data_1CKS
# 
_entry.id   1CKS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CKS         
WWPDB D_1000172364 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CKS 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Parge, H.E.'  1 
'Arvai, A.S.'  2 
'Tainer, J.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'Human CksHs2 atomic structure: a role for its hexameric assembly in cell cycle control.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            262 
_citation.page_first                387 
_citation.page_last                 395 
_citation.year                      1993 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8211159 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Parge, H.E.'   1 
primary 'Arvai, A.S.'   2 
primary 'Murtari, D.J.' 3 
primary 'Reed, S.I.'    4 
primary 'Tainer, J.A.'  5 
# 
_cell.entry_id           1CKS 
_cell.length_a           100.100 
_cell.length_b           57.600 
_cell.length_c           51.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CKS 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2' 9879.365 3   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                             96.063   3   ? ? ? ? 
3 water       nat water                                     18.015   224 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 
_entity_poly.pdbx_seq_one_letter_code_can   MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  HIS n 
1 4  LYS n 
1 5  GLN n 
1 6  ILE n 
1 7  TYR n 
1 8  TYR n 
1 9  SER n 
1 10 ASP n 
1 11 LYS n 
1 12 TYR n 
1 13 PHE n 
1 14 ASP n 
1 15 GLU n 
1 16 HIS n 
1 17 TYR n 
1 18 GLU n 
1 19 TYR n 
1 20 ARG n 
1 21 HIS n 
1 22 VAL n 
1 23 MET n 
1 24 LEU n 
1 25 PRO n 
1 26 ARG n 
1 27 GLU n 
1 28 LEU n 
1 29 SER n 
1 30 LYS n 
1 31 GLN n 
1 32 VAL n 
1 33 PRO n 
1 34 LYS n 
1 35 THR n 
1 36 HIS n 
1 37 LEU n 
1 38 MET n 
1 39 SER n 
1 40 GLU n 
1 41 GLU n 
1 42 GLU n 
1 43 TRP n 
1 44 ARG n 
1 45 ARG n 
1 46 LEU n 
1 47 GLY n 
1 48 VAL n 
1 49 GLN n 
1 50 GLN n 
1 51 SER n 
1 52 LEU n 
1 53 GLY n 
1 54 TRP n 
1 55 VAL n 
1 56 HIS n 
1 57 TYR n 
1 58 MET n 
1 59 ILE n 
1 60 HIS n 
1 61 GLU n 
1 62 PRO n 
1 63 GLU n 
1 64 PRO n 
1 65 HIS n 
1 66 ILE n 
1 67 LEU n 
1 68 LEU n 
1 69 PHE n 
1 70 ARG n 
1 71 ARG n 
1 72 PRO n 
1 73 LEU n 
1 74 PRO n 
1 75 LYS n 
1 76 ASP n 
1 77 GLN n 
1 78 GLN n 
1 79 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CKS2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P33552 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CKS A 1 ? 79 ? P33552 1 ? 79 ? 1 79 
2 1 1CKS B 1 ? 79 ? P33552 1 ? 79 ? 1 79 
3 1 1CKS C 1 ? 79 ? P33552 1 ? 79 ? 1 79 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CKS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.22 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1CKS 
_refine.ls_number_reflns_obs                     13693 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10. 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1680000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1680000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2031 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               2270 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        10. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.40  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.821900 0.297000  0.486100 -0.294800 -0.508400 0.809100  0.487400 -0.808300 -0.330300 -26.15100 14.73900 70.60900 
2 given ? 0.835000 -0.308100 0.455900 0.280000  -0.475300 -0.834100 0.473700 0.824100  -0.310600 -7.47800  73.04600 23.03300 
# 
_struct.entry_id                  1CKS 
_struct.title                     'HUMAN CKSHS2 ATOMIC STRUCTURE: A ROLE FOR ITS HEXAMERIC ASSEMBLY IN CELL CYCLE CONTROL' 
_struct.pdbx_descriptor           'CYCLIN-DEPENDENT KINASE SUBUNIT TYPE 2 (CKSHS2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CKS 
_struct_keywords.pdbx_keywords   'CELL DIVISION' 
_struct_keywords.text            'CELL DIVISION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE FOLLOWING TRANSFORMATION WILL GENERATE CHAINS D, E, F
FROM CHAINS A, B, C, RESPECTIVELY.  CHAINS A, B, C, D, E,
AND F FORM A HEXAMER.

TRNSF1   3 -1.000000  0.000000  0.000000      53.094002
TRNSF2   3  0.000000  1.000000  0.000000       0.000000
TRNSF3   3  0.000000  0.000000 -1.000000      90.760002
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1A PRO A 25 ? GLN A 31 ? PRO A 25 GLN A 31 1 ? 7 
HELX_P HELX_P2 2A GLU A 40 ? LEU A 46 ? GLU A 40 LEU A 46 1 ? 7 
HELX_P HELX_P3 1B PRO B 25 ? GLN B 31 ? PRO B 25 GLN B 31 1 ? 7 
HELX_P HELX_P4 2B GLU B 40 ? LEU B 46 ? GLU B 40 LEU B 46 1 ? 7 
HELX_P HELX_P5 1C PRO C 25 ? GLN C 31 ? PRO C 25 GLN C 31 1 ? 7 
HELX_P HELX_P6 2C GLU C 40 ? LEU C 46 ? GLU C 40 LEU C 46 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A1 ? 4 ? 
B1 ? 4 ? 
C1 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A1 1 2 ? anti-parallel 
A1 2 3 ? anti-parallel 
A1 3 4 ? anti-parallel 
B1 1 2 ? anti-parallel 
B1 2 3 ? anti-parallel 
B1 3 4 ? anti-parallel 
C1 1 2 ? anti-parallel 
C1 2 3 ? anti-parallel 
C1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A1 1 GLN A 5  ? GLU A 15 ? GLN A 5  GLU A 15 
A1 2 HIS A 16 ? LEU A 24 ? HIS A 16 LEU A 24 
A1 3 TRP A 54 ? HIS A 60 ? TRP A 54 HIS A 60 
A1 4 HIS A 65 ? ARG A 71 ? HIS A 65 ARG A 71 
B1 1 GLN B 5  ? GLU B 15 ? GLN B 5  GLU B 15 
B1 2 HIS B 16 ? LEU B 24 ? HIS B 16 LEU B 24 
B1 3 TRP B 54 ? HIS B 60 ? TRP B 54 HIS B 60 
B1 4 HIS B 65 ? ARG B 71 ? HIS B 65 ARG B 71 
C1 1 GLN C 5  ? GLU C 15 ? GLN C 5  GLU C 15 
C1 2 HIS C 16 ? LEU C 24 ? HIS C 16 LEU C 24 
C1 3 TRP C 54 ? HIS C 60 ? TRP C 54 HIS C 60 
C1 4 HIS C 65 ? ARG C 71 ? HIS C 65 ARG C 71 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A1 1 2 O TYR A 7 ? O TYR A 7 N MET A 23 ? N MET A 23 
B1 1 2 O TYR B 7 ? O TYR B 7 N MET B 23 ? N MET B 23 
C1 1 2 O TYR C 7 ? O TYR C 7 N MET C 23 ? N MET C 23 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 300' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 301' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 C 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 LYS A 11 ? LYS A 11  . ? 1_555 ? 
2  AC1 7 ARG A 20 ? ARG A 20  . ? 1_555 ? 
3  AC1 7 GLN A 50 ? GLN A 50  . ? 1_555 ? 
4  AC1 7 SER A 51 ? SER A 51  . ? 1_555 ? 
5  AC1 7 TRP A 54 ? TRP A 54  . ? 1_555 ? 
6  AC1 7 ALA C 2  ? ALA C 2   . ? 2_657 ? 
7  AC1 7 HOH I .  ? HOH C 558 . ? 2_657 ? 
8  AC2 7 ARG A 71 ? ARG A 71  . ? 2_657 ? 
9  AC2 7 ALA B 2  ? ALA B 2   . ? 2_657 ? 
10 AC2 7 LYS B 11 ? LYS B 11  . ? 1_555 ? 
11 AC2 7 ARG B 20 ? ARG B 20  . ? 1_555 ? 
12 AC2 7 GLN B 50 ? GLN B 50  . ? 1_555 ? 
13 AC2 7 SER B 51 ? SER B 51  . ? 1_555 ? 
14 AC2 7 TRP B 54 ? TRP B 54  . ? 1_555 ? 
15 AC3 7 ALA A 2  ? ALA A 2   . ? 1_556 ? 
16 AC3 7 LYS A 4  ? LYS A 4   . ? 1_556 ? 
17 AC3 7 HOH G .  ? HOH A 374 . ? 1_556 ? 
18 AC3 7 ARG C 20 ? ARG C 20  . ? 1_555 ? 
19 AC3 7 GLN C 50 ? GLN C 50  . ? 1_555 ? 
20 AC3 7 SER C 51 ? SER C 51  . ? 1_555 ? 
21 AC3 7 HOH I .  ? HOH C 708 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CKS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CKS 
_atom_sites.fract_transf_matrix[1][1]   0.009990 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005178 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017361 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022042 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2  ? 32.882 20.806 16.235 1.00 64.57  ? 2   ALA A N   1 
ATOM   2    C CA  . ALA A 1 2  ? 34.320 20.863 16.419 1.00 64.91  ? 2   ALA A CA  1 
ATOM   3    C C   . ALA A 1 2  ? 34.781 20.081 17.650 1.00 66.73  ? 2   ALA A C   1 
ATOM   4    O O   . ALA A 1 2  ? 34.165 19.062 17.980 1.00 65.98  ? 2   ALA A O   1 
ATOM   5    C CB  . ALA A 1 2  ? 34.810 22.307 16.596 1.00 62.50  ? 2   ALA A CB  1 
ATOM   6    N N   . HIS A 1 3  ? 35.912 20.426 18.303 1.00 69.34  ? 3   HIS A N   1 
ATOM   7    C CA  . HIS A 1 3  ? 36.266 19.835 19.597 1.00 72.53  ? 3   HIS A CA  1 
ATOM   8    C C   . HIS A 1 3  ? 35.887 20.844 20.672 1.00 72.33  ? 3   HIS A C   1 
ATOM   9    O O   . HIS A 1 3  ? 36.654 21.787 20.917 1.00 74.52  ? 3   HIS A O   1 
ATOM   10   C CB  . HIS A 1 3  ? 37.751 19.586 19.809 1.00 74.48  ? 3   HIS A CB  1 
ATOM   11   C CG  . HIS A 1 3  ? 38.286 18.364 19.118 1.00 78.18  ? 3   HIS A CG  1 
ATOM   12   N ND1 . HIS A 1 3  ? 37.753 17.167 18.871 1.00 80.68  ? 3   HIS A ND1 1 
ATOM   13   C CD2 . HIS A 1 3  ? 39.558 18.360 18.636 1.00 78.70  ? 3   HIS A CD2 1 
ATOM   14   C CE1 . HIS A 1 3  ? 38.667 16.451 18.265 1.00 81.56  ? 3   HIS A CE1 1 
ATOM   15   N NE2 . HIS A 1 3  ? 39.743 17.186 18.131 1.00 82.07  ? 3   HIS A NE2 1 
ATOM   16   N N   . LYS A 1 4  ? 34.691 20.703 21.261 1.00 69.69  ? 4   LYS A N   1 
ATOM   17   C CA  . LYS A 1 4  ? 34.264 21.597 22.330 1.00 64.88  ? 4   LYS A CA  1 
ATOM   18   C C   . LYS A 1 4  ? 33.588 20.764 23.384 1.00 60.07  ? 4   LYS A C   1 
ATOM   19   O O   . LYS A 1 4  ? 32.741 19.892 23.178 1.00 59.90  ? 4   LYS A O   1 
ATOM   20   C CB  . LYS A 1 4  ? 33.275 22.685 21.853 1.00 65.25  ? 4   LYS A CB  1 
ATOM   21   C CG  . LYS A 1 4  ? 31.981 22.213 21.218 1.00 62.70  ? 4   LYS A CG  1 
ATOM   22   C CD  . LYS A 1 4  ? 31.655 23.078 20.015 1.00 60.33  ? 4   LYS A CD  1 
ATOM   23   C CE  . LYS A 1 4  ? 30.409 22.502 19.437 1.00 57.77  ? 4   LYS A CE  1 
ATOM   24   N NZ  . LYS A 1 4  ? 30.642 21.125 19.043 1.00 56.66  ? 4   LYS A NZ  1 
ATOM   25   N N   . GLN A 1 5  ? 34.096 21.070 24.545 1.00 54.61  ? 5   GLN A N   1 
ATOM   26   C CA  . GLN A 1 5  ? 33.610 20.424 25.732 1.00 50.57  ? 5   GLN A CA  1 
ATOM   27   C C   . GLN A 1 5  ? 32.355 21.107 26.216 1.00 44.40  ? 5   GLN A C   1 
ATOM   28   O O   . GLN A 1 5  ? 32.431 22.231 26.703 1.00 45.42  ? 5   GLN A O   1 
ATOM   29   C CB  . GLN A 1 5  ? 34.638 20.484 26.821 1.00 55.07  ? 5   GLN A CB  1 
ATOM   30   C CG  . GLN A 1 5  ? 35.416 21.775 26.828 1.00 57.51  ? 5   GLN A CG  1 
ATOM   31   C CD  . GLN A 1 5  ? 36.249 21.876 28.056 1.00 58.08  ? 5   GLN A CD  1 
ATOM   32   O OE1 . GLN A 1 5  ? 37.299 21.248 28.184 1.00 62.48  ? 5   GLN A OE1 1 
ATOM   33   N NE2 . GLN A 1 5  ? 35.736 22.667 28.969 1.00 58.79  ? 5   GLN A NE2 1 
ATOM   34   N N   . ILE A 1 6  ? 31.187 20.519 26.003 1.00 38.49  ? 6   ILE A N   1 
ATOM   35   C CA  . ILE A 1 6  ? 29.964 21.057 26.592 1.00 30.16  ? 6   ILE A CA  1 
ATOM   36   C C   . ILE A 1 6  ? 29.686 20.157 27.796 1.00 24.50  ? 6   ILE A C   1 
ATOM   37   O O   . ILE A 1 6  ? 29.815 18.938 27.685 1.00 24.58  ? 6   ILE A O   1 
ATOM   38   C CB  . ILE A 1 6  ? 28.834 21.042 25.508 1.00 25.16  ? 6   ILE A CB  1 
ATOM   39   C CG1 . ILE A 1 6  ? 29.182 22.092 24.408 1.00 22.29  ? 6   ILE A CG1 1 
ATOM   40   C CG2 . ILE A 1 6  ? 27.501 21.364 26.137 1.00 18.65  ? 6   ILE A CG2 1 
ATOM   41   C CD1 . ILE A 1 6  ? 28.211 22.319 23.258 1.00 22.06  ? 6   ILE A CD1 1 
ATOM   42   N N   . TYR A 1 7  ? 29.426 20.664 28.986 1.00 22.98  ? 7   TYR A N   1 
ATOM   43   C CA  . TYR A 1 7  ? 29.091 19.785 30.107 1.00 21.20  ? 7   TYR A CA  1 
ATOM   44   C C   . TYR A 1 7  ? 27.559 19.606 30.190 1.00 17.56  ? 7   TYR A C   1 
ATOM   45   O O   . TYR A 1 7  ? 26.840 20.590 30.217 1.00 18.61  ? 7   TYR A O   1 
ATOM   46   C CB  . TYR A 1 7  ? 29.667 20.402 31.405 1.00 24.26  ? 7   TYR A CB  1 
ATOM   47   C CG  . TYR A 1 7  ? 29.453 19.469 32.588 1.00 26.02  ? 7   TYR A CG  1 
ATOM   48   C CD1 . TYR A 1 7  ? 30.151 18.261 32.642 1.00 26.10  ? 7   TYR A CD1 1 
ATOM   49   C CD2 . TYR A 1 7  ? 28.479 19.777 33.543 1.00 23.83  ? 7   TYR A CD2 1 
ATOM   50   C CE1 . TYR A 1 7  ? 29.857 17.349 33.652 1.00 28.16  ? 7   TYR A CE1 1 
ATOM   51   C CE2 . TYR A 1 7  ? 28.168 18.868 34.549 1.00 24.89  ? 7   TYR A CE2 1 
ATOM   52   C CZ  . TYR A 1 7  ? 28.858 17.651 34.595 1.00 29.16  ? 7   TYR A CZ  1 
ATOM   53   O OH  . TYR A 1 7  ? 28.491 16.701 35.550 1.00 34.88  ? 7   TYR A OH  1 
ATOM   54   N N   . TYR A 1 8  ? 26.985 18.419 30.226 1.00 16.84  ? 8   TYR A N   1 
ATOM   55   C CA  . TYR A 1 8  ? 25.552 18.251 30.323 1.00 17.56  ? 8   TYR A CA  1 
ATOM   56   C C   . TYR A 1 8  ? 25.227 17.925 31.763 1.00 18.71  ? 8   TYR A C   1 
ATOM   57   O O   . TYR A 1 8  ? 25.660 16.854 32.181 1.00 17.04  ? 8   TYR A O   1 
ATOM   58   C CB  . TYR A 1 8  ? 25.100 17.106 29.415 1.00 18.28  ? 8   TYR A CB  1 
ATOM   59   C CG  . TYR A 1 8  ? 25.255 17.491 27.954 1.00 21.47  ? 8   TYR A CG  1 
ATOM   60   C CD1 . TYR A 1 8  ? 24.314 18.320 27.334 1.00 20.05  ? 8   TYR A CD1 1 
ATOM   61   C CD2 . TYR A 1 8  ? 26.402 17.094 27.256 1.00 23.82  ? 8   TYR A CD2 1 
ATOM   62   C CE1 . TYR A 1 8  ? 24.534 18.769 26.022 1.00 19.56  ? 8   TYR A CE1 1 
ATOM   63   C CE2 . TYR A 1 8  ? 26.622 17.544 25.947 1.00 22.92  ? 8   TYR A CE2 1 
ATOM   64   C CZ  . TYR A 1 8  ? 25.688 18.384 25.346 1.00 20.48  ? 8   TYR A CZ  1 
ATOM   65   O OH  . TYR A 1 8  ? 25.952 18.894 24.099 1.00 22.01  ? 8   TYR A OH  1 
ATOM   66   N N   . SER A 1 9  ? 24.540 18.734 32.585 1.00 23.85  ? 9   SER A N   1 
ATOM   67   C CA  . SER A 1 9  ? 24.211 18.330 33.973 1.00 26.45  ? 9   SER A CA  1 
ATOM   68   C C   . SER A 1 9  ? 23.206 17.180 33.994 1.00 26.24  ? 9   SER A C   1 
ATOM   69   O O   . SER A 1 9  ? 22.562 16.877 32.970 1.00 22.48  ? 9   SER A O   1 
ATOM   70   C CB  . SER A 1 9  ? 23.566 19.455 34.785 1.00 28.32  ? 9   SER A CB  1 
ATOM   71   O OG  . SER A 1 9  ? 22.171 19.721 34.518 1.00 31.95  ? 9   SER A OG  1 
ATOM   72   N N   . ASP A 1 10 ? 23.005 16.524 35.154 1.00 27.79  ? 10  ASP A N   1 
ATOM   73   C CA  . ASP A 1 10 ? 21.949 15.514 35.169 1.00 28.36  ? 10  ASP A CA  1 
ATOM   74   C C   . ASP A 1 10 ? 20.589 16.207 35.247 1.00 22.84  ? 10  ASP A C   1 
ATOM   75   O O   . ASP A 1 10 ? 20.480 17.410 35.507 1.00 23.37  ? 10  ASP A O   1 
ATOM   76   C CB  . ASP A 1 10 ? 22.188 14.527 36.339 1.00 34.44  ? 10  ASP A CB  1 
ATOM   77   C CG  . ASP A 1 10 ? 23.331 13.535 36.011 1.00 40.94  ? 10  ASP A CG  1 
ATOM   78   O OD1 . ASP A 1 10 ? 23.344 12.914 34.932 1.00 42.83  ? 10  ASP A OD1 1 
ATOM   79   O OD2 . ASP A 1 10 ? 24.224 13.389 36.847 1.00 44.20  ? 10  ASP A OD2 1 
ATOM   80   N N   . LYS A 1 11 ? 19.558 15.505 34.854 1.00 22.39  ? 11  LYS A N   1 
ATOM   81   C CA  . LYS A 1 11 ? 18.233 16.075 34.845 1.00 24.09  ? 11  LYS A CA  1 
ATOM   82   C C   . LYS A 1 11 ? 17.622 16.071 36.274 1.00 22.58  ? 11  LYS A C   1 
ATOM   83   O O   . LYS A 1 11 ? 17.898 15.199 37.119 1.00 20.88  ? 11  LYS A O   1 
ATOM   84   C CB  . LYS A 1 11 ? 17.340 15.253 33.899 1.00 26.57  ? 11  LYS A CB  1 
ATOM   85   C CG  . LYS A 1 11 ? 17.812 15.120 32.499 1.00 31.44  ? 11  LYS A CG  1 
ATOM   86   C CD  . LYS A 1 11 ? 16.867 14.191 31.784 1.00 39.00  ? 11  LYS A CD  1 
ATOM   87   C CE  . LYS A 1 11 ? 17.503 13.651 30.492 1.00 46.15  ? 11  LYS A CE  1 
ATOM   88   N NZ  . LYS A 1 11 ? 16.597 12.777 29.749 1.00 50.06  ? 11  LYS A NZ  1 
ATOM   89   N N   . TYR A 1 12 ? 16.753 17.047 36.540 1.00 20.07  ? 12  TYR A N   1 
ATOM   90   C CA  . TYR A 1 12 ? 15.924 17.078 37.725 1.00 16.81  ? 12  TYR A CA  1 
ATOM   91   C C   . TYR A 1 12 ? 14.501 17.464 37.220 1.00 18.61  ? 12  TYR A C   1 
ATOM   92   O O   . TYR A 1 12 ? 14.313 17.899 36.076 1.00 15.15  ? 12  TYR A O   1 
ATOM   93   C CB  . TYR A 1 12 ? 16.521 18.082 38.733 1.00 13.37  ? 12  TYR A CB  1 
ATOM   94   C CG  . TYR A 1 12 ? 16.801 19.496 38.242 1.00 12.21  ? 12  TYR A CG  1 
ATOM   95   C CD1 . TYR A 1 12 ? 17.930 19.773 37.436 1.00 11.71  ? 12  TYR A CD1 1 
ATOM   96   C CD2 . TYR A 1 12 ? 15.912 20.502 38.616 1.00 10.47  ? 12  TYR A CD2 1 
ATOM   97   C CE1 . TYR A 1 12 ? 18.152 21.077 37.001 1.00 10.52  ? 12  TYR A CE1 1 
