0728 -0.0059 0.0648  237  GLN A NE2  
3543 H H    . GLN A 237 ? 0.2053 0.2053 0.2053 0.0000  0.0000  0.0000  237  GLN A H    
3544 H HA   A GLN A 237 ? 0.2297 0.2297 0.2297 0.0000  0.0000  0.0000  237  GLN A HA   
3545 H HB2  A GLN A 237 ? 0.1943 0.1943 0.1943 0.0000  0.0000  0.0000  237  GLN A HB2  
3546 H HB2  B GLN A 237 ? 0.3193 0.3193 0.3193 0.0000  0.0000  0.0000  237  GLN A HB2  
3547 H HB3  A GLN A 237 ? 0.1943 0.1943 0.1943 0.0000  0.0000  0.0000  237  GLN A HB3  
3548 H HB3  B GLN A 237 ? 0.3193 0.3193 0.3193 0.0000  0.0000  0.0000  237  GLN A HB3  
3549 H HG2  A GLN A 237 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  237  GLN A HG2  
3550 H HG2  B GLN A 237 ? 0.3052 0.3052 0.3052 0.0000  0.0000  0.0000  237  GLN A HG2  
3551 H HG3  A GLN A 237 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  237  GLN A HG3  
3552 H HG3  B GLN A 237 ? 0.3052 0.3052 0.3052 0.0000  0.0000  0.0000  237  GLN A HG3  
3553 H HE21 A GLN A 237 ? 0.2019 0.2019 0.2019 0.0000  0.0000  0.0000  237  GLN A HE21 
3554 H HE21 B GLN A 237 ? 0.3211 0.3211 0.3211 0.0000  0.0000  0.0000  237  GLN A HE21 
3555 H HE22 A GLN A 237 ? 0.2019 0.2019 0.2019 0.0000  0.0000  0.0000  237  GLN A HE22 
3556 H HE22 B GLN A 237 ? 0.3211 0.3211 0.3211 0.0000  0.0000  0.0000  237  GLN A HE22 
3557 N N    . GLN A 238 ? 0.1718 0.1906 0.1775 0.0362  0.0233  0.0592  238  GLN A N    
3558 C CA   . GLN A 238 ? 0.1612 0.1462 0.1919 0.0215  0.0101  0.0377  238  GLN A CA   
3559 C C    . GLN A 238 ? 0.1416 0.1538 0.1561 0.0058  0.0076  0.0331  238  GLN A C    
3560 O O    . GLN A 238 ? 0.1789 0.1564 0.1711 -0.0101 0.0264  0.0338  238  GLN A O    
3561 C CB   . GLN A 238 ? 0.2611 0.1718 0.2235 0.0292  -0.0377 0.0023  238  GLN A CB   
3562 C CG   A GLN A 238 ? 0.2670 0.1737 0.2009 0.0810  -0.0678 -0.0025 238  GLN A CG   
3563 C CG   B GLN A 238 ? 0.3172 0.1741 0.1925 0.0709  0.0028  0.0199  238  GLN A CG   
3564 C CD   A GLN A 238 ? 0.2744 0.1409 0.1829 0.0221  0.0135  -0.0005 238  GLN A CD   
3565 C CD   B GLN A 238 ? 0.3034 0.1544 0.1902 -0.0045 0.0287  0.0322  238  GLN A CD   
3566 O OE1  A GLN A 238 ? 0.3477 0.2768 0.2836 -0.0713 -0.0023 -0.0961 238  GLN A OE1  
3567 O OE1  B GLN A 238 ? 0.3663 0.2055 0.1701 0.0636  0.0356  0.0473  238  GLN A OE1  
3568 N NE2  A GLN A 238 ? 0.3841 0.1345 0.3220 0.0147  0.1576  0.0655  238  GLN A NE2  
3569 N NE2  B GLN A 238 ? 0.2955 0.2710 0.2401 -0.0688 0.0288  0.0934  238  GLN A NE2  
3570 H H    . GLN A 238 ? 0.2159 0.2159 0.2159 0.0000  0.0000  0.0000  238  GLN A H    
3571 H HA   . GLN A 238 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  238  GLN A HA   
3572 H HB2  . GLN A 238 ? 0.2625 0.2625 0.2625 0.0000  0.0000  0.0000  238  GLN A HB2  
3573 H HB3  . GLN A 238 ? 0.2625 0.2625 0.2625 0.0000  0.0000  0.0000  238  GLN A HB3  
3574 H HG2  A GLN A 238 ? 0.2566 0.2566 0.2566 0.0000  0.0000  0.0000  238  GLN A HG2  
3575 H HG2  B GLN A 238 ? 0.2736 0.2736 0.2736 0.0000  0.0000  0.0000  238  GLN A HG2  
3576 H HG3  A GLN A 238 ? 0.2566 0.2566 0.2566 0.0000  0.0000  0.0000  238  GLN A HG3  
3577 H HG3  B GLN A 238 ? 0.2736 0.2736 0.2736 0.0000  0.0000  0.0000  238  GLN A HG3  
3578 H HE21 A GLN A 238 ? 0.3363 0.3363 0.3363 0.0000  0.0000  0.0000  238  GLN A HE21 
3579 H HE21 B GLN A 238 ? 0.3226 0.3226 0.3226 0.0000  0.0000  0.0000  238  GLN A HE21 
3580 H HE22 A GLN A 238 ? 0.3363 0.3363 0.3363 0.0000  0.0000  0.0000  238  GLN A HE22 
3581 H HE22 B GLN A 238 ? 0.3226 0.3226 0.3226 0.0000  0.0000  0.0000  238  GLN A HE22 
3582 N N    . ASP A 239 ? 0.1355 0.1426 0.1691 0.0027  0.0136  0.0403  239  ASP A N    
3583 C CA   . ASP A 239 ? 0.1521 0.1389 0.1388 -0.0056 0.0067  0.0355  239  ASP A CA   
3584 C C    . ASP A 239 ? 0.1571 0.1412 0.1360 0.0164  0.0059  0.0164  239  ASP A C    
3585 O O    . ASP A 239 ? 0.1399 0.1656 0.1473 0.0118  0.0201  0.0319  239  ASP A O    
3586 C CB   . ASP A 239 ? 0.1847 0.1878 0.1551 -0.0270 -0.0126 0.0298  239  ASP A CB   
3587 C CG   . ASP A 239 ? 0.2562 0.2140 0.1661 -0.0354 0.0010  -0.0103 239  ASP A CG   
3588 O OD1  . ASP A 239 ? 0.3030 0.1984 0.2056 0.0221  -0.0033 -0.0331 239  ASP A OD1  
3589 O OD2  . ASP A 239 ? 0.4987 0.2951 0.2489 -0.0126 -0.1260 -0.0577 239  ASP A OD2  
3590 H H    . ASP A 239 ? 0.1788 0.1788 0.1788 0.0000  0.0000  0.0000  239  ASP A H    
3591 H HA   . ASP A 239 ? 0.1719 0.1719 0.1719 0.0000  0.0000  0.0000  239  ASP A HA   
3592 H HB2  . ASP A 239 ? 0.2110 0.2110 0.2110 0.0000  0.0000  0.0000  239  ASP A HB2  
3593 H HB3  . ASP A 239 ? 0.2110 0.2110 0.2110 0.0000  0.0000  0.0000  239  ASP A HB3  
3594 N N    . SER A 240 ? 0.1624 0.1645 0.1345 0.0264  0.0049  0.0228  240  SER A N    
3595 C CA   . SER A 240 ? 0.1602 0.2168 0.1586 0.0281  0.0034  0.0298  240  SER A CA   
3596 C C    . SER A 240 ? 0.1708 0.2377 0.1597 0.0492  0.0226  0.0499  240  SER A C    
3597 O O    . SER A 240 ? 0.1665 0.4056 0.2360 0.0567  0.0193  0.0160  240  SER A O    
3598 C CB   . SER A 240 ? 0.1587 0.2407 0.1731 0.0314  -0.0243 0.0091  240  SER A CB   
3599 O OG   . SER A 240 ? 0.2188 0.2411 0.1846 0.0480  -0.0004 0.0555  240  SER A OG   
3600 H H    . SER A 240 ? 0.1845 0.1845 0.1845 0.0000  0.0000  0.0000  240  SER A H    
3601 H HA   . SER A 240 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  240  SER A HA   
3602 H HB2  . SER A 240 ? 0.2290 0.2290 0.2290 0.0000  0.0000  0.0000  240  SER A HB2  
3603 H HB3  . SER A 240 ? 0.2290 0.2290 0.2290 0.0000  0.0000  0.0000  240  SER A HB3  
3604 H HG   . SER A 240 ? 0.3222 0.3222 0.3222 0.0000  0.0000  0.0000  240  SER A HG   
3605 N N    . ASN A 241 ? 0.2233 0.2015 0.1654 0.0538  0.0404  0.0332  241  ASN A N    
3606 C CA   . ASN A 241 ? 0.2922 0.2081 0.1921 0.0723  0.0864  0.0333  241  ASN A CA   
3607 C C    . ASN A 241 ? 0.2637 0.1818 0.1956 0.0595  0.0892  0.0354  241  ASN A C    
3608 O O    . ASN A 241 ? 0.3180 0.3027 0.2867 0.1327  0.1552  0.0992  241  ASN A O    
3609 C CB   . ASN A 241 ? 0.4109 0.1598 0.2101 0.0442  0.1075  0.0207  241  ASN A CB   
3610 C CG   . ASN A 241 ? 0.3886 0.1963 0.1906 0.0512  0.0674  0.0311  241  ASN A CG   
3611 O OD1  . ASN A 241 ? 0.4892 0.2561 0.1988 0.0720  0.0226  0.0554  241  ASN A OD1  
3612 N ND2  . ASN A 241 ? 0.4455 0.2358 0.2085 -0.0334 0.0758  0.0148  241  ASN A ND2  
3613 H H    . ASN A 241 ? 0.2361 0.2361 0.2361 0.0000  0.0000  0.0000  241  ASN A H    
3614 H HA   . ASN A 241 ? 0.2770 0.2770 0.2770 0.0000  0.0000  0.0000  241  ASN A HA   
3615 H HB2  . ASN A 241 ? 0.3123 0.3123 0.3123 0.0000  0.0000  0.0000  241  ASN A HB2  
3616 H HB3  . ASN A 241 ? 0.3123 0.3123 0.3123 0.0000  0.0000  0.0000  241  ASN A HB3  
3617 H HD21 . ASN A 241 ? 0.3559 0.3559 0.3559 0.0000  0.0000  0.0000  241  ASN A HD21 
3618 H HD22 . ASN A 241 ? 0.3559 0.3559 0.3559 0.0000  0.0000  0.0000  241  ASN A HD22 
3619 N N    . ALA A 242 ? 0.2415 0.1647 0.1756 0.0363  0.0672  0.0227  242  ALA A N    
3620 C CA   . ALA A 242 ? 0.2480 0.1503 0.1626 0.0099  0.0540  0.0198  242  ALA A CA   
3621 C C    . ALA A 242 ? 0.1716 0.1717 0.2353 0.0221  0.0473  0.0092  242  ALA A C    
3622 O O    . ALA A 242 ? 0.2212 0.1963 0.3137 0.0046  0.1024  0.0313  242  ALA A O    
3623 C CB   . ALA A 242 ? 0.2517 0.1954 0.1607 -0.0190 -0.0008 0.0264  242  ALA A CB   
3624 H H    . ALA A 242 ? 0.2327 0.2327 0.2327 0.0000  0.0000  0.0000  242  ALA A H    
3625 H HA   . ALA A 242 ? 0.2243 0.2243 0.2243 0.0000  0.0000  0.0000  242  ALA A HA   
3626 H HB1  . ALA A 242 ? 0.3038 0.3038 0.3038 0.0000  0.0000  0.0000  242  ALA A HB1  
3627 H HB2  . ALA A 242 ? 0.3038 0.3038 0.3038 0.0000  0.0000  0.0000  242  ALA A HB2  
3628 H HB3  . ALA A 242 ? 0.3038 0.3038 0.3038 0.0000  0.0000  0.0000  242  ALA A HB3  
3629 N N    . GLY A 243 ? 0.1734 0.2190 0.2585 0.0257  0.0234  -0.0480 243  GLY A N    
3630 C CA   . GLY A 243 ? 0.1371 0.3147 0.4400 0.0123  0.0140  -0.1547 243  GLY A CA   
3631 C C    . GLY A 243 ? 0.1244 0.2325 0.2766 -0.0095 0.0099  -0.0640 243  GLY A C    
3632 O O    . GLY A 243 ? 0.1420 0.2635 0.3577 -0.0542 0.0540  -0.0836 243  GLY A O    
3633 H H    . GLY A 243 ? 0.2604 0.2604 0.2604 0.0000  0.0000  0.0000  243  GLY A H    
3634 H HA2  . GLY A 243 ? 0.3568 0.3568 0.3568 0.0000  0.0000  0.0000  243  GLY A HA2  
3635 H HA3  . GLY A 243 ? 0.3568 0.3568 0.3568 0.0000  0.0000  0.0000  243  GLY A HA3  
3636 N N    . GLY A 244 ? 0.1318 0.1493 0.1658 -0.0036 -0.0003 0.0101  244  GLY A N    
3637 C CA   . GLY A 244 ? 0.1259 0.1562 0.1375 -0.0048 -0.0053 0.0141  244  GLY A CA   
3638 C C    . GLY A 244 ? 0.1287 0.1294 0.1408 -0.0096 -0.0025 0.0313  244  GLY A C    
3639 O O    . GLY A 244 ? 0.1249 0.1322 0.1548 -0.0049 -0.0026 0.0229  244  GLY A O    
3640 H H    . GLY A 244 ? 0.1787 0.1787 0.1787 0.0000  0.0000  0.0000  244  GLY A H    
3641 H HA2  . GLY A 244 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  244  GLY A HA2  
3642 H HA3  . GLY A 244 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  244  GLY A HA3  
3643 N N    . TYR A 245 ? 0.1236 0.1279 0.1439 -0.0183 -0.0074 0.0293  245  TYR A N    
3644 C CA   . TYR A 245 ? 0.1278 0.1247 0.1518 -0.0095 -0.0028 0.0327  245  TYR A CA   
3645 C C    . TYR A 245 ? 0.1184 0.1221 0.1630 -0.0168 -0.0102 0.0347  245  TYR A C    
3646 O O    . TYR A 245 ? 0.1365 0.1416 0.1510 -0.0282 -0.0122 0.0327  245  TYR A O    
3647 C CB   . TYR A 245 ? 0.1350 0.1182 0.1897 -0.0075 -0.0159 0.0246  245  TYR A CB   
3648 C CG   . TYR A 245 ? 0.1667 0.1264 0.1854 0.0143  0.0001  0.0199  245  TYR A CG   
3649 C CD1  . TYR A 245 ? 0.1714 0.1744 0.1957 0.0104  0.0095  -0.0124 245  TYR A CD1  
3650 C CD2  . TYR A 245 ? 0.2152 0.1205 0.2224 -0.0165 -0.0254 0.0028  245  TYR A CD2  
3651 C CE1  . TYR A 245 ? 0.1691 0.3040 0.1969 0.0049  0.0222  -0.0614 245  TYR A CE1  
3652 C CE2  . TYR A 245 ? 0.2369 0.1337 0.2259 -0.0076 -0.0280 -0.0199 245  TYR A CE2  
3653 C CZ   . TYR A 245 ? 0.2090 0.2797 0.2488 0.0092  0.0042  -0.0976 245  TYR A CZ   
3654 O OH   . TYR A 245 ? 0.2451 0.5481 0.2567 0.0252  0.0162  -0.1853 245  TYR A OH   
3655 H H    . TYR A 245 ? 0.1582 0.1582 0.1582 0.0000  0.0000  0.0000  245  TYR A H    
3656 H HA   . TYR A 245 ? 0.1617 0.1617 0.1617 0.0000  0.0000  0.0000  245  TYR A HA   
3657 H HB2  . TYR A 245 ? 0.1772 0.1772 0.1772 0.0000  0.0000  0.0000  245  TYR A HB2  
3658 H HB3  . TYR A 245 ? 0.1772 0.1772 0.1772 0.0000  0.0000  0.0000  245  TYR A HB3  
3659 H HD1  . TYR A 245 ? 0.2166 0.2166 0.2166 0.0000  0.0000  0.0000  245  TYR A HD1  
3660 H HD2  . TYR A 245 ? 0.2233 0.2233 0.2233 0.0000  0.0000  0.0000  245  TYR A HD2  
3661 H HE1  . TYR A 245 ? 0.2680 0.2680 0.2680 0.0000  0.0000  0.0000  245  TYR A HE1  
3662 H HE2  . TYR A 245 ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  245  TYR A HE2  
3663 H HH   . TYR A 245 ? 0.5250 0.5250 0.5250 0.0000  0.0000  0.0000  245  TYR A HH   
3664 N N    . VAL A 246 ? 0.1162 0.1377 0.1507 -0.0130 -0.0078 0.0324  246  VAL A N    
3665 C CA   . VAL A 246 ? 0.1285 0.1365 0.1642 -0.0198 -0.0144 0.0339  246  VAL A CA   
3666 C C    . VAL A 246 ? 0.1416 0.1322 0.1718 -0.0129 -0.0250 0.0341  246  VAL A C    
3667 O O    . VAL A 246 ? 0.1366 0.1993 0.1792 -0.0191 -0.0068 0.0368  246  VAL A O    
3668 C CB   . VAL A 246 ? 0.1280 0.1332 0.1723 -0.0210 -0.0179 0.0256  246  VAL A CB   
3669 C CG1  . VAL A 246 ? 0.1270 0.1483 0.1659 -0.0154 -0.0209 0.0235  246  VAL A CG1  
3670 C CG2  . VAL A 246 ? 0.1398 0.1441 0.2010 -0.0247 -0.0175 0.0347  246  VAL A CG2  
3671 H H    . VAL A 246 ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  246  VAL A H    
3672 H HA   . VAL A 246 ? 0.1717 0.1717 0.1717 0.0000  0.0000  0.0000  246  VAL A HA   
3673 H HB   . VAL A 246 ? 0.1734 0.1734 0.1734 0.0000  0.0000  0.0000  246  VAL A HB   
3674 H HG11 . VAL A 246 ? 0.2206 0.2206 0.2206 0.0000  0.0000  0.0000  246  VAL A HG11 
3675 H HG12 . VAL A 246 ? 0.2206 0.2206 0.2206 0.0000  0.0000  0.0000  246  VAL A HG12 
3676 H HG13 . VAL A 246 ? 0.2206 0.2206 0.2206 0.0000  0.0000  0.0000  246  VAL A HG13 
3677 H HG21 . VAL A 246 ? 0.2424 0.2424 0.2424 0.0000  0.0000  0.0000  246  VAL A HG21 
3678 H HG22 . VAL A 246 ? 0.2424 0.2424 0.2424 0.0000  0.0000  0.0000  246  VAL A HG22 
3679 H HG23 . VAL A 246 ? 0.2424 0.2424 0.2424 0.0000  0.0000  0.0000  246  VAL A HG23 
3680 N N    . PHE A 247 ? 0.1253 0.1434 0.1851 -0.0101 -0.0227 0.0282  247  PHE A N    
3681 C CA   . PHE A 247 ? 0.1252 0.1543 0.2061 -0.0171 -0.0340 0.0245  247  PHE A CA   
3682 C C    . PHE A 247 ? 0.1306 0.1499 0.1992 -0.0162 -0.0218 0.0329  247  PHE A C    
3683 O O    . PHE A 247 ? 0.1452 0.1682 0.1836 -0.0175 -0.0341 0.0238  247  PHE A O    
3684 C CB   . PHE A 247 ? 0.1246 0.1524 0.2146 -0.0082 -0.0342 0.0269  247  PHE A CB   
3685 C CG   . PHE A 247 ? 0.1312 0.1465 0.1997 -0.0130 -0.0320 0.0305  247  PHE A CG   
3686 C CD1  . PHE A 247 ? 0.1530 0.1336 0.2028 -0.0223 -0.0412 0.0227  247  PHE A CD1  
3687 C CD2  . PHE A 247 ? 0.1264 0.1487 0.1962 -0.0060 -0.0264 0.0233  247  PHE A CD2  
3688 C CE1  . PHE A 247 ? 0.1439 0.1427 0.1769 -0.0097 -0.0316 0.0135  247  PHE A CE1  
3689 C CE2  . PHE A 247 ? 0.1311 0.1507 0.1815 -0.0130 -0.0316 0.0089  247  PHE A CE2  
3690 C CZ   . PHE A 247 ? 0.1192 0.1459 0.1899 -0.0042 -0.0138 0.0025  247  PHE A CZ   
3691 H H    . PHE A 247 ? 0.1815 0.1815 0.1815 0.0000  0.0000  0.0000  247  PHE A H    
3692 H HA   . PHE A 247 ? 0.1943 0.1943 0.1943 0.0000  0.0000  0.0000  247  PHE A HA   
3693 H HB2  . PHE A 247 ? 0.1967 0.1967 0.1967 0.0000  0.0000  0.0000  247  PHE A HB2  
3694 H HB3  . PHE A 247 ? 0.1967 0.1967 0.1967 0.0000  0.0000  0.0000  247  PHE A HB3  
3695 H HD1  . PHE A 247 ? 0.1958 0.1958 0.1958 0.0000  0.0000  0.0000  247  PHE A HD1  
3696 H HD2  . PHE A 247 ? 0.1886 0.1886 0.1886 0.0000  0.0000  0.0000  247  PHE A HD2  
3697 H HE1  . PHE A 247 ? 0.1854 0.1854 0.1854 0.0000  0.0000  0.0000  247  PHE A HE1  
3698 H HE2  . PHE A 247 ? 0.1853 0.1853 0.1853 0.0000  0.0000  0.0000  247  PHE A HE2  
3699 H HZ   . PHE A 247 ? 0.1820 0.1820 0.1820 0.0000  0.0000  0.0000  247  PHE A HZ   
3700 N N    . ASP A 248 ? 0.1313 0.1875 0.2236 -0.0321 -0.0402 0.0242  248  ASP A N    
3701 C CA   . ASP A 248 ? 0.1599 0.1905 0.2339 -0.0382 -0.0445 0.0149  248  ASP A CA   
3702 C C    . ASP A 248 ? 0.1489 0.1771 0.2101 -0.0146 -0.0543 0.0070  248  ASP A C    
3703 O O    . ASP A 248 ? 0.1733 0.1657 0.2211 -0.0199 -0.0663 0.0076  248  ASP A O    
3704 C CB   A ASP A 248 ? 0.1940 0.2842 0.3125 -0.1030 -0.1132 0.0861  248  ASP A CB   
3705 C CB   B ASP A 248 ? 0.1733 0.3581 0.3431 -0.1301 -0.1047 0.0909  248  ASP A CB   
3706 C CG   A ASP A 248 ? 0.2210 0.3334 0.2622 -0.1284 -0.1057 0.0967  248  ASP A CG   
3707 C CG   B ASP A 248 ? 0.2390 0.3759 0.4542 -0.1103 -0.1502 -0.0134 248  ASP A CG   
3708 O OD1  A ASP A 248 ? 0.2081 0.2086 0.2248 -0.0803 -0.0261 0.0071  248  ASP A OD1  
3709 O OD1  B ASP A 248 ? 0.8353 0.5545 0.3706 -0.3095 -0.1798 -0.0589 248  ASP A OD1  
3710 O OD2  A ASP A 248 ? 0.2191 0.3238 0.3148 -0.1058 -0.0831 0.0695  248  ASP A OD2  
3711 O OD2  B ASP A 248 ? 0.5575 0.4999 0.7256 -0.3271 -0.3011 0.0640  248  ASP A OD2  
3712 H H    . ASP A 248 ? 0.2170 0.2170 0.2170 0.0000  0.0000  0.0000  248  ASP A H    
3713 H HA   A ASP A 248 ? 0.2337 0.2337 0.2337 0.0000  0.0000  0.0000  248  ASP A HA   
3714 H HB2  A ASP A 248 ? 0.3162 0.3162 0.3162 0.0000  0.0000  0.0000  248  ASP A HB2  
3715 H HB2  B ASP A 248 ? 0.3498 0.3498 0.3498 0.0000  0.0000  0.0000  248  ASP A HB2  
3716 H HB3  A ASP A 248 ? 0.3162 0.3162 0.3162 0.0000  0.0000  0.0000  248  ASP A HB3  
3717 H HB3  B ASP A 248 ? 0.3498 0.3498 0.3498 0.0000  0.0000  0.0000  248  ASP A HB3  
3718 N N    . CYS A 249 ? 0.1608 0.1667 0.2347 -0.0265 -0.0378 0.0029  249  CYS A N    
3719 C CA   . CYS A 249 ? 0.1610 0.2126 0.2199 -0.0004 -0.0317 0.0077  249  CYS A CA   
3720 C C    . CYS A 249 ? 0.1863 0.1640 0.2438 -0.0094 -0.0445 -0.0009 249  CYS A C    
3721 O O    . CYS A 249 ? 0.2070 0.1970 0.2501 -0.0147 -0.0356 0.0094  249  CYS A O    
3722 C CB   A CYS A 249 ? 0.2010 0.3355 0.3037 0.0878  0.0008  -0.0378 249  CYS A CB   
3723 C CB   B CYS A 249 ? 0.1840 0.1656 0.2153 -0.0071 -0.0437 0.0109  249  CYS A CB   
3724 S SG   A CYS A 249 ? 0.6773 0.2962 0.7435 0.1920  -0.1149 -0.0923 249  CYS A SG   
3725 S SG   B CYS A 249 ? 0.1675 0.1490 0.2240 0.0009  -0.0465 -0.0181 249  CYS A SG   
3726 H H    . CYS A 249 ? 0.2249 0.2249 0.2249 0.0000  0.0000  0.0000  249  CYS A H    
3727 H HA   A CYS A 249 ? 0.2373 0.2373 0.2373 0.0000  0.0000  0.0000  249  CYS A HA   
3728 H HB2  A CYS A 249 ? 0.3361 0.3361 0.3361 0.0000  0.0000  0.0000  249  CYS A HB2  
3729 H HB2  B CYS A 249 ? 0.2259 0.2259 0.2259 0.0000  0.0000  0.0000  249  CYS A HB2  
3730 H HB3  A CYS A 249 ? 0.3361 0.3361 0.3361 0.0000  0.0000  0.0000  249  CYS A HB3  
3731 H HB3  B CYS A 249 ? 0.2259 0.2259 0.2259 0.0000  0.0000  0.0000  249  CYS A HB3  
3732 N N    . SER A 250 ? 0.1902 0.1662 0.2049 0.0057  -0.0563 -0.0146 250  SER A N    
3733 C CA   . SER A 250 ? 0.2033 0.1920 0.2086 0.0180  -0.0561 -0.0111 250  SER A CA   
3734 C C    . SER A 250 ? 0.1992 0.1731 0.2071 0.0143  -0.0604 -0.0118 250  SER A C    
3735 O O    . SER A 250 ? 0.2693 0.2153 0.2499 0.0558  -0.1134 -0.0345 250  SER A O    
3736 C CB   . SER A 250 ? 0.2180 0.1983 0.2819 0.0236  -0.0887 -0.0407 250  SER A CB   
3737 O OG   . SER A 250 ? 0.2339 0.2577 0.3899 -0.0413 -0.0928 0.0391  250  SER A OG   
3738 H H    . SER A 250 ? 0.2246 0.2246 0.2246 0.0000  0.0000  0.0000  250  SER A H    
3739 H HA   . SER A 250 ? 0.2415 0.2415 0.2415 0.0000  0.0000  0.0000  250  SER A HA   
3740 H HB2  . SER A 250 ? 0.2793 0.2793 0.2793 0.0000  0.0000  0.0000  250  SER A HB2  
3741 H HB3  . SER A 250 ? 0.2793 0.2793 0.2793 0.0000  0.0000  0.0000  250  SER A HB3  
3742 H HG   . SER A 250 ? 0.4407 0.4407 0.4407 0.0000  0.0000  0.0000  250  SER A HG   
3743 N N    . THR A 251 ? 0.1734 0.1695 0.2024 0.0150  -0.0476 -0.0086 251  THR A N    
3744 C CA   . THR A 251 ? 0.1598 0.2004 0.2113 0.0227  -0.0334 -0.0303 251  THR A CA   
3745 C C    . THR A 251 ? 0.1592 0.1849 0.2367 0.0132  -0.0482 -0.0375 251  THR A C    
3746 O O    . THR A 251 ? 0.1581 0.1770 0.2930 0.0081  -0.0245 -0.0333 251  THR A O    
3747 C CB   . THR A 251 ? 0.1973 0.2592 0.1876 0.0271  -0.0155 -0.0186 251  THR A CB   
3748 O OG1  . THR A 251 ? 0.1956 0.3194 0.2257 0.0171  -0.0143 0.0332  251  THR A OG1  
3749 C CG2  . THR A 251 ? 0.4509 0.3886 0.2216 0.1954  -0.1209 -0.1006 251  THR A CG2  
3750 H H    . THR A 251 ? 0.2181 0.2181 0.2181 0.0000  0.0000  0.0000  251  THR A H    
3751 H HA   . THR A 251 ? 0.2286 0.2286 0.2286 0.0000  0.0000  0.0000  251  THR A HA   
3752 H HB   . THR A 251 ? 0.2576 0.2576 0.2576 0.0000  0.0000  0.0000  251  THR A HB   
3753 H HG1  . THR A 251 ? 0.3703 0.3703 0.3703 0.0000  0.0000  0.0000  251  THR A HG1  
3754 H HG21 . THR A 251 ? 0.5305 0.5305 0.5305 0.0000  0.0000  0.0000  251  THR A HG21 
3755 H HG22 . THR A 251 ? 0.5305 0.5305 0.5305 0.0000  0.0000  0.0000  251  THR A HG22 
3756 H HG23 . THR A 251 ? 0.5305 0.5305 0.5305 0.0000  0.0000  0.0000  251  THR A HG23 
3757 N N    . ASN A 252 ? 0.1569 0.1915 0.2808 0.0210  -0.0537 -0.0684 252  ASN A N    
3758 C CA   . ASN A 252 ? 0.1677 0.1855 0.3645 0.0164  -0.0433 -0.1013 252  ASN A CA   
3759 C C    . ASN A 252 ? 0.1574 0.2188 0.3308 -0.0092 0.0133  -0.1193 252  ASN A C    
3760 O O    . ASN A 252 ? 0.2022 0.2599 0.3116 -0.0003 0.0279  -0.0759 252  ASN A O    
3761 C CB   . ASN A 252 ? 0.2340 0.1799 0.5943 0.0447  -0.1313 -0.0724 252  ASN A CB   
3762 C CG   . ASN A 252 ? 0.3799 0.2164 0.6114 0.0051  -0.2516 0.0092  252  ASN A CG   
3763 O OD1  . ASN A 252 ? 0.4083 0.5581 0.8916 -0.0435 -0.3208 -0.1245 252  ASN A OD1  
3764 N ND2  . ASN A 252 ? 0.4477 0.7151 0.5362 0.2006  -0.2679 -0.0552 252  ASN A ND2  
3765 H H    . ASN A 252 ? 0.2517 0.2517 0.2517 0.0000  0.0000  0.0000  252  ASN A H    
3766 H HA   . ASN A 252 ? 0.2871 0.2871 0.2871 0.0000  0.0000  0.0000  252  ASN A HA   
3767 H HB2  . ASN A 252 ? 0.4033 0.4033 0.4033 0.0000  0.0000  0.0000  252  ASN A HB2  
3768 H HB3  . ASN A 252 ? 0.4033 0.4033 0.4033 0.0000  0.0000  0.0000  252  ASN A HB3  
3769 H HD21 . ASN A 252 ? 0.6796 0.6796 0.6796 0.0000  0.0000  0.0000  252  ASN A HD21 
3770 H HD22 . ASN A 252 ? 0.6796 0.6796 0.6796 0.0000  0.0000  0.0000  252  ASN A HD22 
3771 N N    . LEU A 253 ? 0.1608 0.1296 0.2159 0.0031  -0.0277 -0.0101 253  LEU A N    
3772 C CA   . LEU A 253 ? 0.1515 0.1226 0.1813 0.0026  -0.0025 0.0011  253  LEU A CA   
3773 C C    . LEU A 253 ? 0.1414 0.1189 0.1826 -0.0032 -0.0027 0.0009  253  LEU A C    
3774 O O    . LEU A 253 ? 0.1696 0.1343 0.1771 -0.0061 -0.0095 0.0037  253  LEU A O    
3775 C CB   . LEU A 253 ? 0.1494 0.1173 0.1777 0.0064  -0.0017 -0.0045 253  LEU A CB   
3776 C CG   . LEU A 253 ? 0.1421 0.1313 0.2189 -0.0058 0.0057  0.0199  253  LEU A CG   
3777 C CD1  . LEU A 253 ? 0.1617 0.1336 0.2533 0.0180  0.0126  0.0317  253  LEU A CD1  
3778 C CD2  . LEU A 253 ? 0.1729 0.1554 0.2236 0.0008  0.0098  0.0397  253  LEU A CD2  
3779 H H    . LEU A 253 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  253  LEU A H    
3780 H HA   . LEU A 253 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  253  LEU A HA   
3781 H HB2  . LEU A 253 ? 0.1778 0.1778 0.1778 0.0000  0.0000  0.0000  253  LEU A HB2  
3782 H HB3  . LEU A 253 ? 0.1778 0.1778 0.1778 0.0000  0.0000  0.0000  253  LEU A HB3  
3783 H HG   . LEU A 253 ? 0.1969 0.1969 0.1969 0.0000  0.0000  0.0000  253  LEU A HG   
3784 H HD11 . LEU A 253 ? 0.2743 0.2743 0.2743 0.0000  0.0000  0.0000  253  LEU A HD11 
3785 H HD12 . LEU A 253 ? 0.2743 0.2743 0.2743 0.0000  0.0000  0.0000  253  LEU A HD12 
3786 H HD13 . LEU A 253 ? 0.2743 0.2743 0.2743 0.0000  0.0000  0.0000  253  LEU A HD13 
3787 H HD21 . LEU A 253 ? 0.2760 0.2760 0.2760 0.0000  0.0000  0.0000  253  LEU A HD21 
3788 H HD22 . LEU A 253 ? 0.2760 0.2760 0.2760 0.0000  0.0000  0.0000  253  LEU A HD22 
3789 H HD23 . LEU A 253 ? 0.2760 0.2760 0.2760 0.0000  0.0000  0.0000  253  LEU A HD23 
3790 N N    . PRO A 254 ? 0.1375 0.1257 0.1759 0.0033  -0.0026 0.0032  254  PRO A N    
3791 C CA   . PRO A 254 ? 0.1145 0.1181 0.1850 0.0025  -0.0026 -0.0014 254  PRO A CA   
3792 C C    . PRO A 254 ? 0.1145 0.1184 0.1489 0.0093  -0.0068 0.0080  254  PRO A C    
3793 O O    . PRO A 254 ? 0.1214 0.1230 0.1561 0.0104  -0.0053 0.0141  254  PRO A O    
3794 C CB   . PRO A 254 ? 0.1556 0.1504 0.2002 -0.0055 0.0362  -0.0103 254  PRO A CB   
3795 C CG   . PRO A 254 ? 0.2829 0.1615 0.2151 -0.0057 0.0702  -0.0024 254  PRO A CG   
3796 C CD   . PRO A 254 ? 0.1719 0.1340 0.1938 -0.0118 0.0212  0.0129  254  PRO A CD   
3797 H HA   . PRO A 254 ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  254  PRO A HA   
3798 H HB2  . PRO A 254 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  254  PRO A HB2  
3799 H HB3  . PRO A 254 ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  254  PRO A HB3  
3800 H HG2  . PRO A 254 ? 0.2638 0.2638 0.2638 0.0000  0.0000  0.0000  254  PRO A HG2  
3801 H HG3  . PRO A 254 ? 0.2638 0.2638 0.2638 0.0000  0.0000  0.0000  254  PRO A HG3  
3802 H HD2  . PRO A 254 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  254  PRO A HD2  
3803 H HD3  . PRO A 254 ? 0.1999 0.1999 0.1999 0.0000  0.0000  0.0000  254  PRO A HD3  
3804 N N    . ASP A 255 ? 0.1140 0.1202 0.1662 0.0065  -0.0237 0.0070  255  ASP A N    
3805 C CA   . ASP A 255 ? 0.1178 0.1163 0.1453 0.0065  -0.0104 -0.0029 255  ASP A CA   
3806 C C    . ASP A 255 ? 0.1114 0.1194 0.1458 0.0008  -0.0056 0.0000  255  ASP A C    
3807 O O    . ASP A 255 ? 0.1222 0.1472 0.1492 -0.0086 0.0065  -0.0075 255  ASP A O    
3808 C CB   . ASP A 255 ? 0.1448 0.1236 0.1529 0.0046  -0.0016 0.0062  255  ASP A CB   
3809 C CG   . ASP A 255 ? 0.1781 0.1463 0.1643 0.0294  -0.0263 0.0082  255  ASP A CG   
3810 O OD1  . ASP A 255 ? 0.1463 0.1707 0.1626 0.0327  -0.0231 0.0006  255  ASP A OD1  
3811 O OD2  . ASP A 255 ? 0.3394 0.2167 0.2173 0.1345  -0.0944 -0.0366 255  ASP A OD2  
3812 H H    . ASP A 255 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  255  ASP A H    
3813 H HA   . ASP A 255 ? 0.1517 0.1517 0.1517 0.0000  0.0000  0.0000  255  ASP A HA   
3814 H HB2  . ASP A 255 ? 0.1686 0.1686 0.1686 0.0000  0.0000  0.0000  255  ASP A HB2  
3815 H HB3  . ASP A 255 ? 0.1686 0.1686 0.1686 0.0000  0.0000  0.0000  255  ASP A HB3  
3816 N N    . PHE A 256 ? 0.1177 0.1160 0.1390 -0.0020 -0.0001 -0.0016 256  PHE A N    
3817 C CA   . PHE A 256 ? 0.1088 0.1187 0.1418 0.0014  0.0001  -0.0038 256  PHE A CA   
3818 C C    . PHE A 256 ? 0.1174 0.1235 0.1325 0.0040  -0.0013 0.0013  256  PHE A C    
3819 O O    . PHE A 256 ? 0.1583 0.1416 0.1437 -0.0191 0.0250  -0.0148 256  PHE A O    
3820 C CB   . PHE A 256 ? 0.1272 0.1224 0.1442 0.0130  -0.0069 -0.0030 256  PHE A CB   
3821 C CG   . PHE A 256 ? 0.1185 0.1197 0.1607 0.0180  -0.0189 -0.0038 256  PHE A CG   
3822 C CD1  . PHE A 256 ? 0.1358 0.1683 0.1477 0.0342  -0.0171 -0.0035 256  PHE A CD1  
3823 C CD2  . PHE A 256 ? 0.1276 0.1229 0.2021 0.0150  -0.0311 0.0048  256  PHE A CD2  
3824 C CE1  . PHE A 256 ? 0.1626 0.1927 0.1761 0.0713  -0.0436 -0.0257 256  PHE A CE1  
3825 C CE2  . PHE A 256 ? 0.1512 0.1310 0.2443 0.0190  -0.0561 -0.0224 256  PHE A CE2  
3826 C CZ   . PHE A 256 ? 0.1704 0.1628 0.2208 0.0591  -0.0716 -0.0420 256  PHE A CZ   
3827 H H    . PHE A 256 ? 0.1491 0.1491 0.1491 0.0000  0.0000  0.0000  256  PHE A H    
3828 H HA   . PHE A 256 ? 0.1477 0.1477 0.1477 0.0000  0.0000  0.0000  256  PHE A HA   
3829 H HB2  . PHE A 256 ? 0.1576 0.1576 0.1576 0.0000  0.0000  0.0000  256  PHE A HB2  
3830 H HB3  . PHE A 256 ? 0.1576 0.1576 0.1576 0.0000  0.0000  0.0000  256  PHE A HB3  
3831 H HD1  . PHE A 256 ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  256  PHE A HD1  
3832 H HD2  . PHE A 256 ? 0.1810 0.1810 0.1810 0.0000  0.0000  0.0000  256  PHE A HD2  
3833 H HE1  . PHE A 256 ? 0.2125 0.2125 0.2125 0.0000  0.0000  0.0000  256  PHE A HE1  
3834 H HE2  . PHE A 256 ? 0.2106 0.2106 0.2106 0.0000  0.0000  0.0000  256  PHE A HE2  
3835 H HZ   . PHE A 256 ? 0.2216 0.2216 0.2216 0.0000  0.0000  0.0000  256  PHE A HZ   
3836 N N    . SER A 257 ? 0.1149 0.1163 0.1327 -0.0021 -0.0047 -0.0001 257  SER A N    
3837 C CA   . SER A 257 ? 0.1365 0.1162 0.1317 -0.0065 -0.0079 0.0088  257  SER A CA   
3838 C C    . SER A 257 ? 0.1161 0.1214 0.1323 -0.0002 -0.0036 0.0006  257  SER A C    
3839 O O    . SER A 257 ? 0.1249 0.1335 0.1365 -0.0045 -0.0058 -0.0023 257  SER A O    
3840 C CB   A SER A 257 ? 0.1326 0.1172 0.1602 -0.0090 -0.0199 0.0066  257  SER A CB   
3841 C CB   B SER A 257 ? 0.1607 0.1425 0.1450 0.0141  -0.0125 0.0214  257  SER A CB   
3842 O OG   A SER A 257 ? 0.1477 0.1554 0.1374 -0.0094 -0.0140 0.0164  257  SER A OG   
3843 O OG   B SER A 257 ? 0.1408 0.1271 0.1898 0.0172  -0.0137 0.0106  257  SER A OG   
3844 H H    . SER A 257 ? 0.1455 0.1455 0.1455 0.0000  0.0000  0.0000  257  SER A H    
3845 H HA   A SER A 257 ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  257  SER A HA   
3846 H HB2  A SER A 257 ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  257  SER A HB2  
3847 H HB2  B SER A 257 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  257  SER A HB2  
3848 H HB3  A SER A 257 ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  257  SER A HB3  
3849 H HB3  B SER A 257 ? 0.1793 0.1793 0.1793 0.0000  0.0000  0.0000  257  SER A HB3  
3850 H HG   A SER A 257 ? 0.2202 0.2202 0.2202 0.0000  0.0000  0.0000  257  SER A HG   
3851 H HG   B SER A 257 ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  257  SER A HG   
3852 N N    . VAL A 258 ? 0.1258 0.1294 0.1257 -0.0039 -0.0051 0.0010  258  VAL A N    
3853 C CA   . VAL A 258 ? 0.1184 0.1218 0.1223 0.0037  -0.0044 0.0011  258  VAL A CA   
3854 C C    . VAL A 258 ? 0.1181 0.1234 0.1348 0.0006  -0.0107 -0.0007 258  VAL A C    
3855 O O    . VAL A 258 ? 0.1578 0.1228 0.1474 0.0019  -0.0095 0.0021  258  VAL A O    
3856 C CB   . VAL A 258 ? 0.1244 0.1182 0.1274 0.0032  -0.0074 -0.0042 258  VAL A CB   
3857 C CG1  . VAL A 258 ? 0.1315 0.1327 0.1501 -0.0009 -0.0003 0.0079  258  VAL A CG1  
3858 C CG2  . VAL A 258 ? 0.1333 0.1368 0.1401 0.0092  0.0040  -0.0015 258  VAL A CG2  
3859 H H    . VAL A 258 ? 0.1524 0.1524 0.1524 0.0000  0.0000  0.0000  258  VAL A H    
3860 H HA   . VAL A 258 ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  258  VAL A HA   
3861 H HB   . VAL A 258 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  258  VAL A HB   
3862 H HG11 . VAL A 258 ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  258  VAL A HG11 
3863 H HG12 . VAL A 258 ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  258  VAL A HG12 
3864 H HG13 . VAL A 258 ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  258  VAL A HG13 
3865 H HG21 . VAL A 258 ? 0.2050 0.2050 0.2050 0.0000  0.0000  0.0000  258  VAL A HG21 
3866 H HG22 . VAL A 258 ? 0.2050 0.2050 0.2050 0.0000  0.0000  0.0000  258  VAL A HG22 
3867 H HG23 . VAL A 258 ? 0.2050 0.2050 0.2050 0.0000  0.0000  0.0000  258  VAL A HG23 
3868 N N    . SER A 259 ? 0.1198 0.1209 0.1457 0.0059  -0.0093 -0.0058 259  SER A N    
3869 C CA   . SER A 259 ? 0.1258 0.1163 0.1806 0.0150  -0.0164 -0.0077 259  SER A CA   
3870 C C    . SER A 259 ? 0.1204 0.1157 0.1607 0.0162  -0.0082 -0.0107 259  SER A C    
3871 O O    . SER A 259 ? 0.1353 0.1565 0.1558 0.0218  -0.0174 -0.0191 259  SER A O    
3872 C CB   . SER A 259 ? 0.1137 0.1498 0.2814 0.0165  -0.0088 -0.0457 259  SER A CB   
3873 O OG   . SER A 259 ? 0.1760 0.1385 0.4188 0.0215  -0.0342 -0.0645 259  SER A OG   
3874 H H    . SER A 259 ? 0.1545 0.1545 0.1545 0.0000  0.0000  0.0000  259  SER A H    
3875 H HA   . SER A 259 ? 0.1691 0.1691 0.1691 0.0000  0.0000  0.0000  259  SER A HA   
3876 H HB2  . SER A 259 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  259  SER A HB2  
3877 H HB3  . SER A 259 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  259  SER A HB3  
3878 H HG   . SER A 259 ? 0.3667 0.3667 0.3667 0.0000  0.0000  0.0000  259  SER A HG   
3879 N N    . ILE A 260 ? 0.1286 0.1223 0.1627 0.0136  -0.0187 0.0021  260  ILE A N    
3880 C CA   . ILE A 260 ? 0.1256 0.1200 0.1858 0.0045  -0.0093 0.0037  260  ILE A CA   
3881 C C    . ILE A 260 ? 0.1307 0.1187 0.1800 0.0073  -0.0064 0.0001  260  ILE A C    
3882 O O    . ILE A 260 ? 0.1492 0.1216 0.1775 0.0117  -0.0046 -0.0063 260  ILE A O    
3883 C CB   . ILE A 260 ? 0.1357 0.1274 0.1959 0.0039  -0.0062 -0.0100 260  ILE A CB   
3884 C CG1  . ILE A 260 ? 0.1646 0.1184 0.2442 0.0152  -0.0038 -0.0034 260  ILE A CG1  
3885 C CG2  . ILE A 260 ? 0.1364 0.1591 0.2453 0.0082  0.0048  -0.0204 260  ILE A CG2  
3886 C CD1  . ILE A 260 ? 0.1211 0.1317 0.2370 0.0086  -0.0189 -0.0171 260  ILE A CD1  
3887 H H    . ILE A 260 ? 0.1654 0.1654 0.1654 0.0000  0.0000  0.0000  260  ILE A H    
3888 H HA   . ILE A 260 ? 0.1725 0.1725 0.1725 0.0000  0.0000  0.0000  260  ILE A HA   
3889 H HB   . ILE A 260 ? 0.1836 0.1836 0.1836 0.0000  0.0000  0.0000  260  ILE A HB   
3890 H HG12 . ILE A 260 ? 0.2109 0.2109 0.2109 0.0000  0.0000  0.0000  260  ILE A HG12 
3891 H HG13 . ILE A 260 ? 0.2109 0.2109 0.2109 0.0000  0.0000  0.0000  260  ILE A HG13 
3892 H HG21 . ILE A 260 ? 0.2704 0.2704 0.2704 0.0000  0.0000  0.0000  260  ILE A HG21 
3893 H HG22 . ILE A 260 ? 0.2704 0.2704 0.2704 0.0000  0.0000  0.0000  260  ILE A HG22 
3894 H HG23 . ILE A 260 ? 0.2704 0.2704 0.2704 0.0000  0.0000  0.0000  260  ILE A HG23 
3895 H HD11 . ILE A 260 ? 0.2449 0.2449 0.2449 0.0000  0.0000  0.0000  260  ILE A HD11 
3896 H HD12 . ILE A 260 ? 0.2449 0.2449 0.2449 0.0000  0.0000  0.0000  260  ILE A HD12 
3897 H HD13 . ILE A 260 ? 0.2449 0.2449 0.2449 0.0000  0.0000  0.0000  260  ILE A HD13 
3898 N N    . SER A 261 ? 0.1497 0.1265 0.1761 0.0062  -0.0052 -0.0049 261  SER A N    
3899 C CA   . SER A 261 ? 0.1530 0.1287 0.1893 0.0114  -0.0069 -0.0109 261  SER A CA   
3900 C C    . SER A 261 ? 0.1610 0.1201 0.1792 0.0100  -0.0011 -0.0106 261  SER A C    
3901 O O    . SER A 261 ? 0.1938 0.1282 0.1920 0.0115  0.0100  0.0031  261  SER A O    
3902 C CB   . SER A 261 ? 0.1575 0.1317 0.2501 0.0011  -0.0070 -0.0092 261  SER A CB   
3903 O OG   . SER A 261 ? 0.1626 0.1631 0.2670 0.0196  -0.0329 -0.0311 261  SER A OG   
3904 H H    . SER A 261 ? 0.1809 0.1809 0.1809 0.0000  0.0000  0.0000  261  SER A H    
3905 H HA   . SER A 261 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  261  SER A HA   
3906 H HB2  . SER A 261 ? 0.2157 0.2157 0.2157 0.0000  0.0000  0.0000  261  SER A HB2  
3907 H HB3  . SER A 261 ? 0.2157 0.2157 0.2157 0.0000  0.0000  0.0000  261  SER A HB3  
3908 H HG   . SER A 261 ? 0.2964 0.2964 0.2964 0.0000  0.0000  0.0000  261  SER A HG   
3909 N N    . GLY A 262 ? 0.1534 0.1326 0.1708 0.0210  -0.0091 0.0000  262  GLY A N    
3910 C CA   . GLY A 262 ? 0.1697 0.1478 0.1894 0.0346  -0.0066 0.0046  262  GLY A CA   
3911 C C    . GLY A 262 ? 0.1562 0.1768 0.1712 0.0365  -0.0106 0.0119  262  GLY A C    
3912 O O    . GLY A 262 ? 0.2015 0.2207 0.2188 0.0762  -0.0378 -0.0051 262  GLY A O    
3913 H H    . GLY A 262 ? 0.1828 0.1828 0.1828 0.0000  0.0000  0.0000  262  GLY A H    
3914 H HA2  . GLY A 262 ? 0.2028 0.2028 0.2028 0.0000  0.0000  0.0000  262  GLY A HA2  
3915 H HA3  . GLY A 262 ? 0.2028 0.2028 0.2028 0.0000  0.0000  0.0000  262  GLY A HA3  
3916 N N    . TYR A 263 ? 0.1660 0.1309 0.1661 0.0195  -0.0170 0.0128  263  TYR A N    
3917 C CA   . TYR A 263 ? 0.1656 0.1429 0.1627 0.0146  -0.0168 0.0086  263  TYR A CA   
3918 C C    . TYR A 263 ? 0.1628 0.1288 0.1546 0.0206  -0.0053 0.0138  263  TYR A C    
3919 O O    . TYR A 263 ? 0.1972 0.1410 0.1870 0.0143  -0.0398 0.0218  263  TYR A O    
3920 C CB   . TYR A 263 ? 0.1579 0.1541 0.1811 -0.0035 -0.0053 -0.0044 263  TYR A CB   
3921 C CG   . TYR A 263 ? 0.1392 0.1505 0.1720 0.0086  -0.0038 0.0093  263  TYR A CG   
3922 C CD1  . TYR A 263 ? 0.1821 0.1504 0.1593 0.0321  -0.0038 0.0205  263  TYR A CD1  
3923 C CD2  . TYR A 263 ? 0.1182 0.1610 0.1788 0.0041  -0.0187 0.0026  263  TYR A CD2  
3924 C CE1  . TYR A 263 ? 0.1671 0.1701 0.1523 0.0358  -0.0050 0.0192  263  TYR A CE1  
3925 C CE2  . TYR A 263 ? 0.1053 0.1537 0.1647 0.0095  -0.0031 0.0101  263  TYR A CE2  
3926 C CZ   . TYR A 263 ? 0.1410 0.1444 0.1413 0.0041  0.0138  0.0201  263  TYR A CZ   
3927 O OH   . TYR A 263 ? 0.1657 0.1531 0.1339 0.0132  0.0087  0.0200  263  TYR A OH   
3928 H H    . TYR A 263 ? 0.1852 0.1852 0.1852 0.0000  0.0000  0.0000  263  TYR A H    
3929 H HA   . TYR A 263 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  263  TYR A HA   
3930 H HB2  . TYR A 263 ? 0.1972 0.1972 0.1972 0.0000  0.0000  0.0000  263  TYR A HB2  
3931 H HB3  . TYR A 263 ? 0.1972 0.1972 0.1972 0.0000  0.0000  0.0000  263  TYR A HB3  
3932 H HD1  . TYR A 263 ? 0.1967 0.1967 0.1967 0.0000  0.0000  0.0000  263  TYR A HD1  
3933 H HD2  . TYR A 263 ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  263  TYR A HD2  
3934 H HE1  . TYR A 263 ? 0.1958 0.1958 0.1958 0.0000  0.0000  0.0000  263  TYR A HE1  
3935 H HE2  . TYR A 263 ? 0.1695 0.1695 0.1695 0.0000  0.0000  0.0000  263  TYR A HE2  
3936 H HH   . TYR A 263 ? 0.2263 0.2263 0.2263 0.0000  0.0000  0.0000  263  TYR A HH   
3937 N N    . THR A 264 ? 0.1759 0.1142 0.1639 0.0198  -0.0128 0.0184  264  THR A N    
3938 C CA   . THR A 264 ? 0.1770 0.1237 0.1530 0.0131  -0.0060 0.0167  264  THR A CA   
3939 C C    . THR A 264 ? 0.1773 0.1269 0.1439 0.0162  -0.0026 0.0189  264  THR A C    
3940 O O    . THR A 264 ? 0.1731 0.1467 0.1504 0.0203  -0.0074 0.0162  264  THR A O    
3941 C CB   . THR A 264 ? 0.1767 0.1232 0.1902 0.0185  0.0163  0.0042  264  THR A CB   
3942 O OG1  . THR A 264 ? 0.1753 0.1404 0.2236 0.0126  0.0272  -0.0156 264  THR A OG1  
3943 C CG2  . THR A 264 ? 0.1943 0.1342 0.2425 -0.0001 0.0212  0.0117  264  THR A CG2  
3944 H H    . THR A 264 ? 0.1816 0.1816 0.1816 0.0000  0.0000  0.0000  264  THR A H    
3945 H HA   . THR A 264 ? 0.1815 0.1815 0.1815 0.0000  0.0000  0.0000  264  THR A HA   
3946 H HB   . THR A 264 ? 0.1961 0.1961 0.1961 0.0000  0.0000  0.0000  264  THR A HB   
3947 H HG1  . THR A 264 ? 0.2696 0.2696 0.2696 0.0000  0.0000  0.0000  264  THR A HG1  
3948 H HG21 . THR A 264 ? 0.2855 0.2855 0.2855 0.0000  0.0000  0.0000  264  THR A HG21 
3949 H HG22 . THR A 264 ? 0.2855 0.2855 0.2855 0.0000  0.0000  0.0000  264  THR A HG22 
3950 H HG23 . THR A 264 ? 0.2855 0.2855 0.2855 0.0000  0.0000  0.0000  264  THR A HG23 
3951 N N    . ALA A 265 ? 0.1423 0.1141 0.1455 0.0028  -0.0038 0.0061  265  ALA A N    
3952 C CA   . ALA A 265 ? 0.1324 0.1195 0.1414 -0.0003 0.0054  0.0043  265  ALA A CA   
3953 C C    . ALA A 265 ? 0.1294 0.1219 0.1385 -0.0017 -0.0075 0.0072  265  ALA A C    
3954 O O    . ALA A 265 ? 0.1573 0.1396 0.1390 -0.0232 -0.0045 0.0110  265  ALA A O    
3955 C CB   . ALA A 265 ? 0.1267 0.1386 0.1580 0.0002  -0.0042 0.0137  265  ALA A CB   
3956 H H    . ALA A 265 ? 0.1607 0.1607 0.1607 0.0000  0.0000  0.0000  265  ALA A H    
3957 H HA   . ALA A 265 ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  265  ALA A HA   
3958 H HB1  . ALA A 265 ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  265  ALA A HB1  
3959 H HB2  . ALA A 265 ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  265  ALA A HB2  
3960 H HB3  . ALA A 265 ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  265  ALA A HB3  
3961 N N    . THR A 266 ? 0.1229 0.1215 0.1290 0.0040  -0.0043 0.0085  266  THR A N    
3962 C CA   . THR A 266 ? 0.1200 0.1262 0.1323 0.0048  -0.0038 0.0059  266  THR A CA   
3963 C C    . THR A 266 ? 0.1117 0.1386 0.1250 0.0016  -0.0088 0.0034  266  THR A C    
3964 O O    . THR A 266 ? 0.1432 0.1402 0.1288 0.0053  0.0057  0.0106  266  THR A O    
3965 C CB   . THR A 266 ? 0.1197 0.1485 0.1600 0.0097  -0.0122 0.0125  266  THR A CB   
3966 O OG1  . THR A 266 ? 0.1455 0.1657 0.1941 0.0320  -0.0130 0.0060  266  THR A OG1  
3967 C CG2  . THR A 266 ? 0.1332 0.1816 0.1977 -0.0080 -0.0305 0.0095  266  THR A CG2  
3968 H H    . THR A 266 ? 0.1493 0.1493 0.1493 0.0000  0.0000  0.0000  266  THR A H    
3969 H HA   . THR A 266 ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  266  THR A HA   
3970 H HB   . THR A 266 ? 0.1712 0.1712 0.1712 0.0000  0.0000  0.0000  266  THR A HB   
3971 H HG1  . THR A 266 ? 0.2527 0.2527 0.2527 0.0000  0.0000  0.0000  266  THR A HG1  
3972 H HG21 . THR A 266 ? 0.2562 0.2562 0.2562 0.0000  0.0000  0.0000  266  THR A HG21 
3973 H HG22 . THR A 266 ? 0.2562 0.2562 0.2562 0.0000  0.0000  0.0000  266  THR A HG22 
3974 H HG23 . THR A 266 ? 0.2562 0.2562 0.2562 0.0000  0.0000  0.0000  266  THR A HG23 
3975 N N    . VAL A 267 ? 0.1076 0.1268 0.1376 -0.0011 -0.0010 -0.0007 267  VAL A N    
3976 C CA   . VAL A 267 ? 0.1217 0.1268 0.1338 0.0037  -0.0076 -0.0045 267  VAL A CA   
3977 C C    . VAL A 267 ? 0.1217 0.1206 0.1388 0.0120  -0.0079 -0.0082 267  VAL A C    
3978 O O    . VAL A 267 ? 0.1231 0.1358 0.1460 -0.0032 -0.0037 -0.0088 267  VAL A O    
3979 C CB   . VAL A 267 ? 0.1124 0.1356 0.1363 0.0083  -0.0097 0.0084  267  VAL A CB   
3980 C CG1  . VAL A 267 ? 0.1400 0.1319 0.1651 0.0096  -0.0049 0.0087  267  VAL A CG1  
3981 C CG2  . VAL A 267 ? 0.1090 0.1481 0.1519 0.0056  -0.0110 0.0072  267  VAL A CG2  
3982 H H    . VAL A 267 ? 0.1488 0.1488 0.1488 0.0000  0.0000  0.0000  267  VAL A H    
3983 H HA   . VAL A 267 ? 0.1529 0.1529 0.1529 0.0000  0.0000  0.0000  267  VAL A HA   
3984 H HB   . VAL A 267 ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  267  VAL A HB   
3985 H HG11 . VAL A 267 ? 0.2185 0.2185 0.2185 0.0000  0.0000  0.0000  267  VAL A HG11 
3986 H HG12 . VAL A 267 ? 0.2185 0.2185 0.2185 0.0000  0.0000  0.0000  267  VAL A HG12 
3987 H HG13 . VAL A 267 ? 0.2185 0.2185 0.2185 0.0000  0.0000  0.0000  267  VAL A HG13 
3988 H HG21 . VAL A 267 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  267  VAL A HG21 
3989 H HG22 . VAL A 267 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  267  VAL A HG22 
3990 H HG23 . VAL A 267 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  267  VAL A HG23 
3991 N N    . PRO A 268 ? 0.1225 0.1422 0.1436 -0.0039 -0.0142 -0.0014 268  PRO A N    
3992 C CA   . PRO A 268 ? 0.1324 0.1479 0.1565 -0.0012 -0.0266 -0.0015 268  PRO A CA   
3993 C C    . PRO A 268 ? 0.1139 0.1445 0.1452 0.0065  -0.0186 -0.0030 268  PRO A C    
3994 O O    . PRO A 268 ? 0.1254 0.1388 0.1571 0.0078  -0.0239 -0.0179 268  PRO A O    
3995 C CB   . PRO A 268 ? 0.1602 0.1688 0.1605 -0.0017 -0.0368 0.0092  268  PRO A CB   
3996 C CG   . PRO A 268 ? 0.2150 0.6239 0.1517 -0.1482 -0.0096 -0.0283 268  PRO A CG   
3997 C CD   . PRO A 268 ? 0.1340 0.1796 0.1441 0.0030  -0.0052 -0.0081 268  PRO A CD   
3998 H HA   . PRO A 268 ? 0.1748 0.1748 0.1748 0.0000  0.0000  0.0000  268  PRO A HA   
3999 H HB2  . PRO A 268 ? 0.1958 0.1958 0.1958 0.0000  0.0000  0.0000  268  PRO A HB2  
4000 H HB3  . PRO A 268 ? 0.1958 0.1958 0.1958 0.0000  0.0000  0.0000  268  PRO A HB3  
4001 H HG2  . PRO A 268 ? 0.3963 0.3963 0.3963 0.0000  0.0000  0.0000  268  PRO A HG2  
4002 H HG3  . PRO A 268 ? 0.3963 0.3963 0.3963 0.0000  0.0000  0.0000  268  PRO A HG3  
4003 H HD2  . PRO A 268 ? 0.1831 0.1831 0.1831 0.0000  0.0000  0.0000  268  PRO A HD2  
4004 H HD3  . PRO A 268 ? 0.1831 0.1831 0.1831 0.0000  0.0000  0.0000  268  PRO A HD3  
4005 N N    . GLY A 269 ? 0.1202 0.1422 0.1660 0.0040  -0.0310 0.0036  269  GLY A N    
4006 C CA   . GLY A 269 ? 0.1298 0.1502 0.1535 0.0050  -0.0190 0.0067  269  GLY A CA   
4007 C C    . GLY A 269 ? 0.1123 0.1408 0.1679 -0.0020 -0.0191 0.0096  269  GLY A C    
4008 O O    . GLY A 269 ? 0.1291 0.1379 0.1747 -0.0030 -0.0137 0.0112  269  GLY A O    
4009 H H    . GLY A 269 ? 0.1714 0.1714 0.1714 0.0000  0.0000  0.0000  269  GLY A H    
4010 H HA2  . GLY A 269 ? 0.1734 0.1734 0.1734 0.0000  0.0000  0.0000  269  GLY A HA2  
4011 H HA3  . GLY A 269 ? 0.1734 0.1734 0.1734 0.0000  0.0000  0.0000  269  GLY A HA3  
4012 N N    . SER A 270 ? 0.1251 0.1430 0.1550 -0.0021 -0.0285 -0.0068 270  SER A N    
4013 C CA   . SER A 270 ? 0.1395 0.1719 0.1723 -0.0010 -0.0368 -0.0368 270  SER A CA   
4014 C C    . SER A 270 ? 0.1355 0.1538 0.1653 0.0059  -0.0178 -0.0270 270  SER A C    
4015 O O    . SER A 270 ? 0.1605 0.1668 0.2322 0.0154  -0.0316 -0.0659 270  SER A O    
4016 C CB   . SER A 270 ? 0.1753 0.2473 0.1667 0.0267  -0.0406 -0.0420 270  SER A CB   
4017 O OG   . SER A 270 ? 0.2767 0.2791 0.1836 0.0001  -0.0150 0.0146  270  SER A OG   
4018 H H    . SER A 270 ? 0.1692 0.1692 0.1692 0.0000  0.0000  0.0000  270  SER A H    
4019 H HA   . SER A 270 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  270  SER A HA   
4020 H HB2  . SER A 270 ? 0.2357 0.2357 0.2357 0.0000  0.0000  0.0000  270  SER A HB2  
4021 H HB3  . SER A 270 ? 0.2357 0.2357 0.2357 0.0000  0.0000  0.0000  270  SER A HB3  
4022 H HG   . SER A 270 ? 0.3697 0.3697 0.3697 0.0000  0.0000  0.0000  270  SER A HG   
4023 N N    . LEU A 271 ? 0.1368 0.1449 0.1438 -0.0025 -0.0186 0.0005  271  LEU A N    
4024 C CA   . LEU A 271 ? 0.1239 0.1495 0.1467 0.0064  -0.0112 -0.0109 271  LEU A CA   
4025 C C    . LEU A 271 ? 0.1195 0.1583 0.1369 0.0084  -0.0099 -0.0149 271  LEU A C    
4026 O O    . LEU A 271 ? 0.1166 0.2296 0.1524 0.0255  -0.0144 0.0020  271  LEU A O    
4027 C CB   . LEU A 271 ? 0.1304 0.1651 0.1985 -0.0135 0.0058  -0.0204 271  LEU A CB   
4028 C CG   . LEU A 271 ? 0.1373 0.1671 0.2499 0.0081  0.0239  0.0318  271  LEU A CG   
4029 C CD1  . LEU A 271 ? 0.1310 0.1815 0.3628 -0.0053 0.0546  0.0191  271  LEU A CD1  
4030 C CD2  . LEU A 271 ? 0.2222 0.2042 0.2048 0.0149  0.0502  0.0330  271  LEU A CD2  
4031 H H    . LEU A 271 ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  271  LEU A H    
4032 H HA   . LEU A 271 ? 0.1681 0.1681 0.1681 0.0000  0.0000  0.0000  271  LEU A HA   
4033 H HB2  . LEU A 271 ? 0.1976 0.1976 0.1976 0.0000  0.0000  0.0000  271  LEU A HB2  
4034 H HB3  . LEU A 271 ? 0.1976 0.1976 0.1976 0.0000  0.0000  0.0000  271  LEU A HB3  
4035 H HG   . LEU A 271 ? 0.2218 0.2218 0.2218 0.0000  0.0000  0.0000  271  LEU A HG   
4036 H HD11 . LEU A 271 ? 0.3377 0.3377 0.3377 0.0000  0.0000  0.0000  271  LEU A HD11 
4037 H HD12 . LEU A 271 ? 0.3377 0.3377 0.3377 0.0000  0.0000  0.0000  271  LEU A HD12 
4038 H HD13 . LEU A 271 ? 0.3377 0.3377 0.3377 0.0000  0.0000  0.0000  271  LEU A HD13 
4039 H HD21 . LEU A 271 ? 0.3156 0.3156 0.3156 0.0000  0.0000  0.0000  271  LEU A HD21 
4040 H HD22 . LEU A 271 ? 0.3156 0.3156 0.3156 0.0000  0.0000  0.0000  271  LEU A HD22 
4041 H HD23 . LEU A 271 ? 0.3156 0.3156 0.3156 0.0000  0.0000  0.0000  271  LEU A HD23 
4042 N N    . ILE A 272 ? 0.1199 0.1540 0.1443 0.0125  -0.0111 -0.0014 272  ILE A N    
4043 C CA   . ILE A 272 ? 0.1155 0.1445 0.1484 0.0051  -0.0111 -0.0032 272  ILE A CA   
4044 C C    . ILE A 272 ? 0.1303 0.1425 0.1369 0.0157  -0.0265 0.0011  272  ILE A C    
4045 O O    . ILE A 272 ? 0.1613 0.1440 0.1552 0.0072  -0.0316 0.0045  272  ILE A O    
4046 C CB   . ILE A 272 ? 0.1107 0.1464 0.1448 0.0080  -0.0129 -0.0043 272  ILE A CB   
4047 C CG1  . ILE A 272 ? 0.1499 0.1486 0.1543 -0.0003 -0.0087 -0.0136 272  ILE A CG1  
4048 C CG2  . ILE A 272 ? 0.1727 0.1643 0.1418 0.0306  -0.0109 -0.0019 272  ILE A CG2  
4049 C CD1  . ILE A 272 ? 0.1588 0.1416 0.1637 0.0023  -0.0102 -0.0045 272  ILE A CD1  
4050 H H    . ILE A 272 ? 0.1673 0.1673 0.1673 0.0000  0.0000  0.0000  272  ILE A H    
4051 H HA   . ILE A 272 ? 0.1634 0.1634 0.1634 0.0000  0.0000  0.0000  272  ILE A HA   
4052 H HB   . ILE A 272 ? 0.1607 0.1607 0.1607 0.0000  0.0000  0.0000  272  ILE A HB   
4053 H HG12 . ILE A 272 ? 0.1811 0.1811 0.1811 0.0000  0.0000  0.0000  272  ILE A HG12 
4054 H HG13 . ILE A 272 ? 0.1811 0.1811 0.1811 0.0000  0.0000  0.0000  272  ILE A HG13 
4055 H HG21 . ILE A 272 ? 0.2394 0.2394 0.2394 0.0000  0.0000  0.0000  272  ILE A HG21 
4056 H HG22 . ILE A 272 ? 0.2394 0.2394 0.2394 0.0000  0.0000  0.0000  272  ILE A HG22 
4057 H HG23 . ILE A 272 ? 0.2394 0.2394 0.2394 0.0000  0.0000  0.0000  272  ILE A HG23 
4058 H HD11 . ILE A 272 ? 0.2320 0.2320 0.2320 0.0000  0.0000  0.0000  272  ILE A HD11 
4059 H HD12 . ILE A 272 ? 0.2320 0.2320 0.2320 0.0000  0.0000  0.0000  272  ILE A HD12 
4060 H HD13 . ILE A 272 ? 0.2320 0.2320 0.2320 0.0000  0.0000  0.0000  272  ILE A HD13 
4061 N N    . ASN A 273 ? 0.1500 0.1389 0.1466 0.0064  -0.0195 -0.0001 273  ASN A N    
4062 C CA   . ASN A 273 ? 0.1362 0.1427 0.1538 -0.0056 -0.0144 0.0024  273  ASN A CA   
4063 C C    . ASN A 273 ? 0.1318 0.1395 0.1513 -0.0113 -0.0070 -0.0059 273  ASN A C    
4064 O O    . ASN A 273 ? 0.1561 0.1709 0.1552 0.0080  0.0025  0.0061  273  ASN A O    
4065 C CB   . ASN A 273 ? 0.1462 0.1657 0.1752 -0.0093 -0.0329 -0.0131 273  ASN A CB   
4066 C CG   . ASN A 273 ? 0.1615 0.1717 0.2210 -0.0112 -0.0576 -0.0179 273  ASN A CG   
4067 O OD1  . ASN A 273 ? 0.1845 0.1633 0.2220 -0.0172 -0.0423 -0.0080 273  ASN A OD1  
4068 N ND2  . ASN A 273 ? 0.2120 0.1990 0.3654 -0.0372 -0.1076 -0.0136 273  ASN A ND2  
4069 H H    . ASN A 273 ? 0.1741 0.1741 0.1741 0.0000  0.0000  0.0000  273  ASN A H    
4070 H HA   . ASN A 273 ? 0.1731 0.1731 0.1731 0.0000  0.0000  0.0000  273  ASN A HA   
4071 H HB2  . ASN A 273 ? 0.1948 0.1948 0.1948 0.0000  0.0000  0.0000  273  ASN A HB2  
4072 H HB3  . ASN A 273 ? 0.1948 0.1948 0.1948 0.0000  0.0000  0.0000  273  ASN A HB3  
4073 H HD21 . ASN A 273 ? 0.3105 0.3105 0.3105 0.0000  0.0000  0.0000  273  ASN A HD21 
4074 H HD22 . ASN A 273 ? 0.3105 0.3105 0.3105 0.0000  0.0000  0.0000  273  ASN A HD22 
4075 N N    . TYR A 274 ? 0.1426 0.1353 0.1536 -0.0023 -0.0104 -0.0007 274  TYR A N    
4076 C CA   . TYR A 274 ? 0.1325 0.1389 0.1675 -0.0001 0.0008  -0.0041 274  TYR A CA   
4077 C C    . TYR A 274 ? 0.1429 0.1706 0.1833 -0.0065 0.0036  -0.0214 274  TYR A C    
4078 O O    . TYR A 274 ? 0.1590 0.1977 0.1783 -0.0051 -0.0007 -0.0375 274  TYR A O    
4079 C CB   . TYR A 274 ? 0.1307 0.1522 0.1620 -0.0036 -0.0017 -0.0024 274  TYR A CB   
4080 C CG   . TYR A 274 ? 0.1261 0.1556 0.1721 -0.0022 -0.0079 -0.0007 274  TYR A CG   
4081 C CD1  . TYR A 274 ? 0.1298 0.1548 0.1525 -0.0079 -0.0064 -0.0243 274  TYR A CD1  
4082 C CD2  . TYR A 274 ? 0.1307 0.1698 0.2216 -0.0032 0.0149  0.0207  274  TYR A CD2  
4083 C CE1  . TYR A 274 ? 0.1289 0.1592 0.1515 -0.0137 -0.0085 -0.0019 274  TYR A CE1  
4084 C CE2  . TYR A 274 ? 0.1489 0.1567 0.2272 0.0051  0.0097  0.0333  274  TYR A CE2  
4085 C CZ   . TYR A 274 ? 0.1252 0.1638 0.1745 -0.0052 -0.0057 0.0022  274  TYR A CZ   
4086 O OH   . TYR A 274 ? 0.1408 0.1971 0.2103 0.0128  0.0051  0.0173  274  TYR A OH   
4087 H H    . TYR A 274 ? 0.1726 0.1726 0.1726 0.0000  0.0000  0.0000  274  TYR A H    
4088 H HA   . TYR A 274 ? 0.1755 0.1755 0.1755 0.0000  0.0000  0.0000  274  TYR A HA   
4089 H HB2  . TYR A 274 ? 0.1779 0.1779 0.1779 0.0000  0.0000  0.0000  274  TYR A HB2  
4090 H HB3  . TYR A 274 ? 0.1779 0.1779 0.1779 0.0000  0.0000  0.0000  274  TYR A HB3  
4091 H HD1  . TYR A 274 ? 0.1748 0.1748 0.1748 0.0000  0.0000  0.0000  274  TYR A HD1  
4092 H HD2  . TYR A 274 ? 0.2088 0.2088 0.2088 0.0000  0.0000  0.0000  274  TYR A HD2  
4093 H HE1  . TYR A 274 ? 0.1758 0.1758 0.1758 0.0000  0.0000  0.0000  274  TYR A HE1  
4094 H HE2  . TYR A 274 ? 0.2132 0.2132 0.2132 0.0000  0.0000  0.0000  274  TYR A HE2  
4095 H HH   . TYR A 274 ? 0.2741 0.2741 0.2741 0.0000  0.0000  0.0000  274  TYR A HH   
4096 N N    . GLY A 275 ? 0.2244 0.1810 0.2274 -0.0463 0.0498  -0.0562 275  GLY A N    
4097 C CA   . GLY A 275 ? 0.3009 0.1778 0.2875 -0.0591 0.0780  -0.0680 275  GLY A CA   