ATOM   98   C CE2 . TYR A 1 12 ? 16.135 21.808 38.188 1.00 10.82  ? 12  TYR A CE2 1 
ATOM   99   C CZ  . TYR A 1 12 ? 17.248 22.074 37.386 1.00 10.24  ? 12  TYR A CZ  1 
ATOM   100  O OH  . TYR A 1 12 ? 17.436 23.375 36.967 1.00 17.54  ? 12  TYR A OH  1 
ATOM   101  N N   . PHE A 1 13 ? 13.445 17.306 38.012 1.00 14.64  ? 13  PHE A N   1 
ATOM   102  C CA  . PHE A 1 13 ? 12.067 17.497 37.581 1.00 14.64  ? 13  PHE A CA  1 
ATOM   103  C C   . PHE A 1 13 ? 11.266 17.990 38.764 1.00 13.16  ? 13  PHE A C   1 
ATOM   104  O O   . PHE A 1 13 ? 11.674 17.827 39.923 1.00 13.79  ? 13  PHE A O   1 
ATOM   105  C CB  . PHE A 1 13 ? 11.452 16.180 37.080 1.00 11.10  ? 13  PHE A CB  1 
ATOM   106  C CG  . PHE A 1 13 ? 11.576 14.991 38.012 1.00 12.47  ? 13  PHE A CG  1 
ATOM   107  C CD1 . PHE A 1 13 ? 12.703 14.147 37.952 1.00 13.58  ? 13  PHE A CD1 1 
ATOM   108  C CD2 . PHE A 1 13 ? 10.580 14.734 38.968 1.00 11.26  ? 13  PHE A CD2 1 
ATOM   109  C CE1 . PHE A 1 13 ? 12.832 13.053 38.842 1.00 14.81  ? 13  PHE A CE1 1 
ATOM   110  C CE2 . PHE A 1 13 ? 10.724 13.648 39.842 1.00 7.81   ? 13  PHE A CE2 1 
ATOM   111  C CZ  . PHE A 1 13 ? 11.835 12.803 39.792 1.00 11.97  ? 13  PHE A CZ  1 
ATOM   112  N N   . ASP A 1 14 ? 10.162 18.652 38.472 1.00 12.65  ? 14  ASP A N   1 
ATOM   113  C CA  . ASP A 1 14 ? 9.227  19.048 39.523 1.00 11.83  ? 14  ASP A CA  1 
ATOM   114  C C   . ASP A 1 14 ? 7.896  18.341 39.234 1.00 11.63  ? 14  ASP A C   1 
ATOM   115  O O   . ASP A 1 14 ? 7.930  17.217 38.743 1.00 9.85   ? 14  ASP A O   1 
ATOM   116  C CB  . ASP A 1 14 ? 9.106  20.605 39.542 1.00 8.71   ? 14  ASP A CB  1 
ATOM   117  C CG  . ASP A 1 14 ? 8.647  21.317 38.280 1.00 8.38   ? 14  ASP A CG  1 
ATOM   118  O OD1 . ASP A 1 14 ? 8.121  20.736 37.348 1.00 15.53  ? 14  ASP A OD1 1 
ATOM   119  O OD2 . ASP A 1 14 ? 8.798  22.501 38.214 1.00 11.96  ? 14  ASP A OD2 1 
ATOM   120  N N   . GLU A 1 15 ? 6.710  18.912 39.462 1.00 14.23  ? 15  GLU A N   1 
ATOM   121  C CA  . GLU A 1 15 ? 5.458  18.203 39.237 1.00 14.42  ? 15  GLU A CA  1 
ATOM   122  C C   . GLU A 1 15 ? 5.045  18.186 37.771 1.00 15.46  ? 15  GLU A C   1 
ATOM   123  O O   . GLU A 1 15 ? 4.196  17.400 37.375 1.00 17.10  ? 15  GLU A O   1 
ATOM   124  C CB  . GLU A 1 15 ? 4.344  18.866 40.068 1.00 17.78  ? 15  GLU A CB  1 
ATOM   125  C CG  . GLU A 1 15 ? 4.603  18.810 41.581 1.00 19.51  ? 15  GLU A CG  1 
ATOM   126  C CD  . GLU A 1 15 ? 3.716  19.706 42.417 1.00 21.29  ? 15  GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 15 ? 3.651  20.921 42.220 1.00 20.72  ? 15  GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 15 ? 3.111  19.149 43.315 1.00 25.33  ? 15  GLU A OE2 1 
ATOM   129  N N   . HIS A 1 16 ? 5.559  19.078 36.918 1.00 12.72  ? 16  HIS A N   1 
ATOM   130  C CA  . HIS A 1 16 ? 5.150  19.188 35.513 1.00 15.30  ? 16  HIS A CA  1 
ATOM   131  C C   . HIS A 1 16 ? 6.246  19.140 34.434 1.00 14.85  ? 16  HIS A C   1 
ATOM   132  O O   . HIS A 1 16 ? 6.007  18.705 33.313 1.00 14.41  ? 16  HIS A O   1 
ATOM   133  C CB  . HIS A 1 16 ? 4.302  20.502 35.372 1.00 18.02  ? 16  HIS A CB  1 
ATOM   134  C CG  . HIS A 1 16 ? 2.981  20.421 36.178 1.00 21.60  ? 16  HIS A CG  1 
ATOM   135  N ND1 . HIS A 1 16 ? 1.902  19.672 35.910 1.00 22.40  ? 16  HIS A ND1 1 
ATOM   136  C CD2 . HIS A 1 16 ? 2.754  21.028 37.410 1.00 20.70  ? 16  HIS A CD2 1 
ATOM   137  C CE1 . HIS A 1 16 ? 1.071  19.790 36.931 1.00 21.41  ? 16  HIS A CE1 1 
ATOM   138  N NE2 . HIS A 1 16 ? 1.594  20.601 37.822 1.00 20.20  ? 16  HIS A NE2 1 
ATOM   139  N N   . TYR A 1 17 ? 7.499  19.438 34.799 1.00 16.65  ? 17  TYR A N   1 
ATOM   140  C CA  . TYR A 1 17 ? 8.636  19.585 33.903 1.00 15.04  ? 17  TYR A CA  1 
ATOM   141  C C   . TYR A 1 17 ? 9.867  18.879 34.396 1.00 14.33  ? 17  TYR A C   1 
ATOM   142  O O   . TYR A 1 17 ? 10.057 18.569 35.561 1.00 16.67  ? 17  TYR A O   1 
ATOM   143  C CB  . TYR A 1 17 ? 9.065  21.015 33.739 1.00 11.74  ? 17  TYR A CB  1 
ATOM   144  C CG  . TYR A 1 17 ? 8.039  21.938 33.135 1.00 17.18  ? 17  TYR A CG  1 
ATOM   145  C CD1 . TYR A 1 17 ? 7.919  22.086 31.757 1.00 17.45  ? 17  TYR A CD1 1 
ATOM   146  C CD2 . TYR A 1 17 ? 7.212  22.650 33.985 1.00 19.99  ? 17  TYR A CD2 1 
ATOM   147  C CE1 . TYR A 1 17 ? 6.973  22.953 31.237 1.00 20.44  ? 17  TYR A CE1 1 
ATOM   148  C CE2 . TYR A 1 17 ? 6.259  23.515 33.477 1.00 23.97  ? 17  TYR A CE2 1 
ATOM   149  C CZ  . TYR A 1 17 ? 6.145  23.667 32.096 1.00 27.17  ? 17  TYR A CZ  1 
ATOM   150  O OH  . TYR A 1 17 ? 5.192  24.562 31.605 1.00 32.97  ? 17  TYR A OH  1 
ATOM   151  N N   . GLU A 1 18 ? 10.729 18.662 33.448 1.00 16.64  ? 18  GLU A N   1 
ATOM   152  C CA  . GLU A 1 18 ? 12.037 18.088 33.617 1.00 15.42  ? 18  GLU A CA  1 
ATOM   153  C C   . GLU A 1 18 ? 12.950 19.246 33.180 1.00 15.96  ? 18  GLU A C   1 
ATOM   154  O O   . GLU A 1 18 ? 12.574 20.131 32.380 1.00 13.00  ? 18  GLU A O   1 
ATOM   155  C CB  . GLU A 1 18 ? 12.001 16.917 32.728 1.00 21.58  ? 18  GLU A CB  1 
ATOM   156  C CG  . GLU A 1 18 ? 13.270 16.193 32.574 1.00 25.73  ? 18  GLU A CG  1 
ATOM   157  C CD  . GLU A 1 18 ? 13.046 14.966 31.747 1.00 22.44  ? 18  GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 18 ? 12.658 15.071 30.590 1.00 25.05  ? 18  GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 18 ? 13.263 13.895 32.289 1.00 30.60  ? 18  GLU A OE2 1 
ATOM   160  N N   . TYR A 1 19 ? 14.140 19.293 33.775 1.00 15.83  ? 19  TYR A N   1 
ATOM   161  C CA  . TYR A 1 19 ? 15.055 20.420 33.637 1.00 16.40  ? 19  TYR A CA  1 
ATOM   162  C C   . TYR A 1 19 ? 16.485 19.924 33.414 1.00 15.81  ? 19  TYR A C   1 
ATOM   163  O O   . TYR A 1 19 ? 16.798 18.806 33.858 1.00 15.75  ? 19  TYR A O   1 
ATOM   164  C CB  . TYR A 1 19 ? 15.056 21.273 34.904 1.00 14.60  ? 19  TYR A CB  1 
ATOM   165  C CG  . TYR A 1 19 ? 13.744 21.901 35.322 1.00 13.51  ? 19  TYR A CG  1 
ATOM   166  C CD1 . TYR A 1 19 ? 12.848 21.222 36.153 1.00 12.59  ? 19  TYR A CD1 1 
ATOM   167  C CD2 . TYR A 1 19 ? 13.446 23.163 34.830 1.00 11.62  ? 19  TYR A CD2 1 
ATOM   168  C CE1 . TYR A 1 19 ? 11.638 21.847 36.469 1.00 12.25  ? 19  TYR A CE1 1 
ATOM   169  C CE2 . TYR A 1 19 ? 12.247 23.792 35.134 1.00 11.07  ? 19  TYR A CE2 1 
ATOM   170  C CZ  . TYR A 1 19 ? 11.351 23.117 35.956 1.00 14.51  ? 19  TYR A CZ  1 
ATOM   171  O OH  . TYR A 1 19 ? 10.157 23.743 36.251 1.00 18.89  ? 19  TYR A OH  1 
ATOM   172  N N   . ARG A 1 20 ? 17.356 20.693 32.743 1.00 14.75  ? 20  ARG A N   1 
ATOM   173  C CA  . ARG A 1 20 ? 18.768 20.306 32.650 1.00 16.84  ? 20  ARG A CA  1 
ATOM   174  C C   . ARG A 1 20 ? 19.538 21.595 32.462 1.00 15.05  ? 20  ARG A C   1 
ATOM   175  O O   . ARG A 1 20 ? 18.982 22.568 31.959 1.00 16.96  ? 20  ARG A O   1 
ATOM   176  C CB  . ARG A 1 20 ? 19.032 19.380 31.451 1.00 18.59  ? 20  ARG A CB  1 
ATOM   177  C CG  . ARG A 1 20 ? 20.482 19.123 31.395 1.00 21.23  ? 20  ARG A CG  1 
ATOM   178  C CD  . ARG A 1 20 ? 20.902 18.703 30.062 1.00 15.25  ? 20  ARG A CD  1 
ATOM   179  N NE  . ARG A 1 20 ? 20.992 17.296 30.242 1.00 19.04  ? 20  ARG A NE  1 
ATOM   180  C CZ  . ARG A 1 20 ? 20.376 16.472 29.425 1.00 25.69  ? 20  ARG A CZ  1 
ATOM   181  N NH1 . ARG A 1 20 ? 19.667 16.929 28.382 1.00 25.25  ? 20  ARG A NH1 1 
ATOM   182  N NH2 . ARG A 1 20 ? 20.423 15.180 29.742 1.00 26.32  ? 20  ARG A NH2 1 
ATOM   183  N N   . HIS A 1 21 ? 20.772 21.661 32.938 1.00 16.28  ? 21  HIS A N   1 
ATOM   184  C CA  . HIS A 1 21 ? 21.659 22.793 32.761 1.00 19.31  ? 21  HIS A CA  1 
ATOM   185  C C   . HIS A 1 21 ? 22.720 22.362 31.736 1.00 18.00  ? 21  HIS A C   1 
ATOM   186  O O   . HIS A 1 21 ? 23.047 21.179 31.711 1.00 16.85  ? 21  HIS A O   1 
ATOM   187  C CB  . HIS A 1 21 ? 22.341 23.132 34.082 1.00 26.53  ? 21  HIS A CB  1 
ATOM   188  C CG  . HIS A 1 21 ? 21.456 23.801 35.136 1.00 37.07  ? 21  HIS A CG  1 
ATOM   189  N ND1 . HIS A 1 21 ? 21.367 23.512 36.430 1.00 39.10  ? 21  HIS A ND1 1 
ATOM   190  C CD2 . HIS A 1 21 ? 20.598 24.857 34.895 1.00 40.14  ? 21  HIS A CD2 1 
ATOM   191  C CE1 . HIS A 1 21 ? 20.504 24.343 36.959 1.00 41.88  ? 21  HIS A CE1 1 
ATOM   192  N NE2 . HIS A 1 21 ? 20.043 25.146 36.037 1.00 40.94  ? 21  HIS A NE2 1 
ATOM   193  N N   . VAL A 1 22 ? 23.288 23.223 30.888 1.00 18.23  ? 22  VAL A N   1 
ATOM   194  C CA  . VAL A 1 22 ? 24.319 22.847 29.927 1.00 18.04  ? 22  VAL A CA  1 
ATOM   195  C C   . VAL A 1 22 ? 25.406 23.868 30.187 1.00 18.56  ? 22  VAL A C   1 
ATOM   196  O O   . VAL A 1 22 ? 25.078 25.050 30.285 1.00 18.85  ? 22  VAL A O   1 
ATOM   197  C CB  . VAL A 1 22 ? 23.720 22.953 28.484 1.00 19.26  ? 22  VAL A CB  1 
ATOM   198  C CG1 . VAL A 1 22 ? 24.778 23.013 27.379 1.00 21.54  ? 22  VAL A CG1 1 
ATOM   199  C CG2 . VAL A 1 22 ? 22.887 21.692 28.246 1.00 19.66  ? 22  VAL A CG2 1 
ATOM   200  N N   . MET A 1 23 ? 26.663 23.445 30.362 1.00 20.50  ? 23  MET A N   1 
ATOM   201  C CA  . MET A 1 23 ? 27.792 24.343 30.634 1.00 25.26  ? 23  MET A CA  1 
ATOM   202  C C   . MET A 1 23 ? 28.532 24.562 29.336 1.00 22.31  ? 23  MET A C   1 
ATOM   203  O O   . MET A 1 23 ? 28.976 23.574 28.761 1.00 20.26  ? 23  MET A O   1 
ATOM   204  C CB  . MET A 1 23 ? 28.843 23.755 31.569 1.00 30.22  ? 23  MET A CB  1 
ATOM   205  C CG  . MET A 1 23 ? 28.491 23.605 33.027 1.00 44.38  ? 23  MET A CG  1 
ATOM   206  S SD  . MET A 1 23 ? 27.045 22.538 33.278 1.00 59.97  ? 23  MET A SD  1 
ATOM   207  C CE  . MET A 1 23 ? 25.899 23.786 33.789 1.00 52.70  ? 23  MET A CE  1 
ATOM   208  N N   . LEU A 1 24 ? 28.700 25.779 28.868 1.00 22.52  ? 24  LEU A N   1 
ATOM   209  C CA  . LEU A 1 24 ? 29.393 26.053 27.616 1.00 27.45  ? 24  LEU A CA  1 
ATOM   210  C C   . LEU A 1 24 ? 30.791 26.584 27.888 1.00 30.07  ? 24  LEU A C   1 
ATOM   211  O O   . LEU A 1 24 ? 30.930 27.406 28.810 1.00 31.46  ? 24  LEU A O   1 
ATOM   212  C CB  . LEU A 1 24 ? 28.644 27.105 26.797 1.00 26.59  ? 24  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 24 ? 27.786 26.777 25.566 1.00 31.70  ? 24  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 24 ? 26.898 25.528 25.680 1.00 28.33  ? 24  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 24 ? 26.949 28.021 25.379 1.00 31.32  ? 24  LEU A CD2 1 
ATOM   216  N N   . PRO A 1 25 ? 31.857 26.211 27.153 1.00 31.35  ? 25  PRO A N   1 
ATOM   217  C CA  . PRO A 1 25 ? 33.098 26.958 27.115 1.00 32.02  ? 25  PRO A CA  1 
ATOM   218  C C   . PRO A 1 25 ? 32.870 28.422 26.749 1.00 33.20  ? 25  PRO A C   1 
ATOM   219  O O   . PRO A 1 25 ? 31.985 28.792 25.969 1.00 32.12  ? 25  PRO A O   1 
ATOM   220  C CB  . PRO A 1 25 ? 33.943 26.165 26.127 1.00 30.32  ? 25  PRO A CB  1 
ATOM   221  C CG  . PRO A 1 25 ? 32.968 25.417 25.268 1.00 34.03  ? 25  PRO A CG  1 
ATOM   222  C CD  . PRO A 1 25 ? 31.921 25.031 26.297 1.00 31.43  ? 25  PRO A CD  1 
ATOM   223  N N   . ARG A 1 26 ? 33.667 29.251 27.405 1.00 37.80  ? 26  ARG A N   1 
ATOM   224  C CA  . ARG A 1 26 ? 33.756 30.695 27.240 1.00 42.21  ? 26  ARG A CA  1 
ATOM   225  C C   . ARG A 1 26 ? 33.606 31.232 25.813 1.00 41.79  ? 26  ARG A C   1 
ATOM   226  O O   . ARG A 1 26 ? 32.912 32.227 25.561 1.00 40.46  ? 26  ARG A O   1 
ATOM   227  C CB  . ARG A 1 26 ? 35.098 31.080 27.831 1.00 47.96  ? 26  ARG A CB  1 
ATOM   228  C CG  . ARG A 1 26 ? 35.163 32.435 28.497 1.00 58.21  ? 26  ARG A CG  1 
ATOM   229  C CD  . ARG A 1 26 ? 36.612 32.937 28.466 1.00 68.08  ? 26  ARG A CD  1 
ATOM   230  N NE  . ARG A 1 26 ? 36.764 34.016 27.480 1.00 78.26  ? 26  ARG A NE  1 
ATOM   231  C CZ  . ARG A 1 26 ? 37.198 33.852 26.204 1.00 83.23  ? 26  ARG A CZ  1 
ATOM   232  N NH1 . ARG A 1 26 ? 37.544 32.645 25.716 1.00 83.98  ? 26  ARG A NH1 1 
ATOM   233  N NH2 . ARG A 1 26 ? 37.259 34.923 25.387 1.00 83.74  ? 26  ARG A NH2 1 
ATOM   234  N N   . GLU A 1 27 ? 34.252 30.551 24.860 1.00 42.23  ? 27  GLU A N   1 
ATOM   235  C CA  . GLU A 1 27 ? 34.180 30.961 23.470 1.00 45.27  ? 27  GLU A CA  1 
ATOM   236  C C   . GLU A 1 27 ? 32.859 30.686 22.789 1.00 43.75  ? 27  GLU A C   1 
ATOM   237  O O   . GLU A 1 27 ? 32.315 31.534 22.080 1.00 45.88  ? 27  GLU A O   1 
ATOM   238  C CB  . GLU A 1 27 ? 35.290 30.286 22.681 1.00 49.19  ? 27  GLU A CB  1 
ATOM   239  C CG  . GLU A 1 27 ? 36.584 31.072 22.879 1.00 56.48  ? 27  GLU A CG  1 
ATOM   240  C CD  . GLU A 1 27 ? 36.568 32.475 22.259 1.00 59.62  ? 27  GLU A CD  1 
ATOM   241  O OE1 . GLU A 1 27 ? 36.453 32.570 21.033 1.00 63.84  ? 27  GLU A OE1 1 
ATOM   242  O OE2 . GLU A 1 27 ? 36.674 33.465 22.991 1.00 59.50  ? 27  GLU A OE2 1 
ATOM   243  N N   . LEU A 1 28 ? 32.293 29.506 23.011 1.00 40.78  ? 28  LEU A N   1 
ATOM   244  C CA  . LEU A 1 28 ? 31.015 29.179 22.452 1.00 38.29  ? 28  LEU A CA  1 
ATOM   245  C C   . LEU A 1 28 ? 29.951 30.048 23.136 1.00 39.85  ? 28  LEU A C   1 
ATOM   246  O O   . LEU A 1 28 ? 28.921 30.365 22.531 1.00 37.87  ? 28  LEU A O   1 
ATOM   247  C CB  . LEU A 1 28 ? 30.814 27.697 22.669 1.00 36.98  ? 28  LEU A CB  1 
ATOM   248  C CG  . LEU A 1 28 ? 29.892 27.003 21.685 1.00 36.75  ? 28  LEU A CG  1 
ATOM   249  C CD1 . LEU A 1 28 ? 30.512 27.044 20.320 1.00 34.33  ? 28  LEU A CD1 1 
ATOM   250  C CD2 . LEU A 1 28 ? 29.678 25.559 22.087 1.00 37.16  ? 28  LEU A CD2 1 
ATOM   251  N N   . SER A 1 29 ? 30.222 30.532 24.362 1.00 41.14  ? 29  SER A N   1 
ATOM   252  C CA  . SER A 1 29 ? 29.313 31.408 25.099 1.00 43.19  ? 29  SER A CA  1 
ATOM   253  C C   . SER A 1 29 ? 29.092 32.711 24.362 1.00 43.35  ? 29  SER A C   1 
ATOM   254  O O   . SER A 1 29 ? 28.001 33.282 24.390 1.00 43.04  ? 29  SER A O   1 
ATOM   255  C CB  . SER A 1 29 ? 29.849 31.800 26.455 1.00 43.74  ? 29  SER A CB  1 
ATOM   256  O OG  . SER A 1 29 ? 30.388 30.680 27.159 1.00 51.21  ? 29  SER A OG  1 
ATOM   257  N N   . LYS A 1 30 ? 30.136 33.193 23.699 1.00 44.81  ? 30  LYS A N   1 
ATOM   258  C CA  . LYS A 1 30 ? 30.043 34.423 22.947 1.00 45.23  ? 30  LYS A CA  1 
ATOM   259  C C   . LYS A 1 30 ? 29.028 34.364 21.838 1.00 43.45  ? 30  LYS A C   1 
ATOM   260  O O   . LYS A 1 30 ? 28.438 35.385 21.525 1.00 44.52  ? 30  LYS A O   1 
ATOM   261  C CB  . LYS A 1 30 ? 31.366 34.731 22.369 1.00 50.88  ? 30  LYS A CB  1 
ATOM   262  C CG  . LYS A 1 30 ? 32.307 35.207 23.458 1.00 57.49  ? 30  LYS A CG  1 
ATOM   263  C CD  . LYS A 1 30 ? 33.711 35.393 22.880 1.00 63.59  ? 30  LYS A CD  1 
ATOM   264  C CE  . LYS A 1 30 ? 33.779 36.078 21.496 1.00 67.23  ? 30  LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 30 ? 33.241 37.428 21.495 1.00 68.81  ? 30  LYS A NZ  1 
ATOM   266  N N   . GLN A 1 31 ? 28.797 33.180 21.276 1.00 41.17  ? 31  GLN A N   1 
ATOM   267  C CA  . GLN A 1 31 ? 27.828 32.942 20.209 1.00 41.28  ? 31  GLN A CA  1 
ATOM   268  C C   . GLN A 1 31 ? 26.344 32.774 20.641 1.00 38.63  ? 31  GLN A C   1 
ATOM   269  O O   . GLN A 1 31 ? 25.460 32.594 19.785 1.00 35.62  ? 31  GLN A O   1 
ATOM   270  C CB  . GLN A 1 31 ? 28.245 31.683 19.428 1.00 47.40  ? 31  GLN A CB  1 
ATOM   271  C CG  . GLN A 1 31 ? 29.659 31.563 18.802 1.00 52.52  ? 31  GLN A CG  1 
ATOM   272  C CD  . GLN A 1 31 ? 29.759 30.310 17.928 1.00 57.83  ? 31  GLN A CD  1 
ATOM   273  O OE1 . GLN A 1 31 ? 28.850 30.023 17.137 1.00 61.80  ? 31  GLN A OE1 1 
ATOM   274  N NE2 . GLN A 1 31 ? 30.817 29.506 18.007 1.00 60.08  ? 31  GLN A NE2 1 
ATOM   275  N N   . VAL A 1 32 ? 25.990 32.788 21.937 1.00 34.65  ? 32  VAL A N   1 
ATOM   276  C CA  . VAL A 1 32 ? 24.592 32.648 22.360 1.00 30.11  ? 32  VAL A CA  1 
ATOM   277  C C   . VAL A 1 32 ? 23.891 34.006 22.180 1.00 27.69  ? 32  VAL A C   1 
ATOM   278  O O   . VAL A 1 32 ? 24.436 35.022 22.644 1.00 25.20  ? 32  VAL A O   1 