4098 C C    . GLY A 275 ? 0.2105 0.1591 0.2477 0.0005  0.0126  -0.0473 275  GLY A C    
4099 O O    . GLY A 275 ? 0.1791 0.1659 0.2458 -0.0247 0.0109  -0.0493 275  GLY A O    
4100 H H    . GLY A 275 ? 0.2532 0.2532 0.2532 0.0000  0.0000  0.0000  275  GLY A H    
4101 H HA2  . GLY A 275 ? 0.3065 0.3065 0.3065 0.0000  0.0000  0.0000  275  GLY A HA2  
4102 H HA3  . GLY A 275 ? 0.3065 0.3065 0.3065 0.0000  0.0000  0.0000  275  GLY A HA3  
4103 N N    . PRO A 276 ? 0.2848 0.1739 0.2696 -0.0492 0.0427  -0.0694 276  PRO A N    
4104 C CA   . PRO A 276 ? 0.2821 0.1586 0.2612 -0.0145 -0.0083 -0.0520 276  PRO A CA   
4105 C C    . PRO A 276 ? 0.2644 0.2323 0.2899 0.0578  -0.0172 -0.0635 276  PRO A C    
4106 O O    . PRO A 276 ? 0.2484 0.3554 0.4101 0.0932  -0.0132 -0.0049 276  PRO A O    
4107 C CB   . PRO A 276 ? 0.6276 0.1544 0.2946 0.0059  -0.0043 -0.0742 276  PRO A CB   
4108 C CG   . PRO A 276 ? 0.6382 0.2122 0.2696 -0.1026 0.0248  -0.0803 276  PRO A CG   
4109 C CD   . PRO A 276 ? 0.3911 0.2274 0.3466 -0.0867 0.1511  -0.1184 276  PRO A CD   
4110 H HA   . PRO A 276 ? 0.2808 0.2808 0.2808 0.0000  0.0000  0.0000  276  PRO A HA   
4111 H HB2  . PRO A 276 ? 0.4306 0.4306 0.4306 0.0000  0.0000  0.0000  276  PRO A HB2  
4112 H HB3  . PRO A 276 ? 0.4306 0.4306 0.4306 0.0000  0.0000  0.0000  276  PRO A HB3  
4113 H HG2  . PRO A 276 ? 0.4480 0.4480 0.4480 0.0000  0.0000  0.0000  276  PRO A HG2  
4114 H HG3  . PRO A 276 ? 0.4480 0.4480 0.4480 0.0000  0.0000  0.0000  276  PRO A HG3  
4115 H HD2  . PRO A 276 ? 0.3860 0.3860 0.3860 0.0000  0.0000  0.0000  276  PRO A HD2  
4116 H HD3  . PRO A 276 ? 0.3860 0.3860 0.3860 0.0000  0.0000  0.0000  276  PRO A HD3  
4117 N N    . SER A 277 ? 0.2584 0.2176 0.2698 0.0478  -0.0691 -0.0248 277  SER A N    
4118 C CA   . SER A 277 ? 0.3798 0.3370 0.2993 0.1458  -0.1168 -0.0240 277  SER A CA   
4119 C C    . SER A 277 ? 0.6149 0.3073 0.4215 0.1946  -0.1800 0.0163  277  SER A C    
4120 O O    . SER A 277 ? 0.4095 0.3598 0.5248 0.1145  -0.1564 0.0746  277  SER A O    
4121 C CB   . SER A 277 ? 0.4256 0.3775 0.2481 -0.0012 -0.0990 0.0837  277  SER A CB   
4122 O OG   . SER A 277 ? 0.5477 0.2966 0.3361 0.1073  -0.1327 0.0797  277  SER A OG   
4123 H H    . SER A 277 ? 0.2983 0.2983 0.2983 0.0000  0.0000  0.0000  277  SER A H    
4124 H HA   . SER A 277 ? 0.4064 0.4064 0.4064 0.0000  0.0000  0.0000  277  SER A HA   
4125 H HB2  . SER A 277 ? 0.4205 0.4205 0.4205 0.0000  0.0000  0.0000  277  SER A HB2  
4126 H HB3  . SER A 277 ? 0.4205 0.4205 0.4205 0.0000  0.0000  0.0000  277  SER A HB3  
4127 H HG   . SER A 277 ? 0.5902 0.5902 0.5902 0.0000  0.0000  0.0000  277  SER A HG   
4128 N N    . GLY A 278 ? 0.4811 0.3893 0.5200 0.1818  -0.0477 -0.0872 278  GLY A N    
4129 C CA   . GLY A 278 ? 0.7261 0.3746 0.6915 0.2801  0.0128  0.0249  278  GLY A CA   
4130 C C    . GLY A 278 ? 1.1568 0.4394 0.8336 0.1647  -0.0024 0.1804  278  GLY A C    
4131 O O    . GLY A 278 ? 1.6184 0.4302 1.0819 -0.0673 0.0702  0.0443  278  GLY A O    
4132 H H    . GLY A 278 ? 0.5561 0.5561 0.5561 0.0000  0.0000  0.0000  278  GLY A H    
4133 H HA2  . GLY A 278 ? 0.7168 0.7168 0.7168 0.0000  0.0000  0.0000  278  GLY A HA2  
4134 H HA3  . GLY A 278 ? 0.7168 0.7168 0.7168 0.0000  0.0000  0.0000  278  GLY A HA3  
4135 N N    . ASP A 279 ? 1.0789 0.8445 0.8862 -0.0303 -0.0306 0.2561  279  ASP A N    
4136 C CA   . ASP A 279 ? 0.9086 0.8815 0.9594 -0.0357 -0.0563 0.3266  279  ASP A CA   
4137 C C    . ASP A 279 ? 0.8602 0.7830 1.0122 0.1499  -0.0554 0.1264  279  ASP A C    
4138 O O    . ASP A 279 ? 0.9939 1.1164 1.1191 0.4490  -0.1882 -0.2062 279  ASP A O    
4139 C CB   . ASP A 279 ? 1.0610 1.1421 0.9869 -0.0470 -0.1034 0.4693  279  ASP A CB   
4140 C CG   . ASP A 279 ? 1.0737 1.3024 0.9564 0.0925  -0.0127 0.4448  279  ASP A CG   
4141 O OD1  . ASP A 279 ? 1.2202 1.5542 1.1025 0.2093  0.1508  0.4516  279  ASP A OD1  
4142 O OD2  . ASP A 279 ? 1.1384 1.4234 0.9489 0.1476  -0.1903 0.3153  279  ASP A OD2  
4143 H H    . ASP A 279 ? 1.1239 1.1239 1.1239 0.0000  0.0000  0.0000  279  ASP A H    
4144 H HA   . ASP A 279 ? 1.0998 1.0998 1.0998 0.0000  0.0000  0.0000  279  ASP A HA   
4145 H HB2  . ASP A 279 ? 1.2760 1.2760 1.2760 0.0000  0.0000  0.0000  279  ASP A HB2  
4146 H HB3  . ASP A 279 ? 1.2760 1.2760 1.2760 0.0000  0.0000  0.0000  279  ASP A HB3  
4147 N N    . GLY A 280 ? 0.9697 0.6650 0.9537 0.1624  -0.0605 0.1380  280  GLY A N    
4148 C CA   . GLY A 280 ? 0.8770 0.3805 0.8847 0.2269  0.0706  0.1123  280  GLY A CA   
4149 C C    . GLY A 280 ? 0.9146 0.4401 0.7059 0.1311  0.0448  0.0679  280  GLY A C    
4150 O O    . GLY A 280 ? 1.3295 0.4750 0.8285 -0.1557 0.2637  0.2416  280  GLY A O    
4151 H H    . GLY A 280 ? 1.0354 1.0354 1.0354 0.0000  0.0000  0.0000  280  GLY A H    
4152 H HA2  . GLY A 280 ? 0.8569 0.8569 0.8569 0.0000  0.0000  0.0000  280  GLY A HA2  
4153 H HA3  . GLY A 280 ? 0.8569 0.8569 0.8569 0.0000  0.0000  0.0000  280  GLY A HA3  
4154 N N    . SER A 281 ? 0.7937 0.2134 0.7901 0.0554  -0.2372 -0.1555 281  SER A N    
4155 C CA   . SER A 281 ? 0.6996 0.1940 0.6615 -0.1347 -0.1736 -0.0908 281  SER A CA   
4156 C C    . SER A 281 ? 0.4711 0.1904 0.5342 -0.0829 -0.2432 -0.0147 281  SER A C    
4157 O O    . SER A 281 ? 0.5023 0.6150 0.5770 0.0150  -0.3359 -0.0446 281  SER A O    
4158 C CB   . SER A 281 ? 0.6872 0.3334 0.7650 -0.1065 -0.1918 -0.2133 281  SER A CB   
4159 O OG   . SER A 281 ? 0.9569 0.6122 0.6604 -0.0882 -0.0751 -0.3236 281  SER A OG   
4160 H H    . SER A 281 ? 0.7189 0.7189 0.7189 0.0000  0.0000  0.0000  281  SER A H    
4161 H HA   . SER A 281 ? 0.6220 0.6220 0.6220 0.0000  0.0000  0.0000  281  SER A HA   
4162 H HB2  . SER A 281 ? 0.7142 0.7142 0.7142 0.0000  0.0000  0.0000  281  SER A HB2  
4163 H HB3  . SER A 281 ? 0.7142 0.7142 0.7142 0.0000  0.0000  0.0000  281  SER A HB3  
4164 H HG   . SER A 281 ? 1.1148 1.1148 1.1148 0.0000  0.0000  0.0000  281  SER A HG   
4165 N N    . THR A 282 ? 0.4087 0.1977 0.3577 -0.1677 -0.0588 0.0016  282  THR A N    
4166 C CA   . THR A 282 ? 0.2381 0.1891 0.2659 -0.0937 -0.0825 0.0393  282  THR A CA   
4167 C C    . THR A 282 ? 0.1851 0.1440 0.2472 -0.0521 -0.0789 0.0234  282  THR A C    
4168 O O    . THR A 282 ? 0.2345 0.1411 0.2705 -0.0286 -0.0638 0.0009  282  THR A O    
4169 C CB   . THR A 282 ? 0.2554 0.2091 0.2544 -0.0973 -0.0867 0.0658  282  THR A CB   
4170 O OG1  . THR A 282 ? 0.3422 0.2125 0.2723 -0.0084 -0.1080 0.0248  282  THR A OG1  
4171 C CG2  . THR A 282 ? 0.3706 0.3564 0.2838 -0.2120 -0.0698 0.0933  282  THR A CG2  
4172 H H    . THR A 282 ? 0.3857 0.3857 0.3857 0.0000  0.0000  0.0000  282  THR A H    
4173 H HA   . THR A 282 ? 0.2772 0.2772 0.2772 0.0000  0.0000  0.0000  282  THR A HA   
4174 H HB   . THR A 282 ? 0.2875 0.2875 0.2875 0.0000  0.0000  0.0000  282  THR A HB   
4175 H HG1  . THR A 282 ? 0.4135 0.4135 0.4135 0.0000  0.0000  0.0000  282  THR A HG1  
4176 H HG21 . THR A 282 ? 0.5053 0.5053 0.5053 0.0000  0.0000  0.0000  282  THR A HG21 
4177 H HG22 . THR A 282 ? 0.5053 0.5053 0.5053 0.0000  0.0000  0.0000  282  THR A HG22 
4178 H HG23 . THR A 282 ? 0.5053 0.5053 0.5053 0.0000  0.0000  0.0000  282  THR A HG23 
4179 N N    . CYS A 283 ? 0.1401 0.1562 0.2394 -0.0339 -0.0377 0.0194  283  CYS A N    
4180 C CA   . CYS A 283 ? 0.1379 0.1306 0.2009 -0.0252 -0.0269 0.0065  283  CYS A CA   
4181 C C    . CYS A 283 ? 0.1413 0.1181 0.1790 -0.0186 -0.0219 0.0239  283  CYS A C    
4182 O O    . CYS A 283 ? 0.1272 0.1882 0.1695 -0.0234 -0.0181 0.0338  283  CYS A O    
4183 C CB   . CYS A 283 ? 0.1599 0.1458 0.1825 -0.0047 -0.0189 -0.0044 283  CYS A CB   
4184 S SG   . CYS A 283 ? 0.1974 0.2018 0.2040 -0.0094 -0.0400 -0.0141 283  CYS A SG   
4185 H H    . CYS A 283 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  283  CYS A H    
4186 H HA   . CYS A 283 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  283  CYS A HA   
4187 H HB2  . CYS A 283 ? 0.1953 0.1953 0.1953 0.0000  0.0000  0.0000  283  CYS A HB2  
4188 H HB3  . CYS A 283 ? 0.1953 0.1953 0.1953 0.0000  0.0000  0.0000  283  CYS A HB3  
4189 N N    . LEU A 284 ? 0.1321 0.1264 0.2014 -0.0237 -0.0177 -0.0107 284  LEU A N    
4190 C CA   . LEU A 284 ? 0.1221 0.1186 0.1754 -0.0150 -0.0094 0.0096  284  LEU A CA   
4191 C C    . LEU A 284 ? 0.1168 0.1161 0.1568 -0.0172 -0.0101 0.0156  284  LEU A C    
4192 O O    . LEU A 284 ? 0.1309 0.1318 0.1434 -0.0175 -0.0072 0.0052  284  LEU A O    
4193 C CB   . LEU A 284 ? 0.1332 0.1152 0.1958 -0.0018 -0.0100 0.0023  284  LEU A CB   
4194 C CG   . LEU A 284 ? 0.1225 0.1287 0.1916 -0.0005 -0.0113 0.0058  284  LEU A CG   
4195 C CD1  . LEU A 284 ? 0.1471 0.1376 0.1976 -0.0073 -0.0127 0.0262  284  LEU A CD1  
4196 C CD2  . LEU A 284 ? 0.1300 0.1607 0.2139 -0.0082 -0.0152 0.0133  284  LEU A CD2  
4197 H H    . LEU A 284 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  284  LEU A H    
4198 H HA   . LEU A 284 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  284  LEU A HA   
4199 H HB2  . LEU A 284 ? 0.1777 0.1777 0.1777 0.0000  0.0000  0.0000  284  LEU A HB2  
4200 H HB3  . LEU A 284 ? 0.1777 0.1777 0.1777 0.0000  0.0000  0.0000  284  LEU A HB3  
4201 H HG   . LEU A 284 ? 0.1771 0.1771 0.1771 0.0000  0.0000  0.0000  284  LEU A HG   
4202 H HD11 . LEU A 284 ? 0.2411 0.2411 0.2411 0.0000  0.0000  0.0000  284  LEU A HD11 
4203 H HD12 . LEU A 284 ? 0.2411 0.2411 0.2411 0.0000  0.0000  0.0000  284  LEU A HD12 
4204 H HD13 . LEU A 284 ? 0.2411 0.2411 0.2411 0.0000  0.0000  0.0000  284  LEU A HD13 
4205 H HD21 . LEU A 284 ? 0.2523 0.2523 0.2523 0.0000  0.0000  0.0000  284  LEU A HD21 
4206 H HD22 . LEU A 284 ? 0.2523 0.2523 0.2523 0.0000  0.0000  0.0000  284  LEU A HD22 
4207 H HD23 . LEU A 284 ? 0.2523 0.2523 0.2523 0.0000  0.0000  0.0000  284  LEU A HD23 
4208 N N    . GLY A 285 ? 0.1180 0.1204 0.1400 -0.0129 -0.0106 0.0111  285  GLY A N    
4209 C CA   . GLY A 285 ? 0.1081 0.1164 0.1423 -0.0094 -0.0131 0.0144  285  GLY A CA   
4210 C C    . GLY A 285 ? 0.0998 0.1189 0.1276 -0.0079 -0.0084 0.0035  285  GLY A C    
4211 O O    . GLY A 285 ? 0.1112 0.1195 0.1403 -0.0073 -0.0139 0.0118  285  GLY A O    
4212 H H    . GLY A 285 ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  285  GLY A H    
4213 H HA2  . GLY A 285 ? 0.1467 0.1467 0.1467 0.0000  0.0000  0.0000  285  GLY A HA2  
4214 H HA3  . GLY A 285 ? 0.1467 0.1467 0.1467 0.0000  0.0000  0.0000  285  GLY A HA3  
4215 N N    . GLY A 286 ? 0.1060 0.1165 0.1328 -0.0091 -0.0143 0.0128  286  GLY A N    
4216 C CA   . GLY A 286 ? 0.1071 0.1150 0.1301 -0.0097 -0.0082 0.0073  286  GLY A CA   
4217 C C    . GLY A 286 ? 0.0981 0.1125 0.1297 -0.0034 -0.0100 0.0088  286  GLY A C    
4218 O O    . GLY A 286 ? 0.0977 0.1357 0.1445 -0.0130 -0.0020 -0.0048 286  GLY A O    
4219 H H    . GLY A 286 ? 0.1421 0.1421 0.1421 0.0000  0.0000  0.0000  286  GLY A H    
4220 H HA2  . GLY A 286 ? 0.1408 0.1408 0.1408 0.0000  0.0000  0.0000  286  GLY A HA2  
4221 H HA3  . GLY A 286 ? 0.1408 0.1408 0.1408 0.0000  0.0000  0.0000  286  GLY A HA3  
4222 N N    . ILE A 287 ? 0.0933 0.1243 0.1308 -0.0049 -0.0041 0.0072  287  ILE A N    
4223 C CA   . ILE A 287 ? 0.1031 0.1124 0.1295 -0.0032 -0.0035 0.0064  287  ILE A CA   
4224 C C    . ILE A 287 ? 0.1031 0.1108 0.1382 -0.0062 -0.0009 0.0101  287  ILE A C    
4225 O O    . ILE A 287 ? 0.1045 0.1262 0.1431 -0.0075 -0.0068 0.0142  287  ILE A O    
4226 C CB   . ILE A 287 ? 0.1079 0.1201 0.1421 -0.0011 0.0006  0.0066  287  ILE A CB   
4227 C CG1  . ILE A 287 ? 0.1277 0.1194 0.1463 -0.0023 -0.0075 0.0127  287  ILE A CG1  
4228 C CG2  . ILE A 287 ? 0.1504 0.1307 0.1426 0.0097  0.0024  0.0030  287  ILE A CG2  
4229 C CD1  . ILE A 287 ? 0.1380 0.1407 0.1589 0.0194  -0.0157 0.0091  287  ILE A CD1  
4230 H H    . ILE A 287 ? 0.1393 0.1393 0.1393 0.0000  0.0000  0.0000  287  ILE A H    
4231 H HA   . ILE A 287 ? 0.1381 0.1381 0.1381 0.0000  0.0000  0.0000  287  ILE A HA   
4232 H HB   . ILE A 287 ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  287  ILE A HB   
4233 H HG12 . ILE A 287 ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  287  ILE A HG12 
4234 H HG13 . ILE A 287 ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  287  ILE A HG13 
4235 H HG21 . ILE A 287 ? 0.2119 0.2119 0.2119 0.0000  0.0000  0.0000  287  ILE A HG21 
4236 H HG22 . ILE A 287 ? 0.2119 0.2119 0.2119 0.0000  0.0000  0.0000  287  ILE A HG22 
4237 H HG23 . ILE A 287 ? 0.2119 0.2119 0.2119 0.0000  0.0000  0.0000  287  ILE A HG23 
4238 H HD11 . ILE A 287 ? 0.2189 0.2189 0.2189 0.0000  0.0000  0.0000  287  ILE A HD11 
4239 H HD12 . ILE A 287 ? 0.2189 0.2189 0.2189 0.0000  0.0000  0.0000  287  ILE A HD12 
4240 H HD13 . ILE A 287 ? 0.2189 0.2189 0.2189 0.0000  0.0000  0.0000  287  ILE A HD13 
4241 N N    . GLN A 288 ? 0.1075 0.1229 0.1280 -0.0074 0.0025  0.0110  288  GLN A N    
4242 C CA   . GLN A 288 ? 0.1096 0.1172 0.1384 -0.0004 -0.0068 0.0234  288  GLN A CA   
4243 C C    . GLN A 288 ? 0.1073 0.1304 0.1351 -0.0033 0.0072  0.0039  288  GLN A C    
4244 O O    . GLN A 288 ? 0.1152 0.1347 0.1363 -0.0173 0.0036  0.0021  288  GLN A O    
4245 C CB   . GLN A 288 ? 0.0955 0.1246 0.1371 -0.0146 -0.0053 0.0168  288  GLN A CB   
4246 C CG   . GLN A 288 ? 0.1168 0.1166 0.1399 -0.0070 -0.0092 0.0183  288  GLN A CG   
4247 C CD   . GLN A 288 ? 0.1184 0.1243 0.1450 -0.0161 -0.0154 0.0218  288  GLN A CD   
4248 O OE1  . GLN A 288 ? 0.1396 0.1431 0.1426 -0.0332 -0.0059 0.0249  288  GLN A OE1  
4249 N NE2  . GLN A 288 ? 0.1191 0.1358 0.1423 -0.0215 -0.0103 0.0234  288  GLN A NE2  
4250 H H    . GLN A 288 ? 0.1434 0.1434 0.1434 0.0000  0.0000  0.0000  288  GLN A H    
4251 H HA   . GLN A 288 ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  288  GLN A HA   
4252 H HB2  . GLN A 288 ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  288  GLN A HB2  
4253 H HB3  . GLN A 288 ? 0.1429 0.1429 0.1429 0.0000  0.0000  0.0000  288  GLN A HB3  
4254 H HG2  . GLN A 288 ? 0.1493 0.1493 0.1493 0.0000  0.0000  0.0000  288  GLN A HG2  
4255 H HG3  . GLN A 288 ? 0.1493 0.1493 0.1493 0.0000  0.0000  0.0000  288  GLN A HG3  
4256 H HE21 . GLN A 288 ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  288  GLN A HE21 
4257 H HE22 . GLN A 288 ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  288  GLN A HE22 
4258 N N    . SER A 289 ? 0.1338 0.1313 0.1353 -0.0186 -0.0047 0.0132  289  SER A N    
4259 C CA   . SER A 289 ? 0.1267 0.1578 0.1312 -0.0139 -0.0031 -0.0034 289  SER A CA   
4260 C C    . SER A 289 ? 0.1327 0.1317 0.1268 -0.0114 -0.0050 0.0142  289  SER A C    
4261 O O    . SER A 289 ? 0.1298 0.1393 0.1304 -0.0061 0.0031  0.0017  289  SER A O    
4262 C CB   . SER A 289 ? 0.1557 0.1802 0.1277 -0.0350 -0.0025 0.0133  289  SER A CB   
4263 O OG   . SER A 289 ? 0.1637 0.2128 0.1417 -0.0261 -0.0086 0.0207  289  SER A OG   
4264 H H    . SER A 289 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  289  SER A H    
4265 H HA   . SER A 289 ? 0.1663 0.1663 0.1663 0.0000  0.0000  0.0000  289  SER A HA   
4266 H HB2  . SER A 289 ? 0.1854 0.1854 0.1854 0.0000  0.0000  0.0000  289  SER A HB2  
4267 H HB3  . SER A 289 ? 0.1854 0.1854 0.1854 0.0000  0.0000  0.0000  289  SER A HB3  
4268 H HG   . SER A 289 ? 0.2591 0.2591 0.2591 0.0000  0.0000  0.0000  289  SER A HG   
4269 N N    . ASN A 290 ? 0.1290 0.1362 0.1312 -0.0037 0.0022  0.0009  290  ASN A N    
4270 C CA   . ASN A 290 ? 0.1245 0.1339 0.1170 -0.0070 -0.0038 0.0043  290  ASN A CA   
4271 C C    . ASN A 290 ? 0.1297 0.1311 0.1233 -0.0044 -0.0012 0.0160  290  ASN A C    
4272 O O    . ASN A 290 ? 0.1309 0.1427 0.1275 -0.0073 -0.0083 0.0180  290  ASN A O    
4273 C CB   . ASN A 290 ? 0.1329 0.1376 0.1232 -0.0009 -0.0060 0.0109  290  ASN A CB   
4274 C CG   . ASN A 290 ? 0.1217 0.1483 0.1415 -0.0063 0.0000  -0.0043 290  ASN A CG   
4275 O OD1  . ASN A 290 ? 0.1498 0.1736 0.1249 0.0094  0.0118  -0.0015 290  ASN A OD1  
4276 N ND2  . ASN A 290 ? 0.1604 0.1556 0.1833 -0.0041 0.0231  -0.0134 290  ASN A ND2  
4277 H H    . ASN A 290 ? 0.1586 0.1586 0.1586 0.0000  0.0000  0.0000  290  ASN A H    
4278 H HA   . ASN A 290 ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  290  ASN A HA   
4279 H HB2  . ASN A 290 ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  290  ASN A HB2  
4280 H HB3  . ASN A 290 ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  290  ASN A HB3  
4281 H HD21 . ASN A 290 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  290  ASN A HD21 
4282 H HD22 . ASN A 290 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  290  ASN A HD22 
4283 N N    . SER A 291 ? 0.1520 0.1506 0.1353 -0.0196 -0.0068 0.0216  291  SER A N    
4284 C CA   . SER A 291 ? 0.1586 0.1545 0.1309 -0.0207 -0.0102 0.0281  291  SER A CA   
4285 C C    . SER A 291 ? 0.1561 0.1446 0.1401 -0.0245 -0.0010 0.0191  291  SER A C    
4286 O O    . SER A 291 ? 0.1709 0.1614 0.1461 -0.0205 -0.0131 0.0283  291  SER A O    
4287 C CB   . SER A 291 ? 0.2064 0.1485 0.1432 0.0154  -0.0233 0.0130  291  SER A CB   
4288 O OG   . SER A 291 ? 0.2735 0.1558 0.1690 0.0216  -0.0336 -0.0004 291  SER A OG   
4289 H H    . SER A 291 ? 0.1752 0.1752 0.1752 0.0000  0.0000  0.0000  291  SER A H    
4290 H HA   . SER A 291 ? 0.1776 0.1776 0.1776 0.0000  0.0000  0.0000  291  SER A HA   
4291 H HB2  . SER A 291 ? 0.1992 0.1992 0.1992 0.0000  0.0000  0.0000  291  SER A HB2  
4292 H HB3  . SER A 291 ? 0.1992 0.1992 0.1992 0.0000  0.0000  0.0000  291  SER A HB3  
4293 H HG   . SER A 291 ? 0.2992 0.2992 0.2992 0.0000  0.0000  0.0000  291  SER A HG   
4294 N N    . GLY A 292 ? 0.1706 0.1787 0.1179 0.0025  0.0034  0.0149  292  GLY A N    
4295 C CA   . GLY A 292 ? 0.1937 0.1877 0.1179 0.0117  0.0146  0.0108  292  GLY A CA   
4296 C C    . GLY A 292 ? 0.1730 0.1673 0.1206 0.0288  -0.0015 0.0003  292  GLY A C    
4297 O O    . GLY A 292 ? 0.2170 0.2063 0.1208 0.0420  -0.0169 -0.0153 292  GLY A O    
4298 H H    . GLY A 292 ? 0.1869 0.1869 0.1869 0.0000  0.0000  0.0000  292  GLY A H    
4299 H HA2  . GLY A 292 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  292  GLY A HA2  
4300 H HA3  . GLY A 292 ? 0.1997 0.1997 0.1997 0.0000  0.0000  0.0000  292  GLY A HA3  
4301 N N    . ILE A 293 ? 0.1680 0.1532 0.1141 0.0172  -0.0119 -0.0008 293  ILE A N    
4302 C CA   . ILE A 293 ? 0.1824 0.1642 0.1298 0.0064  -0.0296 0.0095  293  ILE A CA   
4303 C C    . ILE A 293 ? 0.2204 0.1661 0.1181 -0.0120 -0.0201 0.0072  293  ILE A C    
4304 O O    . ILE A 293 ? 0.2726 0.2020 0.1486 -0.0556 -0.0074 -0.0207 293  ILE A O    
4305 C CB   . ILE A 293 ? 0.1575 0.1598 0.1471 -0.0054 -0.0352 0.0077  293  ILE A CB   
4306 C CG1  . ILE A 293 ? 0.1519 0.1502 0.1350 0.0103  -0.0100 0.0074  293  ILE A CG1  
4307 C CG2  . ILE A 293 ? 0.1661 0.1720 0.1719 0.0186  -0.0327 0.0184  293  ILE A CG2  
4308 C CD1  . ILE A 293 ? 0.1800 0.1699 0.1540 0.0147  0.0167  0.0061  293  ILE A CD1  
4309 H H    . ILE A 293 ? 0.1741 0.1741 0.1741 0.0000  0.0000  0.0000  293  ILE A H    
4310 H HA   . ILE A 293 ? 0.1906 0.1906 0.1906 0.0000  0.0000  0.0000  293  ILE A HA   
4311 H HB   . ILE A 293 ? 0.1858 0.1858 0.1858 0.0000  0.0000  0.0000  293  ILE A HB   
4312 H HG12 . ILE A 293 ? 0.1748 0.1748 0.1748 0.0000  0.0000  0.0000  293  ILE A HG12 
4313 H HG13 . ILE A 293 ? 0.1748 0.1748 0.1748 0.0000  0.0000  0.0000  293  ILE A HG13 
4314 H HG21 . ILE A 293 ? 0.2549 0.2549 0.2549 0.0000  0.0000  0.0000  293  ILE A HG21 
4315 H HG22 . ILE A 293 ? 0.2549 0.2549 0.2549 0.0000  0.0000  0.0000  293  ILE A HG22 
4316 H HG23 . ILE A 293 ? 0.2549 0.2549 0.2549 0.0000  0.0000  0.0000  293  ILE A HG23 
4317 H HD11 . ILE A 293 ? 0.2519 0.2519 0.2519 0.0000  0.0000  0.0000  293  ILE A HD11 
4318 H HD12 . ILE A 293 ? 0.2519 0.2519 0.2519 0.0000  0.0000  0.0000  293  ILE A HD12 
4319 H HD13 . ILE A 293 ? 0.2519 0.2519 0.2519 0.0000  0.0000  0.0000  293  ILE A HD13 
4320 N N    . GLY A 294 ? 0.2563 0.1555 0.1118 0.0305  -0.0003 -0.0016 294  GLY A N    
4321 C CA   . GLY A 294 ? 0.3039 0.1508 0.1258 0.0113  0.0114  -0.0080 294  GLY A CA   
4322 C C    . GLY A 294 ? 0.1859 0.1474 0.1213 0.0070  0.0001  -0.0198 294  GLY A C    
4323 O O    . GLY A 294 ? 0.1877 0.1436 0.1202 -0.0025 0.0051  -0.0196 294  GLY A O    
4324 H H    . GLY A 294 ? 0.2095 0.2095 0.2095 0.0000  0.0000  0.0000  294  GLY A H    
4325 H HA2  . GLY A 294 ? 0.2322 0.2322 0.2322 0.0000  0.0000  0.0000  294  GLY A HA2  
4326 H HA3  . GLY A 294 ? 0.2322 0.2322 0.2322 0.0000  0.0000  0.0000  294  GLY A HA3  
4327 N N    . PHE A 295 ? 0.1603 0.1274 0.1172 0.0223  -0.0015 -0.0087 295  PHE A N    
4328 C CA   . PHE A 295 ? 0.1273 0.1323 0.1127 0.0168  -0.0095 -0.0208 295  PHE A CA   
4329 C C    . PHE A 295 ? 0.1207 0.1254 0.1137 0.0159  -0.0018 -0.0070 295  PHE A C    
4330 O O    . PHE A 295 ? 0.1338 0.1244 0.1189 0.0111  -0.0018 -0.0111 295  PHE A O    
4331 C CB   . PHE A 295 ? 0.1316 0.1278 0.1282 0.0168  -0.0156 -0.0170 295  PHE A CB   
4332 C CG   . PHE A 295 ? 0.1236 0.1252 0.1337 0.0097  -0.0248 -0.0073 295  PHE A CG   
4333 C CD1  . PHE A 295 ? 0.1241 0.1569 0.1471 0.0173  -0.0297 -0.0065 295  PHE A CD1  
4334 C CD2  . PHE A 295 ? 0.1249 0.1494 0.1372 0.0221  -0.0152 -0.0077 295  PHE A CD2  
4335 C CE1  . PHE A 295 ? 0.1432 0.1526 0.1666 0.0268  -0.0415 -0.0042 295  PHE A CE1  
4336 C CE2  . PHE A 295 ? 0.1198 0.1538 0.1654 0.0167  -0.0126 -0.0151 295  PHE A CE2  
4337 C CZ   . PHE A 295 ? 0.1233 0.1587 0.1804 0.0368  -0.0236 -0.0118 295  PHE A CZ   
4338 H H    . PHE A 295 ? 0.1620 0.1620 0.1620 0.0000  0.0000  0.0000  295  PHE A H    
4339 H HA   . PHE A 295 ? 0.1489 0.1489 0.1489 0.0000  0.0000  0.0000  295  PHE A HA   
4340 H HB2  . PHE A 295 ? 0.1550 0.1550 0.1550 0.0000  0.0000  0.0000  295  PHE A HB2  
4341 H HB3  . PHE A 295 ? 0.1550 0.1550 0.1550 0.0000  0.0000  0.0000  295  PHE A HB3  
4342 H HD1  . PHE A 295 ? 0.1712 0.1712 0.1712 0.0000  0.0000  0.0000  295  PHE A HD1  
4343 H HD2  . PHE A 295 ? 0.1646 0.1646 0.1646 0.0000  0.0000  0.0000  295  PHE A HD2  
4344 H HE1  . PHE A 295 ? 0.1849 0.1849 0.1849 0.0000  0.0000  0.0000  295  PHE A HE1  
4345 H HE2  . PHE A 295 ? 0.1755 0.1755 0.1755 0.0000  0.0000  0.0000  295  PHE A HE2  
4346 H HZ   . PHE A 295 ? 0.1849 0.1849 0.1849 0.0000  0.0000  0.0000  295  PHE A HZ   
4347 N N    . SER A 296 ? 0.1224 0.1109 0.1098 0.0033  0.0020  -0.0098 296  SER A N    
4348 C CA   . SER A 296 ? 0.1071 0.1167 0.1142 -0.0005 -0.0004 -0.0083 296  SER A CA   
4349 C C    . SER A 296 ? 0.1055 0.1058 0.1074 0.0019  -0.0004 -0.0061 296  SER A C    
4350 O O    . SER A 296 ? 0.1151 0.1153 0.1239 -0.0063 0.0088  -0.0208 296  SER A O    
4351 C CB   . SER A 296 ? 0.1109 0.1195 0.1219 0.0070  -0.0026 -0.0127 296  SER A CB   
4352 O OG   . SER A 296 ? 0.1133 0.1488 0.1319 0.0095  0.0049  -0.0177 296  SER A OG   
4353 H H    . SER A 296 ? 0.1373 0.1373 0.1373 0.0000  0.0000  0.0000  296  SER A H    
4354 H HA   . SER A 296 ? 0.1351 0.1351 0.1351 0.0000  0.0000  0.0000  296  SER A HA   
4355 H HB2  . SER A 296 ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  296  SER A HB2  
4356 H HB3  . SER A 296 ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  296  SER A HB3  
4357 H HG   . SER A 296 ? 0.1969 0.1969 0.1969 0.0000  0.0000  0.0000  296  SER A HG   
4358 N N    . ILE A 297 ? 0.0997 0.1083 0.1017 -0.0002 0.0002  -0.0046 297  ILE A N    
4359 C CA   . ILE A 297 ? 0.0967 0.1054 0.1093 0.0004  0.0006  -0.0046 297  ILE A CA   
4360 C C    . ILE A 297 ? 0.0952 0.1055 0.1058 0.0078  0.0002  -0.0032 297  ILE A C    
4361 O O    . ILE A 297 ? 0.1046 0.1103 0.1084 -0.0025 -0.0038 -0.0025 297  ILE A O    
4362 C CB   . ILE A 297 ? 0.1176 0.1154 0.1073 0.0145  -0.0020 -0.0015 297  ILE A CB   
4363 C CG1  . ILE A 297 ? 0.1381 0.1369 0.1159 0.0236  -0.0116 -0.0035 297  ILE A CG1  
4364 C CG2  . ILE A 297 ? 0.1242 0.1350 0.1145 0.0138  -0.0015 -0.0052 297  ILE A CG2  
4365 C CD1  . ILE A 297 ? 0.1500 0.1516 0.1329 -0.0018 -0.0139 0.0047  297  ILE A CD1  
4366 H H    . ILE A 297 ? 0.1239 0.1239 0.1239 0.0000  0.0000  0.0000  297  ILE A H    
4367 H HA   . ILE A 297 ? 0.1245 0.1245 0.1245 0.0000  0.0000  0.0000  297  ILE A HA   
4368 H HB   . ILE A 297 ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  297  ILE A HB   
4369 H HG12 . ILE A 297 ? 0.1564 0.1564 0.1564 0.0000  0.0000  0.0000  297  ILE A HG12 
4370 H HG13 . ILE A 297 ? 0.1564 0.1564 0.1564 0.0000  0.0000  0.0000  297  ILE A HG13 
4371 H HG21 . ILE A 297 ? 0.1868 0.1868 0.1868 0.0000  0.0000  0.0000  297  ILE A HG21 
4372 H HG22 . ILE A 297 ? 0.1868 0.1868 0.1868 0.0000  0.0000  0.0000  297  ILE A HG22 
4373 H HG23 . ILE A 297 ? 0.1868 0.1868 0.1868 0.0000  0.0000  0.0000  297  ILE A HG23 
4374 H HD11 . ILE A 297 ? 0.2172 0.2172 0.2172 0.0000  0.0000  0.0000  297  ILE A HD11 
4375 H HD12 . ILE A 297 ? 0.2172 0.2172 0.2172 0.0000  0.0000  0.0000  297  ILE A HD12 
4376 H HD13 . ILE A 297 ? 0.2172 0.2172 0.2172 0.0000  0.0000  0.0000  297  ILE A HD13 
4377 N N    . PHE A 298 ? 0.1013 0.1100 0.1056 -0.0012 -0.0038 -0.0046 298  PHE A N    
4378 C CA   . PHE A 298 ? 0.0994 0.1105 0.1108 0.0023  -0.0012 -0.0025 298  PHE A CA   
4379 C C    . PHE A 298 ? 0.0998 0.1086 0.1007 0.0043  -0.0067 0.0001  298  PHE A C    
4380 O O    . PHE A 298 ? 0.1119 0.1097 0.1137 -0.0040 0.0060  -0.0027 298  PHE A O    
4381 C CB   . PHE A 298 ? 0.1090 0.1112 0.1115 0.0041  -0.0015 -0.0052 298  PHE A CB   
4382 C CG   . PHE A 298 ? 0.1210 0.1078 0.1186 0.0140  -0.0064 0.0003  298  PHE A CG   
4383 C CD1  . PHE A 298 ? 0.1436 0.1522 0.1263 0.0413  -0.0196 -0.0218 298  PHE A CD1  
4384 C CD2  . PHE A 298 ? 0.1227 0.1204 0.1288 0.0181  -0.0083 -0.0103 298  PHE A CD2  
4385 C CE1  . PHE A 298 ? 0.1763 0.1830 0.1199 0.0571  -0.0176 -0.0284 298  PHE A CE1  
4386 C CE2  . PHE A 298 ? 0.1348 0.1465 0.1441 0.0332  -0.0047 -0.0121 298  PHE A CE2  
4387 C CZ   . PHE A 298 ? 0.1550 0.1619 0.1261 0.0556  0.0038  -0.0049 298  PHE A CZ   
4388 H H    . PHE A 298 ? 0.1268 0.1268 0.1268 0.0000  0.0000  0.0000  298  PHE A H    
4389 H HA   . PHE A 298 ? 0.1283 0.1283 0.1283 0.0000  0.0000  0.0000  298  PHE A HA   
4390 H HB2  . PHE A 298 ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  298  PHE A HB2  
4391 H HB3  . PHE A 298 ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  298  PHE A HB3  
4392 H HD1  . PHE A 298 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  298  PHE A HD1  
4393 H HD2  . PHE A 298 ? 0.1488 0.1488 0.1488 0.0000  0.0000  0.0000  298  PHE A HD2  
4394 H HE1  . PHE A 298 ? 0.1916 0.1916 0.1916 0.0000  0.0000  0.0000  298  PHE A HE1  
4395 H HE2  . PHE A 298 ? 0.1702 0.1702 0.1702 0.0000  0.0000  0.0000  298  PHE A HE2  
4396 H HZ   . PHE A 298 ? 0.1772 0.1772 0.1772 0.0000  0.0000  0.0000  298  PHE A HZ   
4397 N N    . GLY A 299 ? 0.1013 0.1057 0.1088 -0.0009 0.0001  -0.0026 299  GLY A N    
4398 C CA   . GLY A 299 ? 0.0996 0.1054 0.1052 0.0039  -0.0079 -0.0039 299  GLY A CA   
4399 C C    . GLY A 299 ? 0.0935 0.1087 0.1127 0.0064  -0.0042 0.0011  299  GLY A C    
4400 O O    . GLY A 299 ? 0.1005 0.1059 0.1139 0.0062  -0.0104 0.0032  299  GLY A O    
4401 H H    . GLY A 299 ? 0.1263 0.1263 0.1263 0.0000  0.0000  0.0000  299  GLY A H    
4402 H HA2  . GLY A 299 ? 0.1241 0.1241 0.1241 0.0000  0.0000  0.0000  299  GLY A HA2  
4403 H HA3  . GLY A 299 ? 0.1241 0.1241 0.1241 0.0000  0.0000  0.0000  299  GLY A HA3  
4404 N N    . ASP A 300 ? 0.1021 0.1012 0.1037 0.0068  -0.0079 -0.0020 300  ASP A N    
4405 C CA   . ASP A 300 ? 0.1041 0.1046 0.1087 0.0037  -0.0072 -0.0033 300  ASP A CA   
4406 C C    . ASP A 300 ? 0.1093 0.0976 0.1072 0.0016  -0.0082 0.0010  300  ASP A C    
4407 O O    . ASP A 300 ? 0.1112 0.1126 0.1152 0.0081  -0.0040 -0.0002 300  ASP A O    
4408 C CB   . ASP A 300 ? 0.1019 0.1156 0.1136 0.0063  -0.0057 -0.0019 300  ASP A CB   
4409 C CG   . ASP A 300 ? 0.1041 0.1194 0.1055 0.0097  -0.0123 -0.0041 300  ASP A CG   
4410 O OD1  . ASP A 300 ? 0.1129 0.1145 0.1194 0.0000  -0.0028 -0.0041 300  ASP A OD1  
4411 O OD2  . ASP A 300 ? 0.1214 0.1162 0.1352 0.0124  -0.0155 -0.0105 300  ASP A OD2  
4412 H H    . ASP A 300 ? 0.1229 0.1229 0.1229 0.0000  0.0000  0.0000  300  ASP A H    
4413 H HA   . ASP A 300 ? 0.1269 0.1269 0.1269 0.0000  0.0000  0.0000  300  ASP A HA   
4414 H HB2  . ASP A 300 ? 0.1325 0.1325 0.1325 0.0000  0.0000  0.0000  300  ASP A HB2  
4415 H HB3  . ASP A 300 ? 0.1325 0.1325 0.1325 0.0000  0.0000  0.0000  300  ASP A HB3  
4416 N N    . ILE A 301 ? 0.0970 0.1067 0.1110 0.0065  -0.0127 0.0032  301  ILE A N    
4417 C CA   . ILE A 301 ? 0.1044 0.1137 0.1248 -0.0019 -0.0112 0.0006  301  ILE A CA   
4418 C C    . ILE A 301 ? 0.0945 0.1142 0.1188 0.0032  -0.0053 -0.0031 301  ILE A C    
4419 O O    . ILE A 301 ? 0.1089 0.1233 0.1280 0.0061  -0.0200 0.0020  301  ILE A O    
4420 C CB   . ILE A 301 ? 0.1044 0.1178 0.1129 0.0004  0.0000  0.0006  301  ILE A CB   
4421 C CG1  . ILE A 301 ? 0.1109 0.1172 0.1301 0.0031  -0.0072 0.0068  301  ILE A CG1  
4422 C CG2  . ILE A 301 ? 0.1069 0.1210 0.1428 0.0062  -0.0036 0.0046  301  ILE A CG2  
4423 C CD1  . ILE A 301 ? 0.1124 0.1209 0.1493 -0.0030 -0.0092 -0.0057 301  ILE A CD1  
4424 H H    . ILE A 301 ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  301  ILE A H    
4425 H HA   . ILE A 301 ? 0.1372 0.1372 0.1372 0.0000  0.0000  0.0000  301  ILE A HA   
4426 H HB   . ILE A 301 ? 0.1340 0.1340 0.1340 0.0000  0.0000  0.0000  301  ILE A HB   
4427 H HG12 . ILE A 301 ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  301  ILE A HG12 
4428 H HG13 . ILE A 301 ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  301  ILE A HG13 
4429 H HG21 . ILE A 301 ? 0.1853 0.1853 0.1853 0.0000  0.0000  0.0000  301  ILE A HG21 
4430 H HG22 . ILE A 301 ? 0.1853 0.1853 0.1853 0.0000  0.0000  0.0000  301  ILE A HG22 
4431 H HG23 . ILE A 301 ? 0.1853 0.1853 0.1853 0.0000  0.0000  0.0000  301  ILE A HG23 
4432 H HD11 . ILE A 301 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  301  ILE A HD11 
4433 H HD12 . ILE A 301 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  301  ILE A HD12 
4434 H HD13 . ILE A 301 ? 0.1912 0.1912 0.1912 0.0000  0.0000  0.0000  301  ILE A HD13 
4435 N N    . PHE A 302 ? 0.1039 0.1101 0.1117 0.0036  -0.0038 0.0054  302  PHE A N    
4436 C CA   . PHE A 302 ? 0.1068 0.1101 0.1067 0.0132  -0.0065 0.0031  302  PHE A CA   
4437 C C    . PHE A 302 ? 0.0930 0.1103 0.1141 0.0046  -0.0104 -0.0010 302  PHE A C    
4438 O O    . PHE A 302 ? 0.1147 0.1102 0.1158 0.0092  -0.0112 0.0024  302  PHE A O    
4439 C CB   . PHE A 302 ? 0.1251 0.1120 0.1163 0.0100  -0.0061 0.0006  302  PHE A CB   
4440 C CG   . PHE A 302 ? 0.1308 0.1097 0.1071 0.0140  -0.0061 -0.0011 302  PHE A CG   
4441 C CD1  . PHE A 302 ? 0.1241 0.1191 0.1293 0.0158  -0.0191 -0.0042 302  PHE A CD1  
4442 C CD2  . PHE A 302 ? 0.1280 0.1241 0.1233 0.0082  -0.0086 -0.0002 302  PHE A CD2  
4443 C CE1  . PHE A 302 ? 0.1548 0.1186 0.1427 0.0271  -0.0202 -0.0101 302  PHE A CE1  
4444 C CE2  . PHE A 302 ? 0.1681 0.1250 0.1291 -0.0086 -0.0115 -0.0078 302  PHE A CE2  
4445 C CZ   . PHE A 302 ? 0.1899 0.1064 0.1441 0.0026  -0.0131 -0.0032 302  PHE A CZ   
4446 H H    . PHE A 302 ? 0.1303 0.1303 0.1303 0.0000  0.0000  0.0000  302  PHE A H    
4447 H HA   . PHE A 302 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  302  PHE A HA   
4448 H HB2  . PHE A 302 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  302  PHE A HB2  
4449 H HB3  . PHE A 302 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  302  PHE A HB3  
4450 H HD1  . PHE A 302 ? 0.1489 0.1489 0.1489 0.0000  0.0000  0.0000  302  PHE A HD1  
4451 H HD2  . PHE A 302 ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  302  PHE A HD2  
4452 H HE1  . PHE A 302 ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  302  PHE A HE1  
4453 H HE2  . PHE A 302 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  302  PHE A HE2  
4454 H HZ   . PHE A 302 ? 0.1762 0.1762 0.1762 0.0000  0.0000  0.0000  302  PHE A HZ   
4455 N N    . LEU A 303 ? 0.1058 0.1065 0.1141 0.0034  -0.0060 0.0071  303  LEU A N    
4456 C CA   . LEU A 303 ? 0.1079 0.1150 0.1291 0.0043  -0.0004 0.0124  303  LEU A CA   
4457 C C    . LEU A 303 ? 0.0961 0.1189 0.1237 0.0094  0.0022  0.0121  303  LEU A C    
4458 O O    . LEU A 303 ? 0.1087 0.1394 0.1340 0.0085  0.0047  0.0316  303  LEU A O    
4459 C CB   . LEU A 303 ? 0.1110 0.1178 0.1341 0.0096  -0.0010 0.0118  303  LEU A CB   
4460 C CG   . LEU A 303 ? 0.1107 0.1179 0.1412 0.0027  -0.0058 0.0045  303  LEU A CG   
4461 C CD1  . LEU A 303 ? 0.1184 0.1505 0.1562 0.0214  -0.0127 0.0029  303  LEU A CD1  
4462 C CD2  . LEU A 303 ? 0.1396 0.1282 0.1900 -0.0163 -0.0133 0.0114  303  LEU A CD2  
4463 H H    . LEU A 303 ? 0.1306 0.1306 0.1306 0.0000  0.0000  0.0000  303  LEU A H    
4464 H HA   . LEU A 303 ? 0.1408 0.1408 0.1408 0.0000  0.0000  0.0000  303  LEU A HA   
4465 H HB2  . LEU A 303 ? 0.1451 0.1451 0.1451 0.0000  0.0000  0.0000  303  LEU A HB2  
4466 H HB3  . LEU A 303 ? 0.1451 0.1451 0.1451 0.0000  0.0000  0.0000  303  LEU A HB3  
4467 H HG   . LEU A 303 ? 0.1479 0.1479 0.1479 0.0000  0.0000  0.0000  303  LEU A HG   
4468 H HD11 . LEU A 303 ? 0.2125 0.2125 0.2125 0.0000  0.0000  0.0000  303  LEU A HD11 
4469 H HD12 . LEU A 303 ? 0.2125 0.2125 0.2125 0.0000  0.0000  0.0000  303  LEU A HD12 
4470 H HD13 . LEU A 303 ? 0.2125 0.2125 0.2125 0.0000  0.0000  0.0000  303  LEU A HD13 
4471 H HD21 . LEU A 303 ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  303  LEU A HD21 
4472 H HD22 . LEU A 303 ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  303  LEU A HD22 
4473 H HD23 . LEU A 303 ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  303  LEU A HD23 
4474 N N    . LYS A 304 ? 0.1252 0.1134 0.1121 0.0075  -0.0010 0.0073  304  LYS A N    
4475 C CA   . LYS A 304 ? 0.1418 0.1225 0.1107 0.0117  -0.0025 0.0024  304  LYS A CA   
4476 C C    . LYS A 304 ? 0.1278 0.1277 0.1152 0.0086  0.0017  0.0133  304  LYS A C    
4477 O O    . LYS A 304 ? 0.1641 0.1584 0.1198 0.0257  -0.0124 0.0055  304  LYS A O    
4478 C CB   . LYS A 304 ? 0.1267 0.1266 0.1238 0.0121  -0.0116 -0.0051 304  LYS A CB   
4479 C CG   . LYS A 304 ? 0.1293 0.1310 0.1427 0.0154  0.0012  -0.0079 304  LYS A CG   
4480 C CD   . LYS A 304 ? 0.1358 0.1298 0.1334 0.0037  -0.0163 -0.0048 304  LYS A CD   
4481 C CE   . LYS A 304 ? 0.1489 0.1430 0.1211 0.0064  0.0066  -0.0091 304  LYS A CE   
4482 N NZ   . LYS A 304 ? 0.1316 0.1432 0.1372 0.0082  0.0031  0.0014  304  LYS A NZ   
4483 H H    . LYS A 304 ? 0.1403 0.1403 0.1403 0.0000  0.0000  0.0000  304  LYS A H    
4484 H HA   . LYS A 304 ? 0.1500 0.1500 0.1500 0.0000  0.0000  0.0000  304  LYS A HA   
4485 H HB2  . LYS A 304 ? 0.1508 0.1508 0.1508 0.0000  0.0000  0.0000  304  LYS A HB2  
4486 H HB3  . LYS A 304 ? 0.1508 0.1508 0.1508 0.0000  0.0000  0.0000  304  LYS A HB3  
4487 H HG2  . LYS A 304 ? 0.1612 0.1612 0.1612 0.0000  0.0000  0.0000  304  LYS A HG2  
4488 H HG3  . LYS A 304 ? 0.1612 0.1612 0.1612 0.0000  0.0000  0.0000  304  LYS A HG3  
4489 H HD2  . LYS A 304 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  304  LYS A HD2  
4490 H HD3  . LYS A 304 ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  304  LYS A HD3  
4491 H HE2  . LYS A 304 ? 0.1652 0.1652 0.1652 0.0000  0.0000  0.0000  304  LYS A HE2  
4492 H HE3  . LYS A 304 ? 0.1652 0.1652 0.1652 0.0000  0.0000  0.0000  304  LYS A HE3  
4493 H HZ1  . LYS A 304 ? 0.2061 0.2061 0.2061 0.0000  0.0000  0.0000  304  LYS A HZ1  
4494 H HZ2  . LYS A 304 ? 0.2061 0.2061 0.2061 0.0000  0.0000  0.0000  304  LYS A HZ2  
4495 H HZ3  . LYS A 304 ? 0.2061 0.2061 0.2061 0.0000  0.0000  0.0000  304  LYS A HZ3  
4496 N N    . SER A 305 ? 0.1108 0.1163 0.1112 0.0005  -0.0051 0.0068  305  SER A N    
4497 C CA   . SER A 305 ? 0.1030 0.1195 0.1223 0.0008  -0.0086 0.0157  305  SER A CA   
4498 C C    . SER A 305 ? 0.1039 0.1210 0.1215 0.0048  -0.0119 0.0075  305  SER A C    
4499 O O    . SER A 305 ? 0.1104 0.1270 0.1332 0.0089  -0.0104 0.0184  305  SER A O    
4500 C CB   . SER A 305 ? 0.0998 0.1217 0.1386 -0.0004 -0.0040 0.0119  305  SER A CB   
4501 O OG   . SER A 305 ? 0.1107 0.1334 0.1249 0.0087  0.0010  0.0142  305  SER A OG   
4502 H H    . SER A 305 ? 0.1353 0.1353 0.1353 0.0000  0.0000  0.0000  305  SER A H    
4503 H HA   . SER A 305 ? 0.1379 0.1379 0.1379 0.0000  0.0000  0.0000  305  SER A HA   
4504 H HB2  . SER A 305 ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  305  SER A HB2  
4505 H HB3  . SER A 305 ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  305  SER A HB3  
4506 H HG   . SER A 305 ? 0.1845 0.1845 0.1845 0.0000  0.0000  0.0000  305  SER A HG   
4507 N N    . GLN A 306 ? 0.1105 0.1089 0.1163 0.0046  -0.0081 0.0115  306  GLN A N    
4508 C CA   . GLN A 306 ? 0.1044 0.1131 0.1213 0.0024  -0.0043 0.0075  306  GLN A CA   
4509 C C    . GLN A 306 ? 0.0993 0.1077 0.1245 0.0088  -0.0037 0.0092  306  GLN A C    
4510 O O    . GLN A 306 ? 0.1186 0.1141 0.1602 0.0042  0.0137  0.0146  306  GLN A O    
4511 C CB   . GLN A 306 ? 0.1109 0.1215 0.1276 0.0010  -0.0113 0.0020  306  GLN A CB   
4512 C CG   . GLN A 306 ? 0.1222 0.1274 0.1233 -0.0009 -0.0053 0.0000  306  GLN A CG   
4513 C CD   . GLN A 306 ? 0.1282 0.1416 0.1183 0.0087  0.0082  0.0009  306  GLN A CD   
4514 O OE1  . GLN A 306 ? 0.1438 0.1329 0.1516 0.0030  0.0154  -0.0008 306  GLN A OE1  
4515 N NE2  . GLN A 306 ? 0.1231 0.1396 0.1475 0.0107  -0.0001 0.0005  306  GLN A NE2  
4516 H H    . GLN A 306 ? 0.1343 0.1343 0.1343 0.0000  0.0000  0.0000  306  GLN A H    
4517 H HA   . GLN A 306 ? 0.1355 0.1355 0.1355 0.0000  0.0000  0.0000  306  GLN A HA   
4518 H HB2  . GLN A 306 ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  306  GLN A HB2  
4519 H HB3  . GLN A 306 ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  306  GLN A HB3  
4520 H HG2  . GLN A 306 ? 0.1492 0.1492 0.1492 0.0000  0.0000  0.0000  306  GLN A HG2  
4521 H HG3  . GLN A 306 ? 0.1492 0.1492 0.1492 0.0000  0.0000  0.0000  306  GLN A HG3  
4522 H HE21 . GLN A 306 ? 0.1641 0.1641 0.1641 0.0000  0.0000  0.0000  306  GLN A HE21 
4523 H HE22 . GLN A 306 ? 0.1641 0.1641 0.1641 0.0000  0.0000  0.0000  306  GLN A HE22 
4524 N N    . TYR A 307 ? 0.1054 0.1146 0.1152 0.0042  -0.0083 0.0119  307  TYR A N    
4525 C CA   . TYR A 307 ? 0.0937 0.1112 0.1156 0.0060  -0.0102 0.0089  307  TYR A CA   
4526 C C    . TYR A 307 ? 0.0985 0.1110 0.1224 -0.0022 -0.0054 0.0114  307  TYR A C    
4527 O O    . TYR A 307 ? 0.1168 0.1184 0.1261 0.0115  -0.0102 0.0000  307  TYR A O    
4528 C CB   . TYR A 307 ? 0.1108 0.1315 0.1118 0.0018  -0.0084 0.0131  307  TYR A CB   
4529 C CG   . TYR A 307 ? 0.1078 0.1309 0.1187 0.0019  -0.0102 0.0194  307  TYR A CG   
4530 C CD1  . TYR A 307 ? 0.1246 0.1252 0.1271 -0.0019 -0.0009 0.0111  307  TYR A CD1  
4531 C CD2  . TYR A 307 ? 0.1251 0.1309 0.1316 -0.0009 -0.0067 0.0185  307  TYR A CD2  
4532 C CE1  . TYR A 307 ? 0.1322 0.1400 0.1203 -0.0023 -0.0008 0.0027  307  TYR A CE1  
4533 C CE2  . TYR A 307 ? 0.1270 0.1288 0.1378 -0.0029 0.0001  0.0127  307  TYR A CE2  
4534 C CZ   . TYR A 307 ? 0.1133 0.1393 0.1159 -0.0043 -0.0089 0.0201  307  TYR A CZ   
4535 O OH   . TYR A 307 ? 0.1195 0.1624 0.1332 -0.0085 -0.0034 0.0293  307  TYR A OH   
4536 H H    . TYR A 307 ? 0.1341 0.1341 0.1341 0.0000  0.0000  0.0000  307  TYR A H    
4537 H HA   . TYR A 307 ? 0.1282 0.1282 0.1282 0.0000  0.0000  0.0000  307  TYR A HA   
4538 H HB2  . TYR A 307 ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  307  TYR A HB2  
4539 H HB3  . TYR A 307 ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  307  TYR A HB3  
4540 H HD1  . TYR A 307 ? 0.1507 0.1507 0.1507 0.0000  0.0000  0.0000  307  TYR A HD1  
4541 H HD2  . TYR A 307 ? 0.1550 0.1550 0.1550 0.0000  0.0000  0.0000  307  TYR A HD2  
4542 H HE1  . TYR A 307 ? 0.1570 0.1570 0.1570 0.0000  0.0000  0.0000  307  TYR A HE1  
4543 H HE2  . TYR A 307 ? 0.1574 0.1574 0.1574 0.0000  0.0000  0.0000  307  TYR A HE2  
4544 H HH   . TYR A 307 ? 0.2076 0.2076 0.2076 0.0000  0.0000  0.0000  307  TYR A HH   
4545 N N    . VAL A 308 ? 0.0985 0.1096 0.1142 0.0045  -0.0064 0.0012  308  VAL A N    
4546 C CA   . VAL A 308 ? 0.1073 0.1047 0.1146 -0.0005 -0.0107 0.0060  308  VAL A CA   
4547 C C    . VAL A 308 ? 0.1025 0.1096 0.1118 0.0085  -0.0031 0.0077  308  VAL A C    
4548 O O    . VAL A 308 ? 0.1052 0.1153 0.1278 0.0005  -0.0044 0.0051  308  VAL A O    
4549 C CB   . VAL A 308 ? 0.1131 0.1157 0.1183 -0.0060 -0.0072 0.0104  308  VAL A CB   
4550 C CG1  . VAL A 308 ? 0.1359 0.1316 0.1196 0.0001  -0.0164 0.0144  308  VAL A CG1  
4551 C CG2  . VAL A 308 ? 0.1217 0.1311 0.1359 -0.0103 -0.0041 0.0238  308  VAL A CG2  
4552 H H    . VAL A 308 ? 0.1289 0.1289 0.1289 0.0000  0.0000  0.0000  308  VAL A H    
4553 H HA   . VAL A 308 ? 0.1307 0.1307 0.1307 0.0000  0.0000  0.0000  308  VAL A HA   
4554 H HB   . VAL A 308 ? 0.1388 0.1388 0.1388 0.0000  0.0000  0.0000  308  VAL A HB   
4555 H HG11 . VAL A 308 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  308  VAL A HG11 
4556 H HG12 . VAL A 308 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  308  VAL A HG12 
4557 H HG13 . VAL A 308 ? 0.1935 0.1935 0.1935 0.0000  0.0000  0.0000  308  VAL A HG13 
4558 H HG21 . VAL A 308 ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  308  VAL A HG21 
4559 H HG22 . VAL A 308 ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  308  VAL A HG22 
4560 H HG23 . VAL A 308 ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  308  VAL A HG23 
4561 N N    . VAL A 309 ? 0.1005 0.1121 0.1206 0.0044  -0.0045 0.0014  309  VAL A N    
4562 C CA   . VAL A 309 ? 0.1089 0.1062 0.1212 0.0020  -0.0067 0.0037  309  VAL A CA   
4563 C C    . VAL A 309 ? 0.0962 0.1102 0.1274 0.0008  -0.0065 0.0079  309  VAL A C    
4564 O O    . VAL A 309 ? 0.1098 0.1282 0.1270 0.0162  -0.0061 -0.0094 309  VAL A O    
4565 C CB   . VAL A 309 ? 0.1207 0.1095 0.1248 0.0055  0.0017  0.0076  309  VAL A CB   
4566 C CG1  . VAL A 309 ? 0.1257 0.1215 0.1367 -0.0031 0.0022  0.0086  309  VAL A CG1  
4567 C CG2  . VAL A 309 ? 0.1394 0.1222 0.1414 0.0007  -0.0245 0.0177  309  VAL A CG2  
4568 H H    . VAL A 309 ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  309  VAL A H    
4569 H HA   . VAL A 309 ? 0.1345 0.1345 0.1345 0.0000  0.0000  0.0000  309  VAL A HA   
4570 H HB   . VAL A 309 ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  309  VAL A HB   
4571 H HG11 . VAL A 309 ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  309  VAL A HG11 
4572 H HG12 . VAL A 309 ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  309  VAL A HG12 
4573 H HG13 . VAL A 309 ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  309  VAL A HG13 
4574 H HG21 . VAL A 309 ? 0.2015 0.2015 0.2015 0.0000  0.0000  0.0000  309  VAL A HG21 
4575 H HG22 . VAL A 309 ? 0.2015 0.2015 0.2015 0.0000  0.0000  0.0000  309  VAL A HG22 
4576 H HG23 . VAL A 309 ? 0.2015 0.2015 0.2015 0.0000  0.0000  0.0000  309  VAL A HG23 
4577 N N    . PHE A 310 ? 0.1089 0.1042 0.1153 0.0040  -0.0067 0.0025  310  PHE A N    
4578 C CA   . PHE A 310 ? 0.0978 0.1149 0.1151 0.0029  -0.0092 -0.0006 310  PHE A CA   
4579 C C    . PHE A 310 ? 0.1101 0.1115 0.1151 0.0011  -0.0093 0.0020  310  PHE A C    
4580 O O    . PHE A 310 ? 0.1133 0.1198 0.1294 0.0022  -0.0015 -0.0053 310  PHE A O    
4581 C CB   . PHE A 310 ? 0.1028 0.1152 0.1165 0.0023  -0.0074 0.0022  310  PHE A CB   
4582 C CG   . PHE A 310 ? 0.1086 0.1089 0.1198 0.0072  -0.0037 -0.0009 310  PHE A CG   
4583 C CD1  . PHE A 310 ? 0.1213 0.1135 0.1200 0.0012  -0.0177 0.0033  310  PHE A CD1  
4584 C CD2  . PHE A 310 ? 0.1167 0.1068 0.1163 0.0095  -0.0030 -0.0029 310  PHE A CD2  
4585 C CE1  . PHE A 310 ? 0.1177 0.1276 0.1475 0.0011  -0.0195 -0.0030 310  PHE A CE1  
4586 C CE2  . PHE A 310 ? 0.1140 0.1158 0.1288 0.0111  0.0102  0.0016  310  PHE A CE2  
4587 C CZ   . PHE A 310 ? 0.1114 0.1124 0.1475 0.0046  0.0019  0.0016  310  PHE A CZ   
4588 H H    . PHE A 310 ? 0.1313 0.1313 0.1313 0.0000  0.0000  0.0000  310  PHE A H    
4589 H HA   . PHE A 310 ? 0.1311 0.1311 0.1311 0.0000  0.0000  0.0000  310  PHE A HA   
4590 H HB2  . PHE A 310 ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  310  PHE A HB2  
4591 H HB3  . PHE A 310 ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  310  PHE A HB3  
4592 H HD1  . PHE A 310 ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  310  PHE A HD1  
4593 H HD2  . PHE A 310 ? 0.1359 0.1359 0.1359 0.0000  0.0000  0.0000  310  PHE A HD2  
4594 H HE1  . PHE A 310 ? 0.1572 0.1572 0.1572 0.0000  0.0000  0.0000  310  PHE A HE1  
4595 H HE2  . PHE A 310 ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  310  PHE A HE2  
4596 H HZ   . PHE A 310 ? 0.1486 0.1486 0.1486 0.0000  0.0000  0.0000  310  PHE A HZ   
4597 N N    . ASP A 311 ? 0.1219 0.1164 0.1276 0.0009  -0.0005 -0.0067 311  ASP A N    
4598 C CA   . ASP A 311 ? 0.1140 0.1137 0.1449 -0.0030 -0.0046 0.0015  311  ASP A CA   
4599 C C    . ASP A 311 ? 0.1243 0.1111 0.1464 0.0023  -0.0065 -0.0016 311  ASP A C    
4600 O O    . ASP A 311 ? 0.1328 0.1254 0.1397 -0.0055 -0.0015 -0.0081 311  ASP A O    
4601 C CB   . ASP A 311 ? 0.1348 0.1168 0.1659 0.0092  -0.0112 0.0053  311  ASP A CB   
4602 C CG   . ASP A 311 ? 0.1601 0.1251 0.1749 0.0015  -0.0225 0.0049  311  ASP A CG   
4603 O OD1  . ASP A 311 ? 0.1633 0.1303 0.1702 -0.0082 -0.0119 0.0123  311  ASP A OD1  
4604 O OD2  . ASP A 311 ? 0.1842 0.1377 0.1924 0.0122  -0.0202 0.0268  311  ASP A OD2  
4605 H H    . ASP A 311 ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  311  ASP A H    
4606 H HA   . ASP A 311 ? 0.1491 0.1491 0.1491 0.0000  0.0000  0.0000  311  ASP A HA   
4607 H HB2  . ASP A 311 ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  311  ASP A HB2  
4608 H HB3  . ASP A 311 ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  311  ASP A HB3  
4609 N N    . SER A 312 ? 0.1170 0.1230 0.1463 0.0013  -0.0081 -0.0025 312  SER A N    
4610 C CA   . SER A 312 ? 0.1306 0.1385 0.1615 -0.0030 -0.0186 -0.0094 312  SER A CA   
4611 C C    . SER A 312 ? 0.1388 0.1419 0.1513 -0.0056 -0.0062 -0.0113 312  SER A C    
4612 O O    . SER A 312 ? 0.1613 0.1653 0.1768 -0.0083 -0.0249 -0.0241 312  SER A O    
4613 C CB   . SER A 312 ? 0.1239 0.1735 0.1724 0.0116  -0.0258 -0.0116 312  SER A CB   
4614 O OG   . SER A 312 ? 0.1587 0.2265 0.1762 -0.0242 -0.0175 -0.0148 312  SER A OG   
4615 H H    . SER A 312 ? 0.1545 0.1545 0.1545 0.0000  0.0000  0.0000  312  SER A H    
4616 H HA   . SER A 312 ? 0.1722 0.1722 0.1722 0.0000  0.0000  0.0000  312  SER A HA   
4617 H HB2  . SER A 312 ? 0.1880 0.1880 0.1880 0.0000  0.0000  0.0000  312  SER A HB2  
4618 H HB3  . SER A 312 ? 0.1880 0.1880 0.1880 0.0000  0.0000  0.0000  312  SER A HB3  
4619 H HG   . SER A 312 ? 0.2807 0.2807 0.2807 0.0000  0.0000  0.0000  312  SER A HG   
4620 N N    . ASP A 313 ? 0.1678 0.1240 0.1635 -0.0139 -0.0039 -0.0029 313  ASP A N    
4621 C CA   . ASP A 313 ? 0.1801 0.1278 0.2101 -0.0038 -0.0025 -0.0160 313  ASP A CA   
4622 C C    . ASP A 313 ? 0.1859 0.1319 0.2012 0.0043  -0.0186 -0.0279 313  ASP A C    
4623 O O    . ASP A 313 ? 0.1794 0.2236 0.2264 -0.0142 -0.0155 -0.0366 313  ASP A O    
4624 C CB   A ASP A 313 ? 0.2467 0.1208 0.2671 -0.0447 -0.0053 0.0097  313  ASP A CB   
4625 C CB   B ASP A 313 ? 0.2506 0.1098 0.2422 -0.0287 0.0079  0.0116  313  ASP A CB   
4626 C CG   A ASP A 313 ? 0.2327 0.1438 0.2322 -0.0676 -0.0453 0.0394  313  ASP A CG   
4627 C CG   B ASP A 313 ? 0.3882 0.1220 0.3168 0.0205  -0.1273 -0.0165 313  ASP A CG   
4628 O OD1  A ASP A 313 ? 0.2574 0.1764 0.2564 -0.0615 -0.0686 0.0412  313  ASP A OD1  
4629 O OD1  B ASP A 313 ? 0.6494 0.1143 0.4020 0.0261  -0.2768 -0.0138 313  ASP A OD1  
4630 O OD2  A ASP A 313 ? 0.2774 0.1986 0.2239 -0.0266 -0.0245 0.0054  313  ASP A OD2  
4631 O OD2  B ASP A 313 ? 0.5808 0.1536 0.4443 0.0562  -0.2866 -0.0440 313  ASP A OD2  
4632 H H    . ASP A 313 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  313  ASP A H    
4633 H HA   A ASP A 313 ? 0.2072 0.2072 0.2072 0.0000  0.0000  0.0000  313  ASP A HA   
4634 H HB2  A ASP A 313 ? 0.2538 0.2538 0.2538 0.0000  0.0000  0.0000  313  ASP A HB2  
4635 H HB2  B ASP A 313 ? 0.2410 0.2410 0.2410 0.0000  0.0000  0.0000  313  ASP A HB2  
4636 H HB3  A ASP A 313 ? 0.2538 0.2538 0.2538 0.0000  0.0000  0.0000  313  ASP A HB3  
4637 H HB3  B ASP A 313 ? 0.2410 0.2410 0.2410 0.0000  0.0000  0.0000  313  ASP A HB3  
4638 N N    . GLY A 314 ? 0.1729 0.1408 0.2038 -0.0105 -0.0086 -0.0261 314  GLY A N    
4639 C CA   . GLY A 314 ? 0.1793 0.1316 0.2208 -0.0056 0.0115  -0.0220 314  GLY A CA   
4640 C C    . GLY A 314 ? 0.1690 0.1675 0.1961 -0.0195 -0.0122 -0.0418 314  GLY A C    
4641 O O    . GLY A 314 ? 0.2573 0.2069 0.2324 -0.0498 -0.0229 -0.0739 314  GLY A O    
4642 H H    . GLY A 314 ? 0.2069 0.2069 0.2069 0.0000  0.0000  0.0000  314  GLY A H    
4643 H HA2  . GLY A 314 ? 0.2126 0.2126 0.2126 0.0000  0.0000  0.0000  314  GLY A HA2  
4644 H HA3  . GLY A 314 ? 0.2126 0.2126 0.2126 0.0000  0.0000  0.0000  314  GLY A HA3  
4645 N N    . PRO A 315 ? 0.1407 0.1574 0.1619 -0.0131 -0.0178 -0.0197 315  PRO A N    
4646 C CA   . PRO A 315 ? 0.1317 0.1358 0.1497 0.0011  -0.0188 -0.0110 315  PRO A CA   
4647 C C    . PRO A 315 ? 0.1359 0.1142 0.1393 -0.0095 -0.0138 -0.0087 315  PRO A C    
4648 O O    . PRO A 315 ? 0.1354 0.1248 0.1418 0.0012  -0.0123 -0.0127 315  PRO A O    
4649 C CB   . PRO A 315 ? 0.1302 0.1487 0.1707 0.0047  -0.0094 0.0056  315  PRO A CB   
4650 C CG   . PRO A 315 ? 0.1379 0.1889 0.1737 -0.0086 -0.0277 0.0204  315  PRO A CG   
4651 C CD   . PRO A 315 ? 0.1644 0.2025 0.1657 -0.0083 -0.0247 -0.0107 315  PRO A CD   