ATOM   279  C CB  . VAL A 1 32 ? 24.536 32.179 23.851 1.00 26.88  ? 32  VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 32 ? 23.136 32.045 24.404 1.00 21.77  ? 32  VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 32 ? 25.102 30.795 23.891 1.00 25.11  ? 32  VAL A CG2 1 
ATOM   282  N N   . PRO A 1 33 ? 22.715 34.110 21.508 1.00 25.09  ? 33  PRO A N   1 
ATOM   283  C CA  . PRO A 1 33 ? 21.913 35.322 21.456 1.00 24.38  ? 33  PRO A CA  1 
ATOM   284  C C   . PRO A 1 33 ? 21.712 35.931 22.845 1.00 26.84  ? 33  PRO A C   1 
ATOM   285  O O   . PRO A 1 33 ? 21.422 35.274 23.847 1.00 27.70  ? 33  PRO A O   1 
ATOM   286  C CB  . PRO A 1 33 ? 20.626 34.898 20.840 1.00 22.12  ? 33  PRO A CB  1 
ATOM   287  C CG  . PRO A 1 33 ? 20.999 33.713 20.006 1.00 21.60  ? 33  PRO A CG  1 
ATOM   288  C CD  . PRO A 1 33 ? 22.015 33.012 20.855 1.00 21.55  ? 33  PRO A CD  1 
ATOM   289  N N   . LYS A 1 34 ? 21.845 37.237 22.898 1.00 29.92  ? 34  LYS A N   1 
ATOM   290  C CA  . LYS A 1 34 ? 21.646 37.976 24.127 1.00 31.19  ? 34  LYS A CA  1 
ATOM   291  C C   . LYS A 1 34 ? 20.204 38.497 24.314 1.00 31.86  ? 34  LYS A C   1 
ATOM   292  O O   . LYS A 1 34 ? 19.734 38.791 25.419 1.00 30.55  ? 34  LYS A O   1 
ATOM   293  C CB  . LYS A 1 34 ? 22.634 39.133 24.101 1.00 34.91  ? 34  LYS A CB  1 
ATOM   294  C CG  . LYS A 1 34 ? 24.060 38.729 23.876 1.00 37.54  ? 34  LYS A CG  1 
ATOM   295  C CD  . LYS A 1 34 ? 24.625 38.216 25.185 1.00 44.13  ? 34  LYS A CD  1 
ATOM   296  C CE  . LYS A 1 34 ? 25.870 39.037 25.513 1.00 48.62  ? 34  LYS A CE  1 
ATOM   297  N NZ  . LYS A 1 34 ? 25.590 40.472 25.572 1.00 52.67  ? 34  LYS A NZ  1 
ATOM   298  N N   . THR A 1 35 ? 19.502 38.668 23.192 1.00 31.83  ? 35  THR A N   1 
ATOM   299  C CA  . THR A 1 35 ? 18.201 39.321 23.103 1.00 29.63  ? 35  THR A CA  1 
ATOM   300  C C   . THR A 1 35 ? 17.009 38.396 23.168 1.00 28.24  ? 35  THR A C   1 
ATOM   301  O O   . THR A 1 35 ? 15.882 38.873 23.308 1.00 29.84  ? 35  THR A O   1 
ATOM   302  C CB  . THR A 1 35 ? 18.147 40.155 21.763 1.00 30.66  ? 35  THR A CB  1 
ATOM   303  O OG1 . THR A 1 35 ? 18.830 39.407 20.727 1.00 37.40  ? 35  THR A OG1 1 
ATOM   304  C CG2 . THR A 1 35 ? 18.778 41.529 21.927 1.00 31.50  ? 35  THR A CG2 1 
ATOM   305  N N   . HIS A 1 36 ? 17.202 37.090 23.051 1.00 22.91  ? 36  HIS A N   1 
ATOM   306  C CA  . HIS A 1 36 ? 16.065 36.217 22.940 1.00 24.01  ? 36  HIS A CA  1 
ATOM   307  C C   . HIS A 1 36 ? 16.587 34.846 23.246 1.00 21.68  ? 36  HIS A C   1 
ATOM   308  O O   . HIS A 1 36 ? 17.800 34.615 23.153 1.00 24.17  ? 36  HIS A O   1 
ATOM   309  C CB  . HIS A 1 36 ? 15.446 36.268 21.476 1.00 25.23  ? 36  HIS A CB  1 
ATOM   310  C CG  . HIS A 1 36 ? 16.378 35.807 20.333 1.00 27.01  ? 36  HIS A CG  1 
ATOM   311  N ND1 . HIS A 1 36 ? 17.311 36.500 19.676 1.00 25.67  ? 36  HIS A ND1 1 
ATOM   312  C CD2 . HIS A 1 36 ? 16.440 34.512 19.871 1.00 24.59  ? 36  HIS A CD2 1 
ATOM   313  C CE1 . HIS A 1 36 ? 17.924 35.675 18.875 1.00 26.64  ? 36  HIS A CE1 1 
ATOM   314  N NE2 . HIS A 1 36 ? 17.396 34.480 18.999 1.00 26.81  ? 36  HIS A NE2 1 
ATOM   315  N N   . LEU A 1 37 ? 15.662 33.941 23.534 1.00 21.36  ? 37  LEU A N   1 
ATOM   316  C CA  . LEU A 1 37 ? 15.986 32.549 23.801 1.00 22.50  ? 37  LEU A CA  1 
ATOM   317  C C   . LEU A 1 37 ? 16.226 31.814 22.491 1.00 22.30  ? 37  LEU A C   1 
ATOM   318  O O   . LEU A 1 37 ? 15.817 32.285 21.430 1.00 23.73  ? 37  LEU A O   1 
ATOM   319  C CB  . LEU A 1 37 ? 14.845 31.907 24.602 1.00 19.87  ? 37  LEU A CB  1 
ATOM   320  C CG  . LEU A 1 37 ? 14.679 32.576 25.978 1.00 20.79  ? 37  LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 37 ? 13.297 32.256 26.479 1.00 18.94  ? 37  LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 37 ? 15.787 32.156 26.934 1.00 11.79  ? 37  LEU A CD2 1 
ATOM   323  N N   . MET A 1 38 ? 16.874 30.645 22.513 1.00 21.32  ? 38  MET A N   1 
ATOM   324  C CA  . MET A 1 38 ? 17.215 29.956 21.286 1.00 18.83  ? 38  MET A CA  1 
ATOM   325  C C   . MET A 1 38 ? 16.154 28.949 20.877 1.00 19.18  ? 38  MET A C   1 
ATOM   326  O O   . MET A 1 38 ? 15.591 28.238 21.719 1.00 19.15  ? 38  MET A O   1 
ATOM   327  C CB  . MET A 1 38 ? 18.526 29.227 21.448 1.00 17.05  ? 38  MET A CB  1 
ATOM   328  C CG  . MET A 1 38 ? 19.706 30.160 21.541 1.00 15.65  ? 38  MET A CG  1 
ATOM   329  S SD  . MET A 1 38 ? 21.194 29.136 21.600 1.00 21.52  ? 38  MET A SD  1 
ATOM   330  C CE  . MET A 1 38 ? 21.281 28.431 23.216 1.00 20.07  ? 38  MET A CE  1 
ATOM   331  N N   . SER A 1 39 ? 15.915 28.854 19.571 1.00 19.51  ? 39  SER A N   1 
ATOM   332  C CA  . SER A 1 39 ? 14.984 27.888 18.989 1.00 18.45  ? 39  SER A CA  1 
ATOM   333  C C   . SER A 1 39 ? 15.705 26.570 18.950 1.00 17.00  ? 39  SER A C   1 
ATOM   334  O O   . SER A 1 39 ? 16.930 26.571 19.148 1.00 19.70  ? 39  SER A O   1 
ATOM   335  C CB  . SER A 1 39 ? 14.605 28.266 17.551 1.00 18.16  ? 39  SER A CB  1 
ATOM   336  O OG  . SER A 1 39 ? 15.757 28.317 16.722 1.00 22.63  ? 39  SER A OG  1 
ATOM   337  N N   . GLU A 1 40 ? 15.038 25.458 18.666 1.00 16.92  ? 40  GLU A N   1 
ATOM   338  C CA  . GLU A 1 40 ? 15.757 24.204 18.604 1.00 20.68  ? 40  GLU A CA  1 
ATOM   339  C C   . GLU A 1 40 ? 16.804 24.167 17.483 1.00 21.88  ? 40  GLU A C   1 
ATOM   340  O O   . GLU A 1 40 ? 17.893 23.637 17.686 1.00 20.78  ? 40  GLU A O   1 
ATOM   341  C CB  . GLU A 1 40 ? 14.767 23.066 18.448 1.00 22.90  ? 40  GLU A CB  1 
ATOM   342  C CG  . GLU A 1 40 ? 15.408 21.695 18.528 1.00 31.36  ? 40  GLU A CG  1 
ATOM   343  C CD  . GLU A 1 40 ? 14.396 20.570 18.564 1.00 39.01  ? 40  GLU A CD  1 
ATOM   344  O OE1 . GLU A 1 40 ? 14.012 20.131 17.481 1.00 45.44  ? 40  GLU A OE1 1 
ATOM   345  O OE2 . GLU A 1 40 ? 14.003 20.127 19.651 1.00 43.13  ? 40  GLU A OE2 1 
ATOM   346  N N   . GLU A 1 41 ? 16.593 24.747 16.311 1.00 24.96  ? 41  GLU A N   1 
ATOM   347  C CA  . GLU A 1 41 ? 17.633 24.756 15.289 1.00 25.32  ? 41  GLU A CA  1 
ATOM   348  C C   . GLU A 1 41 ? 18.813 25.616 15.757 1.00 24.11  ? 41  GLU A C   1 
ATOM   349  O O   . GLU A 1 41 ? 19.950 25.233 15.503 1.00 25.73  ? 41  GLU A O   1 
ATOM   350  C CB  . GLU A 1 41 ? 17.084 25.313 13.974 1.00 26.38  ? 41  GLU A CB  1 
ATOM   351  C CG  . GLU A 1 41 ? 18.078 25.075 12.831 1.00 35.56  ? 41  GLU A CG  1 
ATOM   352  C CD  . GLU A 1 41 ? 17.680 25.705 11.496 1.00 39.66  ? 41  GLU A CD  1 
ATOM   353  O OE1 . GLU A 1 41 ? 16.688 25.263 10.905 1.00 40.33  ? 41  GLU A OE1 1 
ATOM   354  O OE2 . GLU A 1 41 ? 18.368 26.634 11.050 1.00 43.35  ? 41  GLU A OE2 1 
ATOM   355  N N   . GLU A 1 42 ? 18.625 26.739 16.458 1.00 24.20  ? 42  GLU A N   1 
ATOM   356  C CA  . GLU A 1 42 ? 19.705 27.571 16.975 1.00 23.03  ? 42  GLU A CA  1 
ATOM   357  C C   . GLU A 1 42 ? 20.638 26.870 17.953 1.00 22.86  ? 42  GLU A C   1 
ATOM   358  O O   . GLU A 1 42 ? 21.862 26.967 17.798 1.00 22.76  ? 42  GLU A O   1 
ATOM   359  C CB  . GLU A 1 42 ? 19.159 28.779 17.681 1.00 21.47  ? 42  GLU A CB  1 
ATOM   360  C CG  . GLU A 1 42 ? 18.839 29.917 16.770 1.00 26.80  ? 42  GLU A CG  1 
ATOM   361  C CD  . GLU A 1 42 ? 18.265 31.157 17.455 1.00 29.15  ? 42  GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 42 ? 17.191 31.078 18.051 1.00 32.99  ? 42  GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 42 ? 18.876 32.222 17.374 1.00 33.15  ? 42  GLU A OE2 1 
ATOM   364  N N   . TRP A 1 43 ? 20.110 26.157 18.965 1.00 20.87  ? 43  TRP A N   1 
ATOM   365  C CA  . TRP A 1 43 ? 20.995 25.467 19.870 1.00 18.84  ? 43  TRP A CA  1 
ATOM   366  C C   . TRP A 1 43 ? 21.492 24.204 19.176 1.00 19.39  ? 43  TRP A C   1 
ATOM   367  O O   . TRP A 1 43 ? 22.619 23.819 19.491 1.00 18.92  ? 43  TRP A O   1 
ATOM   368  C CB  . TRP A 1 43 ? 20.294 25.160 21.268 1.00 17.00  ? 43  TRP A CB  1 
ATOM   369  C CG  . TRP A 1 43 ? 18.993 24.358 21.419 1.00 15.47  ? 43  TRP A CG  1 
ATOM   370  C CD1 . TRP A 1 43 ? 17.796 24.987 21.739 1.00 13.32  ? 43  TRP A CD1 1 
ATOM   371  C CD2 . TRP A 1 43 ? 18.857 22.983 21.326 1.00 12.30  ? 43  TRP A CD2 1 
ATOM   372  N NE1 . TRP A 1 43 ? 16.911 24.011 21.854 1.00 8.73   ? 43  TRP A NE1 1 
ATOM   373  C CE2 . TRP A 1 43 ? 17.487 22.804 21.614 1.00 11.81  ? 43  TRP A CE2 1 
ATOM   374  C CE3 . TRP A 1 43 ? 19.676 21.883 21.050 1.00 11.41  ? 43  TRP A CE3 1 
ATOM   375  C CZ2 . TRP A 1 43 ? 16.940 21.512 21.621 1.00 13.97  ? 43  TRP A CZ2 1 
ATOM   376  C CZ3 . TRP A 1 43 ? 19.124 20.601 21.063 1.00 13.08  ? 43  TRP A CZ3 1 
ATOM   377  C CH2 . TRP A 1 43 ? 17.760 20.412 21.347 1.00 15.57  ? 43  TRP A CH2 1 
ATOM   378  N N   . ARG A 1 44 ? 20.830 23.514 18.226 1.00 20.03  ? 44  ARG A N   1 
ATOM   379  C CA  . ARG A 1 44 ? 21.473 22.408 17.496 1.00 21.80  ? 44  ARG A CA  1 
ATOM   380  C C   . ARG A 1 44 ? 22.644 22.883 16.604 1.00 21.35  ? 44  ARG A C   1 
ATOM   381  O O   . ARG A 1 44 ? 23.658 22.185 16.508 1.00 21.31  ? 44  ARG A O   1 
ATOM   382  C CB  . ARG A 1 44 ? 20.477 21.673 16.624 1.00 18.95  ? 44  ARG A CB  1 
ATOM   383  C CG  . ARG A 1 44 ? 19.517 20.940 17.506 1.00 23.70  ? 44  ARG A CG  1 
ATOM   384  C CD  . ARG A 1 44 ? 18.634 20.112 16.643 1.00 27.80  ? 44  ARG A CD  1 
ATOM   385  N NE  . ARG A 1 44 ? 19.346 18.935 16.161 1.00 32.50  ? 44  ARG A NE  1 
ATOM   386  C CZ  . ARG A 1 44 ? 18.753 17.994 15.395 1.00 31.81  ? 44  ARG A CZ  1 
ATOM   387  N NH1 . ARG A 1 44 ? 17.467 18.079 15.004 1.00 30.99  ? 44  ARG A NH1 1 
ATOM   388  N NH2 . ARG A 1 44 ? 19.444 16.883 15.093 1.00 33.24  ? 44  ARG A NH2 1 
ATOM   389  N N   . ARG A 1 45 ? 22.593 24.085 16.011 1.00 20.52  ? 45  ARG A N   1 
ATOM   390  C CA  . ARG A 1 45 ? 23.670 24.632 15.207 1.00 19.19  ? 45  ARG A CA  1 
ATOM   391  C C   . ARG A 1 45 ? 24.839 24.982 16.088 1.00 23.30  ? 45  ARG A C   1 
ATOM   392  O O   . ARG A 1 45 ? 25.955 25.076 15.584 1.00 22.32  ? 45  ARG A O   1 
ATOM   393  C CB  . ARG A 1 45 ? 23.297 25.908 14.516 1.00 17.29  ? 45  ARG A CB  1 
ATOM   394  C CG  . ARG A 1 45 ? 22.497 25.689 13.277 1.00 12.01  ? 45  ARG A CG  1 
ATOM   395  C CD  . ARG A 1 45 ? 22.307 27.074 12.704 1.00 14.10  ? 45  ARG A CD  1 
ATOM   396  N NE  . ARG A 1 45 ? 21.535 26.998 11.450 1.00 20.19  ? 45  ARG A NE  1 
ATOM   397  C CZ  . ARG A 1 45 ? 22.134 27.106 10.238 1.00 20.00  ? 45  ARG A CZ  1 
ATOM   398  N NH1 . ARG A 1 45 ? 23.476 27.290 10.124 1.00 16.04  ? 45  ARG A NH1 1 
ATOM   399  N NH2 . ARG A 1 45 ? 21.375 27.025 9.139  1.00 16.30  ? 45  ARG A NH2 1 
ATOM   400  N N   . LEU A 1 46 ? 24.634 25.224 17.396 1.00 23.77  ? 46  LEU A N   1 
ATOM   401  C CA  . LEU A 1 46 ? 25.694 25.588 18.332 1.00 22.01  ? 46  LEU A CA  1 
ATOM   402  C C   . LEU A 1 46 ? 26.544 24.389 18.755 1.00 20.38  ? 46  LEU A C   1 
ATOM   403  O O   . LEU A 1 46 ? 27.641 24.543 19.262 1.00 22.27  ? 46  LEU A O   1 
ATOM   404  C CB  . LEU A 1 46 ? 25.070 26.185 19.562 1.00 25.63  ? 46  LEU A CB  1 
ATOM   405  C CG  . LEU A 1 46 ? 25.366 27.553 20.143 1.00 29.02  ? 46  LEU A CG  1 
ATOM   406  C CD1 . LEU A 1 46 ? 25.094 27.382 21.637 1.00 32.49  ? 46  LEU A CD1 1 
ATOM   407  C CD2 . LEU A 1 46 ? 26.795 28.031 19.962 1.00 29.70  ? 46  LEU A CD2 1 
ATOM   408  N N   . GLY A 1 47 ? 26.025 23.183 18.618 1.00 21.03  ? 47  GLY A N   1 
ATOM   409  C CA  . GLY A 1 47 ? 26.717 22.009 19.049 1.00 22.72  ? 47  GLY A CA  1 
ATOM   410  C C   . GLY A 1 47 ? 26.058 21.391 20.281 1.00 23.28  ? 47  GLY A C   1 
ATOM   411  O O   . GLY A 1 47 ? 26.665 20.455 20.796 1.00 25.37  ? 47  GLY A O   1 
ATOM   412  N N   . VAL A 1 48 ? 24.868 21.773 20.795 1.00 24.06  ? 48  VAL A N   1 
ATOM   413  C CA  . VAL A 1 48 ? 24.276 21.154 21.987 1.00 20.79  ? 48  VAL A CA  1 
ATOM   414  C C   . VAL A 1 48 ? 23.615 19.866 21.533 1.00 23.19  ? 48  VAL A C   1 
ATOM   415  O O   . VAL A 1 48 ? 22.691 19.903 20.731 1.00 25.79  ? 48  VAL A O   1 
ATOM   416  C CB  . VAL A 1 48 ? 23.209 22.090 22.666 1.00 19.04  ? 48  VAL A CB  1 
ATOM   417  C CG1 . VAL A 1 48 ? 22.684 21.404 23.924 1.00 16.52  ? 48  VAL A CG1 1 
ATOM   418  C CG2 . VAL A 1 48 ? 23.823 23.425 23.118 1.00 16.11  ? 48  VAL A CG2 1 
ATOM   419  N N   . GLN A 1 49 ? 24.015 18.702 22.019 1.00 25.79  ? 49  GLN A N   1 
ATOM   420  C CA  . GLN A 1 49 ? 23.516 17.441 21.536 1.00 29.89  ? 49  GLN A CA  1 
ATOM   421  C C   . GLN A 1 49 ? 22.756 16.743 22.617 1.00 28.60  ? 49  GLN A C   1 
ATOM   422  O O   . GLN A 1 49 ? 23.302 15.937 23.383 1.00 31.93  ? 49  GLN A O   1 
ATOM   423  C CB  . GLN A 1 49 ? 24.660 16.516 21.073 1.00 36.70  ? 49  GLN A CB  1 
ATOM   424  C CG  . GLN A 1 49 ? 25.343 16.751 19.708 1.00 47.66  ? 49  GLN A CG  1 
ATOM   425  C CD  . GLN A 1 49 ? 24.566 16.376 18.422 1.00 56.03  ? 49  GLN A CD  1 
ATOM   426  O OE1 . GLN A 1 49 ? 23.836 15.365 18.314 1.00 55.92  ? 49  GLN A OE1 1 
ATOM   427  N NE2 . GLN A 1 49 ? 24.754 17.176 17.369 1.00 61.24  ? 49  GLN A NE2 1 
ATOM   428  N N   . GLN A 1 50 ? 21.464 17.031 22.567 1.00 26.73  ? 50  GLN A N   1 
ATOM   429  C CA  . GLN A 1 50 ? 20.463 16.502 23.486 1.00 23.91  ? 50  GLN A CA  1 
ATOM   430  C C   . GLN A 1 50 ? 19.202 16.211 22.697 1.00 22.62  ? 50  GLN A C   1 
ATOM   431  O O   . GLN A 1 50 ? 19.069 16.722 21.579 1.00 22.33  ? 50  GLN A O   1 
ATOM   432  C CB  . GLN A 1 50 ? 20.157 17.522 24.589 1.00 20.88  ? 50  GLN A CB  1 
ATOM   433  C CG  . GLN A 1 50 ? 19.468 18.794 24.161 1.00 18.23  ? 50  GLN A CG  1 
ATOM   434  C CD  . GLN A 1 50 ? 19.483 19.867 25.215 1.00 18.59  ? 50  GLN A CD  1 
ATOM   435  O OE1 . GLN A 1 50 ? 19.871 19.676 26.363 1.00 23.26  ? 50  GLN A OE1 1 
ATOM   436  N NE2 . GLN A 1 50 ? 19.099 21.063 24.841 1.00 18.34  ? 50  GLN A NE2 1 
ATOM   437  N N   . SER A 1 51 ? 18.304 15.405 23.260 1.00 22.30  ? 51  SER A N   1 
ATOM   438  C CA  . SER A 1 51 ? 17.045 15.025 22.625 1.00 21.22  ? 51  SER A CA  1 
ATOM   439  C C   . SER A 1 51 ? 16.167 16.159 22.172 1.00 19.06  ? 51  SER A C   1 
ATOM   440  O O   . SER A 1 51 ? 16.269 17.323 22.576 1.00 23.64  ? 51  SER A O   1 
ATOM   441  C CB  . SER A 1 51 ? 16.252 14.144 23.575 1.00 24.53  ? 51  SER A CB  1 
ATOM   442  O OG  . SER A 1 51 ? 17.017 12.975 23.872 1.00 31.04  ? 51  SER A OG  1 
ATOM   443  N N   . LEU A 1 52 ? 15.273 15.856 21.270 1.00 19.96  ? 52  LEU A N   1 
ATOM   444  C CA  . LEU A 1 52 ? 14.429 16.921 20.771 1.00 21.14  ? 52  LEU A CA  1 
ATOM   445  C C   . LEU A 1 52 ? 13.377 17.168 21.839 1.00 18.92  ? 52  LEU A C   1 
ATOM   446  O O   . LEU A 1 52 ? 13.159 16.307 22.692 1.00 15.99  ? 52  LEU A O   1 
ATOM   447  C CB  . LEU A 1 52 ? 13.799 16.480 19.454 1.00 25.81  ? 52  LEU A CB  1 
ATOM   448  C CG  . LEU A 1 52 ? 14.783 16.023 18.366 1.00 28.14  ? 52  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 52 ? 14.026 15.216 17.348 1.00 29.45  ? 52  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 52 ? 15.520 17.219 17.792 1.00 26.54  ? 52  LEU A CD2 1 
ATOM   451  N N   . GLY A 1 53 ? 12.742 18.336 21.844 1.00 17.19  ? 53  GLY A N   1 
ATOM   452  C CA  . GLY A 1 53 ? 11.733 18.576 22.849 1.00 18.12  ? 53  GLY A CA  1 
ATOM   453  C C   . GLY A 1 53 ? 12.266 19.485 23.920 1.00 16.26  ? 53  GLY A C   1 
ATOM   454  O O   . GLY A 1 53 ? 11.460 20.196 24.497 1.00 17.49  ? 53  GLY A O   1 
ATOM   455  N N   . TRP A 1 54 ? 13.582 19.521 24.192 1.00 16.68  ? 54  TRP A N   1 
ATOM   456  C CA  . TRP A 1 54 ? 14.153 20.387 25.202 1.00 17.06  ? 54  TRP A CA  1 
ATOM   457  C C   . TRP A 1 54 ? 14.005 21.818 24.779 1.00 18.20  ? 54  TRP A C   1 
ATOM   458  O O   . TRP A 1 54 ? 14.297 22.089 23.617 1.00 20.49  ? 54  TRP A O   1 
ATOM   459  C CB  . TRP A 1 54 ? 15.615 20.068 25.396 1.00 16.14  ? 54  TRP A CB  1 
ATOM   460  C CG  . TRP A 1 54 ? 15.842 18.852 26.290 1.00 14.92  ? 54  TRP A CG  1 
ATOM   461  C CD1 . TRP A 1 54 ? 16.351 17.688 25.790 1.00 14.08  ? 54  TRP A CD1 1 