4652 H HA   . PRO A 315 ? 0.1669 0.1669 0.1669 0.0000  0.0000  0.0000  315  PRO A HA   
4653 H HB2  . PRO A 315 ? 0.1798 0.1798 0.1798 0.0000  0.0000  0.0000  315  PRO A HB2  
4654 H HB3  . PRO A 315 ? 0.1798 0.1798 0.1798 0.0000  0.0000  0.0000  315  PRO A HB3  
4655 H HG2  . PRO A 315 ? 0.2002 0.2002 0.2002 0.0000  0.0000  0.0000  315  PRO A HG2  
4656 H HG3  . PRO A 315 ? 0.2002 0.2002 0.2002 0.0000  0.0000  0.0000  315  PRO A HG3  
4657 H HD2  . PRO A 315 ? 0.2130 0.2130 0.2130 0.0000  0.0000  0.0000  315  PRO A HD2  
4658 H HD3  . PRO A 315 ? 0.2130 0.2130 0.2130 0.0000  0.0000  0.0000  315  PRO A HD3  
4659 N N    . GLN A 316 ? 0.1146 0.1299 0.1430 0.0041  -0.0116 -0.0072 316  GLN A N    
4660 C CA   . GLN A 316 ? 0.1228 0.1127 0.1495 0.0018  -0.0147 -0.0107 316  GLN A CA   
4661 C C    . GLN A 316 ? 0.1154 0.1141 0.1306 0.0105  -0.0029 -0.0069 316  GLN A C    
4662 O O    . GLN A 316 ? 0.1237 0.1302 0.1368 -0.0029 -0.0006 -0.0150 316  GLN A O    
4663 C CB   . GLN A 316 ? 0.1315 0.1197 0.1682 0.0080  -0.0150 -0.0115 316  GLN A CB   
4664 C CG   . GLN A 316 ? 0.1616 0.1300 0.1546 0.0170  -0.0140 -0.0090 316  GLN A CG   
4665 C CD   . GLN A 316 ? 0.1701 0.1423 0.2095 0.0152  0.0062  0.0179  316  GLN A CD   
4666 O OE1  . GLN A 316 ? 0.1719 0.1334 0.2339 0.0191  -0.0029 0.0080  316  GLN A OE1  
4667 N NE2  . GLN A 316 ? 0.2151 0.1471 0.2193 0.0050  0.0124  0.0282  316  GLN A NE2  
4668 H H    . GLN A 316 ? 0.1550 0.1550 0.1550 0.0000  0.0000  0.0000  316  GLN A H    
4669 H HA   . GLN A 316 ? 0.1540 0.1540 0.1540 0.0000  0.0000  0.0000  316  GLN A HA   
4670 H HB2  . GLN A 316 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  316  GLN A HB2  
4671 H HB3  . GLN A 316 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  316  GLN A HB3  
4672 H HG2  . GLN A 316 ? 0.1785 0.1785 0.1785 0.0000  0.0000  0.0000  316  GLN A HG2  
4673 H HG3  . GLN A 316 ? 0.1785 0.1785 0.1785 0.0000  0.0000  0.0000  316  GLN A HG3  
4674 H HE21 . GLN A 316 ? 0.2327 0.2327 0.2327 0.0000  0.0000  0.0000  316  GLN A HE21 
4675 H HE22 . GLN A 316 ? 0.2327 0.2327 0.2327 0.0000  0.0000  0.0000  316  GLN A HE22 
4676 N N    . LEU A 317 ? 0.1158 0.1155 0.1253 0.0091  -0.0077 -0.0091 317  LEU A N    
4677 C CA   . LEU A 317 ? 0.1126 0.1131 0.1207 0.0096  -0.0082 -0.0005 317  LEU A CA   
4678 C C    . LEU A 317 ? 0.1109 0.1103 0.1294 0.0095  -0.0029 0.0001  317  LEU A C    
4679 O O    . LEU A 317 ? 0.1401 0.1251 0.1314 0.0279  -0.0109 -0.0064 317  LEU A O    
4680 C CB   . LEU A 317 ? 0.1138 0.1169 0.1281 0.0175  0.0006  0.0021  317  LEU A CB   
4681 C CG   . LEU A 317 ? 0.1114 0.1211 0.1233 0.0101  0.0015  -0.0001 317  LEU A CG   
4682 C CD1  . LEU A 317 ? 0.1390 0.1279 0.1415 0.0177  0.0111  0.0143  317  LEU A CD1  
4683 C CD2  . LEU A 317 ? 0.1396 0.1252 0.1370 0.0319  0.0022  0.0012  317  LEU A CD2  
4684 H H    . LEU A 317 ? 0.1426 0.1426 0.1426 0.0000  0.0000  0.0000  317  LEU A H    
4685 H HA   . LEU A 317 ? 0.1386 0.1386 0.1386 0.0000  0.0000  0.0000  317  LEU A HA   
4686 H HB2  . LEU A 317 ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  317  LEU A HB2  
4687 H HB3  . LEU A 317 ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  317  LEU A HB3  
4688 H HG   . LEU A 317 ? 0.1424 0.1424 0.1424 0.0000  0.0000  0.0000  317  LEU A HG   
4689 H HD11 . LEU A 317 ? 0.2042 0.2042 0.2042 0.0000  0.0000  0.0000  317  LEU A HD11 
4690 H HD12 . LEU A 317 ? 0.2042 0.2042 0.2042 0.0000  0.0000  0.0000  317  LEU A HD12 
4691 H HD13 . LEU A 317 ? 0.2042 0.2042 0.2042 0.0000  0.0000  0.0000  317  LEU A HD13 
4692 H HD21 . LEU A 317 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  317  LEU A HD21 
4693 H HD22 . LEU A 317 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  317  LEU A HD22 
4694 H HD23 . LEU A 317 ? 0.2009 0.2009 0.2009 0.0000  0.0000  0.0000  317  LEU A HD23 
4695 N N    . GLY A 318 ? 0.1109 0.1129 0.1330 0.0134  -0.0077 -0.0003 318  GLY A N    
4696 C CA   . GLY A 318 ? 0.1132 0.1214 0.1277 0.0102  -0.0172 -0.0027 318  GLY A CA   
4697 C C    . GLY A 318 ? 0.1154 0.1262 0.1196 0.0083  -0.0091 0.0063  318  GLY A C    
4698 O O    . GLY A 318 ? 0.1167 0.1199 0.1502 0.0137  -0.0074 -0.0133 318  GLY A O    
4699 H H    . GLY A 318 ? 0.1427 0.1427 0.1427 0.0000  0.0000  0.0000  318  GLY A H    
4700 H HA2  . GLY A 318 ? 0.1449 0.1449 0.1449 0.0000  0.0000  0.0000  318  GLY A HA2  
4701 H HA3  . GLY A 318 ? 0.1449 0.1449 0.1449 0.0000  0.0000  0.0000  318  GLY A HA3  
4702 N N    . PHE A 319 ? 0.1117 0.1097 0.1336 0.0084  -0.0078 0.0061  319  PHE A N    
4703 C CA   . PHE A 319 ? 0.1049 0.1202 0.1268 0.0049  -0.0065 0.0026  319  PHE A CA   
4704 C C    . PHE A 319 ? 0.1077 0.1198 0.1233 0.0039  0.0050  0.0054  319  PHE A C    
4705 O O    . PHE A 319 ? 0.1196 0.1170 0.1390 0.0149  -0.0062 0.0073  319  PHE A O    
4706 C CB   . PHE A 319 ? 0.1137 0.1450 0.1280 0.0069  -0.0032 0.0075  319  PHE A CB   
4707 C CG   . PHE A 319 ? 0.1105 0.1267 0.1296 0.0003  -0.0042 0.0092  319  PHE A CG   
4708 C CD1  . PHE A 319 ? 0.1269 0.1384 0.1275 0.0086  -0.0051 -0.0036 319  PHE A CD1  
4709 C CD2  . PHE A 319 ? 0.1364 0.1309 0.1483 -0.0065 -0.0172 0.0068  319  PHE A CD2  
4710 C CE1  . PHE A 319 ? 0.1133 0.1661 0.1262 0.0151  -0.0046 -0.0026 319  PHE A CE1  
4711 C CE2  . PHE A 319 ? 0.1604 0.1355 0.1696 0.0013  -0.0214 0.0347  319  PHE A CE2  
4712 C CZ   . PHE A 319 ? 0.1519 0.1709 0.1321 -0.0042 -0.0083 0.0310  319  PHE A CZ   
4713 H H    . PHE A 319 ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  319  PHE A H    
4714 H HA   . PHE A 319 ? 0.1407 0.1407 0.1407 0.0000  0.0000  0.0000  319  PHE A HA   
4715 H HB2  . PHE A 319 ? 0.1546 0.1546 0.1546 0.0000  0.0000  0.0000  319  PHE A HB2  
4716 H HB3  . PHE A 319 ? 0.1546 0.1546 0.1546 0.0000  0.0000  0.0000  319  PHE A HB3  
4717 H HD1  . PHE A 319 ? 0.1572 0.1572 0.1572 0.0000  0.0000  0.0000  319  PHE A HD1  
4718 H HD2  . PHE A 319 ? 0.1663 0.1663 0.1663 0.0000  0.0000  0.0000  319  PHE A HD2  
4719 H HE1  . PHE A 319 ? 0.1622 0.1622 0.1622 0.0000  0.0000  0.0000  319  PHE A HE1  
4720 H HE2  . PHE A 319 ? 0.1862 0.1862 0.1862 0.0000  0.0000  0.0000  319  PHE A HE2  
4721 H HZ   . PHE A 319 ? 0.1820 0.1820 0.1820 0.0000  0.0000  0.0000  319  PHE A HZ   
4722 N N    . ALA A 320 ? 0.1107 0.1178 0.1291 0.0075  -0.0038 0.0110  320  ALA A N    
4723 C CA   . ALA A 320 ? 0.1160 0.1208 0.1229 0.0082  -0.0010 0.0126  320  ALA A CA   
4724 C C    . ALA A 320 ? 0.1083 0.1241 0.1183 0.0027  0.0022  0.0171  320  ALA A C    
4725 O O    . ALA A 320 ? 0.1181 0.1173 0.1305 0.0120  -0.0083 0.0139  320  ALA A O    
4726 C CB   . ALA A 320 ? 0.1314 0.1292 0.1263 0.0018  -0.0012 0.0187  320  ALA A CB   
4727 H H    . ALA A 320 ? 0.1430 0.1430 0.1430 0.0000  0.0000  0.0000  320  ALA A H    
4728 H HA   . ALA A 320 ? 0.1439 0.1439 0.1439 0.0000  0.0000  0.0000  320  ALA A HA   
4729 H HB1  . ALA A 320 ? 0.1934 0.1934 0.1934 0.0000  0.0000  0.0000  320  ALA A HB1  
4730 H HB2  . ALA A 320 ? 0.1934 0.1934 0.1934 0.0000  0.0000  0.0000  320  ALA A HB2  
4731 H HB3  . ALA A 320 ? 0.1934 0.1934 0.1934 0.0000  0.0000  0.0000  320  ALA A HB3  
4732 N N    . PRO A 321 ? 0.1072 0.1325 0.1208 0.0131  -0.0075 0.0133  321  PRO A N    
4733 C CA   . PRO A 321 ? 0.1148 0.1378 0.1228 0.0045  -0.0069 0.0173  321  PRO A CA   
4734 C C    . PRO A 321 ? 0.1027 0.1303 0.1182 -0.0023 -0.0122 0.0200  321  PRO A C    
4735 O O    . PRO A 321 ? 0.1335 0.1339 0.1204 0.0153  0.0018  0.0176  321  PRO A O    
4736 C CB   . PRO A 321 ? 0.1099 0.1589 0.1506 0.0049  -0.0134 0.0113  321  PRO A CB   
4737 C CG   . PRO A 321 ? 0.1154 0.1533 0.1564 0.0167  -0.0087 0.0216  321  PRO A CG   
4738 C CD   . PRO A 321 ? 0.1189 0.1451 0.1273 0.0263  -0.0134 0.0109  321  PRO A CD   
4739 H HA   . PRO A 321 ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  321  PRO A HA   
4740 H HB2  . PRO A 321 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  321  PRO A HB2  
4741 H HB3  . PRO A 321 ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  321  PRO A HB3  
4742 H HG2  . PRO A 321 ? 0.1701 0.1701 0.1701 0.0000  0.0000  0.0000  321  PRO A HG2  
4743 H HG3  . PRO A 321 ? 0.1701 0.1701 0.1701 0.0000  0.0000  0.0000  321  PRO A HG3  
4744 H HD2  . PRO A 321 ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  321  PRO A HD2  
4745 H HD3  . PRO A 321 ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  321  PRO A HD3  
4746 N N    . GLN A 322 ? 0.1164 0.1318 0.1266 0.0061  0.0006  0.0244  322  GLN A N    
4747 C CA   . GLN A 322 ? 0.1442 0.1344 0.1377 0.0114  0.0032  0.0150  322  GLN A CA   
4748 C C    . GLN A 322 ? 0.1716 0.1382 0.1507 -0.0080 0.0094  0.0046  322  GLN A C    
4749 O O    . GLN A 322 ? 0.1746 0.1872 0.1471 -0.0090 -0.0205 0.0000  322  GLN A O    
4750 C CB   . GLN A 322 ? 0.1733 0.1285 0.1850 0.0067  0.0296  0.0197  322  GLN A CB   
4751 C CG   . GLN A 322 ? 0.1846 0.1573 0.2006 0.0407  0.0133  0.0328  322  GLN A CG   
4752 C CD   . GLN A 322 ? 0.2012 0.1408 0.1754 0.0383  -0.0189 0.0041  322  GLN A CD   
4753 O OE1  . GLN A 322 ? 0.2803 0.1637 0.1702 0.0529  -0.0340 -0.0016 322  GLN A OE1  
4754 N NE2  . GLN A 322 ? 0.1582 0.1272 0.1727 0.0213  -0.0145 -0.0035 322  GLN A NE2  
4755 H H    . GLN A 322 ? 0.1500 0.1500 0.1500 0.0000  0.0000  0.0000  322  GLN A H    
4756 H HA   . GLN A 322 ? 0.1665 0.1665 0.1665 0.0000  0.0000  0.0000  322  GLN A HA   
4757 H HB2  . GLN A 322 ? 0.1947 0.1947 0.1947 0.0000  0.0000  0.0000  322  GLN A HB2  
4758 H HB3  . GLN A 322 ? 0.1947 0.1947 0.1947 0.0000  0.0000  0.0000  322  GLN A HB3  
4759 H HG2  . GLN A 322 ? 0.2170 0.2170 0.2170 0.0000  0.0000  0.0000  322  GLN A HG2  
4760 H HG3  . GLN A 322 ? 0.2170 0.2170 0.2170 0.0000  0.0000  0.0000  322  GLN A HG3  
4761 H HE21 . GLN A 322 ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  322  GLN A HE21 
4762 H HE22 . GLN A 322 ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  322  GLN A HE22 
4763 N N    A ALA A 323 ? 0.2040 0.1433 0.1272 -0.0072 -0.0020 0.0252  323  ALA A N    
4764 N N    B ALA A 323 ? 0.2569 0.1758 0.1253 -0.0153 0.0380  -0.0140 323  ALA A N    
4765 C CA   A ALA A 323 ? 0.2495 0.1704 0.1441 0.0184  -0.0209 -0.0092 323  ALA A CA   
4766 C CA   B ALA A 323 ? 0.1829 0.1915 0.1454 -0.0456 0.0495  0.0104  323  ALA A CA   
4767 C C    A ALA A 323 ? 0.2586 0.2231 0.1577 0.0054  0.0034  -0.0272 323  ALA A C    
4768 C C    B ALA A 323 ? 0.2923 0.2126 0.2195 -0.0881 -0.0451 0.0002  323  ALA A C    
4769 O O    A ALA A 323 ? 0.2193 0.2835 0.2124 -0.0015 0.0423  -0.0203 323  ALA A O    
4770 O O    B ALA A 323 ? 0.7536 0.2597 0.2325 0.1310  -0.2243 -0.1084 323  ALA A O    
4771 C CB   A ALA A 323 ? 0.1908 0.2033 0.1393 -0.0032 -0.0180 0.0443  323  ALA A CB   
4772 C CB   B ALA A 323 ? 0.1914 0.2401 0.1655 -0.0658 0.0303  0.0455  323  ALA A CB   
4773 O OXT  A ALA A 323 ? 0.3367 0.4508 0.1659 0.0225  0.0048  -0.0708 323  ALA A OXT  
4774 O OXT  B ALA A 323 ? 0.6381 0.3172 0.3922 -0.2202 -0.3440 0.1440  323  ALA A OXT  
4775 H H    A ALA A 323 ? 0.1899 0.1899 0.1899 0.0000  0.0000  0.0000  323  ALA A H    
4776 H H    B ALA A 323 ? 0.2232 0.2232 0.2232 0.0000  0.0000  0.0000  323  ALA A H    
4777 H HA   A ALA A 323 ? 0.2256 0.2256 0.2256 0.0000  0.0000  0.0000  323  ALA A HA   
4778 H HA   B ALA A 323 ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  323  ALA A HA   
4779 H HB1  A ALA A 323 ? 0.2667 0.2667 0.2667 0.0000  0.0000  0.0000  323  ALA A HB1  
4780 H HB1  B ALA A 323 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  323  ALA A HB1  
4781 H HB2  A ALA A 323 ? 0.2667 0.2667 0.2667 0.0000  0.0000  0.0000  323  ALA A HB2  
4782 H HB2  B ALA A 323 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  323  ALA A HB2  
4783 H HB3  A ALA A 323 ? 0.2667 0.2667 0.2667 0.0000  0.0000  0.0000  323  ALA A HB3  
4784 H HB3  B ALA A 323 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  323  ALA A HB3  
4785 C C1   . MAN B .   ? 0.1597 0.1755 0.1649 -0.0125 -0.0066 0.0625  328  MAN A C1   
4786 C C2   . MAN B .   ? 0.1927 0.1798 0.1746 -0.0397 -0.0327 0.0436  328  MAN A C2   
4787 C C3   . MAN B .   ? 0.1979 0.1701 0.1400 -0.0218 -0.0268 0.0182  328  MAN A C3   
4788 C C4   . MAN B .   ? 0.1772 0.1523 0.1547 -0.0186 -0.0072 0.0377  328  MAN A C4   
4789 C C5   . MAN B .   ? 0.1872 0.1499 0.1515 -0.0126 -0.0071 0.0379  328  MAN A C5   
4790 C C6   . MAN B .   ? 0.2360 0.1564 0.1894 -0.0156 -0.0131 0.0371  328  MAN A C6   
4791 O O2   . MAN B .   ? 0.1843 0.3272 0.2094 -0.0370 -0.0528 0.1162  328  MAN A O2   
4792 O O3   . MAN B .   ? 0.2648 0.1726 0.1409 -0.0056 -0.0309 0.0143  328  MAN A O3   
4793 O O4   . MAN B .   ? 0.1911 0.1868 0.1524 -0.0200 -0.0054 0.0217  328  MAN A O4   
4794 O O5   . MAN B .   ? 0.2079 0.1569 0.1666 0.0005  0.0114  0.0455  328  MAN A O5   
4795 O O6   . MAN B .   ? 0.2696 0.1574 0.2134 -0.0066 -0.0281 0.0288  328  MAN A O6   
4796 H H1   . MAN B .   ? 0.2000 0.2000 0.2000 0.0000  0.0000  0.0000  328  MAN A H1   
4797 H H2   . MAN B .   ? 0.2189 0.2189 0.2189 0.0000  0.0000  0.0000  328  MAN A H2   
4798 H H3   . MAN B .   ? 0.2031 0.2031 0.2031 0.0000  0.0000  0.0000  328  MAN A H3   
4799 H H4   . MAN B .   ? 0.1937 0.1937 0.1937 0.0000  0.0000  0.0000  328  MAN A H4   
4800 H H5   . MAN B .   ? 0.1954 0.1954 0.1954 0.0000  0.0000  0.0000  328  MAN A H5   
4801 H H61  . MAN B .   ? 0.2327 0.2327 0.2327 0.0000  0.0000  0.0000  328  MAN A H61  
4802 H H62  . MAN B .   ? 0.2327 0.2327 0.2327 0.0000  0.0000  0.0000  328  MAN A H62  
4803 H HO2  . MAN B .   ? 0.3605 0.3605 0.3605 0.0000  0.0000  0.0000  328  MAN A HO2  
4804 H HO3  . MAN B .   ? 0.2891 0.2891 0.2891 0.0000  0.0000  0.0000  328  MAN A HO3  
4805 H HO4  . MAN B .   ? 0.2652 0.2652 0.2652 0.0000  0.0000  0.0000  328  MAN A HO4  
4806 H HO6  . MAN B .   ? 0.3202 0.3202 0.3202 0.0000  0.0000  0.0000  328  MAN A HO6  
4807 C C1   . MAN C .   ? 0.2763 0.2845 0.1367 0.0551  0.0154  -0.0100 329  MAN A C1   
4808 C C2   . MAN C .   ? 0.2922 0.4674 0.1749 -0.0669 0.0243  0.0682  329  MAN A C2   
4809 C C3   . MAN C .   ? 0.4580 0.2682 0.1643 -0.0620 -0.0604 0.0343  329  MAN A C3   
4810 C C4   . MAN C .   ? 0.4696 0.2779 0.2144 -0.0111 -0.1053 0.0228  329  MAN A C4   
4811 C C5   . MAN C .   ? 0.4553 0.2942 0.2007 -0.0555 -0.1475 0.0339  329  MAN A C5   
4812 C C6   . MAN C .   ? 0.3709 0.4027 0.2202 -0.0762 -0.0140 -0.0767 329  MAN A C6   
4813 O O2   . MAN C .   ? 0.6221 0.7332 0.2911 0.1429  0.2387  0.2293  329  MAN A O2   
4814 O O3   . MAN C .   ? 0.6739 0.4307 0.2368 -0.2355 -0.0914 0.1417  329  MAN A O3   
4815 O O4   . MAN C .   ? 0.4439 0.3333 0.3141 -0.0256 -0.1138 0.0848  329  MAN A O4   
4816 O O5   . MAN C .   ? 0.5214 0.2800 0.1598 0.0577  -0.0453 -0.0274 329  MAN A O5   
4817 O O6   . MAN C .   ? 0.5681 0.4389 0.3417 -0.2506 -0.0571 -0.0674 329  MAN A O6   
4818 H H1   . MAN C .   ? 0.2790 0.2790 0.2790 0.0000  0.0000  0.0000  329  MAN A H1   
4819 H H2   . MAN C .   ? 0.3737 0.3737 0.3737 0.0000  0.0000  0.0000  329  MAN A H2   
4820 H H3   . MAN C .   ? 0.3561 0.3561 0.3561 0.0000  0.0000  0.0000  329  MAN A H3   
4821 H H4   . MAN C .   ? 0.3848 0.3848 0.3848 0.0000  0.0000  0.0000  329  MAN A H4   
4822 H H5   . MAN C .   ? 0.3801 0.3801 0.3801 0.0000  0.0000  0.0000  329  MAN A H5   
4823 H H61  . MAN C .   ? 0.3976 0.3976 0.3976 0.0000  0.0000  0.0000  329  MAN A H61  
4824 H H62  . MAN C .   ? 0.3976 0.3976 0.3976 0.0000  0.0000  0.0000  329  MAN A H62  
4825 H HO2  . MAN C .   ? 0.8232 0.8232 0.8232 0.0000  0.0000  0.0000  329  MAN A HO2  
4826 H HO3  . MAN C .   ? 0.6707 0.6707 0.6707 0.0000  0.0000  0.0000  329  MAN A HO3  
4827 H HO4  . MAN C .   ? 0.5456 0.5456 0.5456 0.0000  0.0000  0.0000  329  MAN A HO4  
4828 H HO6  . MAN C .   ? 0.6743 0.6743 0.6743 0.0000  0.0000  0.0000  329  MAN A HO6  
4829 S S    . SO4 D .   ? 0.5164 0.2167 0.3638 -0.0537 0.1926  0.0283  327  SO4 A S    
4830 O O1   . SO4 D .   ? 0.5163 0.7185 0.5301 -0.2481 0.2563  0.0326  327  SO4 A O1   
4831 O O2   . SO4 D .   ? 1.2700 0.3358 0.6386 -0.2228 0.2661  -0.1887 327  SO4 A O2   
4832 O O3   . SO4 D .   ? 0.8934 0.5953 0.5184 0.2293  0.2958  0.3591  327  SO4 A O3   
4833 O O4   . SO4 D .   ? 0.2447 0.1921 0.4275 -0.0099 0.0746  0.0396  327  SO4 A O4   
4834 N NV2  . PP7 E .   ? 0.1248 0.1172 0.1339 -0.0023 -0.0214 0.0047  324  PP7 A NV2  
4835 C CV1  . PP7 E .   ? 0.1419 0.1435 0.1898 -0.0234 -0.0316 0.0152  324  PP7 A CV1  
4836 C CV6  . PP7 E .   ? 0.1284 0.1111 0.1399 0.0023  -0.0213 0.0033  324  PP7 A CV6  
4837 C CV2  . PP7 E .   ? 0.1348 0.2626 0.2021 0.0099  -0.0098 0.0149  324  PP7 A CV2  
4838 C CV7  . PP7 E .   ? 0.1317 0.1230 0.1434 0.0195  -0.0102 -0.0050 324  PP7 A CV7  
4839 C CV3  . PP7 E .   ? 0.2261 0.2227 0.2796 0.0336  0.0214  0.0051  324  PP7 A CV3  
4840 C CV8  . PP7 E .   ? 0.1680 0.1405 0.1561 0.0138  -0.0175 -0.0216 324  PP7 A CV8  
4841 C CV4  . PP7 E .   ? 0.1286 0.4056 0.2517 -0.0382 -0.0182 0.0665  324  PP7 A CV4  
4842 C CV9  . PP7 E .   ? 0.1098 0.1436 0.1305 0.0115  -0.0056 -0.0068 324  PP7 A CV9  
4843 C CV5  . PP7 E .   ? 0.1486 0.1319 0.1645 -0.0126 -0.0270 0.0149  324  PP7 A CV5  
4844 C CR   . PP7 E .   ? 0.1193 0.1154 0.1169 0.0054  -0.0109 0.0080  324  PP7 A CR   
4845 O OV1  . PP7 E .   ? 0.1899 0.1558 0.2495 -0.0347 -0.0744 0.0603  324  PP7 A OV1  
4846 O OV2  . PP7 E .   ? 0.1114 0.1124 0.1352 0.0018  -0.0191 0.0048  324  PP7 A OV2  
4847 N N1   . PP7 E .   ? 0.1096 0.1171 0.1276 0.0097  -0.0072 -0.0006 324  PP7 A N1   
4848 C C1   . PP7 E .   ? 0.1149 0.1042 0.1214 0.0065  -0.0040 0.0038  324  PP7 A C1   
4849 C C2   . PP7 E .   ? 0.1073 0.1282 0.1288 0.0023  -0.0037 0.0049  324  PP7 A C2   
4850 C C4   . PP7 E .   ? 0.1157 0.1252 0.1198 0.0029  0.0006  0.0083  324  PP7 A C4   
4851 O O2   . PP7 E .   ? 0.1562 0.1543 0.1261 0.0137  0.0051  0.0123  324  PP7 A O2   
4852 N N2   . PP7 E .   ? 0.1315 0.1321 0.1113 0.0018  -0.0052 -0.0014 324  PP7 A N2   
4853 C CB   . PP7 E .   ? 0.1167 0.1354 0.1187 0.0111  -0.0149 0.0009  324  PP7 A CB   
4854 C C3   . PP7 E .   ? 0.1112 0.1064 0.1129 0.0026  -0.0110 0.0015  324  PP7 A C3   
4855 O O1   . PP7 E .   ? 0.1201 0.1378 0.1238 0.0014  -0.0097 0.0136  324  PP7 A O1   
4856 N NL   . PP7 E .   ? 0.1097 0.1185 0.1161 0.0038  -0.0077 0.0065  324  PP7 A NL   
4857 C CAL  . PP7 E .   ? 0.1120 0.1140 0.1083 0.0023  -0.0165 0.0050  324  PP7 A CAL  
4858 C CBL  . PP7 E .   ? 0.1072 0.1179 0.1228 0.0062  -0.0130 0.0048  324  PP7 A CBL  
4859 C CGL  . PP7 E .   ? 0.1334 0.1244 0.1241 0.0116  -0.0115 -0.0041 324  PP7 A CGL  
4860 C CL1  . PP7 E .   ? 0.1806 0.1426 0.1541 -0.0016 0.0190  -0.0196 324  PP7 A CL1  
4861 C CL2  . PP7 E .   ? 0.1883 0.1291 0.1528 0.0259  -0.0318 -0.0012 324  PP7 A CL2  
4862 P P    . PP7 E .   ? 0.1213 0.1149 0.1133 0.0058  -0.0042 -0.0021 324  PP7 A P    
4863 O O3   . PP7 E .   ? 0.1270 0.1176 0.1538 0.0075  -0.0234 0.0089  324  PP7 A O3   
4864 O O4   . PP7 E .   ? 0.1229 0.1303 0.1100 -0.0095 -0.0068 -0.0017 324  PP7 A O4   
4865 O O5   . PP7 E .   ? 0.1592 0.1483 0.1295 -0.0277 0.0279  -0.0251 324  PP7 A O5   
4866 C C5   . PP7 E .   ? 0.1304 0.1253 0.1157 -0.0072 -0.0004 -0.0040 324  PP7 A C5   
4867 C C6   . PP7 E .   ? 0.1301 0.1276 0.1278 0.0031  -0.0157 0.0016  324  PP7 A C6   
4868 C C7   . PP7 E .   ? 0.1879 0.2658 0.1365 0.0436  -0.0339 0.0250  324  PP7 A C7   
4869 C CE2  . PP7 E .   ? 0.1195 0.1365 0.1186 0.0094  -0.0134 -0.0040 324  PP7 A CE2  
4870 C CZ   . PP7 E .   ? 0.1330 0.1694 0.1343 0.0026  -0.0088 -0.0216 324  PP7 A CZ   
4871 C CD2  . PP7 E .   ? 0.1202 0.1241 0.1126 0.0111  -0.0073 -0.0011 324  PP7 A CD2  
4872 C CE1  . PP7 E .   ? 0.1431 0.2437 0.1162 -0.0178 -0.0114 -0.0359 324  PP7 A CE1  
4873 C CD1  . PP7 E .   ? 0.1265 0.2094 0.1121 -0.0046 -0.0095 -0.0112 324  PP7 A CD1  
4874 C CG   . PP7 E .   ? 0.1127 0.1359 0.1138 0.0119  -0.0099 0.0013  324  PP7 A CG   
4875 C CT   . PP7 E .   ? 0.1367 0.1257 0.1375 0.0101  0.0080  0.0120  324  PP7 A CT   
4876 O OT1  . PP7 E .   ? 0.1507 0.1775 0.1230 0.0046  -0.0209 0.0043  324  PP7 A OT1  
4877 O OT2  . PP7 E .   ? 0.1463 0.1509 0.2378 0.0055  -0.0076 0.0497  324  PP7 A OT2  
4878 H HV2  . PP7 E .   ? 0.1503 0.1503 0.1503 0.0000  0.0000  0.0000  324  PP7 A HV2  
4879 H HV12 . PP7 E .   ? 0.1901 0.1901 0.1901 0.0000  0.0000  0.0000  324  PP7 A HV12 
4880 H HV6  . PP7 E .   ? 0.1517 0.1517 0.1517 0.0000  0.0000  0.0000  324  PP7 A HV6  
4881 H HV33 . PP7 E .   ? 0.3642 0.3642 0.3642 0.0000  0.0000  0.0000  324  PP7 A HV33 
4882 H HV83 . PP7 E .   ? 0.2323 0.2323 0.2323 0.0000  0.0000  0.0000  324  PP7 A HV83 
4883 H HV42 . PP7 E .   ? 0.3930 0.3930 0.3930 0.0000  0.0000  0.0000  324  PP7 A HV42 
4884 H HV93 . PP7 E .   ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  324  PP7 A HV93 
4885 H H1   . PP7 E .   ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  324  PP7 A H1   
4886 H H1A  . PP7 E .   ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  324  PP7 A H1A  
4887 H HC21 . PP7 E .   ? 0.1458 0.1458 0.1458 0.0000  0.0000  0.0000  324  PP7 A HC21 
4888 H HC22 . PP7 E .   ? 0.1458 0.1458 0.1458 0.0000  0.0000  0.0000  324  PP7 A HC22 
4889 H H2   . PP7 E .   ? 0.1500 0.1500 0.1500 0.0000  0.0000  0.0000  324  PP7 A H2   
4890 H HCB1 . PP7 E .   ? 0.1483 0.1483 0.1483 0.0000  0.0000  0.0000  324  PP7 A HCB1 
4891 H HCB2 . PP7 E .   ? 0.1483 0.1483 0.1483 0.0000  0.0000  0.0000  324  PP7 A HCB2 
4892 H HL   . PP7 E .   ? 0.1377 0.1377 0.1377 0.0000  0.0000  0.0000  324  PP7 A HL   
4893 H HAL  . PP7 E .   ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  324  PP7 A HAL  
4894 H HBL2 . PP7 E .   ? 0.1392 0.1392 0.1392 0.0000  0.0000  0.0000  324  PP7 A HBL2 
4895 H HGL  . PP7 E .   ? 0.1527 0.1527 0.1527 0.0000  0.0000  0.0000  324  PP7 A HGL  
4896 H HL12 . PP7 E .   ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  324  PP7 A HL12 
4897 H HL21 . PP7 E .   ? 0.2351 0.2351 0.2351 0.0000  0.0000  0.0000  324  PP7 A HL21 
4898 H HC5  . PP7 E .   ? 0.1486 0.1486 0.1486 0.0000  0.0000  0.0000  324  PP7 A HC5  
4899 H HC61 . PP7 E .   ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  324  PP7 A HC61 
4900 H HC62 . PP7 E .   ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  324  PP7 A HC62 
4901 H H7A  . PP7 E .   ? 0.2951 0.2951 0.2951 0.0000  0.0000  0.0000  324  PP7 A H7A  
4902 H H7B  . PP7 E .   ? 0.2951 0.2951 0.2951 0.0000  0.0000  0.0000  324  PP7 A H7B  
4903 H H7C  . PP7 E .   ? 0.2951 0.2951 0.2951 0.0000  0.0000  0.0000  324  PP7 A H7C  
4904 H HZ   . PP7 E .   ? 0.1747 0.1747 0.1747 0.0000  0.0000  0.0000  324  PP7 A HZ   
4905 H HD2  . PP7 E .   ? 0.1427 0.1427 0.1427 0.0000  0.0000  0.0000  324  PP7 A HD2  
4906 H HE1  . PP7 E .   ? 0.2012 0.2012 0.2012 0.0000  0.0000  0.0000  324  PP7 A HE1  
4907 H HD1  . PP7 E .   ? 0.1792 0.1792 0.1792 0.0000  0.0000  0.0000  324  PP7 A HD1  
4908 C C1   . GOL F .   ? 0.2699 0.2408 0.2485 0.0910  0.0545  0.0128  325  GOL A C1   
4909 O O1   . GOL F .   ? 0.3400 0.2401 0.2107 0.0671  0.0452  0.0224  325  GOL A O1   
4910 C C2   . GOL F .   ? 0.2230 0.2142 0.2849 0.0228  0.0127  0.0148  325  GOL A C2   
4911 O O2   . GOL F .   ? 0.2759 0.4061 0.3614 -0.0701 -0.0489 0.1019  325  GOL A O2   
4912 C C3   . GOL F .   ? 0.2805 0.2075 0.2553 0.0395  -0.0035 0.0017  325  GOL A C3   
4913 O O3   . GOL F .   ? 0.2096 0.1704 0.2538 -0.0137 -0.0203 0.0196  325  GOL A O3   
4914 C C1   . GOL G .   ? 0.3795 0.4837 0.8639 -0.1222 0.0507  0.1615  326  GOL A C1   
4915 O O1   . GOL G .   ? 0.4693 0.6982 1.0565 -0.2949 0.1054  0.0914  326  GOL A O1   
4916 C C2   . GOL G .   ? 0.4111 0.3726 0.7886 -0.1524 0.0224  0.0766  326  GOL A C2   
4917 O O2   . GOL G .   ? 0.4961 0.3015 0.4466 -0.1099 0.1941  -0.1103 326  GOL A O2   
4918 C C3   . GOL G .   ? 0.4146 0.3995 0.5679 -0.1751 0.0014  0.0003  326  GOL A C3   
4919 O O3   . GOL G .   ? 0.3009 0.3329 0.2816 -0.0868 0.0018  -0.0660 326  GOL A O3   
4920 O O    . HOH H .   ? 0.1285 0.1331 0.1371 0.0040  -0.0138 -0.0003 501  HOH A O    
4921 O O    . HOH H .   ? 0.1228 0.1204 0.1449 0.0185  0.0070  0.0038  502  HOH A O    
4922 O O    . HOH H .   ? 0.1209 0.1147 0.1271 0.0009  -0.0007 -0.0015 503  HOH A O    
4923 O O    . HOH H .   ? 0.1166 0.1357 0.1231 0.0054  -0.0076 -0.0112 504  HOH A O    
4924 O O    . HOH H .   ? 0.1337 0.1191 0.1477 0.0075  0.0006  0.0024  505  HOH A O    
4925 O O    . HOH H .   ? 0.1235 0.1160 0.1200 0.0069  0.0029  -0.0081 506  HOH A O    
4926 O O    . HOH H .   ? 0.1581 0.1639 0.1340 0.0126  -0.0092 -0.0126 507  HOH A O    
4927 O O    . HOH H .   ? 0.1345 0.1426 0.1456 0.0156  0.0042  0.0030  508  HOH A O    
4928 O O    . HOH H .   ? 0.1245 0.1475 0.1359 0.0169  -0.0016 0.0079  509  HOH A O    