ATOM   462  C CD2 . TRP A 1 54 ? 15.642 18.807 27.650 1.00 14.87  ? 54  TRP A CD2 1 
ATOM   463  N NE1 . TRP A 1 54 ? 16.498 16.905 26.830 1.00 18.66  ? 54  TRP A NE1 1 
ATOM   464  C CE2 . TRP A 1 54 ? 16.083 17.530 27.961 1.00 15.44  ? 54  TRP A CE2 1 
ATOM   465  C CE3 . TRP A 1 54 ? 15.164 19.657 28.641 1.00 14.32  ? 54  TRP A CE3 1 
ATOM   466  C CZ2 . TRP A 1 54 ? 16.056 17.064 29.279 1.00 16.07  ? 54  TRP A CZ2 1 
ATOM   467  C CZ3 . TRP A 1 54 ? 15.135 19.193 29.949 1.00 11.12  ? 54  TRP A CZ3 1 
ATOM   468  C CH2 . TRP A 1 54 ? 15.579 17.909 30.264 1.00 12.73  ? 54  TRP A CH2 1 
ATOM   469  N N   . VAL A 1 55 ? 13.526 22.725 25.627 1.00 14.37  ? 55  VAL A N   1 
ATOM   470  C CA  . VAL A 1 55 ? 13.311 24.097 25.256 1.00 11.80  ? 55  VAL A CA  1 
ATOM   471  C C   . VAL A 1 55 ? 14.275 24.983 26.027 1.00 12.70  ? 55  VAL A C   1 
ATOM   472  O O   . VAL A 1 55 ? 14.377 24.866 27.248 1.00 17.18  ? 55  VAL A O   1 
ATOM   473  C CB  . VAL A 1 55 ? 11.848 24.430 25.572 1.00 14.68  ? 55  VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 55 ? 11.577 25.886 25.328 1.00 14.60  ? 55  VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 55 ? 10.922 23.583 24.725 1.00 14.88  ? 55  VAL A CG2 1 
ATOM   476  N N   . HIS A 1 56 ? 14.996 25.902 25.385 1.00 13.45  ? 56  HIS A N   1 
ATOM   477  C CA  . HIS A 1 56 ? 15.833 26.889 26.049 1.00 13.69  ? 56  HIS A CA  1 
ATOM   478  C C   . HIS A 1 56 ? 14.848 27.846 26.732 1.00 14.18  ? 56  HIS A C   1 
ATOM   479  O O   . HIS A 1 56 ? 14.283 28.692 26.031 1.00 14.95  ? 56  HIS A O   1 
ATOM   480  C CB  . HIS A 1 56 ? 16.731 27.623 24.985 1.00 11.35  ? 56  HIS A CB  1 
ATOM   481  C CG  . HIS A 1 56 ? 17.677 28.677 25.560 1.00 9.74   ? 56  HIS A CG  1 
ATOM   482  N ND1 . HIS A 1 56 ? 18.096 29.855 25.061 1.00 11.95  ? 56  HIS A ND1 1 
ATOM   483  C CD2 . HIS A 1 56 ? 18.218 28.573 26.815 1.00 11.47  ? 56  HIS A CD2 1 
ATOM   484  C CE1 . HIS A 1 56 ? 18.833 30.463 25.963 1.00 9.98   ? 56  HIS A CE1 1 
ATOM   485  N NE2 . HIS A 1 56 ? 18.895 29.676 27.010 1.00 13.74  ? 56  HIS A NE2 1 
ATOM   486  N N   . TYR A 1 57 ? 14.599 27.792 28.047 1.00 14.02  ? 57  TYR A N   1 
ATOM   487  C CA  . TYR A 1 57 ? 13.564 28.651 28.600 1.00 15.70  ? 57  TYR A CA  1 
ATOM   488  C C   . TYR A 1 57 ? 13.985 29.828 29.421 1.00 15.31  ? 57  TYR A C   1 
ATOM   489  O O   . TYR A 1 57 ? 13.178 30.722 29.670 1.00 14.25  ? 57  TYR A O   1 
ATOM   490  C CB  . TYR A 1 57 ? 12.539 27.838 29.451 1.00 20.20  ? 57  TYR A CB  1 
ATOM   491  C CG  . TYR A 1 57 ? 13.011 27.428 30.819 1.00 21.30  ? 57  TYR A CG  1 
ATOM   492  C CD1 . TYR A 1 57 ? 14.009 26.467 30.872 1.00 24.21  ? 57  TYR A CD1 1 
ATOM   493  C CD2 . TYR A 1 57 ? 12.540 28.045 31.990 1.00 17.76  ? 57  TYR A CD2 1 
ATOM   494  C CE1 . TYR A 1 57 ? 14.591 26.098 32.085 1.00 25.74  ? 57  TYR A CE1 1 
ATOM   495  C CE2 . TYR A 1 57 ? 13.127 27.672 33.215 1.00 26.11  ? 57  TYR A CE2 1 
ATOM   496  C CZ  . TYR A 1 57 ? 14.158 26.705 33.250 1.00 25.79  ? 57  TYR A CZ  1 
ATOM   497  O OH  . TYR A 1 57 ? 14.834 26.358 34.402 1.00 29.40  ? 57  TYR A OH  1 
ATOM   498  N N   . MET A 1 58 ? 15.248 29.902 29.788 1.00 16.94  ? 58  MET A N   1 
ATOM   499  C CA  . MET A 1 58 ? 15.674 30.983 30.647 1.00 22.30  ? 58  MET A CA  1 
ATOM   500  C C   . MET A 1 58 ? 17.115 31.307 30.426 1.00 23.46  ? 58  MET A C   1 
ATOM   501  O O   . MET A 1 58 ? 17.898 30.399 30.140 1.00 22.89  ? 58  MET A O   1 
ATOM   502  C CB  . MET A 1 58 ? 15.531 30.624 32.134 1.00 23.43  ? 58  MET A CB  1 
ATOM   503  C CG  . MET A 1 58 ? 15.653 31.804 33.103 1.00 29.43  ? 58  MET A CG  1 
ATOM   504  S SD  . MET A 1 58 ? 15.447 31.200 34.792 1.00 35.30  ? 58  MET A SD  1 
ATOM   505  C CE  . MET A 1 58 ? 13.700 31.380 35.000 1.00 29.84  ? 58  MET A CE  1 
ATOM   506  N N   . ILE A 1 59 ? 17.420 32.592 30.556 1.00 28.27  ? 59  ILE A N   1 
ATOM   507  C CA  . ILE A 1 59 ? 18.782 33.118 30.613 1.00 32.72  ? 59  ILE A CA  1 
ATOM   508  C C   . ILE A 1 59 ? 19.256 32.938 32.078 1.00 34.11  ? 59  ILE A C   1 
ATOM   509  O O   . ILE A 1 59 ? 18.556 33.334 33.021 1.00 30.02  ? 59  ILE A O   1 
ATOM   510  C CB  . ILE A 1 59 ? 18.708 34.601 30.197 1.00 33.43  ? 59  ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 59 ? 18.379 34.719 28.701 1.00 34.50  ? 59  ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 59 ? 20.001 35.288 30.584 1.00 34.76  ? 59  ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 59 ? 19.317 34.077 27.662 1.00 32.98  ? 59  ILE A CD1 1 
ATOM   514  N N   . HIS A 1 60 ? 20.421 32.335 32.333 1.00 38.99  ? 60  HIS A N   1 
ATOM   515  C CA  . HIS A 1 60 ? 20.916 32.151 33.691 1.00 43.89  ? 60  HIS A CA  1 
ATOM   516  C C   . HIS A 1 60 ? 21.278 33.476 34.356 1.00 45.76  ? 60  HIS A C   1 
ATOM   517  O O   . HIS A 1 60 ? 21.736 34.417 33.703 1.00 44.33  ? 60  HIS A O   1 
ATOM   518  C CB  . HIS A 1 60 ? 22.140 31.257 33.680 1.00 45.44  ? 60  HIS A CB  1 
ATOM   519  C CG  . HIS A 1 60 ? 22.516 30.743 35.070 1.00 53.23  ? 60  HIS A CG  1 
ATOM   520  N ND1 . HIS A 1 60 ? 23.643 30.950 35.756 1.00 58.08  ? 60  HIS A ND1 1 
ATOM   521  C CD2 . HIS A 1 60 ? 21.728 29.929 35.856 1.00 55.82  ? 60  HIS A CD2 1 
ATOM   522  C CE1 . HIS A 1 60 ? 23.575 30.307 36.898 1.00 58.84  ? 60  HIS A CE1 1 
ATOM   523  N NE2 . HIS A 1 60 ? 22.415 29.694 36.944 1.00 58.37  ? 60  HIS A NE2 1 
ATOM   524  N N   . GLU A 1 61 ? 20.966 33.538 35.661 1.00 50.54  ? 61  GLU A N   1 
ATOM   525  C CA  . GLU A 1 61 ? 21.311 34.637 36.566 1.00 55.12  ? 61  GLU A CA  1 
ATOM   526  C C   . GLU A 1 61 ? 22.756 35.059 36.276 1.00 57.44  ? 61  GLU A C   1 
ATOM   527  O O   . GLU A 1 61 ? 23.627 34.168 36.305 1.00 58.62  ? 61  GLU A O   1 
ATOM   528  C CB  . GLU A 1 61 ? 21.119 34.102 38.008 1.00 57.13  ? 61  GLU A CB  1 
ATOM   529  C CG  . GLU A 1 61 ? 21.287 35.077 39.183 1.00 63.01  ? 61  GLU A CG  1 
ATOM   530  C CD  . GLU A 1 61 ? 22.677 35.326 39.809 1.00 67.63  ? 61  GLU A CD  1 
ATOM   531  O OE1 . GLU A 1 61 ? 23.317 34.362 40.255 1.00 69.56  ? 61  GLU A OE1 1 
ATOM   532  O OE2 . GLU A 1 61 ? 23.103 36.489 39.892 1.00 66.61  ? 61  GLU A OE2 1 
ATOM   533  N N   . PRO A 1 62 ? 23.108 36.302 35.908 1.00 59.42  ? 62  PRO A N   1 
ATOM   534  C CA  . PRO A 1 62 ? 24.496 36.693 35.657 1.00 60.83  ? 62  PRO A CA  1 
ATOM   535  C C   . PRO A 1 62 ? 25.168 36.946 37.014 1.00 62.59  ? 62  PRO A C   1 
ATOM   536  O O   . PRO A 1 62 ? 24.768 37.892 37.734 1.00 64.46  ? 62  PRO A O   1 
ATOM   537  C CB  . PRO A 1 62 ? 24.384 37.931 34.769 1.00 60.68  ? 62  PRO A CB  1 
ATOM   538  C CG  . PRO A 1 62 ? 22.927 37.967 34.345 1.00 59.94  ? 62  PRO A CG  1 
ATOM   539  C CD  . PRO A 1 62 ? 22.209 37.398 35.565 1.00 58.95  ? 62  PRO A CD  1 
ATOM   540  N N   . GLU A 1 63 ? 26.158 36.112 37.408 1.00 62.36  ? 63  GLU A N   1 
ATOM   541  C CA  . GLU A 1 63 ? 26.838 36.311 38.695 1.00 61.27  ? 63  GLU A CA  1 
ATOM   542  C C   . GLU A 1 63 ? 27.709 37.564 38.562 1.00 57.13  ? 63  GLU A C   1 
ATOM   543  O O   . GLU A 1 63 ? 28.301 37.816 37.492 1.00 57.52  ? 63  GLU A O   1 
ATOM   544  C CB  . GLU A 1 63 ? 27.770 35.131 39.112 1.00 64.97  ? 63  GLU A CB  1 
ATOM   545  C CG  . GLU A 1 63 ? 27.788 35.003 40.672 1.00 70.53  ? 63  GLU A CG  1 
ATOM   546  C CD  . GLU A 1 63 ? 29.043 34.517 41.435 1.00 72.84  ? 63  GLU A CD  1 
ATOM   547  O OE1 . GLU A 1 63 ? 30.113 34.366 40.835 1.00 76.96  ? 63  GLU A OE1 1 
ATOM   548  O OE2 . GLU A 1 63 ? 28.955 34.315 42.655 1.00 70.99  ? 63  GLU A OE2 1 
ATOM   549  N N   . PRO A 1 64 ? 27.707 38.445 39.573 1.00 52.84  ? 64  PRO A N   1 
ATOM   550  C CA  . PRO A 1 64 ? 28.618 39.568 39.638 1.00 48.60  ? 64  PRO A CA  1 
ATOM   551  C C   . PRO A 1 64 ? 30.081 39.256 39.457 1.00 44.02  ? 64  PRO A C   1 
ATOM   552  O O   . PRO A 1 64 ? 30.612 38.139 39.459 1.00 40.78  ? 64  PRO A O   1 
ATOM   553  C CB  . PRO A 1 64 ? 28.318 40.227 40.967 1.00 50.77  ? 64  PRO A CB  1 
ATOM   554  C CG  . PRO A 1 64 ? 27.303 39.333 41.659 1.00 53.57  ? 64  PRO A CG  1 
ATOM   555  C CD  . PRO A 1 64 ? 26.581 38.701 40.474 1.00 53.57  ? 64  PRO A CD  1 
ATOM   556  N N   . HIS A 1 65 ? 30.735 40.366 39.224 1.00 41.17  ? 65  HIS A N   1 
ATOM   557  C CA  . HIS A 1 65 ? 32.154 40.332 38.984 1.00 40.45  ? 65  HIS A CA  1 
ATOM   558  C C   . HIS A 1 65 ? 32.735 40.672 40.347 1.00 31.98  ? 65  HIS A C   1 
ATOM   559  O O   . HIS A 1 65 ? 32.550 41.797 40.791 1.00 26.95  ? 65  HIS A O   1 
ATOM   560  C CB  . HIS A 1 65 ? 32.411 41.359 37.900 1.00 49.60  ? 65  HIS A CB  1 
ATOM   561  C CG  . HIS A 1 65 ? 31.664 40.976 36.617 1.00 59.71  ? 65  HIS A CG  1 
ATOM   562  N ND1 . HIS A 1 65 ? 32.180 40.440 35.508 1.00 63.20  ? 65  HIS A ND1 1 
ATOM   563  C CD2 . HIS A 1 65 ? 30.293 41.084 36.434 1.00 62.46  ? 65  HIS A CD2 1 
ATOM   564  C CE1 . HIS A 1 65 ? 31.179 40.212 34.685 1.00 64.16  ? 65  HIS A CE1 1 
ATOM   565  N NE2 . HIS A 1 65 ? 30.053 40.598 35.246 1.00 64.17  ? 65  HIS A NE2 1 
ATOM   566  N N   . ILE A 1 66 ? 33.310 39.675 41.020 1.00 27.96  ? 66  ILE A N   1 
ATOM   567  C CA  . ILE A 1 66 ? 33.835 39.769 42.383 1.00 24.50  ? 66  ILE A CA  1 
ATOM   568  C C   . ILE A 1 66 ? 35.355 39.941 42.494 1.00 23.69  ? 66  ILE A C   1 
ATOM   569  O O   . ILE A 1 66 ? 36.099 39.107 41.963 1.00 20.73  ? 66  ILE A O   1 
ATOM   570  C CB  . ILE A 1 66 ? 33.417 38.497 43.154 1.00 25.30  ? 66  ILE A CB  1 
ATOM   571  C CG1 . ILE A 1 66 ? 31.902 38.372 43.095 1.00 26.69  ? 66  ILE A CG1 1 
ATOM   572  C CG2 . ILE A 1 66 ? 33.960 38.531 44.593 1.00 22.61  ? 66  ILE A CG2 1 
ATOM   573  C CD1 . ILE A 1 66 ? 31.384 37.077 43.709 1.00 29.78  ? 66  ILE A CD1 1 
ATOM   574  N N   . LEU A 1 67 ? 35.821 40.970 43.227 1.00 22.70  ? 67  LEU A N   1 
ATOM   575  C CA  . LEU A 1 67 ? 37.226 41.212 43.554 1.00 17.97  ? 67  LEU A CA  1 
ATOM   576  C C   . LEU A 1 67 ? 37.367 40.758 44.995 1.00 17.78  ? 67  LEU A C   1 
ATOM   577  O O   . LEU A 1 67 ? 36.514 41.052 45.860 1.00 19.39  ? 67  LEU A O   1 
ATOM   578  C CB  . LEU A 1 67 ? 37.599 42.679 43.494 1.00 13.40  ? 67  LEU A CB  1 
ATOM   579  C CG  . LEU A 1 67 ? 37.532 43.369 42.153 1.00 14.11  ? 67  LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 67 ? 37.876 44.816 42.336 1.00 16.49  ? 67  LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 67 ? 38.493 42.753 41.167 1.00 10.76  ? 67  LEU A CD2 1 
ATOM   582  N N   . LEU A 1 68 ? 38.421 39.972 45.173 1.00 15.94  ? 68  LEU A N   1 
ATOM   583  C CA  . LEU A 1 68 ? 38.828 39.360 46.421 1.00 13.42  ? 68  LEU A CA  1 
ATOM   584  C C   . LEU A 1 68 ? 39.969 40.123 47.105 1.00 14.88  ? 68  LEU A C   1 
ATOM   585  O O   . LEU A 1 68 ? 41.056 40.286 46.519 1.00 12.98  ? 68  LEU A O   1 
ATOM   586  C CB  . LEU A 1 68 ? 39.231 37.943 46.090 1.00 12.57  ? 68  LEU A CB  1 
ATOM   587  C CG  . LEU A 1 68 ? 38.162 37.077 45.497 1.00 17.33  ? 68  LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 68 ? 38.663 35.690 45.311 1.00 14.12  ? 68  LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 68 ? 37.042 36.899 46.495 1.00 18.22  ? 68  LEU A CD2 1 
ATOM   590  N N   . PHE A 1 69 ? 39.763 40.628 48.334 1.00 13.12  ? 69  PHE A N   1 
ATOM   591  C CA  . PHE A 1 69 ? 40.761 41.372 49.080 1.00 10.85  ? 69  PHE A CA  1 
ATOM   592  C C   . PHE A 1 69 ? 41.034 40.740 50.421 1.00 14.27  ? 69  PHE A C   1 
ATOM   593  O O   . PHE A 1 69 ? 40.132 40.136 51.001 1.00 15.46  ? 69  PHE A O   1 
ATOM   594  C CB  . PHE A 1 69 ? 40.313 42.772 49.345 1.00 9.94   ? 69  PHE A CB  1 
ATOM   595  C CG  . PHE A 1 69 ? 40.183 43.568 48.079 1.00 9.24   ? 69  PHE A CG  1 
ATOM   596  C CD1 . PHE A 1 69 ? 41.285 44.275 47.604 1.00 10.95  ? 69  PHE A CD1 1 
ATOM   597  C CD2 . PHE A 1 69 ? 38.974 43.617 47.387 1.00 12.90  ? 69  PHE A CD2 1 
ATOM   598  C CE1 . PHE A 1 69 ? 41.183 45.034 46.440 1.00 9.88   ? 69  PHE A CE1 1 
ATOM   599  C CE2 . PHE A 1 69 ? 38.882 44.386 46.220 1.00 12.34  ? 69  PHE A CE2 1 
ATOM   600  C CZ  . PHE A 1 69 ? 39.982 45.097 45.739 1.00 14.72  ? 69  PHE A CZ  1 
ATOM   601  N N   . ARG A 1 70 ? 42.258 40.803 50.946 1.00 15.62  ? 70  ARG A N   1 
ATOM   602  C CA  . ARG A 1 70 ? 42.521 40.328 52.288 1.00 13.66  ? 70  ARG A CA  1 
ATOM   603  C C   . ARG A 1 70 ? 43.495 41.322 52.875 1.00 15.40  ? 70  ARG A C   1 
ATOM   604  O O   . ARG A 1 70 ? 44.144 42.072 52.134 1.00 13.51  ? 70  ARG A O   1 
ATOM   605  C CB  . ARG A 1 70 ? 43.114 38.918 52.306 1.00 12.98  ? 70  ARG A CB  1 
ATOM   606  C CG  . ARG A 1 70 ? 44.437 38.772 51.674 1.00 18.13  ? 70  ARG A CG  1 
ATOM   607  C CD  . ARG A 1 70 ? 44.914 37.371 51.889 1.00 18.33  ? 70  ARG A CD  1 
ATOM   608  N NE  . ARG A 1 70 ? 46.319 37.360 51.495 1.00 20.03  ? 70  ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 70 ? 46.999 36.245 51.226 1.00 19.25  ? 70  ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 70 ? 46.465 35.053 51.330 1.00 21.19  ? 70  ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 70 ? 48.209 36.321 50.707 1.00 24.15  ? 70  ARG A NH2 1 
ATOM   612  N N   . ARG A 1 71 ? 43.539 41.435 54.206 1.00 17.29  ? 71  ARG A N   1 
ATOM   613  C CA  . ARG A 1 71 ? 44.429 42.354 54.920 1.00 15.16  ? 71  ARG A CA  1 
ATOM   614  C C   . ARG A 1 71 ? 44.941 41.578 56.106 1.00 17.90  ? 71  ARG A C   1 
ATOM   615  O O   . ARG A 1 71 ? 44.106 40.907 56.718 1.00 19.24  ? 71  ARG A O   1 
ATOM   616  C CB  . ARG A 1 71 ? 43.670 43.528 55.395 1.00 13.81  ? 71  ARG A CB  1 
ATOM   617  C CG  . ARG A 1 71 ? 44.602 44.546 55.990 1.00 15.76  ? 71  ARG A CG  1 
ATOM   618  C CD  . ARG A 1 71 ? 43.992 45.889 55.903 1.00 17.03  ? 71  ARG A CD  1 
ATOM   619  N NE  . ARG A 1 71 ? 42.750 45.987 56.624 1.00 20.37  ? 71  ARG A NE  1 
ATOM   620  C CZ  . ARG A 1 71 ? 42.196 47.175 56.900 1.00 24.16  ? 71  ARG A CZ  1 
ATOM   621  N NH1 . ARG A 1 71 ? 42.724 48.348 56.535 1.00 22.43  ? 71  ARG A NH1 1 
ATOM   622  N NH2 . ARG A 1 71 ? 41.086 47.171 57.633 1.00 27.39  ? 71  ARG A NH2 1 
ATOM   623  N N   . PRO A 1 72 ? 46.234 41.498 56.482 1.00 20.70  ? 72  PRO A N   1 
ATOM   624  C CA  . PRO A 1 72 ? 46.658 40.762 57.673 1.00 20.02  ? 72  PRO A CA  1 
ATOM   625  C C   . PRO A 1 72 ? 46.081 41.386 58.953 1.00 18.67  ? 72  PRO A C   1 
ATOM   626  O O   . PRO A 1 72 ? 45.916 42.612 59.040 1.00 18.20  ? 72  PRO A O   1 
ATOM   627  C CB  . PRO A 1 72 ? 48.177 40.790 57.582 1.00 20.91  ? 72  PRO A CB  1 
ATOM   628  C CG  . PRO A 1 72 ? 48.434 42.119 56.945 1.00 22.34  ? 72  PRO A CG  1 
ATOM   629  C CD  . PRO A 1 72 ? 47.366 42.158 55.850 1.00 21.05  ? 72  PRO A CD  1 
ATOM   630  N N   . LEU A 1 73 ? 45.691 40.565 59.921 1.00 21.89  ? 73  LEU A N   1 
ATOM   631  C CA  . LEU A 1 73 ? 45.248 41.079 61.226 1.00 26.98  ? 73  LEU A CA  1 
ATOM   632  C C   . LEU A 1 73 ? 46.467 41.642 61.995 1.00 31.35  ? 73  LEU A C   1 
ATOM   633  O O   . LEU A 1 73 ? 47.612 41.246 61.678 1.00 32.39  ? 73  LEU A O   1 
ATOM   634  C CB  . LEU A 1 73 ? 44.574 39.933 62.022 1.00 22.47  ? 73  LEU A CB  1 
ATOM   635  C CG  . LEU A 1 73 ? 43.225 39.382 61.509 1.00 20.09  ? 73  LEU A CG  1 
ATOM   636  C CD1 . LEU A 1 73 ? 42.846 38.086 62.186 1.00 19.36  ? 73  LEU A CD1 1 
ATOM   637  C CD2 . LEU A 1 73 ? 42.177 40.429 61.747 1.00 16.07  ? 73  LEU A CD2 1 
ATOM   638  N N   . PRO A 1 74 ? 46.387 42.560 62.975 1.00 34.50  ? 74  PRO A N   1 
ATOM   639  C CA  . PRO A 1 74 ? 47.555 42.920 63.748 1.00 37.91  ? 74  PRO A CA  1 
ATOM   640  C C   . PRO A 1 74 ? 47.987 41.765 64.657 1.00 44.47  ? 74  PRO A C   1 
ATOM   641  O O   . PRO A 1 74 ? 47.205 40.894 65.080 1.00 45.56  ? 74  PRO A O   1 
ATOM   642  C CB  . PRO A 1 74 ? 47.127 44.173 64.461 1.00 36.34  ? 74  PRO A CB  1 
ATOM   643  C CG  . PRO A 1 74 ? 45.897 44.664 63.741 1.00 31.69  ? 74  PRO A CG  1 