4929 O O    . HOH H .   ? 0.1487 0.1411 0.1411 0.0023  -0.0257 0.0146  510  HOH A O    
4930 O O    . HOH H .   ? 0.1361 0.1471 0.1532 0.0103  -0.0138 0.0011  511  HOH A O    
4931 O O    . HOH H .   ? 0.2124 0.1403 0.1678 0.0407  -0.0114 -0.0276 512  HOH A O    
4932 O O    . HOH H .   ? 0.1548 0.1569 0.1512 0.0116  0.0041  0.0234  513  HOH A O    
4933 O O    . HOH H .   ? 0.1322 0.1260 0.1271 0.0192  -0.0175 -0.0007 514  HOH A O    
4934 O O    . HOH H .   ? 0.1388 0.1556 0.1459 0.0069  -0.0064 -0.0275 515  HOH A O    
4935 O O    . HOH H .   ? 0.1827 0.1561 0.2562 0.0254  -0.0254 0.0093  516  HOH A O    
4936 O O    . HOH H .   ? 0.1602 0.1781 0.1514 0.0088  -0.0262 0.0059  517  HOH A O    
4937 O O    . HOH H .   ? 0.1467 0.1480 0.1973 0.0292  -0.0233 -0.0081 518  HOH A O    
4938 O O    . HOH H .   ? 0.1789 0.1791 0.1493 0.0083  -0.0226 -0.0178 519  HOH A O    
4939 O O    . HOH H .   ? 0.1455 0.1947 0.1453 0.0197  -0.0133 -0.0383 520  HOH A O    
4940 O O    . HOH H .   ? 0.1467 0.1690 0.1681 0.0100  -0.0134 0.0133  521  HOH A O    
4941 O O    . HOH H .   ? 0.1882 0.2626 0.1459 -0.0309 0.0210  -0.0526 522  HOH A O    
4942 O O    . HOH H .   ? 0.1952 0.1987 0.1530 0.0277  -0.0127 0.0175  523  HOH A O    
4943 O O    . HOH H .   ? 0.1497 0.1482 0.1692 0.0147  -0.0091 0.0049  524  HOH A O    
4944 O O    . HOH H .   ? 0.1766 0.1537 0.1551 0.0212  -0.0149 0.0044  525  HOH A O    
4945 O O    . HOH H .   ? 0.1913 0.1825 0.1389 0.0105  -0.0075 0.0206  526  HOH A O    
4946 O O    . HOH H .   ? 0.1846 0.1799 0.2443 0.0200  -0.0933 -0.0183 527  HOH A O    
4947 O O    . HOH H .   ? 0.2654 0.2155 0.1639 -0.1140 -0.0415 0.0440  528  HOH A O    
4948 O O    . HOH H .   ? 0.1990 0.1690 0.1933 -0.0444 -0.0256 0.0099  529  HOH A O    
4949 O O    . HOH H .   ? 0.1560 0.2165 0.1796 0.0437  -0.0346 -0.0526 530  HOH A O    
4950 O O    . HOH H .   ? 0.1541 0.1679 0.1279 -0.0103 -0.0031 0.0355  531  HOH A O    
4951 O O    . HOH H .   ? 0.1589 0.1499 0.1446 -0.0033 0.0063  -0.0059 532  HOH A O    
4952 O O    . HOH H .   ? 0.2149 0.1877 0.2031 0.0407  0.0257  0.0532  533  HOH A O    
4953 O O    . HOH H .   ? 0.1925 0.2452 0.1523 -0.0357 -0.0094 0.0465  534  HOH A O    
4954 O O    . HOH H .   ? 0.2157 0.1864 0.1401 0.0128  -0.0367 -0.0200 535  HOH A O    
4955 O O    . HOH H .   ? 0.1465 0.1716 0.1967 0.0283  0.0223  0.0192  536  HOH A O    
4956 O O    . HOH H .   ? 0.1861 0.3913 0.2023 0.0328  -0.0078 0.0140  537  HOH A O    
4957 O O    . HOH H .   ? 0.1699 0.2321 0.1851 0.0572  -0.0141 -0.0297 538  HOH A O    
4958 O O    . HOH H .   ? 0.1752 0.1694 0.1595 0.0595  0.0268  0.0246  539  HOH A O    
4959 O O    . HOH H .   ? 0.1844 0.2047 0.1464 0.0200  0.0051  0.0385  540  HOH A O    
4960 O O    . HOH H .   ? 0.1913 0.1682 0.2479 -0.0346 0.0320  -0.0310 541  HOH A O    
4961 O O    . HOH H .   ? 0.1813 0.1769 0.1649 -0.0039 -0.0033 -0.0197 542  HOH A O    
4962 O O    . HOH H .   ? 0.2193 0.2106 0.2728 0.0348  0.0167  0.0223  543  HOH A O    
4963 O O    . HOH H .   ? 0.1898 0.1540 0.2249 -0.0074 -0.0447 0.0385  544  HOH A O    
4964 O O    . HOH H .   ? 0.2031 0.2582 0.1527 -0.0166 -0.0033 0.0129  545  HOH A O    
4965 O O    . HOH H .   ? 0.1422 0.3261 0.1619 0.0484  -0.0022 0.0239  546  HOH A O    
4966 O O    . HOH H .   ? 0.2193 0.1783 0.2033 0.0273  0.0018  0.0184  547  HOH A O    
4967 O O    . HOH H .   ? 0.2123 0.3082 0.2829 -0.0655 -0.0295 0.1263  548  HOH A O    
4968 O O    . HOH H .   ? 0.2554 0.2532 0.2190 -0.0778 -0.0137 0.0092  549  HOH A O    
4969 O O    . HOH H .   ? 0.1899 0.1952 0.1692 0.0073  -0.0060 0.0030  550  HOH A O    
4970 O O    . HOH H .   ? 0.2978 0.2359 0.2714 0.0415  -0.1512 -0.0065 551  HOH A O    
4971 O O    . HOH H .   ? 0.1917 0.2237 0.1938 -0.0519 -0.0239 0.0245  552  HOH A O    
4972 O O    . HOH H .   ? 0.2894 0.2548 0.1983 0.0056  0.0195  0.0391  553  HOH A O    
4973 O O    . HOH H .   ? 0.2043 0.1767 0.2108 0.0417  -0.0148 -0.0066 554  HOH A O    
4974 O O    . HOH H .   ? 0.2921 0.1311 0.2991 0.0354  -0.0459 0.0133  555  HOH A O    
4975 O O    . HOH H .   ? 0.2264 0.1538 0.3146 0.0015  0.0544  0.0138  556  HOH A O    
4976 O O    . HOH H .   ? 0.1671 0.2575 0.1949 -0.0279 -0.0033 0.0152  557  HOH A O    
4977 O O    . HOH H .   ? 0.1960 0.1806 0.2011 -0.0091 -0.0228 0.0245  558  HOH A O    
4978 O O    . HOH H .   ? 0.2248 0.2109 0.2630 -0.0379 0.0338  -0.0111 559  HOH A O    
4979 O O    . HOH H .   ? 0.2253 0.2621 0.1766 0.0555  0.0128  -0.0455 560  HOH A O    
4980 O O    . HOH H .   ? 0.2035 0.2069 0.3132 0.0430  -0.0729 0.0089  561  HOH A O    
4981 O O    . HOH H .   ? 0.2230 0.2704 0.3984 -0.0443 -0.0810 0.0606  562  HOH A O    
4982 O O    . HOH H .   ? 0.2750 0.2017 0.2320 -0.0329 -0.0599 0.0104  563  HOH A O    
4983 O O    . HOH H .   ? 0.1958 0.1344 0.2822 0.0110  -0.0398 -0.0130 564  HOH A O    
4984 O O    . HOH H .   ? 0.2219 0.2713 0.1924 -0.0685 -0.0345 0.0690  565  HOH A O    
4985 O O    . HOH H .   ? 0.2038 0.2409 0.1483 0.0220  -0.0164 -0.0193 566  HOH A O    
4986 O O    . HOH H .   ? 0.1689 0.2027 0.1486 -0.0217 -0.0194 -0.0237 567  HOH A O    
4987 O O    . HOH H .   ? 0.2163 0.2410 0.1990 -0.0215 0.0078  -0.0113 568  HOH A O    
4988 O O    . HOH H .   ? 0.2183 0.2728 0.2127 -0.0356 0.0023  0.0235  569  HOH A O    
4989 O O    . HOH H .   ? 0.2226 0.1515 0.2209 -0.0094 -0.0302 -0.0118 570  HOH A O    
4990 O O    . HOH H .   ? 0.2525 0.2304 0.2554 0.0372  0.0325  0.0342  571  HOH A O    
4991 O O    . HOH H .   ? 0.2644 0.2167 0.4007 0.0433  -0.1734 -0.0289 572  HOH A O    
4992 O O    . HOH H .   ? 0.2335 0.2469 0.2244 -0.0252 -0.0538 0.0461  573  HOH A O    
4993 O O    . HOH H .   ? 0.2372 0.2226 0.3263 -0.0379 0.0413  -0.0536 574  HOH A O    
4994 O O    . HOH H .   ? 0.1722 0.3229 0.1689 -0.0176 -0.0253 0.0218  575  HOH A O    
4995 O O    . HOH H .   ? 0.2935 0.1877 0.3593 0.0142  -0.0992 -0.0480 576  HOH A O    
4996 O O    . HOH H .   ? 0.2164 0.2642 0.2227 0.0786  0.0704  0.0931  577  HOH A O    
4997 O O    . HOH H .   ? 0.2525 0.1812 0.1915 0.0572  0.0003  0.0032  578  HOH A O    
4998 O O    . HOH H .   ? 0.2708 0.2539 0.3409 0.0618  -0.0447 -0.1071 579  HOH A O    
4999 O O    A HOH H .   ? 0.1628 0.2577 0.2430 0.0497  0.0278  0.0212  580  HOH A O    
5000 O O    B HOH H .   ? 0.4278 0.2884 0.2527 0.0883  -0.1421 0.0436  580  HOH A O    
5001 O O    . HOH H .   ? 0.2586 0.1892 0.3889 -0.0136 0.0036  -0.0838 581  HOH A O    
5002 O O    . HOH H .   ? 0.2188 0.2982 0.1861 0.0587  0.0041  0.0446  582  HOH A O    
5003 O O    . HOH H .   ? 0.1888 0.1902 0.2925 -0.0301 -0.0616 0.0341  583  HOH A O    
5004 O O    . HOH H .   ? 0.2307 0.3357 0.2073 0.0410  0.0126  -0.0041 584  HOH A O    
5005 O O    . HOH H .   ? 0.2963 0.2631 0.2928 -0.0938 -0.0588 0.0089  585  HOH A O    
5006 O O    . HOH H .   ? 0.2925 0.1854 0.2038 -0.0107 -0.0465 -0.0127 586  HOH A O    
5007 O O    . HOH H .   ? 0.2365 0.2573 0.2538 0.0067  -0.0225 0.0425  587  HOH A O    
5008 O O    . HOH H .   ? 0.1962 0.2837 0.3029 0.0569  -0.0009 -0.0866 588  HOH A O    
5009 O O    . HOH H .   ? 0.2466 0.2107 0.1980 0.0042  -0.0690 -0.0262 589  HOH A O    
5010 O O    . HOH H .   ? 0.2828 0.3429 0.1873 -0.0711 -0.0663 0.0595  590  HOH A O    
5011 O O    . HOH H .   ? 0.1778 0.2656 0.2311 0.0416  0.0040  0.0661  591  HOH A O    
5012 O O    . HOH H .   ? 0.2518 0.2098 0.3274 -0.0098 -0.0883 0.0079  592  HOH A O    
5013 O O    . HOH H .   ? 0.2114 0.3592 0.1689 0.0157  0.0134  0.0451  593  HOH A O    
5014 O O    . HOH H .   ? 0.2604 0.3208 0.3305 0.0943  0.0010  -0.1519 594  HOH A O    
5015 O O    . HOH H .   ? 0.1884 0.2039 0.4048 -0.0237 0.0388  -0.0061 595  HOH A O    
5016 O O    . HOH H .   ? 0.2512 0.1945 0.2540 -0.0091 0.0148  -0.0020 596  HOH A O    
5017 O O    . HOH H .   ? 0.2851 0.3919 0.1753 -0.0215 -0.0479 0.0214  597  HOH A O    
5018 O O    . HOH H .   ? 0.2934 0.1599 0.3352 0.0255  -0.0782 0.0133  598  HOH A O    
5019 O O    . HOH H .   ? 0.3420 0.2158 0.3931 -0.0138 -0.0551 -0.0035 599  HOH A O    
5020 O O    . HOH H .   ? 0.3076 0.1418 0.4882 -0.0459 -0.1264 -0.0017 600  HOH A O    
5021 O O    . HOH H .   ? 0.3470 0.2593 0.2469 0.0729  -0.0319 0.0421  601  HOH A O    
5022 O O    . HOH H .   ? 0.2584 0.2408 0.1967 -0.0571 -0.0142 -0.0079 602  HOH A O    
5023 O O    . HOH H .   ? 0.2254 0.2226 0.3371 0.0473  0.0075  -0.0185 603  HOH A O    
5024 O O    . HOH H .   ? 0.2298 0.4709 0.2117 -0.0998 0.0081  -0.0165 604  HOH A O    
5025 O O    . HOH H .   ? 0.2976 0.1941 0.2615 0.0238  0.0095  0.0304  605  HOH A O    
5026 O O    . HOH H .   ? 0.1982 0.2226 0.2426 0.0080  0.0063  0.0486  606  HOH A O    
5027 O O    . HOH H .   ? 0.3022 0.2852 0.3014 -0.0350 0.0277  -0.0710 607  HOH A O    
5028 O O    . HOH H .   ? 0.2992 0.2361 0.2728 0.0051  0.0961  0.0025  608  HOH A O    
5029 O O    . HOH H .   ? 0.4013 0.2337 0.2001 -0.0745 -0.1048 0.0221  609  HOH A O    
5030 O O    . HOH H .   ? 0.1793 0.2754 0.2482 -0.0150 -0.0076 -0.0197 610  HOH A O    
5031 O O    . HOH H .   ? 0.2779 0.3738 0.1970 0.0349  0.0116  0.0189  611  HOH A O    
5032 O O    . HOH H .   ? 0.3001 0.2144 0.2164 0.0089  -0.0554 -0.0410 612  HOH A O    
5033 O O    . HOH H .   ? 0.2882 0.2497 0.3647 -0.0696 0.0663  0.0140  613  HOH A O    
5034 O O    . HOH H .   ? 0.3479 0.2832 0.2194 0.0229  -0.0294 -0.0334 614  HOH A O    
5035 O O    . HOH H .   ? 0.4495 0.3673 0.3168 -0.0460 0.0307  0.0752  615  HOH A O    
5036 O O    . HOH H .   ? 0.3712 0.3592 0.2692 -0.1069 0.0187  0.0588  616  HOH A O    
5037 O O    . HOH H .   ? 0.1874 0.2552 0.5123 0.0206  -0.0554 -0.0459 617  HOH A O    
5038 O O    . HOH H .   ? 0.3697 0.3810 0.2197 -0.0758 0.1280  -0.0933 618  HOH A O    
5039 O O    . HOH H .   ? 0.2907 0.3046 0.2995 0.0679  0.0436  -0.0471 619  HOH A O    
5040 O O    . HOH H .   ? 0.2927 0.4311 0.2746 -0.0865 0.0419  -0.1272 620  HOH A O    
5041 O O    . HOH H .   ? 0.3541 0.3442 0.2233 0.0492  -0.0912 0.0278  621  HOH A O    
5042 O O    . HOH H .   ? 0.2333 0.3111 0.2059 0.0563  -0.0014 -0.0459 622  HOH A O    
5043 O O    . HOH H .   ? 0.2256 0.2524 0.1959 -0.0315 -0.0388 0.0283  623  HOH A O    
5044 O O    . HOH H .   ? 0.2128 0.2745 0.2515 0.0056  -0.0249 0.0251  624  HOH A O    
5045 O O    A HOH H .   ? 0.3778 0.1853 0.3621 0.1116  -0.2404 -0.0647 625  HOH A O    
5046 O O    B HOH H .   ? 0.1576 0.1748 0.2653 0.0268  0.0007  0.0048  625  HOH A O    
5047 O O    A HOH H .   ? 0.1683 0.1912 0.1811 0.0280  -0.0216 0.0024  626  HOH A O    
5048 O O    B HOH H .   ? 0.1820 0.2420 0.2268 -0.0257 -0.0135 -0.0068 626  HOH A O    
5049 O O    . HOH H .   ? 0.3077 0.3016 0.2217 0.0092  0.0009  0.0242  627  HOH A O    
5050 O O    . HOH H .   ? 0.2570 0.3612 0.1990 0.0348  0.0262  0.0342  628  HOH A O    
5051 O O    . HOH H .   ? 0.5588 0.1665 0.4587 -0.0161 -0.2745 0.0104  629  HOH A O    
5052 O O    . HOH H .   ? 0.2094 0.2256 0.1993 0.0174  -0.0192 0.0220  630  HOH A O    
5053 O O    . HOH H .   ? 0.5932 0.4132 0.2490 -0.1887 0.1255  -0.0331 631  HOH A O    
5054 O O    . HOH H .   ? 0.2595 0.3433 0.1807 -0.0206 -0.0218 0.0171  632  HOH A O    
5055 O O    . HOH H .   ? 0.3778 0.2872 0.2559 -0.0463 0.0519  0.0492  633  HOH A O    
5056 O O    . HOH H .   ? 0.2504 0.5192 0.2409 0.0557  0.0799  0.0600  634  HOH A O    
5057 O O    . HOH H .   ? 0.3580 0.3443 0.3145 0.1426  -0.1620 -0.0935 635  HOH A O    
5058 O O    . HOH H .   ? 0.2985 0.3124 0.3034 -0.0113 -0.0755 0.0628  636  HOH A O    
5059 O O    . HOH H .   ? 0.3694 0.2616 0.4092 0.0988  0.0606  0.0752  637  HOH A O    
5060 O O    . HOH H .   ? 0.3188 0.2369 0.2508 0.0814  -0.0223 -0.0114 638  HOH A O    
5061 O O    . HOH H .   ? 0.1995 0.3611 0.2512 -0.0010 -0.0292 0.0606  639  HOH A O    
5062 O O    . HOH H .   ? 0.6513 0.4372 0.2366 0.2406  0.0042  0.0088  640  HOH A O    
5063 O O    . HOH H .   ? 0.4549 0.2729 0.2338 0.0392  0.0571  -0.0024 641  HOH A O    
5064 O O    . HOH H .   ? 0.4078 0.3276 0.2335 -0.1018 0.0977  -0.0389 642  HOH A O    
5065 O O    . HOH H .   ? 0.3013 0.2530 0.1970 0.0069  -0.0164 -0.0734 643  HOH A O    
5066 O O    . HOH H .   ? 0.3070 0.1758 0.2318 0.0671  0.0899  0.0564  644  HOH A O    
5067 O O    . HOH H .   ? 0.2270 0.2112 0.2763 -0.0491 -0.0052 -0.0222 645  HOH A O    
5068 O O    . HOH H .   ? 0.3095 0.2026 0.1852 0.0615  0.0252  0.0070  646  HOH A O    
5069 O O    . HOH H .   ? 0.3282 0.2261 0.2901 0.0924  -0.0961 -0.0205 647  HOH A O    
5070 O O    . HOH H .   ? 0.2571 0.2024 0.2414 0.0305  -0.0026 -0.0021 648  HOH A O    
5071 O O    . HOH H .   ? 0.2400 0.1949 0.4285 -0.0126 -0.0351 -0.0070 649  HOH A O    
5072 O O    A HOH H .   ? 0.1894 0.2055 0.1749 -0.0060 0.0008  -0.0314 650  HOH A O    
5073 O O    B HOH H .   ? 0.1448 0.2323 0.1940 0.0028  0.0007  0.0548  650  HOH A O    
5074 O O    . HOH H .   ? 0.3096 0.3328 0.2291 0.0371  -0.0654 -0.0040 651  HOH A O    
5075 O O    . HOH H .   ? 0.2881 0.2349 0.3867 -0.0302 0.0381  -0.0590 652  HOH A O    
5076 O O    . HOH H .   ? 0.2152 0.2506 0.3043 -0.0084 -0.0526 -0.0383 653  HOH A O    
5077 O O    . HOH H .   ? 0.2393 0.2605 0.4372 0.0065  0.0157  0.0585  654  HOH A O    
5078 O O    . HOH H .   ? 0.2113 0.1991 0.1572 0.0156  -0.0100 -0.0038 655  HOH A O    
5079 O O    . HOH H .   ? 0.2691 0.1646 0.3344 -0.0006 -0.0637 -0.0009 656  HOH A O    
5080 O O    . HOH H .   ? 0.2763 0.1980 0.3834 -0.0290 0.0055  -0.0199 657  HOH A O    
5081 O O    . HOH H .   ? 0.2441 0.5469 0.1972 0.0506  -0.0488 -0.1045 658  HOH A O    
5082 O O    . HOH H .   ? 0.2874 0.3268 0.3092 0.0649  -0.0020 0.0648  659  HOH A O    
5083 O O    . HOH H .   ? 0.2901 0.2502 0.3400 -0.0114 0.0872  -0.0347 660  HOH A O    
5084 O O    . HOH H .   ? 0.4090 0.3058 0.2507 0.0641  -0.0463 0.0287  661  HOH A O    
5085 O O    A HOH H .   ? 0.2442 0.2132 0.1670 -0.0551 -0.0028 -0.0012 662  HOH A O    
5086 O O    . HOH H .   ? 0.1913 0.3083 0.4395 -0.0236 -0.0292 0.0716  663  HOH A O    
5087 O O    . HOH H .   ? 0.3645 0.3653 0.2718 0.0242  0.0267  0.0010  664  HOH A O    
5088 O O    . HOH H .   ? 0.3392 0.3385 0.2728 0.0578  -0.0756 -0.0111 665  HOH A O    
5089 O O    . HOH H .   ? 0.5168 0.5099 0.4542 -0.1829 -0.2260 0.0867  666  HOH A O    
5090 O O    . HOH H .   ? 0.2691 0.1823 0.4037 -0.0493 -0.0390 0.1082  667  HOH A O    
5091 O O    . HOH H .   ? 0.3742 0.2679 0.3571 -0.0042 -0.0508 0.0233  668  HOH A O    
5092 O O    . HOH H .   ? 0.3804 0.5748 0.2234 -0.1370 0.0469  0.0094  669  HOH A O    
5093 O O    . HOH H .   ? 0.3169 0.3442 0.4037 0.1077  -0.2075 -0.1913 670  HOH A O    
5094 O O    A HOH H .   ? 0.2661 0.2194 0.3452 -0.0610 -0.1736 0.1078  671  HOH A O    
5095 O O    B HOH H .   ? 0.1459 0.1372 0.2600 0.0151  -0.0461 -0.0219 671  HOH A O    
5096 O O    . HOH H .   ? 0.1838 0.2239 0.5066 0.0441  0.0857  0.1149  672  HOH A O    
5097 O O    . HOH H .   ? 0.3839 0.3275 0.3059 0.0760  -0.0221 -0.0372 673  HOH A O    
5098 O O    . HOH H .   ? 0.3258 0.3846 0.3731 -0.1200 0.0935  0.0212  674  HOH A O    
5099 O O    . HOH H .   ? 0.2661 0.3858 0.5182 -0.1150 -0.0862 -0.0099 675  HOH A O    
5100 O O    . HOH H .   ? 0.2434 0.2183 0.2962 -0.0016 -0.0145 -0.0381 676  HOH A O    
5101 O O    . HOH H .   ? 0.3268 0.2688 0.4144 -0.0351 0.0746  -0.0020 677  HOH A O    
5102 O O    . HOH H .   ? 0.3698 0.2261 0.3984 -0.0467 0.0570  0.0522  678  HOH A O    
5103 O O    . HOH H .   ? 0.2761 0.3734 0.2510 0.0386  0.0130  0.0475  679  HOH A O    
5104 O O    . HOH H .   ? 0.6017 0.3305 0.2665 0.1647  -0.1573 -0.0791 680  HOH A O    
5105 O O    . HOH H .   ? 0.2775 0.4821 0.4346 -0.0715 -0.0247 -0.2260 681  HOH A O    
5106 O O    . HOH H .   ? 0.3474 0.3385 0.2879 0.0405  -0.0058 -0.1427 682  HOH A O    
5107 O O    . HOH H .   ? 0.4830 0.3616 0.3350 0.2333  0.0546  0.0857  683  HOH A O    
5108 O O    . HOH H .   ? 0.6246 0.2873 0.2455 -0.1830 0.0095  -0.0100 684  HOH A O    
5109 O O    . HOH H .   ? 0.4733 0.2237 0.4967 0.0459  -0.3019 -0.0093 685  HOH A O    
5110 O O    . HOH H .   ? 0.2529 0.7313 0.2652 -0.0088 -0.0179 -0.0906 686  HOH A O    
5111 O O    . HOH H .   ? 0.3582 0.2655 0.4167 0.0759  0.0699  -0.0285 687  HOH A O    
5112 O O    A HOH H .   ? 0.1500 0.3993 0.2373 -0.0620 -0.0296 0.1111  688  HOH A O    
5113 O O    B HOH H .   ? 0.2882 0.3515 0.2555 0.0889  0.0084  0.1107  688  HOH A O    
5114 O O    . HOH H .   ? 0.4447 0.2521 0.2265 -0.0184 0.0148  0.0019  689  HOH A O    
5115 O O    . HOH H .   ? 0.2575 0.3639 0.4429 -0.0669 -0.0426 0.2371  690  HOH A O    
5116 O O    . HOH H .   ? 0.2021 0.5455 0.4845 0.1089  -0.0434 -0.2070 691  HOH A O    
5117 O O    . HOH H .   ? 0.3752 0.3766 0.3477 0.1383  0.0172  0.0996  692  HOH A O    
5118 O O    . HOH H .   ? 0.2697 0.5475 0.4345 0.0360  -0.1018 0.1807  693  HOH A O    
5119 O O    . HOH H .   ? 0.2692 0.5582 0.3323 0.0051  -0.0035 0.1678  694  HOH A O    
5120 O O    . HOH H .   ? 0.6058 0.2889 0.2267 -0.1729 0.0083  -0.0222 695  HOH A O    
5121 O O    . HOH H .   ? 0.2788 0.7875 0.3210 0.1243  -0.0545 -0.1721 696  HOH A O    
5122 O O    . HOH H .   ? 0.3778 0.2387 0.3570 -0.0205 -0.0206 -0.0027 697  HOH A O    
5123 O O    . HOH H .   ? 0.4162 0.2345 0.3904 0.0281  0.0868  0.0346  698  HOH A O    
5124 O O    . HOH H .   ? 0.2492 0.3099 0.5466 0.0026  0.0812  -0.1836 699  HOH A O    
5125 O O    . HOH H .   ? 0.3029 0.5270 0.2250 -0.0191 0.0405  -0.0577 700  HOH A O    
5126 O O    . HOH H .   ? 0.2648 0.4489 0.3702 -0.0336 -0.0244 -0.0742 701  HOH A O    
5127 O O    . HOH H .   ? 0.3599 0.2781 0.4111 0.0296  0.0432  -0.1415 702  HOH A O    
5128 O O    . HOH H .   ? 0.5389 0.5636 0.4649 0.3729  -0.2677 -0.2909 703  HOH A O    
5129 O O    . HOH H .   ? 0.1994 0.4683 0.3883 -0.0386 -0.0039 -0.0019 704  HOH A O    
5130 O O    . HOH H .   ? 0.3528 0.4826 0.2084 0.0990  -0.0466 -0.0092 705  HOH A O    
5131 O O    . HOH H .   ? 0.3983 0.4755 0.2428 0.1559  0.0660  0.0424  706  HOH A O    
5132 O O    . HOH H .   ? 0.5186 0.3293 0.2608 -0.1858 0.0051  -0.0460 707  HOH A O    
5133 O O    . HOH H .   ? 0.3672 0.1746 0.5432 0.0132  -0.0646 0.0916  708  HOH A O    
5134 O O    . HOH H .   ? 0.4751 0.2350 0.6357 0.0455  -0.3643 0.0458  709  HOH A O    
5135 O O    . HOH H .   ? 0.2978 0.5276 0.6288 0.1208  0.0940  0.0703  710  HOH A O    
5136 O O    . HOH H .   ? 0.3937 0.2474 0.6528 0.0940  -0.0554 -0.1881 711  HOH A O    
5137 O O    A HOH H .   ? 0.5841 0.1846 0.2192 0.1525  -0.1315 -0.0575 712  HOH A O    
5138 O O    B HOH H .   ? 0.4537 0.2250 0.2033 -0.0453 -0.1285 -0.0522 712  HOH A O    
5139 O O    . HOH H .   ? 0.4981 0.1965 0.7326 -0.0752 -0.1171 0.0574  713  HOH A O    
5140 O O    . HOH H .   ? 0.3786 0.3351 0.4845 -0.1082 0.1875  -0.0580 714  HOH A O    
5141 O O    . HOH H .   ? 0.4824 0.4732 0.3236 0.2258  0.0792  0.0853  715  HOH A O    
5142 O O    . HOH H .   ? 0.3617 0.6185 0.3532 -0.1464 0.1436  -0.1995 716  HOH A O    
5143 O O    . HOH H .   ? 0.3500 0.3103 0.3698 -0.0337 -0.0215 0.0757  717  HOH A O    
5144 O O    . HOH H .   ? 0.6196 0.3250 0.6451 0.2766  -0.1390 -0.0832 718  HOH A O    
5145 O O    . HOH H .   ? 0.4772 0.2252 0.4714 -0.0123 0.1470  -0.0911 719  HOH A O    
5146 O O    . HOH H .   ? 0.4995 0.7467 0.2444 -0.1528 0.0595  0.0474  720  HOH A O    
5147 O O    . HOH H .   ? 0.3968 0.2745 0.3358 -0.0073 -0.0892 -0.0650 721  HOH A O    
5148 O O    . HOH H .   ? 0.3082 0.3149 0.3928 -0.0123 -0.0611 0.0789  722  HOH A O    
5149 O O    . HOH H .   ? 0.3466 0.7912 0.5682 -0.2045 -0.1841 0.3807  723  HOH A O    
5150 O O    . HOH H .   ? 0.3978 0.5175 0.3281 0.2101  -0.1545 -0.1226 724  HOH A O    
5151 O O    . HOH H .   ? 0.2624 0.6683 0.4081 -0.0740 -0.0313 -0.1154 725  HOH A O    
5152 O O    . HOH H .   ? 0.4542 0.4983 0.3967 0.0516  -0.1416 0.0268  726  HOH A O    
5153 O O    A HOH H .   ? 0.4442 0.4558 0.1993 0.2499  -0.1013 -0.0622 727  HOH A O    
5154 O O    B HOH H .   ? 0.2524 0.2090 0.2267 -0.0296 -0.0224 -0.0094 727  HOH A O    
5155 O O    . HOH H .   ? 0.8664 0.5883 0.3323 -0.1041 -0.0841 0.0847  728  HOH A O    
5156 O O    . HOH H .   ? 0.3270 0.6387 0.3562 0.1533  0.0704  -0.0668 729  HOH A O    
5157 O O    . HOH H .   ? 0.5587 0.4055 0.3007 0.2282  -0.0342 0.0589  730  HOH A O    
5158 O O    . HOH H .   ? 0.3446 0.5357 0.3338 0.1264  0.0803  0.0844  731  HOH A O    
5159 O O    . HOH H .   ? 0.4693 0.2411 0.5881 -0.0758 -0.1706 0.0941  732  HOH A O    
5160 O O    . HOH H .   ? 0.5011 0.2877 0.4818 -0.0498 0.0776  -0.0111 733  HOH A O    
5161 O O    . HOH H .   ? 0.3117 0.3931 0.3001 0.0242  -0.0645 -0.0480 734  HOH A O    
5162 O O    . HOH H .   ? 0.3656 0.3458 0.4375 -0.0787 0.0962  -0.1020 735  HOH A O    
5163 O O    . HOH H .   ? 0.4943 0.5385 0.4291 0.2200  0.1313  0.0136  736  HOH A O    
5164 O O    . HOH H .   ? 0.3342 0.5026 0.4985 -0.0676 -0.0490 0.1307  737  HOH A O    
5165 O O    . HOH H .   ? 0.8977 0.2711 0.2396 0.0880  0.0119  0.0258  738  HOH A O    
5166 O O    . HOH H .   ? 0.7729 0.2989 0.3596 -0.0376 -0.0754 -0.0728 739  HOH A O    
5167 O O    . HOH H .   ? 0.5328 0.3258 0.4252 -0.0618 -0.1558 -0.0803 740  HOH A O    
5168 O O    . HOH H .   ? 0.7510 0.3379 0.4504 -0.0553 -0.2803 -0.0426 741  HOH A O    
5169 O O    A HOH H .   ? 0.4081 0.3486 0.2872 0.0472  0.1965  -0.0117 742  HOH A O    
5170 O O    . HOH H .   ? 0.6360 0.3185 0.3667 -0.0247 0.0913  0.0219  743  HOH A O    
5171 O O    . HOH H .   ? 0.5105 0.5865 0.2437 -0.0731 0.1133  -0.0428 744  HOH A O    
5172 O O    . HOH H .   ? 0.5536 0.5082 0.3157 -0.2355 -0.0970 0.0500  745  HOH A O    
5173 O O    . HOH H .   ? 0.7617 0.4135 0.5368 -0.1296 -0.2232 -0.0242 746  HOH A O    
5174 O O    . HOH H .   ? 0.3392 0.7484 0.7667 -0.2140 -0.0554 -0.1180 747  HOH A O    
5175 O O    . HOH H .   ? 0.7220 0.6198 0.5413 -0.0086 -0.3113 -0.1236 748  HOH A O    
5176 O O    . HOH H .   ? 0.2023 0.6808 0.4507 0.1015  -0.0083 0.2622  749  HOH A O    
5177 O O    . HOH H .   ? 0.6085 0.3298 0.3072 0.2451  -0.0673 -0.0712 750  HOH A O    
5178 O O    . HOH H .   ? 0.6514 0.2919 0.5639 0.1834  -0.0979 -0.1838 751  HOH A O    
5179 O O    . HOH H .   ? 0.4459 0.3696 0.4543 0.1075  0.1792  0.0897  752  HOH A O    
5180 O O    . HOH H .   ? 0.4792 0.4051 0.6528 -0.0761 0.0550  0.2575  753  HOH A O    
5181 O O    . HOH H .   ? 0.4045 0.5133 0.2960 0.2419  -0.0714 -0.0099 754  HOH A O    
5182 O O    . HOH H .   ? 0.2076 0.3340 0.5397 -0.0131 -0.0568 -0.1486 755  HOH A O    
5183 O O    . HOH H .   ? 0.4663 0.5626 0.6156 -0.0960 -0.0122 -0.3755 756  HOH A O    
5184 O O    . HOH H .   ? 0.2900 0.3273 0.5614 -0.0084 0.0172  -0.0817 757  HOH A O    
5185 O O    . HOH H .   ? 0.4596 0.4145 0.7307 0.0233  0.0145  0.0492  758  HOH A O    
5186 O O    . HOH H .   ? 0.3606 0.3833 0.4179 0.1559  0.0084  0.0200  759  HOH A O    
5187 O O    . HOH H .   ? 0.3409 0.4343 0.3979 0.0670  0.0172  -0.1459 760  HOH A O    
5188 O O    . HOH H .   ? 0.2358 0.7334 0.3412 0.1234  -0.1016 -0.1588 761  HOH A O    
5189 O O    . HOH H .   ? 0.7230 0.6494 0.5893 0.0137  0.1755  -0.2605 762  HOH A O    
5190 O O    . HOH H .   ? 0.3949 0.4694 0.4040 -0.2050 -0.0778 0.1060  763  HOH A O    
5191 O O    . HOH H .   ? 0.3431 0.6265 0.6102 0.0162  0.1136  0.0222  764  HOH A O    
5192 O O    . HOH H .   ? 0.4570 0.4943 0.4912 -0.0092 0.0446  0.0629  765  HOH A O    
5193 O O    . HOH H .   ? 0.5168 0.4171 0.4838 -0.1569 -0.2369 -0.0571 766  HOH A O    
5194 O O    A HOH H .   ? 0.4133 0.3119 0.3358 0.0723  0.0663  -0.0877 767  HOH A O    
5195 O O    B HOH H .   ? 0.4770 0.2011 0.3853 0.0025  -0.0559 -0.0316 767  HOH A O    
5196 O O    . HOH H .   ? 0.3908 0.5250 0.6593 0.0210  0.1500  0.0200  768  HOH A O    
5197 O O    . HOH H .   ? 0.5761 0.6946 0.5021 0.0702  -0.0742 0.1287  769  HOH A O    
5198 O O    . HOH H .   ? 0.3375 0.7803 0.3801 0.0022  -0.1505 0.1332  770  HOH A O    
5199 O O    A HOH H .   ? 0.2234 0.2864 0.2959 -0.0412 -0.0664 0.1067  771  HOH A O    
5200 O O    B HOH H .   ? 0.1978 0.2843 0.2509 0.0250  -0.0196 0.0849  771  HOH A O    
5201 O O    . HOH H .   ? 0.3680 0.5384 0.4749 0.0223  0.0982  0.2091  772  HOH A O    
5202 O O    . HOH H .   ? 0.6440 0.2303 0.4214 0.0472  -0.1316 -0.0988 773  HOH A O    
5203 O O    . HOH H .   ? 0.1380 0.4183 0.9007 0.0615  -0.0116 0.2451  774  HOH A O    
5204 O O    . HOH H .   ? 0.3718 0.8744 0.2470 0.1383  0.1006  -0.0495 775  HOH A O    
5205 O O    . HOH H .   ? 0.4614 0.4060 0.4876 0.0140  0.1352  -0.0121 776  HOH A O    
5206 O O    . HOH H .   ? 0.7091 0.5872 0.1662 0.0000  -0.0154 0.0000  777  HOH A O    
5207 O O    . HOH H .   ? 0.7195 0.5956 0.2935 0.0000  -0.1545 0.0000  778  HOH A O    
5208 O O    . HOH H .   ? 0.2183 0.6069 0.5556 0.0202  0.1124  -0.0443 779  HOH A O    