ATOM   644  C CD  . PRO A 1 74 ? 45.228 43.340 63.373 1.00 32.80  ? 74  PRO A CD  1 
ATOM   645  N N   . LYS A 1 75 ? 49.298 41.734 64.886 1.00 53.78  ? 75  LYS A N   1 
ATOM   646  C CA  . LYS A 1 75 ? 49.967 40.753 65.753 1.00 61.14  ? 75  LYS A CA  1 
ATOM   647  C C   . LYS A 1 75 ? 50.889 41.439 66.792 1.00 63.33  ? 75  LYS A C   1 
ATOM   648  O O   . LYS A 1 75 ? 51.980 41.001 67.207 1.00 65.18  ? 75  LYS A O   1 
ATOM   649  C CB  . LYS A 1 75 ? 50.794 39.722 64.887 1.00 64.73  ? 75  LYS A CB  1 
ATOM   650  C CG  . LYS A 1 75 ? 51.773 40.150 63.763 1.00 70.11  ? 75  LYS A CG  1 
ATOM   651  C CD  . LYS A 1 75 ? 51.088 40.189 62.384 1.00 74.18  ? 75  LYS A CD  1 
ATOM   652  C CE  . LYS A 1 75 ? 52.017 40.663 61.267 1.00 76.13  ? 75  LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 75 ? 51.354 40.631 59.969 1.00 77.06  ? 75  LYS A NZ  1 
ATOM   654  N N   . ALA B 1 2  ? 35.589 50.523 53.399 1.00 71.50  ? 2   ALA B N   1 
ATOM   655  C CA  . ALA B 1 2  ? 34.221 50.092 53.113 1.00 69.37  ? 2   ALA B CA  1 
ATOM   656  C C   . ALA B 1 2  ? 33.300 51.154 52.526 1.00 69.93  ? 2   ALA B C   1 
ATOM   657  O O   . ALA B 1 2  ? 33.766 52.221 52.121 1.00 70.18  ? 2   ALA B O   1 
ATOM   658  C CB  . ALA B 1 2  ? 33.505 49.611 54.366 1.00 68.58  ? 2   ALA B CB  1 
ATOM   659  N N   . HIS B 1 3  ? 31.987 50.839 52.422 1.00 71.20  ? 3   HIS B N   1 
ATOM   660  C CA  . HIS B 1 3  ? 30.905 51.803 52.172 1.00 71.14  ? 3   HIS B CA  1 
ATOM   661  C C   . HIS B 1 3  ? 29.510 51.140 52.312 1.00 67.27  ? 3   HIS B C   1 
ATOM   662  O O   . HIS B 1 3  ? 29.361 50.206 53.116 1.00 66.16  ? 3   HIS B O   1 
ATOM   663  C CB  . HIS B 1 3  ? 31.061 52.482 50.770 1.00 75.83  ? 3   HIS B CB  1 
ATOM   664  C CG  . HIS B 1 3  ? 30.311 53.828 50.612 1.00 80.35  ? 3   HIS B CG  1 
ATOM   665  N ND1 . HIS B 1 3  ? 29.589 54.541 51.492 1.00 81.63  ? 3   HIS B ND1 1 
ATOM   666  C CD2 . HIS B 1 3  ? 30.286 54.543 49.428 1.00 81.11  ? 3   HIS B CD2 1 
ATOM   667  C CE1 . HIS B 1 3  ? 29.143 55.622 50.890 1.00 81.95  ? 3   HIS B CE1 1 
ATOM   668  N NE2 . HIS B 1 3  ? 29.568 55.613 49.650 1.00 81.89  ? 3   HIS B NE2 1 
ATOM   669  N N   . LYS B 1 4  ? 28.476 51.545 51.562 1.00 62.96  ? 4   LYS B N   1 
ATOM   670  C CA  . LYS B 1 4  ? 27.106 51.140 51.819 1.00 59.01  ? 4   LYS B CA  1 
ATOM   671  C C   . LYS B 1 4  ? 26.182 51.518 50.650 1.00 54.64  ? 4   LYS B C   1 
ATOM   672  O O   . LYS B 1 4  ? 25.171 52.234 50.758 1.00 53.95  ? 4   LYS B O   1 
ATOM   673  C CB  . LYS B 1 4  ? 26.593 51.809 53.103 1.00 63.29  ? 4   LYS B CB  1 
ATOM   674  C CG  . LYS B 1 4  ? 26.673 53.355 53.153 1.00 68.12  ? 4   LYS B CG  1 
ATOM   675  C CD  . LYS B 1 4  ? 25.671 53.925 54.166 1.00 71.54  ? 4   LYS B CD  1 
ATOM   676  C CE  . LYS B 1 4  ? 26.044 55.310 54.709 1.00 73.04  ? 4   LYS B CE  1 
ATOM   677  N NZ  . LYS B 1 4  ? 27.178 55.250 55.623 1.00 73.58  ? 4   LYS B NZ  1 
ATOM   678  N N   . GLN B 1 5  ? 26.566 51.095 49.465 1.00 47.61  ? 5   GLN B N   1 
ATOM   679  C CA  . GLN B 1 5  ? 25.720 51.311 48.321 1.00 40.92  ? 5   GLN B CA  1 
ATOM   680  C C   . GLN B 1 5  ? 24.912 50.061 48.074 1.00 32.29  ? 5   GLN B C   1 
ATOM   681  O O   . GLN B 1 5  ? 25.210 48.982 48.576 1.00 27.80  ? 5   GLN B O   1 
ATOM   682  C CB  . GLN B 1 5  ? 26.512 51.582 47.081 1.00 48.58  ? 5   GLN B CB  1 
ATOM   683  C CG  . GLN B 1 5  ? 27.538 52.698 47.132 1.00 56.32  ? 5   GLN B CG  1 
ATOM   684  C CD  . GLN B 1 5  ? 28.899 52.161 47.530 1.00 61.89  ? 5   GLN B CD  1 
ATOM   685  O OE1 . GLN B 1 5  ? 29.083 51.595 48.623 1.00 64.26  ? 5   GLN B OE1 1 
ATOM   686  N NE2 . GLN B 1 5  ? 29.871 52.360 46.651 1.00 62.32  ? 5   GLN B NE2 1 
ATOM   687  N N   . ILE B 1 6  ? 23.877 50.237 47.282 1.00 28.17  ? 6   ILE B N   1 
ATOM   688  C CA  . ILE B 1 6  ? 23.020 49.149 46.876 1.00 25.59  ? 6   ILE B CA  1 
ATOM   689  C C   . ILE B 1 6  ? 23.624 48.695 45.558 1.00 21.72  ? 6   ILE B C   1 
ATOM   690  O O   . ILE B 1 6  ? 24.024 49.507 44.727 1.00 20.07  ? 6   ILE B O   1 
ATOM   691  C CB  . ILE B 1 6  ? 21.534 49.662 46.709 1.00 24.69  ? 6   ILE B CB  1 
ATOM   692  C CG1 . ILE B 1 6  ? 20.925 49.956 48.050 1.00 23.75  ? 6   ILE B CG1 1 
ATOM   693  C CG2 . ILE B 1 6  ? 20.674 48.595 46.076 1.00 23.49  ? 6   ILE B CG2 1 
ATOM   694  C CD1 . ILE B 1 6  ? 19.663 50.820 47.980 1.00 25.84  ? 6   ILE B CD1 1 
ATOM   695  N N   . TYR B 1 7  ? 23.723 47.398 45.396 1.00 20.31  ? 7   TYR B N   1 
ATOM   696  C CA  . TYR B 1 7  ? 24.204 46.857 44.157 1.00 23.05  ? 7   TYR B CA  1 
ATOM   697  C C   . TYR B 1 7  ? 23.006 46.352 43.321 1.00 23.02  ? 7   TYR B C   1 
ATOM   698  O O   . TYR B 1 7  ? 22.169 45.641 43.876 1.00 21.77  ? 7   TYR B O   1 
ATOM   699  C CB  . TYR B 1 7  ? 25.152 45.725 44.485 1.00 24.26  ? 7   TYR B CB  1 
ATOM   700  C CG  . TYR B 1 7  ? 25.765 45.075 43.256 1.00 25.22  ? 7   TYR B CG  1 
ATOM   701  C CD1 . TYR B 1 7  ? 26.791 45.708 42.551 1.00 24.03  ? 7   TYR B CD1 1 
ATOM   702  C CD2 . TYR B 1 7  ? 25.235 43.863 42.812 1.00 25.40  ? 7   TYR B CD2 1 
ATOM   703  C CE1 . TYR B 1 7  ? 27.274 45.112 41.376 1.00 27.06  ? 7   TYR B CE1 1 
ATOM   704  C CE2 . TYR B 1 7  ? 25.713 43.269 41.642 1.00 27.07  ? 7   TYR B CE2 1 
ATOM   705  C CZ  . TYR B 1 7  ? 26.732 43.898 40.924 1.00 29.98  ? 7   TYR B CZ  1 
ATOM   706  O OH  . TYR B 1 7  ? 27.171 43.302 39.746 1.00 34.86  ? 7   TYR B OH  1 
ATOM   707  N N   . TYR B 1 8  ? 22.876 46.645 42.021 1.00 19.81  ? 8   TYR B N   1 
ATOM   708  C CA  . TYR B 1 8  ? 21.771 46.201 41.184 1.00 20.29  ? 8   TYR B CA  1 
ATOM   709  C C   . TYR B 1 8  ? 22.376 45.198 40.221 1.00 22.88  ? 8   TYR B C   1 
ATOM   710  O O   . TYR B 1 8  ? 23.328 45.551 39.519 1.00 24.96  ? 8   TYR B O   1 
ATOM   711  C CB  . TYR B 1 8  ? 21.179 47.370 40.400 1.00 15.68  ? 8   TYR B CB  1 
ATOM   712  C CG  . TYR B 1 8  ? 20.632 48.447 41.318 1.00 17.16  ? 8   TYR B CG  1 
ATOM   713  C CD1 . TYR B 1 8  ? 21.471 49.346 41.996 1.00 16.16  ? 8   TYR B CD1 1 
ATOM   714  C CD2 . TYR B 1 8  ? 19.254 48.498 41.516 1.00 18.66  ? 8   TYR B CD2 1 
ATOM   715  C CE1 . TYR B 1 8  ? 20.925 50.286 42.865 1.00 18.02  ? 8   TYR B CE1 1 
ATOM   716  C CE2 . TYR B 1 8  ? 18.702 49.430 42.388 1.00 21.67  ? 8   TYR B CE2 1 
ATOM   717  C CZ  . TYR B 1 8  ? 19.534 50.314 43.052 1.00 21.90  ? 8   TYR B CZ  1 
ATOM   718  O OH  . TYR B 1 8  ? 18.952 51.203 43.927 1.00 23.39  ? 8   TYR B OH  1 
ATOM   719  N N   . SER B 1 9  ? 21.938 43.941 40.200 1.00 23.89  ? 9   SER B N   1 
ATOM   720  C CA  . SER B 1 9  ? 22.465 42.981 39.256 1.00 25.88  ? 9   SER B CA  1 
ATOM   721  C C   . SER B 1 9  ? 21.956 43.282 37.836 1.00 28.72  ? 9   SER B C   1 
ATOM   722  O O   . SER B 1 9  ? 21.032 44.077 37.570 1.00 27.66  ? 9   SER B O   1 
ATOM   723  C CB  . SER B 1 9  ? 22.041 41.540 39.617 1.00 27.87  ? 9   SER B CB  1 
ATOM   724  O OG  . SER B 1 9  ? 20.757 41.086 39.107 1.00 27.85  ? 9   SER B OG  1 
ATOM   725  N N   . ASP B 1 10 ? 22.597 42.539 36.929 1.00 29.25  ? 10  ASP B N   1 
ATOM   726  C CA  . ASP B 1 10 ? 22.185 42.515 35.543 1.00 28.88  ? 10  ASP B CA  1 
ATOM   727  C C   . ASP B 1 10 ? 20.881 41.703 35.430 1.00 25.34  ? 10  ASP B C   1 
ATOM   728  O O   . ASP B 1 10 ? 20.682 40.714 36.144 1.00 24.78  ? 10  ASP B O   1 
ATOM   729  C CB  . ASP B 1 10 ? 23.305 41.877 34.701 1.00 31.83  ? 10  ASP B CB  1 
ATOM   730  C CG  . ASP B 1 10 ? 24.656 42.573 34.872 1.00 33.63  ? 10  ASP B CG  1 
ATOM   731  O OD1 . ASP B 1 10 ? 24.782 43.746 34.484 1.00 30.86  ? 10  ASP B OD1 1 
ATOM   732  O OD2 . ASP B 1 10 ? 25.555 41.927 35.422 1.00 36.05  ? 10  ASP B OD2 1 
ATOM   733  N N   . LYS B 1 11 ? 20.019 42.181 34.543 1.00 21.59  ? 11  LYS B N   1 
ATOM   734  C CA  . LYS B 1 11 ? 18.749 41.593 34.213 1.00 20.07  ? 11  LYS B CA  1 
ATOM   735  C C   . LYS B 1 11 ? 18.918 40.367 33.363 1.00 22.29  ? 11  LYS B C   1 
ATOM   736  O O   . LYS B 1 11 ? 19.861 40.250 32.571 1.00 24.91  ? 11  LYS B O   1 
ATOM   737  C CB  . LYS B 1 11 ? 17.923 42.567 33.458 1.00 18.68  ? 11  LYS B CB  1 
ATOM   738  C CG  . LYS B 1 11 ? 17.731 43.780 34.302 1.00 17.14  ? 11  LYS B CG  1 
ATOM   739  C CD  . LYS B 1 11 ? 16.715 44.639 33.600 1.00 22.66  ? 11  LYS B CD  1 
ATOM   740  C CE  . LYS B 1 11 ? 17.368 45.656 32.712 1.00 22.74  ? 11  LYS B CE  1 
ATOM   741  N NZ  . LYS B 1 11 ? 16.847 46.969 33.047 1.00 28.51  ? 11  LYS B NZ  1 
ATOM   742  N N   . TYR B 1 12 ? 18.042 39.406 33.596 1.00 22.14  ? 12  TYR B N   1 
ATOM   743  C CA  . TYR B 1 12 ? 17.983 38.194 32.802 1.00 20.38  ? 12  TYR B CA  1 
ATOM   744  C C   . TYR B 1 12 ? 16.497 37.905 32.629 1.00 18.94  ? 12  TYR B C   1 
ATOM   745  O O   . TYR B 1 12 ? 15.656 38.657 33.164 1.00 19.63  ? 12  TYR B O   1 
ATOM   746  C CB  . TYR B 1 12 ? 18.746 37.035 33.495 1.00 21.42  ? 12  TYR B CB  1 
ATOM   747  C CG  . TYR B 1 12 ? 18.393 36.703 34.915 1.00 23.13  ? 12  TYR B CG  1 
ATOM   748  C CD1 . TYR B 1 12 ? 18.798 37.533 35.973 1.00 22.86  ? 12  TYR B CD1 1 
ATOM   749  C CD2 . TYR B 1 12 ? 17.606 35.578 35.128 1.00 26.19  ? 12  TYR B CD2 1 
ATOM   750  C CE1 . TYR B 1 12 ? 18.397 37.229 37.270 1.00 26.62  ? 12  TYR B CE1 1 
ATOM   751  C CE2 . TYR B 1 12 ? 17.189 35.272 36.424 1.00 29.55  ? 12  TYR B CE2 1 
ATOM   752  C CZ  . TYR B 1 12 ? 17.587 36.102 37.483 1.00 29.88  ? 12  TYR B CZ  1 
ATOM   753  O OH  . TYR B 1 12 ? 17.149 35.804 38.761 1.00 30.95  ? 12  TYR B OH  1 
ATOM   754  N N   . PHE B 1 13 ? 16.084 36.901 31.882 1.00 15.86  ? 13  PHE B N   1 
ATOM   755  C CA  . PHE B 1 13 ? 14.668 36.737 31.568 1.00 17.90  ? 13  PHE B CA  1 
ATOM   756  C C   . PHE B 1 13 ? 14.364 35.304 31.234 1.00 17.44  ? 13  PHE B C   1 
ATOM   757  O O   . PHE B 1 13 ? 15.280 34.500 31.009 1.00 17.65  ? 13  PHE B O   1 
ATOM   758  C CB  . PHE B 1 13 ? 14.213 37.624 30.346 1.00 18.20  ? 13  PHE B CB  1 
ATOM   759  C CG  . PHE B 1 13 ? 15.037 37.449 29.057 1.00 22.08  ? 13  PHE B CG  1 
ATOM   760  C CD1 . PHE B 1 13 ? 14.681 36.481 28.093 1.00 21.06  ? 13  PHE B CD1 1 
ATOM   761  C CD2 . PHE B 1 13 ? 16.168 38.258 28.839 1.00 21.55  ? 13  PHE B CD2 1 
ATOM   762  C CE1 . PHE B 1 13 ? 15.450 36.320 26.935 1.00 24.81  ? 13  PHE B CE1 1 
ATOM   763  C CE2 . PHE B 1 13 ? 16.931 38.085 27.670 1.00 23.96  ? 13  PHE B CE2 1 
ATOM   764  C CZ  . PHE B 1 13 ? 16.578 37.117 26.722 1.00 24.25  ? 13  PHE B CZ  1 
ATOM   765  N N   . ASP B 1 14 ? 13.090 34.953 31.229 1.00 16.47  ? 14  ASP B N   1 
ATOM   766  C CA  . ASP B 1 14 ? 12.731 33.632 30.759 1.00 12.61  ? 14  ASP B CA  1 
ATOM   767  C C   . ASP B 1 14 ? 11.662 33.892 29.722 1.00 14.23  ? 14  ASP B C   1 
ATOM   768  O O   . ASP B 1 14 ? 11.556 34.998 29.173 1.00 14.69  ? 14  ASP B O   1 
ATOM   769  C CB  . ASP B 1 14 ? 12.210 32.754 31.922 1.00 17.64  ? 14  ASP B CB  1 
ATOM   770  C CG  . ASP B 1 14 ? 11.047 33.184 32.821 1.00 17.59  ? 14  ASP B CG  1 
ATOM   771  O OD1 . ASP B 1 14 ? 10.290 34.100 32.519 1.00 20.72  ? 14  ASP B OD1 1 
ATOM   772  O OD2 . ASP B 1 14 ? 10.905 32.556 33.855 1.00 24.55  ? 14  ASP B OD2 1 
ATOM   773  N N   . GLU B 1 15 ? 10.789 32.947 29.435 1.00 17.28  ? 15  GLU B N   1 
ATOM   774  C CA  . GLU B 1 15 ? 9.722  33.171 28.473 1.00 19.29  ? 15  GLU B CA  1 
ATOM   775  C C   . GLU B 1 15 ? 8.727  34.266 28.857 1.00 23.53  ? 15  GLU B C   1 
ATOM   776  O O   . GLU B 1 15 ? 8.065  34.820 27.972 1.00 28.12  ? 15  GLU B O   1 
ATOM   777  C CB  . GLU B 1 15 ? 8.969  31.868 28.257 1.00 24.36  ? 15  GLU B CB  1 
ATOM   778  C CG  . GLU B 1 15 ? 9.911  30.663 28.146 1.00 35.80  ? 15  GLU B CG  1 
ATOM   779  C CD  . GLU B 1 15 ? 9.414  29.450 27.362 1.00 41.00  ? 15  GLU B CD  1 
ATOM   780  O OE1 . GLU B 1 15 ? 8.595  28.700 27.884 1.00 45.62  ? 15  GLU B OE1 1 
ATOM   781  O OE2 . GLU B 1 15 ? 9.869  29.243 26.232 1.00 45.25  ? 15  GLU B OE2 1 
ATOM   782  N N   . HIS B 1 16 ? 8.591  34.632 30.149 1.00 21.90  ? 16  HIS B N   1 
ATOM   783  C CA  . HIS B 1 16 ? 7.546  35.517 30.605 1.00 19.53  ? 16  HIS B CA  1 
ATOM   784  C C   . HIS B 1 16 ? 7.980  36.730 31.365 1.00 17.18  ? 16  HIS B C   1 
ATOM   785  O O   . HIS B 1 16 ? 7.286  37.748 31.340 1.00 14.84  ? 16  HIS B O   1 
ATOM   786  C CB  . HIS B 1 16 ? 6.587  34.760 31.492 1.00 27.77  ? 16  HIS B CB  1 
ATOM   787  C CG  . HIS B 1 16 ? 5.952  33.533 30.867 1.00 34.90  ? 16  HIS B CG  1 
ATOM   788  N ND1 . HIS B 1 16 ? 4.998  33.485 29.935 1.00 38.91  ? 16  HIS B ND1 1 
ATOM   789  C CD2 . HIS B 1 16 ? 6.306  32.237 31.168 1.00 38.22  ? 16  HIS B CD2 1 
ATOM   790  C CE1 . HIS B 1 16 ? 4.763  32.226 29.656 1.00 40.51  ? 16  HIS B CE1 1 
ATOM   791  N NE2 . HIS B 1 16 ? 5.554  31.491 30.403 1.00 41.15  ? 16  HIS B NE2 1 
ATOM   792  N N   . TYR B 1 17 ? 9.121  36.676 32.042 1.00 19.33  ? 17  TYR B N   1 
ATOM   793  C CA  . TYR B 1 17 ? 9.534  37.792 32.906 1.00 20.00  ? 17  TYR B CA  1 
ATOM   794  C C   . TYR B 1 17 ? 10.987 38.170 32.708 1.00 17.58  ? 17  TYR B C   1 
ATOM   795  O O   . TYR B 1 17 ? 11.759 37.361 32.192 1.00 18.22  ? 17  TYR B O   1 
ATOM   796  C CB  . TYR B 1 17 ? 9.424  37.473 34.402 1.00 18.10  ? 17  TYR B CB  1 
ATOM   797  C CG  . TYR B 1 17 ? 8.037  37.085 34.872 1.00 19.69  ? 17  TYR B CG  1 
ATOM   798  C CD1 . TYR B 1 17 ? 7.091  38.042 35.264 1.00 20.46  ? 17  TYR B CD1 1 
ATOM   799  C CD2 . TYR B 1 17 ? 7.735  35.727 34.903 1.00 21.28  ? 17  TYR B CD2 1 
ATOM   800  C CE1 . TYR B 1 17 ? 5.831  37.624 35.691 1.00 21.15  ? 17  TYR B CE1 1 
ATOM   801  C CE2 . TYR B 1 17 ? 6.486  35.309 35.325 1.00 20.25  ? 17  TYR B CE2 1 
ATOM   802  C CZ  . TYR B 1 17 ? 5.559  36.256 35.711 1.00 20.62  ? 17  TYR B CZ  1 
ATOM   803  O OH  . TYR B 1 17 ? 4.348  35.777 36.124 1.00 23.91  ? 17  TYR B OH  1 
ATOM   804  N N   . GLU B 1 18 ? 11.223 39.409 33.111 1.00 18.14  ? 18  GLU B N   1 
ATOM   805  C CA  . GLU B 1 18 ? 12.517 39.992 33.356 1.00 17.63  ? 18  GLU B CA  1 
ATOM   806  C C   . GLU B 1 18 ? 12.744 39.780 34.870 1.00 17.07  ? 18  GLU B C   1 
ATOM   807  O O   . GLU B 1 18 ? 11.809 39.922 35.663 1.00 14.78  ? 18  GLU B O   1 
ATOM   808  C CB  . GLU B 1 18 ? 12.565 41.469 33.198 1.00 15.86  ? 18  GLU B CB  1 
ATOM   809  C CG  . GLU B 1 18 ? 12.208 42.082 31.927 1.00 22.63  ? 18  GLU B CG  1 
ATOM   810  C CD  . GLU B 1 18 ? 12.716 43.505 31.937 1.00 23.98  ? 18  GLU B CD  1 
ATOM   811  O OE1 . GLU B 1 18 ? 13.877 43.664 31.572 1.00 32.11  ? 18  GLU B OE1 1 
ATOM   812  O OE2 . GLU B 1 18 ? 11.989 44.435 32.293 1.00 21.86  ? 18  GLU B OE2 1 
ATOM   813  N N   . TYR B 1 19 ? 13.991 39.576 35.291 1.00 17.29  ? 19  TYR B N   1 
ATOM   814  C CA  . TYR B 1 19 ? 14.379 39.297 36.661 1.00 16.90  ? 19  TYR B CA  1 
ATOM   815  C C   . TYR B 1 19 ? 15.612 40.097 37.053 1.00 18.03  ? 19  TYR B C   1 
ATOM   816  O O   . TYR B 1 19 ? 16.472 40.326 36.191 1.00 16.42  ? 19  TYR B O   1 
ATOM   817  C CB  . TYR B 1 19 ? 14.743 37.838 36.833 1.00 13.89  ? 19  TYR B CB  1 
ATOM   818  C CG  . TYR B 1 19 ? 13.650 36.830 36.613 1.00 13.75  ? 19  TYR B CG  1 
ATOM   819  C CD1 . TYR B 1 19 ? 12.761 36.577 37.672 1.00 13.76  ? 19  TYR B CD1 1 
ATOM   820  C CD2 . TYR B 1 19 ? 13.511 36.167 35.390 1.00 13.39  ? 19  TYR B CD2 1 
ATOM   821  C CE1 . TYR B 1 19 ? 11.723 35.656 37.498 1.00 13.77  ? 19  TYR B CE1 1 
ATOM   822  C CE2 . TYR B 1 19 ? 12.470 35.245 35.228 1.00 13.43  ? 19  TYR B CE2 1 
ATOM   823  C CZ  . TYR B 1 19 ? 11.580 34.997 36.287 1.00 14.51  ? 19  TYR B CZ  1 
ATOM   824  O OH  . TYR B 1 19 ? 10.554 34.080 36.155 1.00 17.44  ? 19  TYR B OH  1 
ATOM   825  N N   . ARG B 1 20 ? 15.735 40.563 38.291 1.00 17.29  ? 20  ARG B N   1 
ATOM   826  C CA  . ARG B 1 20 ? 16.995 41.108 38.747 1.00 17.19  ? 20  ARG B CA  1 
ATOM   827  C C   . ARG B 1 20 ? 17.039 40.981 40.252 1.00 18.71  ? 20  ARG B C   1 
ATOM   828  O O   . ARG B 1 20 ? 16.006 40.868 40.910 1.00 17.91  ? 20  ARG B O   1 
ATOM   829  C CB  . ARG B 1 20 ? 17.168 42.563 38.372 1.00 15.73  ? 20  ARG B CB  1 
ATOM   830  C CG  . ARG B 1 20 ? 16.330 43.567 39.108 1.00 20.44  ? 20  ARG B CG  1 
ATOM   831  C CD  . ARG B 1 20 ? 17.269 44.625 39.646 1.00 24.15  ? 20  ARG B CD  1 
ATOM   832  N NE  . ARG B 1 20 ? 17.968 45.306 38.591 1.00 25.58  ? 20  ARG B NE  1 
ATOM   833  C CZ  . ARG B 1 20 ? 17.477 46.380 37.955 1.00 27.96  ? 20  ARG B CZ  1 
ATOM   834  N NH1 . ARG B 1 20 ? 16.304 46.936 38.254 1.00 26.75  ? 20  ARG B NH1 1 
ATOM   835  N NH2 . ARG B 1 20 ? 18.152 46.839 36.893 1.00 28.08  ? 20  ARG B NH2 1 
ATOM   836  N N   . HIS B 1 21 ? 18.247 40.966 40.809 1.00 20.71  ? 21  HIS B N   1 
ATOM   837  C CA  . HIS B 1 21 ? 18.511 40.849 42.239 1.00 19.80  ? 21  HIS B CA  1 
ATOM   838  C C   . HIS B 1 21 ? 19.010 42.199 42.645 1.00 18.88  ? 21  HIS B C   1 
ATOM   839  O O   . HIS B 1 21 ? 19.648 42.910 41.852 1.00 18.93  ? 21  HIS B O   1 
ATOM   840  C CB  . HIS B 1 21 ? 19.638 39.842 42.594 1.00 25.08  ? 21  HIS B CB  1 
ATOM   841  C CG  . HIS B 1 21 ? 19.383 38.397 42.163 1.00 31.11  ? 21  HIS B CG  1 
ATOM   842  N ND1 . HIS B 1 21 ? 19.986 37.281 42.563 1.00 37.31  ? 21  HIS B ND1 1 
ATOM   843  C CD2 . HIS B 1 21 ? 18.399 37.990 41.297 1.00 35.15  ? 21  HIS B CD2 1 
ATOM   844  C CE1 . HIS B 1 21 ? 19.407 36.245 41.995 1.00 33.69  ? 21  HIS B CE1 1 
ATOM   845  N NE2 . HIS B 1 21 ? 18.454 36.694 41.234 1.00 35.83  ? 21  HIS B NE2 1 
ATOM   846  N N   . VAL B 1 22 ? 18.721 42.575 43.863 1.00 17.77  ? 22  VAL B N   1 
ATOM   847  C CA  . VAL B 1 22 ? 19.280 43.796 44.402 1.00 18.52  ? 22  VAL B CA  1 
ATOM   848  C C   . VAL B 1 22 ? 19.996 43.379 45.682 1.00 20.45  ? 22  VAL B C   1 
ATOM   849  O O   . VAL B 1 22 ? 19.551 42.456 46.361 1.00 19.54  ? 22  VAL B O   1 
ATOM   850  C CB  . VAL B 1 22 ? 18.145 44.782 44.649 1.00 16.35  ? 22  VAL B CB  1 
ATOM   851  C CG1 . VAL B 1 22 ? 18.553 45.970 45.466 1.00 13.63  ? 22  VAL B CG1 1 
ATOM   852  C CG2 . VAL B 1 22 ? 17.732 45.324 43.286 1.00 14.67  ? 22  VAL B CG2 1 
ATOM   853  N N   . MET B 1 23 ? 21.142 43.960 46.003 1.00 21.69  ? 23  MET B N   1 
ATOM   854  C CA  . MET B 1 23 ? 21.863 43.605 47.203 1.00 24.68  ? 23  MET B CA  1 
ATOM   855  C C   . MET B 1 23 ? 21.973 44.787 48.096 1.00 22.79  ? 23  MET B C   1 
ATOM   856  O O   . MET B 1 23 ? 22.418 45.861 47.661 1.00 22.81  ? 23  MET B O   1 
ATOM   857  C CB  . MET B 1 23 ? 23.240 43.162 46.917 1.00 26.57  ? 23  MET B CB  1 
ATOM   858  C CG  . MET B 1 23 ? 23.173 41.698 46.992 1.00 35.48  ? 23  MET B CG  1 
ATOM   859  S SD  . MET B 1 23 ? 24.470 41.121 45.913 1.00 45.69  ? 23  MET B SD  1 
ATOM   860  C CE  . MET B 1 23 ? 23.394 41.184 44.500 1.00 43.61  ? 23  MET B CE  1 
ATOM   861  N N   . LEU B 1 24 ? 21.509 44.521 49.316 1.00 23.70  ? 24  LEU B N   1 
ATOM   862  C CA  . LEU B 1 24 ? 21.489 45.518 50.360 1.00 25.91  ? 24  LEU B CA  1 
ATOM   863  C C   . LEU B 1 24 ? 22.649 45.316 51.307 1.00 26.24  ? 24  LEU B C   1 
ATOM   864  O O   . LEU B 1 24 ? 22.987 44.178 51.680 1.00 26.54  ? 24  LEU B O   1 
ATOM   865  C CB  . LEU B 1 24 ? 20.213 45.451 51.175 1.00 25.21  ? 24  LEU B CB  1 
ATOM   866  C CG  . LEU B 1 24 ? 18.970 45.705 50.355 1.00 29.38  ? 24  LEU B CG  1 
ATOM   867  C CD1 . LEU B 1 24 ? 17.769 45.358 51.204 1.00 29.80  ? 24  LEU B CD1 1 
ATOM   868  C CD2 . LEU B 1 24 ? 18.936 47.152 49.873 1.00 28.85  ? 24  LEU B CD2 1 
ATOM   869  N N   . PRO B 1 25 ? 23.228 46.452 51.710 1.00 28.80  ? 25  PRO B N   1 
ATOM   870  C CA  . PRO B 1 25 ? 24.078 46.545 52.889 1.00 33.41  ? 25  PRO B CA  1 
ATOM   871  C C   . PRO B 1 25 ? 23.340 46.062 54.143 1.00 36.39  ? 25  PRO B C   1 
ATOM   872  O O   . PRO B 1 25 ? 22.107 46.229 54.246 1.00 38.76  ? 25  PRO B O   1 
ATOM   873  C CB  . PRO B 1 25 ? 24.482 48.024 52.878 1.00 33.23  ? 25  PRO B CB  1 
ATOM   874  C CG  . PRO B 1 25 ? 23.415 48.756 52.098 1.00 31.06  ? 25  PRO B CG  1 
ATOM   875  C CD  . PRO B 1 25 ? 23.131 47.747 51.013 1.00 30.17  ? 25  PRO B CD  1 
ATOM   876  N N   . ARG B 1 26 ? 24.009 45.464 55.134 1.00 39.09  ? 26  ARG B N   1 
ATOM   877  C CA  . ARG B 1 26 ? 23.328 44.959 56.339 1.00 43.15  ? 26  ARG B CA  1 
ATOM   878  C C   . ARG B 1 26 ? 22.434 45.923 57.117 1.00 41.31  ? 26  ARG B C   1 
ATOM   879  O O   . ARG B 1 26 ? 21.329 45.534 57.500 1.00 42.42  ? 26  ARG B O   1 
ATOM   880  C CB  . ARG B 1 26 ? 24.319 44.397 57.349 1.00 46.97  ? 26  ARG B CB  1 
ATOM   881  C CG  . ARG B 1 26 ? 24.111 42.904 57.586 1.00 53.94  ? 26  ARG B CG  1 
ATOM   882  C CD  . ARG B 1 26 ? 25.046 42.369 58.672 1.00 61.62  ? 26  ARG B CD  1 
ATOM   883  N NE  . ARG B 1 26 ? 24.521 42.702 59.987 1.00 68.47  ? 26  ARG B NE  1 
ATOM   884  C CZ  . ARG B 1 26 ? 24.060 41.765 60.824 1.00 70.64  ? 26  ARG B CZ  1 
ATOM   885  N NH1 . ARG B 1 26 ? 24.064 40.465 60.496 1.00 70.77  ? 26  ARG B NH1 1 
ATOM   886  N NH2 . ARG B 1 26 ? 23.559 42.152 62.001 1.00 72.29  ? 26  ARG B NH2 1 
ATOM   887  N N   . GLU B 1 27 ? 22.812 47.180 57.294 1.00 40.32  ? 27  GLU B N   1 
ATOM   888  C CA  . GLU B 1 27 ? 21.970 48.096 58.040 1.00 42.72  ? 27  GLU B CA  1 
ATOM   889  C C   . GLU B 1 27 ? 20.607 48.337 57.389 1.00 40.26  ? 27  GLU B C   1 
ATOM   890  O O   . GLU B 1 27 ? 19.574 48.345 58.065 1.00 39.98  ? 27  GLU B O   1 
ATOM   891  C CB  . GLU B 1 27 ? 22.718 49.408 58.221 1.00 46.20  ? 27  GLU B CB  1 
ATOM   892  C CG  . GLU B 1 27 ? 23.240 50.044 56.942 1.00 56.65  ? 27  GLU B CG  1 
ATOM   893  C CD  . GLU B 1 27 ? 23.194 51.569 56.936 1.00 63.29  ? 27  GLU B CD  1 
ATOM   894  O OE1 . GLU B 1 27 ? 23.596 52.199 57.927 1.00 66.27  ? 27  GLU B OE1 1 
ATOM   895  O OE2 . GLU B 1 27 ? 22.746 52.118 55.923 1.00 66.36  ? 27  GLU B OE2 1 
ATOM   896  N N   . LEU B 1 28 ? 20.565 48.477 56.066 1.00 37.32  ? 28  LEU B N   1 
ATOM   897  C CA  . LEU B 1 28 ? 19.320 48.632 55.340 1.00 34.33  ? 28  LEU B CA  1 
ATOM   898  C C   . LEU B 1 28 ? 18.624 47.303 55.295 1.00 32.66  ? 28  LEU B C   1 
ATOM   899  O O   . LEU B 1 28 ? 17.410 47.275 55.393 1.00 34.34  ? 28  LEU B O   1 
ATOM   900  C CB  . LEU B 1 28 ? 19.549 49.054 53.929 1.00 35.26  ? 28  LEU B CB  1 
ATOM   901  C CG  . LEU B 1 28 ? 19.195 50.447 53.552 1.00 36.22  ? 28  LEU B CG  1 
ATOM   902  C CD1 . LEU B 1 28 ? 19.640 51.470 54.588 1.00 39.19  ? 28  LEU B CD1 1 
ATOM   903  C CD2 . LEU B 1 28 ? 19.869 50.682 52.213 1.00 37.26  ? 28  LEU B CD2 1 
ATOM   904  N N   . SER B 1 29 ? 19.289 46.162 55.230 1.00 33.43  ? 29  SER B N   1 
ATOM   905  C CA  . SER B 1 29 ? 18.557 44.922 55.162 1.00 36.47  ? 29  SER B CA  1 
ATOM   906  C C   . SER B 1 29 ? 17.857 44.593 56.466 1.00 40.10  ? 29  SER B C   1 
ATOM   907  O O   . SER B 1 29 ? 17.119 43.601 56.543 1.00 41.14  ? 29  SER B O   1 
ATOM   908  C CB  . SER B 1 29 ? 19.467 43.801 54.817 1.00 35.38  ? 29  SER B CB  1 
ATOM   909  O OG  . SER B 1 29 ? 20.275 43.388 55.911 1.00 40.44  ? 29  SER B OG  1 
ATOM   910  N N   . LYS B 1 30 ? 18.133 45.376 57.521 1.00 42.77  ? 30  LYS B N   1 
ATOM   911  C CA  . LYS B 1 30 ? 17.458 45.230 58.801 1.00 41.81  ? 30  LYS B CA  1 
ATOM   912  C C   . LYS B 1 30 ? 16.106 45.920 58.791 1.00 39.48  ? 30  LYS B C   1 
ATOM   913  O O   . LYS B 1 30 ? 15.294 45.678 59.684 1.00 40.99  ? 30  LYS B O   1 
ATOM   914  C CB  . LYS B 1 30 ? 18.371 45.794 59.899 1.00 46.24  ? 30  LYS B CB  1 
ATOM   915  C CG  . LYS B 1 30 ? 19.055 44.652 60.655 1.00 52.15  ? 30  LYS B CG  1 
ATOM   916  C CD  . LYS B 1 30 ? 19.752 43.672 59.710 1.00 58.41  ? 30  LYS B CD  1 
ATOM   917  C CE  . LYS B 1 30 ? 19.902 42.276 60.312 1.00 65.36  ? 30  LYS B CE  1 
ATOM   918  N NZ  . LYS B 1 30 ? 20.459 41.336 59.346 1.00 69.10  ? 30  LYS B NZ  1 
ATOM   919  N N   . GLN B 1 31 ? 15.827 46.771 57.792 1.00 35.54  ? 31  GLN B N   1 
ATOM   920  C CA  . GLN B 1 31 ? 14.524 47.430 57.633 1.00 33.57  ? 31  GLN B CA  1 
ATOM   921  C C   . GLN B 1 31 ? 13.628 46.739 56.583 1.00 29.99  ? 31  GLN B C   1 
ATOM   922  O O   . GLN B 1 31 ? 12.616 47.301 56.167 1.00 30.61  ? 31  GLN B O   1 
ATOM   923  C CB  . GLN B 1 31 ? 14.716 48.858 57.208 1.00 32.68  ? 31  GLN B CB  1 
ATOM   924  C CG  . GLN B 1 31 ? 15.768 49.527 58.041 1.00 42.45  ? 31  GLN B CG  1 
ATOM   925  C CD  . GLN B 1 31 ? 16.238 50.837 57.452 1.00 46.04  ? 31  GLN B CD  1 
ATOM   926  O OE1 . GLN B 1 31 ? 15.448 51.595 56.902 1.00 50.35  ? 31  GLN B OE1 1 
ATOM   927  N NE2 . GLN B 1 31 ? 17.523 51.164 57.543 1.00 50.51  ? 31  GLN B NE2 1 
ATOM   928  N N   . VAL B 1 32 ? 13.978 45.553 56.087 1.00 23.94  ? 32  VAL B N   1 
ATOM   929  C CA  . VAL B 1 32 ? 13.157 44.831 55.158 1.00 24.03  ? 32  VAL B CA  1 
ATOM   930  C C   . VAL B 1 32 ? 12.171 43.984 55.979 1.00 23.79  ? 32  VAL B C   1 
ATOM   931  O O   . VAL B 1 32 ? 12.620 43.195 56.831 1.00 25.49  ? 32  VAL B O   1 
ATOM   932  C CB  . VAL B 1 32 ? 14.025 43.904 54.250 1.00 22.88  ? 32  VAL B CB  1 
ATOM   933  C CG1 . VAL B 1 32 ? 13.136 43.053 53.337 1.00 21.18  ? 32  VAL B CG1 1 
ATOM   934  C CG2 . VAL B 1 32 ? 14.907 44.757 53.356 1.00 20.71  ? 32  VAL B CG2 1 
ATOM   935  N N   . PRO B 1 33 ? 10.839 44.047 55.695 1.00 21.62  ? 33  PRO B N   1 
ATOM   936  C CA  . PRO B 1 33 ? 9.815  43.228 56.332 1.00 17.50  ? 33  PRO B CA  1 
ATOM   937  C C   . PRO B 1 33 ? 10.131 41.763 56.280 1.00 17.36  ? 33  PRO B C   1 
ATOM   938  O O   . PRO B 1 33 ? 10.492 41.203 55.238 1.00 18.12  ? 33  PRO B O   1 
ATOM   939  C CB  . PRO B 1 33 ? 8.513  43.534 55.596 1.00 19.40  ? 33  PRO B CB  1 
ATOM   940  C CG  . PRO B 1 33 ? 8.738  44.878 54.946 1.00 17.38  ? 33  PRO B CG  1 
ATOM   941  C CD  . PRO B 1 33 ? 10.236 44.931 54.677 1.00 19.00  ? 33  PRO B CD  1 
ATOM   942  N N   . LYS B 1 34 ? 9.882  41.099 57.387 1.00 17.04  ? 34  LYS B N   1 
ATOM   943  C CA  . LYS B 1 34 ? 10.126 39.678 57.425 1.00 20.11  ? 34  LYS B CA  1 
ATOM   944  C C   . LYS B 1 34 ? 8.846  38.897 57.187 1.00 19.03  ? 34  LYS B C   1 
ATOM   945  O O   . LYS B 1 34 ? 8.919  37.699 56.883 1.00 17.84  ? 34  LYS B O   1 
ATOM   946  C CB  . LYS B 1 34 ? 10.758 39.300 58.806 1.00 27.21  ? 34  LYS B CB  1 
ATOM   947  C CG  . LYS B 1 34 ? 11.928 40.264 59.167 1.00 38.37  ? 34  LYS B CG  1 
ATOM   948  C CD  . LYS B 1 34 ? 13.201 39.747 59.877 1.00 46.22  ? 34  LYS B CD  1 
ATOM   949  C CE  . LYS B 1 34 ? 14.300 40.854 60.017 1.00 51.60  ? 34  LYS B CE  1 
ATOM   950  N NZ  . LYS B 1 34 ? 14.743 41.451 58.753 1.00 56.05  ? 34  LYS B NZ  1 
ATOM   951  N N   . THR B 1 35 ? 7.679  39.555 57.273 1.00 17.34  ? 35  THR B N   1 
ATOM   952  C CA  . THR B 1 35 ? 6.412  38.830 57.294 1.00 19.05  ? 35  THR B CA  1 
ATOM   953  C C   . THR B 1 35 ? 5.594  39.014 56.048 1.00 18.24  ? 35  THR B C   1 
ATOM   954  O O   . THR B 1 35 ? 4.579  38.335 55.893 1.00 18.47  ? 35  THR B O   1 
ATOM   955  C CB  . THR B 1 35 ? 5.542  39.275 58.502 1.00 19.32  ? 35  THR B CB  1 
ATOM   956  O OG1 . THR B 1 35 ? 5.523  40.704 58.432 1.00 26.56  ? 35  THR B OG1 1 
ATOM   957  C CG2 . THR B 1 35 ? 6.073  38.866 59.853 1.00 18.69  ? 35  THR B CG2 1 
ATOM   958  N N   . HIS B 1 36 ? 5.959  39.958 55.188 1.00 15.29  ? 36  HIS B N   1 
ATOM   959  C CA  . HIS B 1 36 ? 5.199  40.116 53.982 1.00 15.34  ? 36  HIS B CA  1 
ATOM   960  C C   . HIS B 1 36 ? 6.113  40.634 52.893 1.00 16.02  ? 36  HIS B C   1 
ATOM   961  O O   . HIS B 1 36 ? 7.223  41.118 53.201 1.00 15.38  ? 36  HIS B O   1 
ATOM   962  C CB  . HIS B 1 36 ? 4.058  41.093 54.230 1.00 13.47  ? 36  HIS B CB  1 
ATOM   963  C CG  . HIS B 1 36 ? 4.470  42.517 54.569 1.00 10.16  ? 36  HIS B CG  1 
ATOM   964  N ND1 . HIS B 1 36 ? 4.559  43.556 53.746 1.00 11.97  ? 36  HIS B ND1 1 
ATOM   965  C CD2 . HIS B 1 36 ? 4.762  42.963 55.833 1.00 10.15  ? 36  HIS B CD2 1 
ATOM   966  C CE1 . HIS B 1 36 ? 4.884  44.598 54.462 1.00 11.66  ? 36  HIS B CE1 1 
ATOM   967  N NE2 . HIS B 1 36 ? 5.005  44.233 55.713 1.00 12.42  ? 36  HIS B NE2 1 
ATOM   968  N N   . LEU B 1 37 ? 5.635  40.555 51.634 1.00 16.19  ? 37  LEU B N   1 
ATOM   969  C CA  . LEU B 1 37 ? 6.325  41.145 50.488 1.00 15.56  ? 37  LEU B CA  1 
ATOM   970  C C   . LEU B 1 37 ? 6.035  42.633 50.491 1.00 15.69  ? 37  LEU B C   1 
ATOM   971  O O   . LEU B 1 37 ? 5.053  43.136 51.026 1.00 14.75  ? 37  LEU B O   1 
ATOM   972  C CB  . LEU B 1 37 ? 5.865  40.537 49.136 1.00 11.74  ? 37  LEU B CB  1 
ATOM   973  C CG  . LEU B 1 37 ? 6.002  39.016 49.026 1.00 12.95  ? 37  LEU B CG  1 
ATOM   974  C CD1 . LEU B 1 37 ? 5.297  38.581 47.767 1.00 10.39  ? 37  LEU B CD1 1 
ATOM   975  C CD2 . LEU B 1 37 ? 7.466  38.567 49.003 1.00 11.03  ? 37  LEU B CD2 1 
ATOM   976  N N   . MET B 1 38 ? 6.947  43.371 49.892 1.00 16.78  ? 38  MET B N   1 
ATOM   977  C CA  . MET B 1 38 ? 6.852  44.811 49.936 1.00 17.06  ? 38  MET B CA  1 
ATOM   978  C C   . MET B 1 38 ? 6.165  45.320 48.677 1.00 17.37  ? 38  MET B C   1 
ATOM   979  O O   . MET B 1 38 ? 6.241  44.697 47.613 1.00 14.80  ? 38  MET B O   1 
ATOM   980  C CB  . MET B 1 38 ? 8.218  45.458 49.992 1.00 17.67  ? 38  MET B CB  1 
ATOM   981  C CG  . MET B 1 38 ? 9.059  45.264 51.235 1.00 19.16  ? 38  MET B CG  1 
ATOM   982  S SD  . MET B 1 38 ? 10.647 46.133 51.044 1.00 19.25  ? 38  MET B SD  1 
ATOM   983  C CE  . MET B 1 38 ? 11.438 44.758 50.292 1.00 9.49   ? 38  MET B CE  1 
ATOM   984  N N   . SER B 1 39 ? 5.496  46.444 48.808 1.00 17.10  ? 39  SER B N   1 
ATOM   985  C CA  . SER B 1 39 ? 4.935  47.127 47.672 1.00 20.71  ? 39  SER B CA  1 
ATOM   986  C C   . SER B 1 39 ? 6.028  48.040 47.116 1.00 21.16  ? 39  SER B C   1 
ATOM   987  O O   . SER B 1 39 ? 7.016  48.313 47.820 1.00 20.05  ? 39  SER B O   1 
ATOM   988  C CB  . SER B 1 39 ? 3.753  47.975 48.116 1.00 21.45  ? 39  SER B CB  1 
ATOM   989  O OG  . SER B 1 39 ? 4.150  49.064 48.954 1.00 23.42  ? 39  SER B OG  1 
ATOM   990  N N   . GLU B 1 40 ? 5.791  48.603 45.933 1.00 20.22  ? 40  GLU B N   1 
ATOM   991  C CA  . GLU B 1 40 ? 6.670  49.575 45.337 1.00 23.11  ? 40  GLU B CA  1 
ATOM   992  C C   . GLU B 1 40 ? 6.914  50.761 46.266 1.00 25.08  ? 40  GLU B C   1 
ATOM   993  O O   . GLU B 1 40 ? 8.055  51.219 46.345 1.00 25.20  ? 40  GLU B O   1 
ATOM   994  C CB  . GLU B 1 40 ? 6.059  50.010 43.977 1.00 30.64  ? 40  GLU B CB  1 
ATOM   995  C CG  . GLU B 1 40 ? 6.945  50.966 43.144 1.00 38.00  ? 40  GLU B CG  1 
ATOM   996  C CD  . GLU B 1 40 ? 6.838  50.929 41.610 1.00 41.82  ? 40  GLU B CD  1 
ATOM   997  O OE1 . GLU B 1 40 ? 6.361  49.953 41.007 1.00 44.14  ? 40  GLU B OE1 1 
ATOM   998  O OE2 . GLU B 1 40 ? 7.281  51.902 41.003 1.00 43.55  ? 40  GLU B OE2 1 
ATOM   999  N N   . GLU B 1 41 ? 5.956  51.246 47.072 1.00 25.96  ? 41  GLU B N   1 
ATOM   1000 C CA  . GLU B 1 41 ? 6.200  52.361 47.983 1.00 28.09  ? 41  GLU B CA  1 
ATOM   1001 C C   . GLU B 1 41 ? 7.193  51.966 49.077 1.00 23.89  ? 41  GLU B C   1 
ATOM   1002 O O   . GLU B 1 41 ? 8.110  52.710 49.420 1.00 22.24  ? 41  GLU B O   1 
ATOM   1003 C CB  . GLU B 1 41 ? 4.843  52.864 48.614 1.00 37.37  ? 41  GLU B CB  1 
ATOM   1004 C CG  . GLU B 1 41 ? 4.355  52.504 50.073 1.00 50.50  ? 41  GLU B CG  1 
ATOM   1005 C CD  . GLU B 1 41 ? 3.102  51.604 50.363 1.00 57.88  ? 41  GLU B CD  1 
ATOM   1006 O OE1 . GLU B 1 41 ? 1.991  51.817 49.839 1.00 61.39  ? 41  GLU B OE1 1 
ATOM   1007 O OE2 . GLU B 1 41 ? 3.234  50.672 51.164 1.00 58.25  ? 41  GLU B OE2 1 
ATOM   1008 N N   . GLU B 1 42 ? 7.105  50.759 49.572 1.00 20.12  ? 42  GLU B N   1 
ATOM   1009 C CA  . GLU B 1 42 ? 7.986  50.308 50.613 1.00 22.11  ? 42  GLU B CA  1 