5209 O O    . HOH H .   ? 0.4168 0.7675 0.5075 0.2028  0.1259  -0.0737 780  HOH A O    
5210 O O    . HOH H .   ? 0.9485 1.0874 1.0631 -0.0151 0.0161  0.0233  781  HOH A O    
5211 O O    . HOH H .   ? 0.4932 0.5772 0.3543 -0.1593 -0.0181 0.0716  782  HOH A O    
5212 O O    . HOH H .   ? 0.4795 0.4158 0.2906 0.0554  -0.0174 -0.0906 783  HOH A O    
5213 O O    . HOH H .   ? 0.2762 0.3035 0.7919 0.0312  0.0210  0.1296  784  HOH A O    
5214 O O    . HOH H .   ? 0.4926 0.6338 0.4300 -0.2669 -0.0224 0.0142  785  HOH A O    
5215 O O    . HOH H .   ? 0.6121 0.2556 0.4085 0.1833  -0.1008 -0.0285 786  HOH A O    
5216 O O    . HOH H .   ? 0.8537 0.4503 0.2754 -0.0365 0.0792  -0.0759 787  HOH A O    
5217 O O    . HOH H .   ? 0.4119 0.3811 0.5529 -0.0129 0.1538  -0.1982 788  HOH A O    
5218 O O    . HOH H .   ? 0.4990 0.6530 0.5174 0.1607  0.0231  -0.2931 789  HOH A O    
5219 O O    . HOH H .   ? 1.0578 0.3037 0.3595 -0.0605 -0.1243 0.1122  790  HOH A O    
5220 O O    . HOH H .   ? 0.2797 0.4822 0.4212 0.0086  0.0860  0.1386  791  HOH A O    
5221 O O    . HOH H .   ? 0.5865 0.3042 0.4427 -0.1254 -0.0575 -0.0583 792  HOH A O    
5222 O O    . HOH H .   ? 0.3333 0.6326 0.4337 -0.0496 0.1201  -0.0964 793  HOH A O    
5223 O O    . HOH H .   ? 0.2710 0.4462 0.8228 -0.0161 0.0089  -0.2906 794  HOH A O    
5224 O O    . HOH H .   ? 0.5425 0.7457 0.3379 0.1201  0.2163  0.0723  795  HOH A O    
5225 O O    . HOH H .   ? 0.4946 0.6403 0.5622 -0.1618 -0.1458 0.1643  796  HOH A O    
5226 O O    . HOH H .   ? 0.5130 0.4289 0.3035 0.0376  -0.0954 0.1041  797  HOH A O    
5227 O O    . HOH H .   ? 0.2846 0.6889 0.4201 -0.0555 -0.0739 -0.1913 798  HOH A O    
5228 O O    . HOH H .   ? 0.5590 0.3992 0.5641 0.0362  -0.0028 -0.1654 799  HOH A O    
5229 O O    . HOH H .   ? 0.4106 0.5155 0.5020 0.0962  -0.0114 0.0367  800  HOH A O    
5230 O O    . HOH H .   ? 0.7864 0.8175 0.5460 -0.2553 0.2507  0.2521  801  HOH A O    
5231 O O    . HOH H .   ? 0.6349 0.5476 0.3222 -0.1316 -0.0603 0.0150  802  HOH A O    
5232 O O    . HOH H .   ? 0.4998 0.3791 0.5076 -0.0086 0.1940  0.0559  803  HOH A O    
5233 O O    . HOH H .   ? 0.8274 0.3784 0.4681 -0.0626 -0.2230 -0.0535 804  HOH A O    
5234 O O    . HOH H .   ? 0.7226 0.4070 0.3180 0.2307  0.0835  0.0085  805  HOH A O    
5235 O O    . HOH H .   ? 0.6746 0.5089 0.6309 -0.1095 -0.0238 -0.0195 806  HOH A O    
5236 O O    A HOH H .   ? 0.3852 0.2138 0.6280 -0.0465 -0.1206 -0.1058 807  HOH A O    
5237 O O    B HOH H .   ? 0.3960 0.3075 0.4079 0.0119  -0.1166 -0.0418 807  HOH A O    
5238 O O    A HOH H .   ? 0.3810 0.4646 0.4483 -0.0338 -0.0146 0.0048  808  HOH A O    
5239 O O    B HOH H .   ? 0.2907 0.4215 0.3659 0.0028  0.0295  -0.0315 808  HOH A O    
5240 O O    . HOH H .   ? 0.4493 0.5962 0.6050 -0.1155 -0.1069 -0.1624 809  HOH A O    
5241 O O    . HOH H .   ? 0.4956 0.4337 0.7019 -0.1838 -0.0460 -0.0261 810  HOH A O    
5242 O O    . HOH H .   ? 0.4550 0.5929 0.6366 -0.3487 -0.0891 -0.0468 811  HOH A O    
5243 O O    . HOH H .   ? 1.0228 0.2910 0.5372 -0.1610 -0.2594 0.1135  812  HOH A O    
5244 O O    . HOH H .   ? 0.6607 0.3827 0.5378 0.0751  0.1816  -0.0536 813  HOH A O    
5245 O O    . HOH H .   ? 0.7347 0.2659 0.6561 -0.0382 -0.1016 -0.1290 814  HOH A O    
5246 O O    . HOH H .   ? 0.7450 0.6561 0.8788 -0.2148 0.1439  0.1889  815  HOH A O    
5247 O O    . HOH H .   ? 0.9112 0.4346 0.2972 0.0746  -0.2005 -0.1029 816  HOH A O    
5248 O O    . HOH H .   ? 0.5852 0.5369 0.2983 0.0906  -0.0677 -0.0645 817  HOH A O    
5249 O O    . HOH H .   ? 0.4416 0.3764 0.3511 0.1196  -0.0934 -0.0942 818  HOH A O    
5250 O O    . HOH H .   ? 0.4977 0.8574 0.3861 0.0306  0.0308  -0.2887 819  HOH A O    
5251 O O    . HOH H .   ? 0.3464 0.7013 0.5426 0.0888  0.1354  0.0362  820  HOH A O    
5252 O O    . HOH H .   ? 0.6700 0.6824 0.3248 0.0446  -0.0204 -0.1744 821  HOH A O    
5253 O O    . HOH H .   ? 0.5293 0.3553 0.8116 0.1364  -0.0847 -0.2480 822  HOH A O    
5254 O O    . HOH H .   ? 0.4594 0.7216 0.4098 -0.3158 0.0285  -0.0489 823  HOH A O    
5255 O O    . HOH H .   ? 0.5425 0.3673 0.6069 0.0032  0.0860  -0.0925 824  HOH A O    
5256 O O    . HOH H .   ? 0.3998 0.5122 0.7134 0.0153  -0.0505 0.2974  825  HOH A O    
5257 O O    . HOH H .   ? 0.5956 0.4020 0.5646 -0.0272 0.0450  -0.1691 826  HOH A O    
5258 O O    . HOH H .   ? 0.5349 0.5179 0.5315 -0.1854 -0.0797 0.1263  827  HOH A O    
5259 O O    . HOH H .   ? 0.9347 0.9955 0.5428 -0.2272 0.1880  0.1651  828  HOH A O    
5260 O O    . HOH H .   ? 0.4159 0.7711 0.6966 0.0027  -0.0109 0.1347  829  HOH A O    
5261 O O    . HOH H .   ? 0.9458 0.6795 0.2864 0.2357  -0.1584 -0.0751 830  HOH A O    
5262 O O    . HOH H .   ? 0.7466 0.6977 0.8149 -0.3930 0.0195  0.2014  831  HOH A O    
5263 O O    . HOH H .   ? 0.4123 0.7005 0.4310 -0.0015 0.1250  0.2094  832  HOH A O    
5264 O O    . HOH H .   ? 0.6720 0.8623 0.4948 0.1604  0.0818  0.0137  833  HOH A O    
5265 O O    . HOH H .   ? 0.4229 0.9233 0.6712 0.3146  -0.1819 -0.2694 834  HOH A O    
5266 O O    . HOH H .   ? 0.4178 0.7318 0.6306 0.1026  0.1166  -0.0886 835  HOH A O    
5267 O O    . HOH H .   ? 0.9633 0.9046 0.8535 -0.1262 -0.0504 -0.0107 836  HOH A O    
5268 O O    . HOH H .   ? 0.4690 0.4985 0.6399 -0.2067 -0.0595 0.0688  837  HOH A O    
5269 O O    . HOH H .   ? 0.3783 0.7703 0.4097 -0.0765 -0.0251 -0.0700 838  HOH A O    
5270 O O    . HOH H .   ? 0.7406 0.5266 0.6271 -0.2174 0.1118  0.2326  839  HOH A O    
5271 O O    . HOH H .   ? 0.1297 0.1511 0.1534 -0.0033 -0.0158 0.0286  840  HOH A O    
5272 O O    A HOH H .   ? 0.2727 0.1862 0.2599 0.0690  -0.0435 -0.0423 841  HOH A O    
5273 O O    B HOH H .   ? 0.2256 0.3337 0.2371 0.0514  -0.0854 -0.1371 841  HOH A O    
5274 O O    . HOH H .   ? 0.3409 0.1939 0.3444 -0.0209 -0.0072 0.0306  842  HOH A O    
5275 O O    . HOH H .   ? 0.3180 0.2456 0.3594 0.0210  0.1118  0.0748  843  HOH A O    
5276 O O    . HOH H .   ? 0.2978 0.2993 0.5451 -0.0279 -0.0357 0.2125  844  HOH A O    
5277 O O    A HOH H .   ? 0.3318 0.2024 0.3287 0.0216  -0.0360 0.0809  845  HOH A O    
5278 O O    B HOH H .   ? 0.3782 0.1204 0.2163 0.0589  -0.0986 -0.0388 845  HOH A O    
5279 O O    . HOH H .   ? 0.3263 0.3544 0.4046 -0.0346 -0.0914 0.0999  846  HOH A O    
5280 O O    . HOH H .   ? 0.3981 0.5099 0.4950 -0.2428 -0.0352 -0.0869 847  HOH A O    
5281 O O    . HOH H .   ? 0.4327 0.4780 0.6021 0.0572  0.1326  0.1854  848  HOH A O    
5282 O O    . HOH H .   ? 0.3165 0.6141 0.6072 0.0719  -0.0565 0.1341  849  HOH A O    
5283 O O    . HOH H .   ? 0.6791 0.3142 0.5875 -0.0299 0.0424  0.2089  850  HOH A O    
5284 O O    . HOH H .   ? 0.4977 0.4895 0.6338 -0.0545 -0.2202 -0.0483 851  HOH A O    
5285 O O    . HOH H .   ? 0.5343 0.4152 0.5784 0.1542  0.0002  -0.1881 852  HOH A O    
5286 O O    . HOH H .   ? 0.3984 0.4868 0.5063 0.0918  0.0647  -0.0455 853  HOH A O    
5287 O O    . HOH H .   ? 0.6582 0.5069 0.4872 0.0584  -0.2504 -0.1752 854  HOH A O    
5288 O O    . HOH H .   ? 0.5346 0.4994 0.4585 -0.3246 0.0996  -0.0709 855  HOH A O    
5289 O O    . HOH H .   ? 0.5640 0.6913 0.6485 -0.1289 0.0287  0.1328  856  HOH A O    
5290 O O    . HOH H .   ? 0.9910 0.3777 0.3205 -0.1287 -0.0838 -0.0195 857  HOH A O    
5291 O O    . HOH H .   ? 0.3971 0.7643 0.6806 0.1135  0.0878  -0.0409 858  HOH A O    
5292 O O    . HOH H .   ? 0.7293 0.5095 0.6652 0.1480  -0.2518 0.1343  859  HOH A O    
5293 O O    . HOH H .   ? 0.6803 0.4033 0.5705 -0.0575 -0.2497 -0.0673 860  HOH A O    
5294 O O    . HOH H .   ? 1.3553 1.2161 1.3123 -0.1556 -0.0545 0.1610  861  HOH A O    
5295 O O    . HOH H .   ? 0.8319 0.6850 0.4335 0.1216  0.0656  0.1691  862  HOH A O    
5296 O O    . HOH H .   ? 0.3074 0.6934 0.9281 -0.1118 -0.1098 -0.0689 863  HOH A O    
5297 O O    . HOH H .   ? 0.5332 0.6455 0.6461 0.1519  0.0946  -0.0474 864  HOH A O    
5298 O O    . HOH H .   ? 0.5507 0.7554 0.7468 -0.2588 0.1371  0.1024  865  HOH A O    
5299 O O    . HOH H .   ? 0.7547 0.7558 0.4341 -0.0650 0.2783  0.1372  866  HOH A O    
5300 O O    . HOH H .   ? 0.2982 0.8339 0.4540 -0.0245 -0.1014 -0.2535 867  HOH A O    
5301 O O    . HOH H .   ? 0.8785 0.6244 0.5983 0.0836  -0.0088 -0.0809 868  HOH A O    
5302 O O    . HOH H .   ? 0.8763 0.6983 0.6197 0.1180  -0.0658 -0.1226 869  HOH A O    
5303 O O    . HOH H .   ? 0.6328 0.8704 0.6959 -0.3843 0.1703  0.2312  870  HOH A O    
5304 O O    . HOH H .   ? 0.4400 0.7152 0.6675 -0.1731 0.0800  0.0912  871  HOH A O    
5305 O O    . HOH H .   ? 0.5177 0.8514 0.6031 -0.0239 0.1880  -0.2156 872  HOH A O    
5306 O O    . HOH H .   ? 0.6223 0.6431 0.4069 0.0385  0.0496  0.0943  873  HOH A O    
5307 O O    . HOH H .   ? 0.6883 0.4446 0.6076 0.0146  0.0430  -0.0794 874  HOH A O    
5308 O O    . HOH H .   ? 0.6832 0.3209 0.7637 -0.2636 -0.1530 -0.0367 875  HOH A O    
5309 O O    . HOH H .   ? 0.5915 0.6252 0.4795 -0.0300 0.1712  -0.0541 876  HOH A O    
5310 O O    . HOH H .   ? 0.3859 0.3585 0.6289 0.0022  0.1005  0.0256  877  HOH A O    
5311 O O    . HOH H .   ? 0.6243 0.7181 0.7670 0.3599  0.0913  -0.1228 878  HOH A O    
5312 O O    . HOH H .   ? 0.7278 0.5277 0.4238 0.0206  0.2703  -0.0791 879  HOH A O    
5313 O O    . HOH H .   ? 0.8054 0.7970 0.4356 -0.1446 0.0664  0.2094  880  HOH A O    
5314 O O    . HOH H .   ? 0.8708 0.6600 0.5694 -0.1773 0.0325  -0.1450 881  HOH A O    
5315 O O    . HOH H .   ? 0.4915 0.7094 0.7913 0.0011  -0.0299 0.2715  882  HOH A O    
5316 O O    . HOH H .   ? 0.7336 0.8251 0.9177 -0.0312 0.1514  -0.1362 883  HOH A O    
5317 O O    . HOH H .   ? 0.8797 0.7687 0.5296 -0.1659 -0.1507 0.0578  884  HOH A O    
5318 O O    . HOH H .   ? 0.8992 0.3107 0.7093 0.0922  -0.1429 -0.1282 885  HOH A O    
5319 O O    . HOH H .   ? 0.7982 0.8060 0.5125 -0.2562 0.0489  0.2770  886  HOH A O    
5320 O O    . HOH H .   ? 0.8777 0.3150 0.7231 -0.1497 -0.1775 0.1214  887  HOH A O    
5321 O O    . HOH H .   ? 0.7742 0.4187 0.4890 0.1023  -0.2379 -0.2186 888  HOH A O    
5322 O O    . HOH H .   ? 1.0401 0.7349 0.6544 -0.2619 -0.0006 0.2132  889  HOH A O    
5323 O O    . HOH H .   ? 0.5585 0.5825 0.5762 0.0020  -0.1903 0.1530  890  HOH A O    
5324 O O    . HOH H .   ? 0.6563 0.5330 0.8768 -0.2547 -0.0018 0.0109  891  HOH A O    
5325 O O    . HOH H .   ? 0.2565 0.2791 0.5164 -0.0099 0.0135  0.0556  892  HOH A O    
5326 O O    . HOH H .   ? 0.5497 0.7943 0.5596 -0.1295 -0.0818 -0.2014 893  HOH A O    
5327 O O    . HOH H .   ? 0.6815 0.3026 0.5581 -0.0059 -0.1851 -0.1737 894  HOH A O    
5328 O O    . HOH H .   ? 0.9613 0.3461 0.8130 -0.0618 -0.2039 0.2702  895  HOH A O    
5329 O O    . HOH H .   ? 0.6354 0.5659 0.6114 0.0932  0.0030  0.1176  896  HOH A O    
5330 O O    . HOH H .   ? 0.4957 0.5548 0.5164 -0.1582 0.2105  -0.1934 897  HOH A O    
5331 O O    . HOH H .   ? 0.6886 0.3536 0.6988 0.0164  -0.3026 0.0765  898  HOH A O    
5332 O O    . HOH H .   ? 0.9933 0.8332 0.5306 -0.0884 -0.1063 -0.0053 899  HOH A O    
5333 O O    . HOH H .   ? 0.7290 0.5814 0.3806 0.0535  -0.0935 0.0897  900  HOH A O    
5334 O O    . HOH H .   ? 0.8901 0.3423 0.7081 -0.0784 -0.2864 -0.0446 901  HOH A O    
5335 O O    . HOH H .   ? 0.7560 0.9456 0.8555 0.0783  0.1044  -0.0431 902  HOH A O    
5336 O O    . HOH H .   ? 0.9739 0.9023 0.5575 0.1505  0.2085  -0.1788 903  HOH A O    
5337 O O    . HOH H .   ? 0.4270 0.6830 0.5915 -0.0764 0.0618  0.0064  904  HOH A O    
5338 O O    . HOH H .   ? 0.8889 0.4604 0.4657 -0.1399 -0.2371 -0.0176 905  HOH A O    
5339 O O    . HOH H .   ? 0.5833 0.6302 0.6766 -0.2553 -0.1445 0.1518  906  HOH A O    
5340 O O    . HOH H .   ? 0.6517 0.8088 0.7115 0.0714  0.2227  -0.2604 907  HOH A O    
5341 O O    . HOH H .   ? 0.9646 0.9022 0.9942 0.3073  0.0064  -0.1143 908  HOH A O    
5342 O O    . HOH H .   ? 0.5868 0.6272 0.6385 -0.0525 -0.0167 -0.3473 909  HOH A O    
5343 O O    . HOH H .   ? 0.4084 0.7061 0.5100 0.1233  0.0872  -0.1983 910  HOH A O    
5344 O O    . HOH H .   ? 1.0069 0.4875 0.5713 -0.3123 -0.0364 0.1890  911  HOH A O    
5345 O O    . HOH H .   ? 0.8022 0.4334 0.4363 -0.0893 0.1776  0.0754  912  HOH A O    
5346 O O    . HOH H .   ? 0.8186 0.6500 0.4876 -0.0498 -0.0314 0.0366  913  HOH A O    
5347 O O    . HOH H .   ? 1.0199 0.4554 0.4545 -0.1662 -0.3330 0.0533  914  HOH A O    
5348 O O    . HOH H .   ? 0.5976 0.4855 0.5326 -0.0469 0.0045  0.0425  915  HOH A O    
5349 O O    . HOH H .   ? 0.6938 0.9881 1.0013 -0.0523 0.1073  0.1105  916  HOH A O    
5350 O O    . HOH H .   ? 0.5818 0.4485 0.6624 -0.2028 0.0848  -0.0733 917  HOH A O    
5351 O O    . HOH H .   ? 0.3848 0.6392 1.0474 0.1259  -0.1547 0.1778  918  HOH A O    
5352 O O    . HOH H .   ? 0.4693 0.5540 0.5723 -0.1180 -0.2127 0.0093  919  HOH A O    
5353 O O    . HOH H .   ? 0.7213 0.9475 0.7406 -0.2430 0.1850  0.0514  920  HOH A O    
5354 O O    . HOH H .   ? 0.5845 0.3884 0.4399 0.1514  0.1226  0.0104  921  HOH A O    
5355 O O    . HOH H .   ? 0.4429 0.3443 0.7806 -0.0231 0.0446  0.0816  922  HOH A O    
5356 O O    . HOH H .   ? 0.7101 0.7798 0.8186 -0.1662 0.0962  -0.0017 923  HOH A O    
5357 O O    . HOH H .   ? 0.9122 0.7515 0.2077 0.3063  0.0872  0.1321  924  HOH A O    
5358 O O    . HOH H .   ? 0.5851 0.7935 0.4636 -0.0958 0.0441  -0.1925 925  HOH A O    
5359 O O    . HOH H .   ? 0.4649 0.7016 0.3633 -0.0605 0.0236  -0.1105 926  HOH A O    
5360 O O    . HOH H .   ? 0.8905 0.8478 0.8282 -0.1594 -0.0504 0.0443  927  HOH A O    
5361 O O    . HOH H .   ? 0.7682 0.7613 0.6097 -0.0162 -0.1006 0.1321  928  HOH A O    
5362 O O    . HOH H .   ? 0.6763 0.9541 0.7364 -0.3179 0.2182  0.1519  929  HOH A O    
5363 O O    . HOH H .   ? 0.6646 1.0702 0.7149 0.1339  0.1814  -0.1586 930  HOH A O    
5364 O O    . HOH H .   ? 1.0060 1.0650 1.0462 0.4262  0.1908  -0.2185 931  HOH A O    
5365 O O    . HOH H .   ? 0.6786 0.8549 0.4853 0.2751  0.2469  -0.0326 932  HOH A O    
5366 O O    . HOH H .   ? 0.7489 0.6904 0.4468 -0.0689 0.0144  0.0614  933  HOH A O    
5367 O O    . HOH H .   ? 1.1174 0.9483 1.1440 0.0472  -0.1502 0.0490  934  HOH A O    
5368 O O    . HOH H .   ? 0.8431 0.7029 0.6097 0.1015  -0.0427 -0.0856 935  HOH A O    
5369 O O    . HOH H .   ? 0.6268 1.0187 0.8816 0.2876  0.1250  -0.1344 936  HOH A O    
5370 O O    . HOH H .   ? 0.4913 0.8504 0.7747 -0.3109 -0.0470 0.0982  937  HOH A O    
5371 O O    . HOH H .   ? 1.1053 0.6711 0.9195 -0.4192 -0.0910 0.2039  938  HOH A O    
5372 O O    . HOH H .   ? 0.9800 0.6374 0.8421 0.2087  0.0417  -0.2353 939  HOH A O    
5373 O O    . HOH H .   ? 0.6633 0.7072 0.4240 0.0972  0.0712  -0.0269 940  HOH A O    
5374 O O    . HOH H .   ? 0.2610 0.3269 0.3277 -0.1368 0.0806  -0.0976 941  HOH A O    
5375 O O    . HOH H .   ? 0.5543 0.6425 0.7740 -0.0778 0.0810  0.2231  942  HOH A O    
5376 O O    . HOH H .   ? 0.5805 0.7910 0.5426 0.1175  0.1566  -0.0617 943  HOH A O    
5377 O O    . HOH H .   ? 0.6984 0.6136 0.9378 0.4337  0.1050  -0.1134 944  HOH A O    
5378 O O    . HOH H .   ? 1.3661 0.6242 0.4585 -0.1089 -0.2325 -0.1316 945  HOH A O    
5379 O O    . HOH H .   ? 0.8311 0.9089 0.4569 -0.0367 0.2722  -0.0550 946  HOH A O    
5380 O O    . HOH H .   ? 0.7730 0.6662 0.7030 0.0216  -0.0756 -0.0253 947  HOH A O    
5381 O O    . HOH H .   ? 0.6150 0.6804 0.6003 0.0978  -0.0801 -0.1238 948  HOH A O    
5382 O O    . HOH H .   ? 0.5462 0.7225 0.6812 -0.0558 0.1321  0.1498  949  HOH A O    
5383 O O    . HOH H .   ? 0.6540 1.0500 0.6313 0.0564  0.3317  0.1488  950  HOH A O    
5384 O O    . HOH H .   ? 0.8657 0.5898 0.8441 -0.3882 -0.2521 0.1277  951  HOH A O    
5385 O O    . HOH H .   ? 0.8959 0.5769 0.7473 0.0339  -0.0852 0.2214  952  HOH A O    
5386 O O    . HOH H .   ? 0.6969 0.5597 0.8277 -0.1937 -0.4648 0.0331  953  HOH A O    
5387 O O    . HOH H .   ? 0.8229 0.8781 0.9313 -0.1474 -0.0780 0.1802  954  HOH A O    
5388 O O    . HOH H .   ? 0.6895 0.4351 0.6027 -0.1230 -0.1310 0.1387  955  HOH A O    
5389 O O    . HOH H .   ? 0.9910 0.4553 0.4116 0.3702  -0.2109 -0.0390 956  HOH A O    
5390 O O    . HOH H .   ? 0.7442 0.6479 0.4769 -0.0158 -0.0732 -0.1384 957  HOH A O    
5391 O O    . HOH H .   ? 0.6374 0.7304 0.7129 0.0317  -0.1575 -0.2306 958  HOH A O    
5392 O O    . HOH H .   ? 0.9820 0.4300 0.5654 -0.0058 -0.0946 0.1003  959  HOH A O    
5393 O O    . HOH H .   ? 0.7277 0.8615 0.6721 -0.0899 0.0674  -0.0760 960  HOH A O    
5394 O O    . HOH H .   ? 1.0285 0.9870 1.0662 -0.2287 0.1066  0.2143  961  HOH A O    
5395 O O    . HOH H .   ? 0.4912 0.7209 0.8383 0.2248  -0.2500 -0.1059 962  HOH A O    
5396 O O    A HOH H .   ? 0.9326 0.7347 0.7554 0.0280  -0.0753 -0.0062 963  HOH A O    
5397 O O    B HOH H .   ? 0.3792 0.3881 0.3102 -0.0502 -0.0557 0.2121  963  HOH A O    
5398 O O    . HOH H .   ? 0.6000 0.7122 0.5486 0.3462  0.0457  -0.0536 964  HOH A O    
5399 O O    . HOH H .   ? 0.6172 0.8967 0.6673 -0.2907 0.1835  0.1850  965  HOH A O    
5400 O O    . HOH H .   ? 0.8359 0.8400 0.6503 0.0000  0.0429  0.0000  966  HOH A O    
5401 O O    . HOH H .   ? 0.6334 0.6032 0.6541 -0.0131 0.1265  -0.1925 967  HOH A O    
5402 O O    . HOH H .   ? 0.8108 0.6741 0.5741 0.2424  -0.0038 0.0185  968  HOH A O    
5403 O O    . HOH H .   ? 0.4558 0.5918 0.9418 -0.1859 0.0605  -0.2007 969  HOH A O    
5404 O O    . HOH H .   ? 0.7952 0.6609 0.7695 -0.0243 0.0726  0.1409  970  HOH A O    
5405 O O    . HOH H .   ? 0.9689 0.7933 0.8622 0.0428  -0.0228 -0.0351 971  HOH A O    
5406 O O    . HOH H .   ? 1.0151 0.6786 0.6712 -0.0515 -0.1177 -0.0864 972  HOH A O    
5407 O O    . HOH H .   ? 0.6242 0.8549 0.3262 0.1666  -0.1180 0.0455  973  HOH A O    
5408 O O    . HOH H .   ? 0.5670 0.5846 0.8451 0.3244  -0.0281 -0.0910 974  HOH A O    
5409 O O    . HOH H .   ? 0.8847 0.3881 0.5367 0.0553  -0.1455 0.0820  975  HOH A O    
5410 O O    . HOH H .   ? 0.6883 0.5261 0.5987 -0.1471 -0.0411 0.1495  976  HOH A O    
5411 O O    . HOH H .   ? 0.6693 0.6061 0.6555 -0.0314 -0.2344 -0.1716 977  HOH A O    
5412 O O    . HOH H .   ? 0.5336 0.9065 0.8247 -0.2655 0.1110  0.1123  978  HOH A O    
5413 O O    . HOH H .   ? 0.9879 0.5177 0.3559 -0.4484 -0.0988 0.0496  979  HOH A O    
5414 O O    . HOH H .   ? 0.5655 0.7697 0.7289 0.0172  0.0982  0.0401  980  HOH A O    
5415 O O    . HOH H .   ? 0.9071 0.7210 0.8712 -0.0321 -0.1748 0.1049  981  HOH A O    
5416 O O    . HOH H .   ? 0.7633 1.0422 0.9343 -0.0725 0.1540  0.0448  982  HOH A O    
5417 O O    . HOH H .   ? 0.5109 0.7671 0.7361 0.0549  0.1741  -0.0584 983  HOH A O    
5418 O O    . HOH H .   ? 1.0074 0.4719 0.7893 -0.1017 -0.0886 0.1076  984  HOH A O    
5419 O O    . HOH H .   ? 0.5914 0.8757 0.5882 0.1466  0.1068  -0.1407 985  HOH A O    
5420 O O    . HOH H .   ? 0.7776 0.6567 0.7969 0.2070  -0.1914 -0.0894 986  HOH A O    
5421 O O    . HOH H .   ? 0.6875 0.6378 0.7988 -0.1945 0.0466  0.1233  987  HOH A O    
5422 O O    A HOH H .   ? 0.1401 0.1548 0.2998 -0.0245 0.0653  -0.0319 988  HOH A O    
5423 O O    . HOH H .   ? 0.3312 0.7667 0.6416 -0.0635 0.0564  -0.2477 989  HOH A O    
5424 O O    . HOH H .   ? 0.3595 0.5457 0.4106 0.1608  0.0450  -0.1532 990  HOH A O    
5425 O O    . HOH H .   ? 0.2941 0.2983 0.3987 0.1424  0.1674  0.1324  991  HOH A O    
5426 O O    . HOH H .   ? 0.3712 0.3446 0.9366 0.0136  -0.0109 0.0465  992  HOH A O    
5427 O O    . HOH H .   ? 0.4511 0.4596 0.5995 0.1507  -0.1453 -0.1706 993  HOH A O    
5428 O O    . HOH H .   ? 0.7598 1.1117 1.0214 0.1052  0.2353  -0.0942 994  HOH A O    
5429 O O    . HOH H .   ? 0.7655 0.6059 0.5687 0.0608  -0.1248 0.1014  995  HOH A O    
5430 O O    . HOH H .   ? 0.6885 0.8618 1.1078 0.0895  -0.0531 -0.0489 996  HOH A O    
5431 O O    . HOH H .   ? 1.0091 0.9654 1.0408 -0.0430 -0.1930 0.1082  997  HOH A O    
5432 O O    . HOH H .   ? 0.5714 0.7250 0.4124 0.0940  0.1164  0.1342  998  HOH A O    
5433 O O    . HOH H .   ? 0.8624 0.6327 0.7315 0.0088  0.0492  0.0194  999  HOH A O    
5434 O O    . HOH H .   ? 0.8841 0.7640 0.7294 -0.0038 -0.1397 -0.0902 1000 HOH A O    
5435 O O    . HOH H .   ? 0.6958 0.4979 0.7555 -0.0289 0.0450  0.0052  1001 HOH A O    
5436 O O    . HOH H .   ? 0.9190 0.7637 0.6882 -0.0351 0.1204  0.1181  1002 HOH A O    
5437 O O    . HOH H .   ? 0.9707 0.8852 0.8108 0.2702  0.0011  -0.1376 1003 HOH A O    
5438 O O    . HOH H .   ? 0.8952 0.7880 0.8488 -0.0697 -0.1485 0.1346  1004 HOH A O    
5439 O O    . HOH H .   ? 0.8179 0.9313 0.8180 -0.1187 0.0784  -0.0602 1005 HOH A O    
5440 O O    . HOH H .   ? 0.7085 0.9191 1.0407 0.0211  -0.0153 0.0448  1006 HOH A O    
5441 O O    . HOH H .   ? 0.9571 0.7003 0.9519 0.1621  -0.0983 -0.1453 1007 HOH A O    
5442 O O    . HOH H .   ? 1.0123 0.9673 0.9504 -0.2714 -0.1303 0.1169  1008 HOH A O    
5443 O O    . HOH H .   ? 0.6851 0.9305 0.8016 -0.1573 0.1575  -0.0955 1009 HOH A O    
5444 O O    . HOH H .   ? 0.7913 0.7641 0.8837 -0.2798 -0.1989 0.0787  1010 HOH A O    
5445 O O    . HOH H .   ? 0.8976 0.8136 0.8255 -0.2156 0.2217  0.2229  1011 HOH A O    
5446 O O    . HOH H .   ? 1.0500 0.5915 0.6554 -0.3965 -0.3145 0.0758  1012 HOH A O    
5447 O O    . HOH H .   ? 1.2651 0.9496 1.1974 0.1464  -0.2280 0.1675  1013 HOH A O    
5448 O O    . HOH H .   ? 1.0500 0.8492 0.6130 0.1425  0.2134  -0.1488 1014 HOH A O    
5449 O O    . HOH H .   ? 0.9675 0.8927 0.8121 -0.0340 0.0502  0.0545  1015 HOH A O    
5450 O O    . HOH H .   ? 0.8555 0.6963 0.8194 0.1717  -0.0452 -0.2720 1016 HOH A O    
5451 O O    . HOH H .   ? 0.7320 0.7201 0.7752 0.1763  0.1625  -0.1998 1017 HOH A O    
5452 O O    . HOH H .   ? 0.6237 0.8328 0.8725 0.0564  0.0345  0.0402  1018 HOH A O    
5453 O O    . HOH H .   ? 0.4593 0.2788 0.5034 -0.0526 0.0510  0.2242  1019 HOH A O    
5454 O O    . HOH H .   ? 0.8408 0.7079 0.9962 -0.2229 -0.2436 0.0970  1020 HOH A O    
5455 O O    . HOH H .   ? 1.0179 0.7747 0.9989 -0.3100 -0.0286 0.2215  1021 HOH A O    
5456 O O    . HOH H .   ? 1.0643 0.8540 0.8153 -0.0293 -0.0549 0.0542  1022 HOH A O    
5457 O O    . HOH H .   ? 1.1395 0.6221 0.8109 0.1325  0.0204  -0.1928 1023 HOH A O    
5458 O O    . HOH H .   ? 1.2842 1.4108 1.3189 0.0140  0.0064  -0.0816 1024 HOH A O    
5459 O O    . HOH H .   ? 1.2434 1.1041 1.1775 -0.0156 -0.1213 0.1122  1025 HOH A O    
5460 O O    . HOH H .   ? 1.1663 0.8191 0.8420 -0.0920 -0.0507 0.2832  1026 HOH A O    
5461 O O    . HOH H .   ? 0.5399 0.7119 0.7782 0.0794  0.1207  -0.0981 1027 HOH A O    
5462 O O    . HOH H .   ? 0.8284 0.8647 0.7842 0.1905  0.1079  -0.0669 1028 HOH A O    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  TRP 40  40  40  TRP TRP A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 GLN 150 150 150 GLN GLN A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLN 160 160 160 GLN GLN A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 PHE 167 167 167 PHE PHE A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 TRP 191 191 191 TRP TRP A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 SER 204 204 204 SER SER A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 ASP 213 213 213 ASP ASP A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 TYR 230 230 230 TYR TYR A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 GLN 232 232 232 GLN GLN A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 GLN 238 238 238 GLN GLN A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 TYR 245 245 245 TYR TYR A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 PHE 247 247 247 PHE PHE A . n 
A 1 248 ASP 248 248 248 ASP ASP A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 ASP 255 255 255 ASP ASP A . n 
A 1 256 PHE 256 256 256 PHE PHE A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 SER 259 259 259 SER SER A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 PRO 268 268 268 PRO PRO A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 GLY 275 275 275 GLY GLY A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 CYS 283 283 283 CYS CYS A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 GLY 292 292 292 GLY GLY A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 ASP 300 300 300 ASP ASP A . n 
A 1 301 ILE 301 301 301 ILE ILE A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 TYR 307 307 307 TYR TYR A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 VAL 309 309 309 VAL VAL A . n 
A 1 310 PHE 310 310 310 PHE PHE A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 SER 312 312 312 SER SER A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 PRO 315 315 315 PRO PRO A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 GLY 318 318 318 GLY GLY A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 ALA 320 320 320 ALA ALA A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ALA 323 323 323 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MAN 1   328  328  MAN MAN A . 