ATOM   1010 C C   . GLU B 1 42 ? 9.388  50.020 50.120 1.00 21.02  ? 42  GLU B C   1 
ATOM   1011 O O   . GLU B 1 42 ? 10.318 50.380 50.820 1.00 23.66  ? 42  GLU B O   1 
ATOM   1012 C CB  . GLU B 1 42 ? 7.443  49.040 51.256 1.00 22.69  ? 42  GLU B CB  1 
ATOM   1013 C CG  . GLU B 1 42 ? 6.198  49.317 52.055 1.00 26.03  ? 42  GLU B CG  1 
ATOM   1014 C CD  . GLU B 1 42 ? 5.438  48.050 52.290 1.00 27.88  ? 42  GLU B CD  1 
ATOM   1015 O OE1 . GLU B 1 42 ? 4.699  47.642 51.415 1.00 27.82  ? 42  GLU B OE1 1 
ATOM   1016 O OE2 . GLU B 1 42 ? 5.589  47.461 53.343 1.00 33.83  ? 42  GLU B OE2 1 
ATOM   1017 N N   . TRP B 1 43 ? 9.637  49.363 48.989 1.00 20.76  ? 43  TRP B N   1 
ATOM   1018 C CA  . TRP B 1 43 ? 11.014 49.138 48.608 1.00 21.02  ? 43  TRP B CA  1 
ATOM   1019 C C   . TRP B 1 43 ? 11.583 50.434 48.069 1.00 23.92  ? 43  TRP B C   1 
ATOM   1020 O O   . TRP B 1 43 ? 12.764 50.651 48.334 1.00 26.06  ? 43  TRP B O   1 
ATOM   1021 C CB  . TRP B 1 43 ? 11.122 47.977 47.603 1.00 13.71  ? 43  TRP B CB  1 
ATOM   1022 C CG  . TRP B 1 43 ? 10.373 47.925 46.292 1.00 12.39  ? 43  TRP B CG  1 
ATOM   1023 C CD1 . TRP B 1 43 ? 9.416  46.961 46.127 1.00 14.48  ? 43  TRP B CD1 1 
ATOM   1024 C CD2 . TRP B 1 43 ? 10.586 48.665 45.151 1.00 14.02  ? 43  TRP B CD2 1 
ATOM   1025 N NE1 . TRP B 1 43 ? 9.016  47.064 44.885 1.00 11.57  ? 43  TRP B NE1 1 
ATOM   1026 C CE2 . TRP B 1 43 ? 9.687  48.052 44.267 1.00 11.67  ? 43  TRP B CE2 1 
ATOM   1027 C CE3 . TRP B 1 43 ? 11.390 49.733 44.710 1.00 14.31  ? 43  TRP B CE3 1 
ATOM   1028 C CZ2 . TRP B 1 43 ? 9.579  48.486 42.940 1.00 14.13  ? 43  TRP B CZ2 1 
ATOM   1029 C CZ3 . TRP B 1 43 ? 11.282 50.171 43.384 1.00 16.97  ? 43  TRP B CZ3 1 
ATOM   1030 C CH2 . TRP B 1 43 ? 10.378 49.546 42.508 1.00 15.59  ? 43  TRP B CH2 1 
ATOM   1031 N N   . ARG B 1 44 ? 10.870 51.365 47.408 1.00 24.82  ? 44  ARG B N   1 
ATOM   1032 C CA  . ARG B 1 44 ? 11.432 52.677 47.109 1.00 26.31  ? 44  ARG B CA  1 
ATOM   1033 C C   . ARG B 1 44 ? 11.824 53.443 48.347 1.00 28.64  ? 44  ARG B C   1 
ATOM   1034 O O   . ARG B 1 44 ? 12.839 54.135 48.339 1.00 31.09  ? 44  ARG B O   1 
ATOM   1035 C CB  . ARG B 1 44 ? 10.506 53.603 46.425 1.00 26.62  ? 44  ARG B CB  1 
ATOM   1036 C CG  . ARG B 1 44 ? 10.403 53.172 45.031 1.00 34.72  ? 44  ARG B CG  1 
ATOM   1037 C CD  . ARG B 1 44 ? 9.558  54.142 44.282 1.00 38.69  ? 44  ARG B CD  1 
ATOM   1038 N NE  . ARG B 1 44 ? 9.437  53.625 42.944 1.00 44.40  ? 44  ARG B NE  1 
ATOM   1039 C CZ  . ARG B 1 44 ? 10.408 53.783 42.046 1.00 47.32  ? 44  ARG B CZ  1 
ATOM   1040 N NH1 . ARG B 1 44 ? 11.551 54.442 42.332 1.00 45.99  ? 44  ARG B NH1 1 
ATOM   1041 N NH2 . ARG B 1 44 ? 10.213 53.211 40.854 1.00 48.40  ? 44  ARG B NH2 1 
ATOM   1042 N N   . ARG B 1 45 ? 11.056 53.380 49.429 1.00 32.40  ? 45  ARG B N   1 
ATOM   1043 C CA  . ARG B 1 45 ? 11.417 54.028 50.689 1.00 35.28  ? 45  ARG B CA  1 
ATOM   1044 C C   . ARG B 1 45 ? 12.727 53.474 51.226 1.00 34.53  ? 45  ARG B C   1 
ATOM   1045 O O   . ARG B 1 45 ? 13.464 54.255 51.809 1.00 35.80  ? 45  ARG B O   1 
ATOM   1046 C CB  . ARG B 1 45 ? 10.321 53.803 51.715 1.00 41.17  ? 45  ARG B CB  1 
ATOM   1047 C CG  . ARG B 1 45 ? 9.653  55.052 52.243 1.00 47.56  ? 45  ARG B CG  1 
ATOM   1048 C CD  . ARG B 1 45 ? 8.143  54.862 52.477 1.00 55.02  ? 45  ARG B CD  1 
ATOM   1049 N NE  . ARG B 1 45 ? 7.809  53.662 53.240 1.00 61.96  ? 45  ARG B NE  1 
ATOM   1050 C CZ  . ARG B 1 45 ? 6.551  53.215 53.385 1.00 64.87  ? 45  ARG B CZ  1 
ATOM   1051 N NH1 . ARG B 1 45 ? 5.494  53.845 52.850 1.00 68.04  ? 45  ARG B NH1 1 
ATOM   1052 N NH2 . ARG B 1 45 ? 6.366  52.067 54.035 1.00 66.48  ? 45  ARG B NH2 1 
ATOM   1053 N N   . LEU B 1 46 ? 13.043 52.169 51.081 1.00 33.21  ? 46  LEU B N   1 
ATOM   1054 C CA  . LEU B 1 46 ? 14.359 51.625 51.410 1.00 30.94  ? 46  LEU B CA  1 
ATOM   1055 C C   . LEU B 1 46 ? 15.476 52.189 50.535 1.00 31.77  ? 46  LEU B C   1 
ATOM   1056 O O   . LEU B 1 46 ? 16.660 52.003 50.829 1.00 29.60  ? 46  LEU B O   1 
ATOM   1057 C CB  . LEU B 1 46 ? 14.389 50.147 51.224 1.00 32.15  ? 46  LEU B CB  1 
ATOM   1058 C CG  . LEU B 1 46 ? 13.933 49.352 52.405 1.00 37.24  ? 46  LEU B CG  1 
ATOM   1059 C CD1 . LEU B 1 46 ? 13.631 47.968 51.927 1.00 39.58  ? 46  LEU B CD1 1 
ATOM   1060 C CD2 . LEU B 1 46 ? 15.000 49.294 53.477 1.00 34.15  ? 46  LEU B CD2 1 
ATOM   1061 N N   . GLY B 1 47 ? 15.157 52.849 49.417 1.00 29.40  ? 47  GLY B N   1 
ATOM   1062 C CA  . GLY B 1 47 ? 16.154 53.426 48.545 1.00 27.77  ? 47  GLY B CA  1 
ATOM   1063 C C   . GLY B 1 47 ? 16.427 52.631 47.273 1.00 28.48  ? 47  GLY B C   1 
ATOM   1064 O O   . GLY B 1 47 ? 17.404 52.957 46.587 1.00 26.95  ? 47  GLY B O   1 
ATOM   1065 N N   . VAL B 1 48 ? 15.630 51.617 46.902 1.00 26.07  ? 48  VAL B N   1 
ATOM   1066 C CA  . VAL B 1 48 ? 15.846 50.841 45.696 1.00 26.92  ? 48  VAL B CA  1 
ATOM   1067 C C   . VAL B 1 48 ? 15.327 51.725 44.596 1.00 29.24  ? 48  VAL B C   1 
ATOM   1068 O O   . VAL B 1 48 ? 14.166 52.106 44.688 1.00 31.39  ? 48  VAL B O   1 
ATOM   1069 C CB  . VAL B 1 48 ? 15.050 49.547 45.735 1.00 24.31  ? 48  VAL B CB  1 
ATOM   1070 C CG1 . VAL B 1 48 ? 15.297 48.677 44.524 1.00 21.87  ? 48  VAL B CG1 1 
ATOM   1071 C CG2 . VAL B 1 48 ? 15.500 48.796 46.962 1.00 25.52  ? 48  VAL B CG2 1 
ATOM   1072 N N   . GLN B 1 49 ? 16.137 52.069 43.595 1.00 29.86  ? 49  GLN B N   1 
ATOM   1073 C CA  . GLN B 1 49 ? 15.716 52.955 42.549 1.00 31.31  ? 49  GLN B CA  1 
ATOM   1074 C C   . GLN B 1 49 ? 15.651 52.067 41.345 1.00 28.15  ? 49  GLN B C   1 
ATOM   1075 O O   . GLN B 1 49 ? 16.637 51.472 40.919 1.00 30.45  ? 49  GLN B O   1 
ATOM   1076 C CB  . GLN B 1 49 ? 16.747 54.108 42.457 1.00 41.24  ? 49  GLN B CB  1 
ATOM   1077 C CG  . GLN B 1 49 ? 18.244 53.769 42.208 1.00 56.76  ? 49  GLN B CG  1 
ATOM   1078 C CD  . GLN B 1 49 ? 19.274 54.901 42.388 1.00 64.42  ? 49  GLN B CD  1 
ATOM   1079 O OE1 . GLN B 1 49 ? 19.944 55.365 41.449 1.00 67.83  ? 49  GLN B OE1 1 
ATOM   1080 N NE2 . GLN B 1 49 ? 19.477 55.372 43.619 1.00 65.06  ? 49  GLN B NE2 1 
ATOM   1081 N N   . GLN B 1 50 ? 14.448 51.852 40.846 1.00 27.24  ? 50  GLN B N   1 
ATOM   1082 C CA  . GLN B 1 50 ? 14.185 50.948 39.714 1.00 25.29  ? 50  GLN B CA  1 
ATOM   1083 C C   . GLN B 1 50 ? 13.091 51.555 38.875 1.00 23.76  ? 50  GLN B C   1 
ATOM   1084 O O   . GLN B 1 50 ? 12.369 52.402 39.395 1.00 25.07  ? 50  GLN B O   1 
ATOM   1085 C CB  . GLN B 1 50 ? 13.634 49.608 40.131 1.00 23.88  ? 50  GLN B CB  1 
ATOM   1086 C CG  . GLN B 1 50 ? 14.588 48.818 40.941 1.00 24.59  ? 50  GLN B CG  1 
ATOM   1087 C CD  . GLN B 1 50 ? 14.052 47.450 41.193 1.00 23.31  ? 50  GLN B CD  1 
ATOM   1088 O OE1 . GLN B 1 50 ? 14.540 46.488 40.626 1.00 25.33  ? 50  GLN B OE1 1 
ATOM   1089 N NE2 . GLN B 1 50 ? 13.058 47.266 42.038 1.00 23.46  ? 50  GLN B NE2 1 
ATOM   1090 N N   . SER B 1 51 ? 12.853 51.190 37.638 1.00 22.75  ? 51  SER B N   1 
ATOM   1091 C CA  . SER B 1 51 ? 11.732 51.804 36.985 1.00 21.88  ? 51  SER B CA  1 
ATOM   1092 C C   . SER B 1 51 ? 10.470 51.022 37.337 1.00 21.03  ? 51  SER B C   1 
ATOM   1093 O O   . SER B 1 51 ? 10.433 50.081 38.142 1.00 19.99  ? 51  SER B O   1 
ATOM   1094 C CB  . SER B 1 51 ? 12.050 51.869 35.474 1.00 18.75  ? 51  SER B CB  1 
ATOM   1095 O OG  . SER B 1 51 ? 12.322 50.635 34.880 1.00 22.27  ? 51  SER B OG  1 
ATOM   1096 N N   . LEU B 1 52 ? 9.374  51.563 36.796 1.00 22.27  ? 52  LEU B N   1 
ATOM   1097 C CA  . LEU B 1 52 ? 7.993  51.149 37.019 1.00 19.02  ? 52  LEU B CA  1 
ATOM   1098 C C   . LEU B 1 52 ? 7.760  49.700 36.725 1.00 18.22  ? 52  LEU B C   1 
ATOM   1099 O O   . LEU B 1 52 ? 8.158  49.198 35.673 1.00 16.23  ? 52  LEU B O   1 
ATOM   1100 C CB  . LEU B 1 52 ? 7.046  51.950 36.113 1.00 20.79  ? 52  LEU B CB  1 
ATOM   1101 C CG  . LEU B 1 52 ? 5.560  52.349 36.343 1.00 21.71  ? 52  LEU B CG  1 
ATOM   1102 C CD1 . LEU B 1 52 ? 4.873  51.959 35.058 1.00 17.85  ? 52  LEU B CD1 1 
ATOM   1103 C CD2 . LEU B 1 52 ? 4.922  51.770 37.602 1.00 18.19  ? 52  LEU B CD2 1 
ATOM   1104 N N   . GLY B 1 53 ? 7.117  49.026 37.675 1.00 17.56  ? 53  GLY B N   1 
ATOM   1105 C CA  . GLY B 1 53 ? 6.608  47.712 37.370 1.00 12.58  ? 53  GLY B CA  1 
ATOM   1106 C C   . GLY B 1 53 ? 7.371  46.576 37.893 1.00 11.43  ? 53  GLY B C   1 
ATOM   1107 O O   . GLY B 1 53 ? 6.926  45.474 37.638 1.00 9.57   ? 53  GLY B O   1 
ATOM   1108 N N   . TRP B 1 54 ? 8.539  46.776 38.510 1.00 15.29  ? 54  TRP B N   1 
ATOM   1109 C CA  . TRP B 1 54 ? 9.264  45.667 39.142 1.00 14.21  ? 54  TRP B CA  1 
ATOM   1110 C C   . TRP B 1 54 ? 8.475  45.280 40.393 1.00 12.58  ? 54  TRP B C   1 
ATOM   1111 O O   . TRP B 1 54 ? 8.027  46.165 41.126 1.00 15.44  ? 54  TRP B O   1 
ATOM   1112 C CB  . TRP B 1 54 ? 10.664 46.117 39.526 1.00 13.52  ? 54  TRP B CB  1 
ATOM   1113 C CG  . TRP B 1 54 ? 11.610 46.210 38.343 1.00 14.67  ? 54  TRP B CG  1 
ATOM   1114 C CD1 . TRP B 1 54 ? 11.933 47.426 37.812 1.00 18.54  ? 54  TRP B CD1 1 
ATOM   1115 C CD2 . TRP B 1 54 ? 12.219 45.167 37.697 1.00 16.04  ? 54  TRP B CD2 1 
ATOM   1116 N NE1 . TRP B 1 54 ? 12.756 47.163 36.824 1.00 20.07  ? 54  TRP B NE1 1 
ATOM   1117 C CE2 . TRP B 1 54 ? 12.952 45.845 36.711 1.00 17.10  ? 54  TRP B CE2 1 
ATOM   1118 C CE3 . TRP B 1 54 ? 12.274 43.772 37.758 1.00 16.22  ? 54  TRP B CE3 1 
ATOM   1119 C CZ2 . TRP B 1 54 ? 13.742 45.168 35.782 1.00 18.49  ? 54  TRP B CZ2 1 
ATOM   1120 C CZ3 . TRP B 1 54 ? 13.063 43.084 36.825 1.00 20.24  ? 54  TRP B CZ3 1 
ATOM   1121 C CH2 . TRP B 1 54 ? 13.794 43.777 35.843 1.00 17.88  ? 54  TRP B CH2 1 
ATOM   1122 N N   . VAL B 1 55 ? 8.279  43.987 40.628 1.00 15.01  ? 55  VAL B N   1 
ATOM   1123 C CA  . VAL B 1 55 ? 7.483  43.444 41.736 1.00 14.24  ? 55  VAL B CA  1 
ATOM   1124 C C   . VAL B 1 55 ? 8.383  42.664 42.706 1.00 13.18  ? 55  VAL B C   1 
ATOM   1125 O O   . VAL B 1 55 ? 9.124  41.768 42.241 1.00 10.60  ? 55  VAL B O   1 
ATOM   1126 C CB  . VAL B 1 55 ? 6.367  42.463 41.194 1.00 14.42  ? 55  VAL B CB  1 
ATOM   1127 C CG1 . VAL B 1 55 ? 5.647  41.817 42.380 1.00 13.02  ? 55  VAL B CG1 1 
ATOM   1128 C CG2 . VAL B 1 55 ? 5.399  43.207 40.277 1.00 9.60   ? 55  VAL B CG2 1 
ATOM   1129 N N   . HIS B 1 56 ? 8.353  42.969 44.013 1.00 11.86  ? 56  HIS B N   1 
ATOM   1130 C CA  . HIS B 1 56 ? 9.019  42.143 45.014 1.00 10.22  ? 56  HIS B CA  1 
ATOM   1131 C C   . HIS B 1 56 ? 8.139  40.868 45.171 1.00 11.19  ? 56  HIS B C   1 
ATOM   1132 O O   . HIS B 1 56 ? 7.108  40.835 45.868 1.00 15.44  ? 56  HIS B O   1 
ATOM   1133 C CB  . HIS B 1 56 ? 9.180  42.978 46.359 1.00 9.53   ? 56  HIS B CB  1 
ATOM   1134 C CG  . HIS B 1 56 ? 9.878  42.232 47.523 1.00 11.57  ? 56  HIS B CG  1 
ATOM   1135 N ND1 . HIS B 1 56 ? 9.674  42.275 48.854 1.00 10.69  ? 56  HIS B ND1 1 
ATOM   1136 C CD2 . HIS B 1 56 ? 10.895 41.309 47.339 1.00 12.96  ? 56  HIS B CD2 1 
ATOM   1137 C CE1 . HIS B 1 56 ? 10.497 41.437 49.450 1.00 10.63  ? 56  HIS B CE1 1 
ATOM   1138 N NE2 . HIS B 1 56 ? 11.223 40.866 48.523 1.00 15.18  ? 56  HIS B NE2 1 
ATOM   1139 N N   . TYR B 1 57 ? 8.551  39.745 44.565 1.00 8.88   ? 57  TYR B N   1 
ATOM   1140 C CA  . TYR B 1 57 ? 7.730  38.554 44.447 1.00 10.06  ? 57  TYR B CA  1 
ATOM   1141 C C   . TYR B 1 57 ? 8.091  37.355 45.303 1.00 10.38  ? 57  TYR B C   1 
ATOM   1142 O O   . TYR B 1 57 ? 7.306  36.398 45.352 1.00 12.59  ? 57  TYR B O   1 
ATOM   1143 C CB  . TYR B 1 57 ? 7.698  38.079 42.946 1.00 9.49   ? 57  TYR B CB  1 
ATOM   1144 C CG  . TYR B 1 57 ? 8.952  37.354 42.433 1.00 10.68  ? 57  TYR B CG  1 
ATOM   1145 C CD1 . TYR B 1 57 ? 10.114 38.045 42.075 1.00 11.01  ? 57  TYR B CD1 1 
ATOM   1146 C CD2 . TYR B 1 57 ? 8.947  35.953 42.389 1.00 13.41  ? 57  TYR B CD2 1 
ATOM   1147 C CE1 . TYR B 1 57 ? 11.266 37.349 41.689 1.00 10.00  ? 57  TYR B CE1 1 
ATOM   1148 C CE2 . TYR B 1 57 ? 10.092 35.257 42.002 1.00 13.96  ? 57  TYR B CE2 1 
ATOM   1149 C CZ  . TYR B 1 57 ? 11.245 35.963 41.657 1.00 15.62  ? 57  TYR B CZ  1 
ATOM   1150 O OH  . TYR B 1 57 ? 12.378 35.242 41.305 1.00 19.18  ? 57  TYR B OH  1 
ATOM   1151 N N   . MET B 1 58 ? 9.277  37.348 45.920 1.00 13.13  ? 58  MET B N   1 
ATOM   1152 C CA  . MET B 1 58 ? 9.765  36.199 46.668 1.00 13.90  ? 58  MET B CA  1 
ATOM   1153 C C   . MET B 1 58 ? 10.852 36.717 47.577 1.00 15.68  ? 58  MET B C   1 
ATOM   1154 O O   . MET B 1 58 ? 11.580 37.689 47.266 1.00 15.43  ? 58  MET B O   1 
ATOM   1155 C CB  . MET B 1 58 ? 10.365 35.185 45.745 1.00 13.36  ? 58  MET B CB  1 
ATOM   1156 C CG  . MET B 1 58 ? 10.764 33.933 46.436 1.00 20.43  ? 58  MET B CG  1 
ATOM   1157 S SD  . MET B 1 58 ? 11.198 32.737 45.195 1.00 27.79  ? 58  MET B SD  1 
ATOM   1158 C CE  . MET B 1 58 ? 12.947 32.798 45.183 1.00 28.21  ? 58  MET B CE  1 
ATOM   1159 N N   . ILE B 1 59 ? 10.855 36.031 48.729 1.00 17.30  ? 59  ILE B N   1 
ATOM   1160 C CA  . ILE B 1 59 ? 11.811 36.235 49.804 1.00 19.26  ? 59  ILE B CA  1 
ATOM   1161 C C   . ILE B 1 59 ? 12.931 35.277 49.434 1.00 20.68  ? 59  ILE B C   1 
ATOM   1162 O O   . ILE B 1 59 ? 12.691 34.141 49.020 1.00 16.62  ? 59  ILE B O   1 
ATOM   1163 C CB  . ILE B 1 59 ? 11.152 35.895 51.205 1.00 18.39  ? 59  ILE B CB  1 
ATOM   1164 C CG1 . ILE B 1 59 ? 10.141 36.986 51.558 1.00 14.34  ? 59  ILE B CG1 1 
ATOM   1165 C CG2 . ILE B 1 59 ? 12.208 35.732 52.295 1.00 21.10  ? 59  ILE B CG2 1 
ATOM   1166 C CD1 . ILE B 1 59 ? 10.664 38.421 51.685 1.00 18.68  ? 59  ILE B CD1 1 
ATOM   1167 N N   . HIS B 1 60 ? 14.183 35.739 49.507 1.00 26.25  ? 60  HIS B N   1 
ATOM   1168 C CA  . HIS B 1 60 ? 15.307 34.882 49.160 1.00 29.93  ? 60  HIS B CA  1 
ATOM   1169 C C   . HIS B 1 60 ? 15.433 33.874 50.279 1.00 31.42  ? 60  HIS B C   1 
ATOM   1170 O O   . HIS B 1 60 ? 15.211 34.184 51.458 1.00 29.31  ? 60  HIS B O   1 
ATOM   1171 C CB  . HIS B 1 60 ? 16.607 35.688 49.042 1.00 32.66  ? 60  HIS B CB  1 
ATOM   1172 C CG  . HIS B 1 60 ? 17.838 34.870 48.671 1.00 36.19  ? 60  HIS B CG  1 
ATOM   1173 N ND1 . HIS B 1 60 ? 18.953 34.745 49.381 1.00 41.49  ? 60  HIS B ND1 1 
ATOM   1174 C CD2 . HIS B 1 60 ? 17.998 34.110 47.539 1.00 38.59  ? 60  HIS B CD2 1 
ATOM   1175 C CE1 . HIS B 1 60 ? 19.776 33.950 48.749 1.00 40.38  ? 60  HIS B CE1 1 
ATOM   1176 N NE2 . HIS B 1 60 ? 19.190 33.577 47.641 1.00 40.69  ? 60  HIS B NE2 1 
ATOM   1177 N N   . GLU B 1 61 ? 15.668 32.647 49.848 1.00 34.27  ? 61  GLU B N   1 
ATOM   1178 C CA  . GLU B 1 61 ? 15.920 31.587 50.790 1.00 43.00  ? 61  GLU B CA  1 
ATOM   1179 C C   . GLU B 1 61 ? 17.051 31.914 51.765 1.00 47.15  ? 61  GLU B C   1 
ATOM   1180 O O   . GLU B 1 61 ? 18.071 32.488 51.333 1.00 45.71  ? 61  GLU B O   1 
ATOM   1181 C CB  . GLU B 1 61 ? 16.244 30.329 50.029 1.00 48.08  ? 61  GLU B CB  1 
ATOM   1182 C CG  . GLU B 1 61 ? 17.168 30.490 48.857 1.00 58.28  ? 61  GLU B CG  1 
ATOM   1183 C CD  . GLU B 1 61 ? 17.597 29.134 48.352 1.00 65.39  ? 61  GLU B CD  1 
ATOM   1184 O OE1 . GLU B 1 61 ? 18.547 28.585 48.933 1.00 70.05  ? 61  GLU B OE1 1 
ATOM   1185 O OE2 . GLU B 1 61 ? 16.973 28.645 47.399 1.00 68.57  ? 61  GLU B OE2 1 
ATOM   1186 N N   . PRO B 1 62 ? 16.886 31.626 53.076 1.00 50.97  ? 62  PRO B N   1 
ATOM   1187 C CA  . PRO B 1 62 ? 17.826 32.037 54.112 1.00 52.95  ? 62  PRO B CA  1 
ATOM   1188 C C   . PRO B 1 62 ? 19.038 31.118 54.053 1.00 54.55  ? 62  PRO B C   1 
ATOM   1189 O O   . PRO B 1 62 ? 18.913 29.881 53.920 1.00 55.49  ? 62  PRO B O   1 
ATOM   1190 C CB  . PRO B 1 62 ? 17.017 31.934 55.387 1.00 53.11  ? 62  PRO B CB  1 
ATOM   1191 C CG  . PRO B 1 62 ? 15.570 31.793 54.928 1.00 50.72  ? 62  PRO B CG  1 
ATOM   1192 C CD  . PRO B 1 62 ? 15.744 30.943 53.689 1.00 50.10  ? 62  PRO B CD  1 
ATOM   1193 N N   . GLU B 1 63 ? 20.223 31.730 54.094 1.00 56.20  ? 63  GLU B N   1 