C 2 MAN 1   329  329  MAN MAN A . 
D 3 SO4 1   327  327  SO4 SO4 A . 
E 4 PP7 1   324  324  PP7 PP7 A . 
F 5 GOL 1   325  325  GOL GLL A . 
G 5 GOL 1   326  326  GOL GLL A . 
H 6 HOH 1   501  501  HOH HOH A . 
H 6 HOH 2   502  502  HOH HOH A . 
H 6 HOH 3   503  503  HOH HOH A . 
H 6 HOH 4   504  504  HOH HOH A . 
H 6 HOH 5   505  505  HOH HOH A . 
H 6 HOH 6   506  506  HOH HOH A . 
H 6 HOH 7   507  507  HOH HOH A . 
H 6 HOH 8   508  508  HOH HOH A . 
H 6 HOH 9   509  509  HOH HOH A . 
H 6 HOH 10  510  510  HOH HOH A . 
H 6 HOH 11  511  511  HOH HOH A . 
H 6 HOH 12  512  512  HOH HOH A . 
H 6 HOH 13  513  513  HOH HOH A . 
H 6 HOH 14  514  514  HOH HOH A . 
H 6 HOH 15  515  515  HOH HOH A . 
H 6 HOH 16  516  516  HOH HOH A . 
H 6 HOH 17  517  517  HOH HOH A . 
H 6 HOH 18  518  518  HOH HOH A . 
H 6 HOH 19  519  519  HOH HOH A . 
H 6 HOH 20  520  520  HOH HOH A . 
H 6 HOH 21  521  521  HOH HOH A . 
H 6 HOH 22  522  522  HOH HOH A . 
H 6 HOH 23  523  523  HOH HOH A . 
H 6 HOH 24  524  524  HOH HOH A . 
H 6 HOH 25  525  525  HOH HOH A . 
H 6 HOH 26  526  526  HOH HOH A . 
H 6 HOH 27  527  527  HOH HOH A . 
H 6 HOH 28  528  528  HOH HOH A . 
H 6 HOH 29  529  529  HOH HOH A . 
H 6 HOH 30  530  530  HOH HOH A . 
H 6 HOH 31  531  531  HOH HOH A . 
H 6 HOH 32  532  532  HOH HOH A . 
H 6 HOH 33  533  533  HOH HOH A . 
H 6 HOH 34  534  534  HOH HOH A . 
H 6 HOH 35  535  535  HOH HOH A . 
H 6 HOH 36  536  536  HOH HOH A . 
H 6 HOH 37  537  537  HOH HOH A . 
H 6 HOH 38  538  538  HOH HOH A . 
H 6 HOH 39  539  539  HOH HOH A . 
H 6 HOH 40  540  540  HOH HOH A . 
H 6 HOH 41  541  541  HOH HOH A . 
H 6 HOH 42  542  542  HOH HOH A . 
H 6 HOH 43  543  543  HOH HOH A . 
H 6 HOH 44  544  544  HOH HOH A . 
H 6 HOH 45  545  545  HOH HOH A . 
H 6 HOH 46  546  546  HOH HOH A . 
H 6 HOH 47  547  547  HOH HOH A . 
H 6 HOH 48  548  548  HOH HOH A . 
H 6 HOH 49  549  549  HOH HOH A . 
H 6 HOH 50  550  550  HOH HOH A . 
H 6 HOH 51  551  551  HOH HOH A . 
H 6 HOH 52  552  552  HOH HOH A . 
H 6 HOH 53  553  553  HOH HOH A . 
H 6 HOH 54  554  554  HOH HOH A . 
H 6 HOH 55  555  555  HOH HOH A . 
H 6 HOH 56  556  556  HOH HOH A . 
H 6 HOH 57  557  557  HOH HOH A . 
H 6 HOH 58  558  558  HOH HOH A . 
H 6 HOH 59  559  559  HOH HOH A . 
H 6 HOH 60  560  560  HOH HOH A . 
H 6 HOH 61  561  561  HOH HOH A . 
H 6 HOH 62  562  562  HOH HOH A . 
H 6 HOH 63  563  563  HOH HOH A . 
H 6 HOH 64  564  564  HOH HOH A . 
H 6 HOH 65  565  565  HOH HOH A . 
H 6 HOH 66  566  566  HOH HOH A . 
H 6 HOH 67  567  567  HOH HOH A . 
H 6 HOH 68  568  568  HOH HOH A . 
H 6 HOH 69  569  569  HOH HOH A . 
H 6 HOH 70  570  570  HOH HOH A . 
H 6 HOH 71  571  571  HOH HOH A . 
H 6 HOH 72  572  572  HOH HOH A . 
H 6 HOH 73  573  573  HOH HOH A . 
H 6 HOH 74  574  574  HOH HOH A . 
H 6 HOH 75  575  575  HOH HOH A . 
H 6 HOH 76  576  576  HOH HOH A . 
H 6 HOH 77  577  577  HOH HOH A . 
H 6 HOH 78  578  578  HOH HOH A . 
H 6 HOH 79  579  579  HOH HOH A . 
H 6 HOH 80  580  580  HOH HOH A . 
H 6 HOH 81  581  581  HOH HOH A . 
H 6 HOH 82  582  582  HOH HOH A . 
H 6 HOH 83  583  583  HOH HOH A . 
H 6 HOH 84  584  584  HOH HOH A . 
H 6 HOH 85  585  585  HOH HOH A . 
H 6 HOH 86  586  586  HOH HOH A . 
H 6 HOH 87  587  587  HOH HOH A . 
H 6 HOH 88  588  588  HOH HOH A . 
H 6 HOH 89  589  589  HOH HOH A . 
H 6 HOH 90  590  590  HOH HOH A . 
H 6 HOH 91  591  591  HOH HOH A . 
H 6 HOH 92  592  592  HOH HOH A . 
H 6 HOH 93  593  593  HOH HOH A . 
H 6 HOH 94  594  594  HOH HOH A . 
H 6 HOH 95  595  595  HOH HOH A . 
H 6 HOH 96  596  596  HOH HOH A . 
H 6 HOH 97  597  597  HOH HOH A . 
H 6 HOH 98  598  598  HOH HOH A . 
H 6 HOH 99  599  599  HOH HOH A . 
H 6 HOH 100 600  600  HOH HOH A . 
H 6 HOH 101 601  601  HOH HOH A . 
H 6 HOH 102 602  602  HOH HOH A . 
H 6 HOH 103 603  603  HOH HOH A . 
H 6 HOH 104 604  604  HOH HOH A . 
H 6 HOH 105 605  605  HOH HOH A . 
H 6 HOH 106 606  606  HOH HOH A . 
H 6 HOH 107 607  607  HOH HOH A . 
H 6 HOH 108 608  608  HOH HOH A . 
H 6 HOH 109 609  609  HOH HOH A . 
H 6 HOH 110 610  610  HOH HOH A . 
H 6 HOH 111 611  611  HOH HOH A . 
H 6 HOH 112 612  612  HOH HOH A . 
H 6 HOH 113 613  613  HOH HOH A . 
H 6 HOH 114 614  614  HOH HOH A . 
H 6 HOH 115 615  615  HOH HOH A . 
H 6 HOH 116 616  616  HOH HOH A . 
H 6 HOH 117 617  617  HOH HOH A . 
H 6 HOH 118 618  618  HOH HOH A . 
H 6 HOH 119 619  619  HOH HOH A . 
H 6 HOH 120 620  620  HOH HOH A . 
H 6 HOH 121 621  621  HOH HOH A . 
H 6 HOH 122 622  622  HOH HOH A . 
H 6 HOH 123 623  623  HOH HOH A . 
H 6 HOH 124 624  624  HOH HOH A . 
H 6 HOH 125 625  625  HOH HOH A . 
H 6 HOH 126 626  626  HOH HOH A . 
H 6 HOH 127 627  627  HOH HOH A . 
H 6 HOH 128 628  628  HOH HOH A . 
H 6 HOH 129 629  629  HOH HOH A . 
H 6 HOH 130 630  630  HOH HOH A . 
H 6 HOH 131 631  631  HOH HOH A . 
H 6 HOH 132 632  632  HOH HOH A . 
H 6 HOH 133 633  633  HOH HOH A . 
H 6 HOH 134 634  634  HOH HOH A . 
H 6 HOH 135 635  635  HOH HOH A . 
H 6 HOH 136 636  636  HOH HOH A . 
H 6 HOH 137 637  637  HOH HOH A . 
H 6 HOH 138 638  638  HOH HOH A . 
H 6 HOH 139 639  639  HOH HOH A . 
H 6 HOH 140 640  640  HOH HOH A . 
H 6 HOH 141 641  641  HOH HOH A . 
H 6 HOH 142 642  642  HOH HOH A . 
H 6 HOH 143 643  643  HOH HOH A . 
H 6 HOH 144 644  644  HOH HOH A . 
H 6 HOH 145 645  645  HOH HOH A . 
H 6 HOH 146 646  646  HOH HOH A . 
H 6 HOH 147 647  647  HOH HOH A . 
H 6 HOH 148 648  648  HOH HOH A . 
H 6 HOH 149 649  649  HOH HOH A . 
H 6 HOH 150 650  650  HOH HOH A . 
H 6 HOH 151 651  651  HOH HOH A . 
H 6 HOH 152 652  652  HOH HOH A . 
H 6 HOH 153 653  653  HOH HOH A . 
H 6 HOH 154 654  654  HOH HOH A . 
H 6 HOH 155 655  655  HOH HOH A . 
H 6 HOH 156 656  656  HOH HOH A . 
H 6 HOH 157 657  657  HOH HOH A . 
H 6 HOH 158 658  658  HOH HOH A . 
H 6 HOH 159 659  659  HOH HOH A . 
H 6 HOH 160 660  660  HOH HOH A . 
H 6 HOH 161 661  661  HOH HOH A . 
H 6 HOH 162 662  662  HOH HOH A . 
H 6 HOH 163 663  663  HOH HOH A . 
H 6 HOH 164 664  664  HOH HOH A . 
H 6 HOH 165 665  665  HOH HOH A . 
H 6 HOH 166 666  666  HOH HOH A . 
H 6 HOH 167 667  667  HOH HOH A . 
H 6 HOH 168 668  668  HOH HOH A . 
H 6 HOH 169 669  669  HOH HOH A . 
H 6 HOH 170 670  670  HOH HOH A . 
H 6 HOH 171 671  671  HOH HOH A . 
H 6 HOH 172 672  672  HOH HOH A . 
H 6 HOH 173 673  673  HOH HOH A . 
H 6 HOH 174 674  674  HOH HOH A . 
H 6 HOH 175 675  675  HOH HOH A . 
H 6 HOH 176 676  676  HOH HOH A . 
H 6 HOH 177 677  677  HOH HOH A . 
H 6 HOH 178 678  678  HOH HOH A . 
H 6 HOH 179 679  679  HOH HOH A . 
H 6 HOH 180 680  680  HOH HOH A . 
H 6 HOH 181 681  681  HOH HOH A . 
H 6 HOH 182 682  682  HOH HOH A . 
H 6 HOH 183 683  683  HOH HOH A . 
H 6 HOH 184 684  684  HOH HOH A . 
H 6 HOH 185 685  685  HOH HOH A . 
H 6 HOH 186 686  686  HOH HOH A . 
H 6 HOH 187 687  687  HOH HOH A . 
H 6 HOH 188 688  688  HOH HOH A . 
H 6 HOH 189 689  689  HOH HOH A . 
H 6 HOH 190 690  690  HOH HOH A . 
H 6 HOH 191 691  691  HOH HOH A . 
H 6 HOH 192 692  692  HOH HOH A . 
H 6 HOH 193 693  693  HOH HOH A . 
H 6 HOH 194 694  694  HOH HOH A . 
H 6 HOH 195 695  695  HOH HOH A . 
H 6 HOH 196 696  696  HOH HOH A . 
H 6 HOH 197 697  697  HOH HOH A . 
H 6 HOH 198 698  698  HOH HOH A . 
H 6 HOH 199 699  699  HOH HOH A . 
H 6 HOH 200 700  700  HOH HOH A . 
H 6 HOH 201 701  701  HOH HOH A . 
H 6 HOH 202 702  702  HOH HOH A . 
H 6 HOH 203 703  703  HOH HOH A . 
H 6 HOH 204 704  704  HOH HOH A . 
H 6 HOH 205 705  705  HOH HOH A . 
H 6 HOH 206 706  706  HOH HOH A . 
H 6 HOH 207 707  707  HOH HOH A . 
H 6 HOH 208 708  708  HOH HOH A . 
H 6 HOH 209 709  709  HOH HOH A . 
H 6 HOH 210 710  710  HOH HOH A . 
H 6 HOH 211 711  711  HOH HOH A . 
H 6 HOH 212 712  712  HOH HOH A . 
H 6 HOH 213 713  713  HOH HOH A . 
H 6 HOH 214 714  714  HOH HOH A . 
H 6 HOH 215 715  715  HOH HOH A . 
H 6 HOH 216 716  716  HOH HOH A . 
H 6 HOH 217 717  717  HOH HOH A . 
H 6 HOH 218 718  718  HOH HOH A . 
H 6 HOH 219 719  719  HOH HOH A . 
H 6 HOH 220 720  720  HOH HOH A . 
H 6 HOH 221 721  721  HOH HOH A . 
H 6 HOH 222 722  722  HOH HOH A . 
H 6 HOH 223 723  723  HOH HOH A . 
H 6 HOH 224 724  724  HOH HOH A . 
H 6 HOH 225 725  725  HOH HOH A . 
H 6 HOH 226 726  726  HOH HOH A . 
H 6 HOH 227 727  727  HOH HOH A . 
H 6 HOH 228 728  728  HOH HOH A . 
H 6 HOH 229 729  729  HOH HOH A . 
H 6 HOH 230 730  730  HOH HOH A . 
H 6 HOH 231 731  731  HOH HOH A . 
H 6 HOH 232 732  732  HOH HOH A . 
H 6 HOH 233 733  733  HOH HOH A . 
H 6 HOH 234 734  734  HOH HOH A . 
H 6 HOH 235 735  735  HOH HOH A . 
H 6 HOH 236 736  736  HOH HOH A . 
H 6 HOH 237 737  737  HOH HOH A . 
H 6 HOH 238 738  738  HOH HOH A . 
H 6 HOH 239 739  739  HOH HOH A . 
H 6 HOH 240 740  740  HOH HOH A . 
H 6 HOH 241 741  741  HOH HOH A . 
H 6 HOH 242 742  742  HOH HOH A . 
H 6 HOH 243 743  743  HOH HOH A . 
H 6 HOH 244 744  744  HOH HOH A . 
H 6 HOH 245 745  745  HOH HOH A . 
H 6 HOH 246 746  746  HOH HOH A . 
H 6 HOH 247 747  747  HOH HOH A . 
H 6 HOH 248 748  748  HOH HOH A . 
H 6 HOH 249 749  749  HOH HOH A . 
H 6 HOH 250 750  750  HOH HOH A . 
H 6 HOH 251 751  751  HOH HOH A . 
H 6 HOH 252 752  752  HOH HOH A . 
H 6 HOH 253 753  753  HOH HOH A . 
H 6 HOH 254 754  754  HOH HOH A . 
H 6 HOH 255 755  755  HOH HOH A . 
H 6 HOH 256 756  756  HOH HOH A . 
H 6 HOH 257 757  757  HOH HOH A . 
H 6 HOH 258 758  758  HOH HOH A . 
H 6 HOH 259 759  759  HOH HOH A . 
H 6 HOH 260 760  760  HOH HOH A . 
H 6 HOH 261 761  761  HOH HOH A . 
H 6 HOH 262 762  762  HOH HOH A . 
H 6 HOH 263 763  763  HOH HOH A . 
H 6 HOH 264 764  764  HOH HOH A . 
H 6 HOH 265 765  765  HOH HOH A . 
H 6 HOH 266 766  766  HOH HOH A . 
H 6 HOH 267 767  767  HOH HOH A . 
H 6 HOH 268 768  768  HOH HOH A . 
H 6 HOH 269 769  769  HOH HOH A . 
H 6 HOH 270 770  770  HOH HOH A . 
H 6 HOH 271 771  771  HOH HOH A . 
H 6 HOH 272 772  772  HOH HOH A . 
H 6 HOH 273 773  773  HOH HOH A . 
H 6 HOH 274 774  774  HOH HOH A . 
H 6 HOH 275 775  775  HOH HOH A . 
H 6 HOH 276 776  776  HOH HOH A . 
H 6 HOH 277 777  777  HOH HOH A . 
H 6 HOH 278 778  778  HOH HOH A . 
H 6 HOH 279 779  779  HOH HOH A . 
H 6 HOH 280 780  780  HOH HOH A . 
H 6 HOH 281 781  781  HOH HOH A . 
H 6 HOH 282 782  782  HOH HOH A . 
H 6 HOH 283 783  783  HOH HOH A . 
H 6 HOH 284 784  784  HOH HOH A . 
H 6 HOH 285 785  785  HOH HOH A . 
H 6 HOH 286 786  786  HOH HOH A . 
H 6 HOH 287 787  787  HOH HOH A . 
H 6 HOH 288 788  788  HOH HOH A . 
H 6 HOH 289 789  789  HOH HOH A . 
H 6 HOH 290 790  790  HOH HOH A . 
H 6 HOH 291 791  791  HOH HOH A . 
H 6 HOH 292 792  792  HOH HOH A . 
H 6 HOH 293 793  793  HOH HOH A . 
H 6 HOH 294 794  794  HOH HOH A . 
H 6 HOH 295 795  795  HOH HOH A . 
H 6 HOH 296 796  796  HOH HOH A . 
H 6 HOH 297 797  797  HOH HOH A . 
H 6 HOH 298 798  798  HOH HOH A . 
H 6 HOH 299 799  799  HOH HOH A . 
H 6 HOH 300 800  800  HOH HOH A . 
H 6 HOH 301 801  801  HOH HOH A . 
H 6 HOH 302 802  802  HOH HOH A . 
H 6 HOH 303 803  803  HOH HOH A . 
H 6 HOH 304 804  804  HOH HOH A . 
H 6 HOH 305 805  805  HOH HOH A . 
H 6 HOH 306 806  806  HOH HOH A . 
H 6 HOH 307 807  807  HOH HOH A . 
H 6 HOH 308 808  808  HOH HOH A . 
H 6 HOH 309 809  809  HOH HOH A . 
H 6 HOH 310 810  810  HOH HOH A . 
H 6 HOH 311 811  811  HOH HOH A . 
H 6 HOH 312 812  812  HOH HOH A . 
H 6 HOH 313 813  813  HOH HOH A . 
H 6 HOH 314 814  814  HOH HOH A . 
H 6 HOH 315 815  815  HOH HOH A . 
H 6 HOH 316 816  816  HOH HOH A . 
H 6 HOH 317 817  817  HOH HOH A . 
H 6 HOH 318 818  818  HOH HOH A . 
H 6 HOH 319 819  819  HOH HOH A . 
H 6 HOH 320 820  820  HOH HOH A . 
H 6 HOH 321 821  821  HOH HOH A . 
H 6 HOH 322 822  822  HOH HOH A . 
H 6 HOH 323 823  823  HOH HOH A . 
H 6 HOH 324 824  824  HOH HOH A . 
H 6 HOH 325 825  825  HOH HOH A . 
H 6 HOH 326 826  826  HOH HOH A . 
H 6 HOH 327 827  827  HOH HOH A . 
H 6 HOH 328 828  828  HOH HOH A . 
H 6 HOH 329 829  829  HOH HOH A . 
H 6 HOH 330 830  830  HOH HOH A . 
H 6 HOH 331 831  831  HOH HOH A . 
H 6 HOH 332 832  832  HOH HOH A . 
H 6 HOH 333 833  833  HOH HOH A . 
H 6 HOH 334 834  834  HOH HOH A . 
H 6 HOH 335 835  835  HOH HOH A . 
H 6 HOH 336 836  836  HOH HOH A . 
H 6 HOH 337 837  837  HOH HOH A . 
H 6 HOH 338 838  838  HOH HOH A . 
H 6 HOH 339 839  839  HOH HOH A . 
H 6 HOH 340 840  840  HOH HOH A . 
H 6 HOH 341 841  841  HOH HOH A . 
H 6 HOH 342 842  842  HOH HOH A . 
H 6 HOH 343 843  843  HOH HOH A . 
H 6 HOH 344 844  844  HOH HOH A . 
H 6 HOH 345 845  845  HOH HOH A . 
H 6 HOH 346 846  846  HOH HOH A . 
H 6 HOH 347 847  847  HOH HOH A . 
H 6 HOH 348 848  848  HOH HOH A . 
H 6 HOH 349 849  849  HOH HOH A . 
H 6 HOH 350 850  850  HOH HOH A . 
H 6 HOH 351 851  851  HOH HOH A . 
H 6 HOH 352 852  852  HOH HOH A . 
H 6 HOH 353 853  853  HOH HOH A . 
H 6 HOH 354 854  854  HOH HOH A . 
H 6 HOH 355 855  855  HOH HOH A . 
H 6 HOH 356 856  856  HOH HOH A . 
H 6 HOH 357 857  857  HOH HOH A . 
H 6 HOH 358 858  858  HOH HOH A . 
H 6 HOH 359 859  859  HOH HOH A . 
H 6 HOH 360 860  860  HOH HOH A . 
H 6 HOH 361 861  861  HOH HOH A . 
H 6 HOH 362 862  862  HOH HOH A . 
H 6 HOH 363 863  863  HOH HOH A . 
H 6 HOH 364 864  864  HOH HOH A . 
H 6 HOH 365 865  865  HOH HOH A . 
H 6 HOH 366 866  866  HOH HOH A . 
H 6 HOH 367 867  867  HOH HOH A . 
H 6 HOH 368 868  868  HOH HOH A . 
H 6 HOH 369 869  869  HOH HOH A . 
H 6 HOH 370 870  870  HOH HOH A . 
H 6 HOH 371 871  871  HOH HOH A . 
H 6 HOH 372 872  872  HOH HOH A . 
H 6 HOH 373 873  873  HOH HOH A . 
H 6 HOH 374 874  874  HOH HOH A . 
H 6 HOH 375 875  875  HOH HOH A . 
H 6 HOH 376 876  876  HOH HOH A . 
H 6 HOH 377 877  877  HOH HOH A . 
H 6 HOH 378 878  878  HOH HOH A . 
H 6 HOH 379 879  879  HOH HOH A . 
H 6 HOH 380 880  880  HOH HOH A . 
H 6 HOH 381 881  881  HOH HOH A . 
H 6 HOH 382 882  882  HOH HOH A . 
H 6 HOH 383 883  883  HOH HOH A . 
H 6 HOH 384 884  884  HOH HOH A . 
H 6 HOH 385 885  885  HOH HOH A . 
H 6 HOH 386 886  886  HOH HOH A . 
H 6 HOH 387 887  887  HOH HOH A . 
H 6 HOH 388 888  888  HOH HOH A . 
H 6 HOH 389 889  889  HOH HOH A . 
H 6 HOH 390 890  890  HOH HOH A . 
H 6 HOH 391 891  891  HOH HOH A . 
H 6 HOH 392 892  892  HOH HOH A . 
H 6 HOH 393 893  893  HOH HOH A . 
H 6 HOH 394 894  894  HOH HOH A . 
H 6 HOH 395 895  895  HOH HOH A . 
H 6 HOH 396 896  896  HOH HOH A . 
H 6 HOH 397 897  897  HOH HOH A . 
H 6 HOH 398 898  898  HOH HOH A . 
H 6 HOH 399 899  899  HOH HOH A . 
H 6 HOH 400 900  900  HOH HOH A . 
H 6 HOH 401 901  901  HOH HOH A . 
H 6 HOH 402 902  902  HOH HOH A . 
H 6 HOH 403 903  903  HOH HOH A . 
H 6 HOH 404 904  904  HOH HOH A . 
H 6 HOH 405 905  905  HOH HOH A . 
H 6 HOH 406 906  906  HOH HOH A . 
H 6 HOH 407 907  907  HOH HOH A . 
H 6 HOH 408 908  908  HOH HOH A . 
H 6 HOH 409 909  909  HOH HOH A . 
H 6 HOH 410 910  910  HOH HOH A . 
H 6 HOH 411 911  911  HOH HOH A . 
H 6 HOH 412 912  912  HOH HOH A . 
H 6 HOH 413 913  913  HOH HOH A . 
H 6 HOH 414 914  914  HOH HOH A . 
H 6 HOH 415 915  915  HOH HOH A . 
H 6 HOH 416 916  916  HOH HOH A . 
H 6 HOH 417 917  917  HOH HOH A . 
H 6 HOH 418 918  918  HOH HOH A . 
H 6 HOH 419 919  919  HOH HOH A . 
H 6 HOH 420 920  920  HOH HOH A . 
H 6 HOH 421 921  921  HOH HOH A . 
H 6 HOH 422 922  922  HOH HOH A . 
H 6 HOH 423 923  923  HOH HOH A . 
H 6 HOH 424 924  924  HOH HOH A . 
H 6 HOH 425 925  925  HOH HOH A . 
H 6 HOH 426 926  926  HOH HOH A . 
H 6 HOH 427 927  927  HOH HOH A . 
H 6 HOH 428 928  928  HOH HOH A . 
H 6 HOH 429 929  929  HOH HOH A . 
H 6 HOH 430 930  930  HOH HOH A . 
H 6 HOH 431 931  931  HOH HOH A . 
H 6 HOH 432 932  932  HOH HOH A . 
H 6 HOH 433 933  933  HOH HOH A . 
H 6 HOH 434 934  934  HOH HOH A . 
H 6 HOH 435 935  935  HOH HOH A . 
H 6 HOH 436 936  936  HOH HOH A . 
H 6 HOH 437 937  937  HOH HOH A . 
H 6 HOH 438 938  938  HOH HOH A . 
H 6 HOH 439 939  939  HOH HOH A . 
H 6 HOH 440 940  940  HOH HOH A . 
H 6 HOH 441 941  941  HOH HOH A . 
H 6 HOH 442 942  942  HOH HOH A . 
H 6 HOH 443 943  943  HOH HOH A . 
H 6 HOH 444 944  944  HOH HOH A . 
H 6 HOH 445 945  945  HOH HOH A . 
H 6 HOH 446 946  946  HOH HOH A . 
H 6 HOH 447 947  947  HOH HOH A . 
H 6 HOH 448 948  948  HOH HOH A . 
H 6 HOH 449 949  949  HOH HOH A . 
H 6 HOH 450 950  950  HOH HOH A . 
H 6 HOH 451 951  951  HOH HOH A . 
H 6 HOH 452 952  952  HOH HOH A . 
H 6 HOH 453 953  953  HOH HOH A . 
H 6 HOH 454 954  954  HOH HOH A . 
H 6 HOH 455 955  955  HOH HOH A . 
H 6 HOH 456 956  956  HOH HOH A . 
H 6 HOH 457 957  957  HOH HOH A . 
H 6 HOH 458 958  958  HOH HOH A . 
H 6 HOH 459 959  959  HOH HOH A . 
H 6 HOH 460 960  960  HOH HOH A . 
H 6 HOH 461 961  961  HOH HOH A . 
H 6 HOH 462 962  962  HOH HOH A . 
H 6 HOH 463 963  963  HOH HOH A . 
H 6 HOH 464 964  964  HOH HOH A . 
H 6 HOH 465 965  965  HOH HOH A . 
H 6 HOH 466 966  966  HOH HOH A . 
H 6 HOH 467 967  967  HOH HOH A . 
H 6 HOH 468 968  968  HOH HOH A . 
H 6 HOH 469 969  969  HOH HOH A . 
H 6 HOH 470 970  970  HOH HOH A . 
H 6 HOH 471 971  971  HOH HOH A . 
H 6 HOH 472 972  972  HOH HOH A . 
H 6 HOH 473 973  973  HOH HOH A . 
H 6 HOH 474 974  974  HOH HOH A . 
H 6 HOH 475 975  975  HOH HOH A . 
H 6 HOH 476 976  976  HOH HOH A . 
H 6 HOH 477 977  977  HOH HOH A . 
H 6 HOH 478 978  978  HOH HOH A . 
H 6 HOH 479 979  979  HOH HOH A . 
H 6 HOH 480 980  980  HOH HOH A . 
H 6 HOH 481 981  981  HOH HOH A . 
H 6 HOH 482 982  982  HOH HOH A . 
H 6 HOH 483 983  983  HOH HOH A . 
H 6 HOH 484 984  984  HOH HOH A . 
H 6 HOH 485 985  985  HOH HOH A . 
H 6 HOH 486 986  986  HOH HOH A . 
H 6 HOH 487 987  987  HOH HOH A . 
H 6 HOH 488 988  988  HOH HOH A . 
H 6 HOH 489 989  989  HOH HOH A . 
H 6 HOH 490 990  990  HOH HOH A . 
H 6 HOH 491 991  991  HOH HOH A . 
H 6 HOH 492 992  992  HOH HOH A . 
H 6 HOH 493 993  993  HOH HOH A . 
H 6 HOH 494 994  994  HOH HOH A . 
H 6 HOH 495 995  995  HOH HOH A . 
H 6 HOH 496 996  996  HOH HOH A . 
H 6 HOH 497 997  997  HOH HOH A . 
H 6 HOH 498 998  998  HOH HOH A . 
H 6 HOH 499 999  999  HOH HOH A . 
H 6 HOH 500 1000 1000 HOH HOH A . 
H 6 HOH 501 1001 1001 HOH HOH A . 
H 6 HOH 502 1002 1002 HOH HOH A . 
H 6 HOH 503 1003 1003 HOH HOH A . 
H 6 HOH 504 1004 1004 HOH HOH A . 
H 6 HOH 505 1005 1005 HOH HOH A . 
H 6 HOH 506 1006 1006 HOH HOH A . 
H 6 HOH 507 1007 1007 HOH HOH A . 
H 6 HOH 508 1008 1008 HOH HOH A . 
H 6 HOH 509 1009 1009 HOH HOH A . 
H 6 HOH 510 1010 1010 HOH HOH A . 
H 6 HOH 511 1011 1011 HOH HOH A . 
H 6 HOH 512 1012 1012 HOH HOH A . 
H 6 HOH 513 1013 1013 HOH HOH A . 
H 6 HOH 514 1014 1014 HOH HOH A . 
H 6 HOH 515 1015 1015 HOH HOH A . 
H 6 HOH 516 1016 1016 HOH HOH A . 
H 6 HOH 517 1017 1017 HOH HOH A . 
H 6 HOH 518 1018 1018 HOH HOH A . 
H 6 HOH 519 1019 1019 HOH HOH A . 
H 6 HOH 520 1020 1020 HOH HOH A . 
H 6 HOH 521 1021 1021 HOH HOH A . 
H 6 HOH 522 1022 1022 HOH HOH A . 
H 6 HOH 523 1023 1023 HOH HOH A . 
H 6 HOH 524 1024 1024 HOH HOH A . 
H 6 HOH 525 1025 1025 HOH HOH A . 
H 6 HOH 526 1026 1026 HOH HOH A . 
H 6 HOH 527 1027 1027 HOH HOH A . 
H 6 HOH 528 1028 1028 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SER 3 A SER 3 ? SER 'GLYCOSYLATION SITE' 
2 A THR 7 A THR 7 ? THR 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.00000000