ATOM   1194 C CA  . GLU B 1 63 ? 21.447 30.946 54.104 1.00 55.79  ? 63  GLU B CA  1 
ATOM   1195 C C   . GLU B 1 63 ? 21.780 30.468 55.515 1.00 54.03  ? 63  GLU B C   1 
ATOM   1196 O O   . GLU B 1 63 ? 21.521 31.174 56.506 1.00 51.44  ? 63  GLU B O   1 
ATOM   1197 C CB  . GLU B 1 63 ? 22.578 31.778 53.524 1.00 58.18  ? 63  GLU B CB  1 
ATOM   1198 C CG  . GLU B 1 63 ? 22.303 32.040 52.049 1.00 64.46  ? 63  GLU B CG  1 
ATOM   1199 C CD  . GLU B 1 63 ? 22.122 30.840 51.096 1.00 70.16  ? 63  GLU B CD  1 
ATOM   1200 O OE1 . GLU B 1 63 ? 22.400 29.688 51.453 1.00 71.15  ? 63  GLU B OE1 1 
ATOM   1201 O OE2 . GLU B 1 63 ? 21.697 31.065 49.957 1.00 73.67  ? 63  GLU B OE2 1 
ATOM   1202 N N   . PRO B 1 64 ? 22.243 29.223 55.697 1.00 53.51  ? 64  PRO B N   1 
ATOM   1203 C CA  . PRO B 1 64 ? 22.662 28.714 56.995 1.00 52.01  ? 64  PRO B CA  1 
ATOM   1204 C C   . PRO B 1 64 ? 23.826 29.540 57.523 1.00 49.77  ? 64  PRO B C   1 
ATOM   1205 O O   . PRO B 1 64 ? 24.457 30.340 56.813 1.00 48.57  ? 64  PRO B O   1 
ATOM   1206 C CB  . PRO B 1 64 ? 23.004 27.265 56.741 1.00 51.50  ? 64  PRO B CB  1 
ATOM   1207 C CG  . PRO B 1 64 ? 22.044 26.926 55.625 1.00 54.14  ? 64  PRO B CG  1 
ATOM   1208 C CD  . PRO B 1 64 ? 22.218 28.142 54.717 1.00 54.11  ? 64  PRO B CD  1 
ATOM   1209 N N   . HIS B 1 65 ? 24.090 29.321 58.811 1.00 48.67  ? 65  HIS B N   1 
ATOM   1210 C CA  . HIS B 1 65 ? 25.125 30.045 59.567 1.00 43.02  ? 65  HIS B CA  1 
ATOM   1211 C C   . HIS B 1 65 ? 26.056 28.869 59.810 1.00 35.91  ? 65  HIS B C   1 
ATOM   1212 O O   . HIS B 1 65 ? 25.717 27.836 60.407 1.00 30.19  ? 65  HIS B O   1 
ATOM   1213 C CB  . HIS B 1 65 ? 24.527 30.606 60.852 1.00 49.33  ? 65  HIS B CB  1 
ATOM   1214 C CG  . HIS B 1 65 ? 23.006 30.778 60.732 1.00 55.98  ? 65  HIS B CG  1 
ATOM   1215 N ND1 . HIS B 1 65 ? 22.128 29.774 60.696 1.00 57.65  ? 65  HIS B ND1 1 
ATOM   1216 C CD2 . HIS B 1 65 ? 22.305 31.953 60.590 1.00 58.15  ? 65  HIS B CD2 1 
ATOM   1217 C CE1 . HIS B 1 65 ? 20.941 30.272 60.527 1.00 59.13  ? 65  HIS B CE1 1 
ATOM   1218 N NE2 . HIS B 1 65 ? 21.056 31.580 60.462 1.00 61.25  ? 65  HIS B NE2 1 
ATOM   1219 N N   . ILE B 1 66 ? 27.138 29.006 59.074 1.00 30.85  ? 66  ILE B N   1 
ATOM   1220 C CA  . ILE B 1 66 ? 28.089 27.935 58.933 1.00 29.16  ? 66  ILE B CA  1 
ATOM   1221 C C   . ILE B 1 66 ? 29.292 28.262 59.773 1.00 26.41  ? 66  ILE B C   1 
ATOM   1222 O O   . ILE B 1 66 ? 29.843 29.361 59.706 1.00 26.57  ? 66  ILE B O   1 
ATOM   1223 C CB  . ILE B 1 66 ? 28.514 27.800 57.447 1.00 29.24  ? 66  ILE B CB  1 
ATOM   1224 C CG1 . ILE B 1 66 ? 27.314 27.420 56.651 1.00 28.04  ? 66  ILE B CG1 1 
ATOM   1225 C CG2 . ILE B 1 66 ? 29.588 26.749 57.245 1.00 24.45  ? 66  ILE B CG2 1 
ATOM   1226 C CD1 . ILE B 1 66 ? 27.468 28.089 55.297 1.00 27.51  ? 66  ILE B CD1 1 
ATOM   1227 N N   . LEU B 1 67 ? 29.706 27.291 60.554 1.00 23.70  ? 67  LEU B N   1 
ATOM   1228 C CA  . LEU B 1 67 ? 30.980 27.441 61.220 1.00 22.68  ? 67  LEU B CA  1 
ATOM   1229 C C   . LEU B 1 67 ? 32.013 26.580 60.439 1.00 17.00  ? 67  LEU B C   1 
ATOM   1230 O O   . LEU B 1 67 ? 31.736 25.447 60.032 1.00 17.26  ? 67  LEU B O   1 
ATOM   1231 C CB  . LEU B 1 67 ? 30.841 26.981 62.701 1.00 23.85  ? 67  LEU B CB  1 
ATOM   1232 C CG  . LEU B 1 67 ? 29.767 27.553 63.631 1.00 24.98  ? 67  LEU B CG  1 
ATOM   1233 C CD1 . LEU B 1 67 ? 29.851 26.844 64.976 1.00 21.62  ? 67  LEU B CD1 1 
ATOM   1234 C CD2 . LEU B 1 67 ? 29.947 29.027 63.784 1.00 22.22  ? 67  LEU B CD2 1 
ATOM   1235 N N   . LEU B 1 68 ? 33.208 27.056 60.177 1.00 15.25  ? 68  LEU B N   1 
ATOM   1236 C CA  . LEU B 1 68 ? 34.219 26.256 59.520 1.00 17.16  ? 68  LEU B CA  1 
ATOM   1237 C C   . LEU B 1 68 ? 35.271 25.777 60.523 1.00 11.72  ? 68  LEU B C   1 
ATOM   1238 O O   . LEU B 1 68 ? 35.848 26.572 61.311 1.00 11.27  ? 68  LEU B O   1 
ATOM   1239 C CB  . LEU B 1 68 ? 34.859 27.093 58.390 1.00 20.55  ? 68  LEU B CB  1 
ATOM   1240 C CG  . LEU B 1 68 ? 33.894 27.641 57.312 1.00 27.68  ? 68  LEU B CG  1 
ATOM   1241 C CD1 . LEU B 1 68 ? 33.525 29.044 57.676 1.00 27.34  ? 68  LEU B CD1 1 
ATOM   1242 C CD2 . LEU B 1 68 ? 34.558 27.888 55.988 1.00 30.61  ? 68  LEU B CD2 1 
ATOM   1243 N N   . PHE B 1 69 ? 35.520 24.468 60.485 1.00 10.04  ? 69  PHE B N   1 
ATOM   1244 C CA  . PHE B 1 69 ? 36.510 23.804 61.350 1.00 13.14  ? 69  PHE B CA  1 
ATOM   1245 C C   . PHE B 1 69 ? 37.591 23.142 60.519 1.00 13.62  ? 69  PHE B C   1 
ATOM   1246 O O   . PHE B 1 69 ? 37.337 22.614 59.431 1.00 15.49  ? 69  PHE B O   1 
ATOM   1247 C CB  . PHE B 1 69 ? 35.863 22.713 62.247 1.00 14.24  ? 69  PHE B CB  1 
ATOM   1248 C CG  . PHE B 1 69 ? 34.988 23.286 63.378 1.00 14.82  ? 69  PHE B CG  1 
ATOM   1249 C CD1 . PHE B 1 69 ? 35.573 23.687 64.576 1.00 12.92  ? 69  PHE B CD1 1 
ATOM   1250 C CD2 . PHE B 1 69 ? 33.605 23.465 63.199 1.00 18.68  ? 69  PHE B CD2 1 
ATOM   1251 C CE1 . PHE B 1 69 ? 34.797 24.258 65.588 1.00 14.11  ? 69  PHE B CE1 1 
ATOM   1252 C CE2 . PHE B 1 69 ? 32.824 24.042 64.221 1.00 17.70  ? 69  PHE B CE2 1 
ATOM   1253 C CZ  . PHE B 1 69 ? 33.428 24.434 65.425 1.00 15.11  ? 69  PHE B CZ  1 
ATOM   1254 N N   . ARG B 1 70 ? 38.817 23.171 61.023 1.00 15.03  ? 70  ARG B N   1 
ATOM   1255 C CA  . ARG B 1 70 ? 39.985 22.612 60.352 1.00 15.89  ? 70  ARG B CA  1 
ATOM   1256 C C   . ARG B 1 70 ? 40.789 21.851 61.383 1.00 18.53  ? 70  ARG B C   1 
ATOM   1257 O O   . ARG B 1 70 ? 40.768 22.195 62.572 1.00 16.01  ? 70  ARG B O   1 
ATOM   1258 C CB  . ARG B 1 70 ? 40.849 23.718 59.829 1.00 17.88  ? 70  ARG B CB  1 
ATOM   1259 C CG  . ARG B 1 70 ? 42.049 23.326 59.070 1.00 20.61  ? 70  ARG B CG  1 
ATOM   1260 C CD  . ARG B 1 70 ? 42.683 24.603 58.629 1.00 20.07  ? 70  ARG B CD  1 
ATOM   1261 N NE  . ARG B 1 70 ? 43.399 25.201 59.726 1.00 25.86  ? 70  ARG B NE  1 
ATOM   1262 C CZ  . ARG B 1 70 ? 44.280 26.195 59.566 1.00 27.84  ? 70  ARG B CZ  1 
ATOM   1263 N NH1 . ARG B 1 70 ? 44.560 26.711 58.384 1.00 25.69  ? 70  ARG B NH1 1 
ATOM   1264 N NH2 . ARG B 1 70 ? 44.893 26.703 60.629 1.00 30.41  ? 70  ARG B NH2 1 
ATOM   1265 N N   . ARG B 1 71 ? 41.443 20.775 61.023 1.00 18.60  ? 71  ARG B N   1 
ATOM   1266 C CA  . ARG B 1 71 ? 42.382 20.203 61.942 1.00 19.15  ? 71  ARG B CA  1 
ATOM   1267 C C   . ARG B 1 71 ? 43.455 19.536 61.099 1.00 20.77  ? 71  ARG B C   1 
ATOM   1268 O O   . ARG B 1 71 ? 43.170 19.066 59.993 1.00 18.55  ? 71  ARG B O   1 
ATOM   1269 C CB  . ARG B 1 71 ? 41.742 19.173 62.889 1.00 16.10  ? 71  ARG B CB  1 
ATOM   1270 C CG  . ARG B 1 71 ? 41.345 17.874 62.383 1.00 9.65   ? 71  ARG B CG  1 
ATOM   1271 C CD  . ARG B 1 71 ? 41.152 17.073 63.614 1.00 11.25  ? 71  ARG B CD  1 
ATOM   1272 N NE  . ARG B 1 71 ? 40.501 15.839 63.229 1.00 22.39  ? 71  ARG B NE  1 
ATOM   1273 C CZ  . ARG B 1 71 ? 39.682 15.125 64.023 1.00 26.46  ? 71  ARG B CZ  1 
ATOM   1274 N NH1 . ARG B 1 71 ? 39.404 15.521 65.266 1.00 29.83  ? 71  ARG B NH1 1 
ATOM   1275 N NH2 . ARG B 1 71 ? 39.115 14.010 63.553 1.00 22.31  ? 71  ARG B NH2 1 
ATOM   1276 N N   . PRO B 1 72 ? 44.711 19.531 61.565 1.00 21.24  ? 72  PRO B N   1 
ATOM   1277 C CA  . PRO B 1 72 ? 45.831 18.873 60.896 1.00 18.68  ? 72  PRO B CA  1 
ATOM   1278 C C   . PRO B 1 72 ? 45.632 17.399 60.647 1.00 17.13  ? 72  PRO B C   1 
ATOM   1279 O O   . PRO B 1 72 ? 45.094 16.683 61.509 1.00 16.52  ? 72  PRO B O   1 
ATOM   1280 C CB  . PRO B 1 72 ? 47.026 19.172 61.808 1.00 21.33  ? 72  PRO B CB  1 
ATOM   1281 C CG  . PRO B 1 72 ? 46.368 19.370 63.185 1.00 25.30  ? 72  PRO B CG  1 
ATOM   1282 C CD  . PRO B 1 72 ? 45.137 20.189 62.809 1.00 20.24  ? 72  PRO B CD  1 
ATOM   1283 N N   . LEU B 1 73 ? 46.034 16.954 59.454 1.00 14.61  ? 73  LEU B N   1 
ATOM   1284 C CA  . LEU B 1 73 ? 46.031 15.522 59.174 1.00 18.62  ? 73  LEU B CA  1 
ATOM   1285 C C   . LEU B 1 73 ? 47.212 14.938 59.969 1.00 20.84  ? 73  LEU B C   1 
ATOM   1286 O O   . LEU B 1 73 ? 48.218 15.642 60.239 1.00 19.68  ? 73  LEU B O   1 
ATOM   1287 C CB  . LEU B 1 73 ? 46.273 15.201 57.687 1.00 16.25  ? 73  LEU B CB  1 
ATOM   1288 C CG  . LEU B 1 73 ? 45.251 15.624 56.657 1.00 15.71  ? 73  LEU B CG  1 
ATOM   1289 C CD1 . LEU B 1 73 ? 45.863 15.433 55.333 1.00 10.88  ? 73  LEU B CD1 1 
ATOM   1290 C CD2 . LEU B 1 73 ? 44.002 14.812 56.732 1.00 10.91  ? 73  LEU B CD2 1 
ATOM   1291 N N   . PRO B 1 74 ? 47.165 13.666 60.374 1.00 20.97  ? 74  PRO B N   1 
ATOM   1292 C CA  . PRO B 1 74 ? 48.318 12.887 60.795 1.00 21.83  ? 74  PRO B CA  1 
ATOM   1293 C C   . PRO B 1 74 ? 49.384 13.031 59.726 1.00 23.08  ? 74  PRO B C   1 
ATOM   1294 O O   . PRO B 1 74 ? 49.081 13.077 58.535 1.00 22.76  ? 74  PRO B O   1 
ATOM   1295 C CB  . PRO B 1 74 ? 47.828 11.494 60.910 1.00 21.73  ? 74  PRO B CB  1 
ATOM   1296 C CG  . PRO B 1 74 ? 46.447 11.770 61.430 1.00 24.92  ? 74  PRO B CG  1 
ATOM   1297 C CD  . PRO B 1 74 ? 45.971 12.853 60.457 1.00 23.11  ? 74  PRO B CD  1 
ATOM   1298 N N   . LYS B 1 75 ? 50.625 13.088 60.170 1.00 19.89  ? 75  LYS B N   1 
ATOM   1299 C CA  . LYS B 1 75 ? 51.778 13.298 59.329 1.00 21.04  ? 75  LYS B CA  1 
ATOM   1300 C C   . LYS B 1 75 ? 51.865 12.410 58.110 1.00 17.33  ? 75  LYS B C   1 
ATOM   1301 O O   . LYS B 1 75 ? 52.121 12.881 57.007 1.00 16.94  ? 75  LYS B O   1 
ATOM   1302 C CB  . LYS B 1 75 ? 52.999 13.110 60.186 1.00 23.61  ? 75  LYS B CB  1 
ATOM   1303 C CG  . LYS B 1 75 ? 53.100 14.192 61.207 1.00 25.06  ? 75  LYS B CG  1 
ATOM   1304 C CD  . LYS B 1 75 ? 53.271 15.493 60.447 1.00 34.76  ? 75  LYS B CD  1 
ATOM   1305 C CE  . LYS B 1 75 ? 53.526 16.644 61.399 1.00 40.03  ? 75  LYS B CE  1 
ATOM   1306 N NZ  . LYS B 1 75 ? 54.640 16.334 62.291 1.00 47.32  ? 75  LYS B NZ  1 
ATOM   1307 N N   . ASP B 1 76 ? 51.582 11.150 58.354 1.00 15.44  ? 76  ASP B N   1 
ATOM   1308 C CA  . ASP B 1 76 ? 51.641 10.160 57.331 1.00 17.06  ? 76  ASP B CA  1 
ATOM   1309 C C   . ASP B 1 76 ? 50.509 10.213 56.303 1.00 17.69  ? 76  ASP B C   1 
ATOM   1310 O O   . ASP B 1 76 ? 50.446 9.409  55.377 1.00 16.78  ? 76  ASP B O   1 
ATOM   1311 C CB  . ASP B 1 76 ? 51.725 8.818  58.053 1.00 23.47  ? 76  ASP B CB  1 
ATOM   1312 C CG  . ASP B 1 76 ? 50.589 8.334  58.961 1.00 28.38  ? 76  ASP B CG  1 
ATOM   1313 O OD1 . ASP B 1 76 ? 49.482 8.875  58.980 1.00 32.08  ? 76  ASP B OD1 1 
ATOM   1314 O OD2 . ASP B 1 76 ? 50.832 7.360  59.656 1.00 31.44  ? 76  ASP B OD2 1 
ATOM   1315 N N   . GLN B 1 77 ? 49.560 11.130 56.479 1.00 17.36  ? 77  GLN B N   1 
ATOM   1316 C CA  . GLN B 1 77 ? 48.504 11.371 55.507 1.00 17.14  ? 77  GLN B CA  1 
ATOM   1317 C C   . GLN B 1 77 ? 48.733 12.654 54.765 1.00 15.91  ? 77  GLN B C   1 
ATOM   1318 O O   . GLN B 1 77 ? 47.986 12.895 53.813 1.00 17.25  ? 77  GLN B O   1 
ATOM   1319 C CB  . GLN B 1 77 ? 47.156 11.520 56.113 1.00 18.53  ? 77  GLN B CB  1 
ATOM   1320 C CG  . GLN B 1 77 ? 46.651 10.156 56.423 1.00 24.74  ? 77  GLN B CG  1 
ATOM   1321 C CD  . GLN B 1 77 ? 45.400 10.296 57.232 1.00 27.24  ? 77  GLN B CD  1 
ATOM   1322 O OE1 . GLN B 1 77 ? 44.522 11.059 56.851 1.00 30.16  ? 77  GLN B OE1 1 
ATOM   1323 N NE2 . GLN B 1 77 ? 45.296 9.624  58.369 1.00 24.37  ? 77  GLN B NE2 1 
ATOM   1324 N N   . GLN B 1 78 ? 49.736 13.443 55.198 1.00 13.77  ? 78  GLN B N   1 
ATOM   1325 C CA  . GLN B 1 78 ? 50.057 14.689 54.524 1.00 13.29  ? 78  GLN B CA  1 
ATOM   1326 C C   . GLN B 1 78 ? 50.887 14.400 53.280 1.00 14.76  ? 78  GLN B C   1 
ATOM   1327 O O   . GLN B 1 78 ? 51.436 13.302 53.058 1.00 13.35  ? 78  GLN B O   1 
ATOM   1328 C CB  . GLN B 1 78 ? 50.820 15.586 55.435 1.00 13.16  ? 78  GLN B CB  1 
ATOM   1329 C CG  . GLN B 1 78 ? 49.917 15.940 56.594 1.00 16.28  ? 78  GLN B CG  1 
ATOM   1330 C CD  . GLN B 1 78 ? 50.581 16.961 57.463 1.00 23.41  ? 78  GLN B CD  1 
ATOM   1331 O OE1 . GLN B 1 78 ? 51.412 17.751 56.969 1.00 24.69  ? 78  GLN B OE1 1 
ATOM   1332 N NE2 . GLN B 1 78 ? 50.228 16.972 58.753 1.00 20.13  ? 78  GLN B NE2 1 
ATOM   1333 N N   . LYS B 1 79 ? 50.856 15.381 52.405 1.00 17.61  ? 79  LYS B N   1 
ATOM   1334 C CA  . LYS B 1 79 ? 51.517 15.306 51.130 1.00 22.45  ? 79  LYS B CA  1 
ATOM   1335 C C   . LYS B 1 79 ? 52.252 16.634 51.029 1.00 24.35  ? 79  LYS B C   1 
ATOM   1336 O O   . LYS B 1 79 ? 52.963 16.967 51.980 1.00 21.83  ? 79  LYS B O   1 
ATOM   1337 C CB  . LYS B 1 79 ? 50.404 15.053 50.068 1.00 22.39  ? 79  LYS B CB  1 
ATOM   1338 C CG  . LYS B 1 79 ? 50.182 13.520 50.085 1.00 24.81  ? 79  LYS B CG  1 
ATOM   1339 C CD  . LYS B 1 79 ? 48.905 12.891 49.558 1.00 25.88  ? 79  LYS B CD  1 
ATOM   1340 C CE  . LYS B 1 79 ? 49.009 11.382 49.825 1.00 25.56  ? 79  LYS B CE  1 
ATOM   1341 N NZ  . LYS B 1 79 ? 48.350 10.887 51.045 1.00 25.84  ? 79  LYS B NZ  1 
ATOM   1342 O OXT . LYS B 1 79 ? 52.126 17.328 50.026 1.00 33.65  ? 79  LYS B OXT 1 
ATOM   1343 N N   . ALA C 1 2  ? 31.133 13.347 64.347 1.00 96.56  ? 2   ALA C N   1 
ATOM   1344 C CA  . ALA C 1 2  ? 29.861 14.021 64.621 1.00 95.51  ? 2   ALA C CA  1 
ATOM   1345 C C   . ALA C 1 2  ? 28.718 13.460 63.769 1.00 95.14  ? 2   ALA C C   1 
ATOM   1346 O O   . ALA C 1 2  ? 29.049 12.947 62.688 1.00 96.04  ? 2   ALA C O   1 
ATOM   1347 C CB  . ALA C 1 2  ? 30.007 15.457 64.322 1.00 95.55  ? 2   ALA C CB  1 
ATOM   1348 N N   . HIS C 1 3  ? 27.390 13.513 64.032 1.00 94.06  ? 3   HIS C N   1 
ATOM   1349 C CA  . HIS C 1 3  ? 26.428 12.701 63.243 1.00 92.80  ? 3   HIS C CA  1 
ATOM   1350 C C   . HIS C 1 3  ? 24.916 12.985 62.992 1.00 89.17  ? 3   HIS C C   1 
ATOM   1351 O O   . HIS C 1 3  ? 24.252 13.766 63.693 1.00 89.46  ? 3   HIS C O   1 
ATOM   1352 C CB  . HIS C 1 3  ? 26.523 11.265 63.806 1.00 97.20  ? 3   HIS C CB  1 
ATOM   1353 C CG  . HIS C 1 3  ? 27.342 10.229 63.030 1.00 101.78 ? 3   HIS C CG  1 
ATOM   1354 N ND1 . HIS C 1 3  ? 28.468 10.341 62.321 1.00 104.04 ? 3   HIS C ND1 1 
ATOM   1355 C CD2 . HIS C 1 3  ? 26.967 8.904  62.965 1.00 103.77 ? 3   HIS C CD2 1 
ATOM   1356 C CE1 . HIS C 1 3  ? 28.780 9.163  61.840 1.00 105.23 ? 3   HIS C CE1 1 
ATOM   1357 N NE2 . HIS C 1 3  ? 27.869 8.304  62.234 1.00 105.42 ? 3   HIS C NE2 1 
ATOM   1358 N N   . LYS C 1 4  ? 24.418 12.216 61.979 1.00 83.42  ? 4   LYS C N   1 
ATOM   1359 C CA  . LYS C 1 4  ? 23.042 12.038 61.442 1.00 75.97  ? 4   LYS C CA  1 
ATOM   1360 C C   . LYS C 1 4  ? 21.789 12.857 61.784 1.00 69.39  ? 4   LYS C C   1 
ATOM   1361 O O   . LYS C 1 4  ? 20.632 12.410 61.887 1.00 65.94  ? 4   LYS C O   1 
ATOM   1362 C CB  . LYS C 1 4  ? 22.647 10.536 61.601 1.00 78.32  ? 4   LYS C CB  1 
ATOM   1363 C CG  . LYS C 1 4  ? 22.926 9.754  62.894 1.00 82.92  ? 4   LYS C CG  1 
ATOM   1364 C CD  . LYS C 1 4  ? 22.286 10.311 64.173 1.00 86.46  ? 4   LYS C CD  1 
ATOM   1365 C CE  . LYS C 1 4  ? 22.734 9.574  65.450 1.00 87.97  ? 4   LYS C CE  1 
ATOM   1366 N NZ  . LYS C 1 4  ? 24.136 9.783  65.787 1.00 88.53  ? 4   LYS C NZ  1 
ATOM   1367 N N   . GLN C 1 5  ? 22.015 14.145 61.874 1.00 62.49  ? 5   GLN C N   1 
ATOM   1368 C CA  . GLN C 1 5  ? 20.933 15.032 62.178 1.00 55.82  ? 5   GLN C CA  1 
ATOM   1369 C C   . GLN C 1 5  ? 20.345 15.499 60.869 1.00 48.11  ? 5   GLN C C   1 
ATOM   1370 O O   . GLN C 1 5  ? 21.117 15.950 60.019 1.00 48.29  ? 5   GLN C O   1 
ATOM   1371 C CB  . GLN C 1 5  ? 21.484 16.193 62.974 1.00 60.39  ? 5   GLN C CB  1 
ATOM   1372 C CG  . GLN C 1 5  ? 20.427 16.986 63.700 1.00 63.90  ? 5   GLN C CG  1 
ATOM   1373 C CD  . GLN C 1 5  ? 19.607 16.157 64.678 1.00 68.64  ? 5   GLN C CD  1 
ATOM   1374 O OE1 . GLN C 1 5  ? 18.505 16.567 65.035 1.00 72.28  ? 5   GLN C OE1 1 
ATOM   1375 N NE2 . GLN C 1 5  ? 20.002 14.979 65.150 1.00 70.04  ? 5   GLN C NE2 1 
ATOM   1376 N N   . ILE C 1 6  ? 19.028 15.321 60.675 1.00 40.56  ? 6   ILE C N   1 
ATOM   1377 C CA  . ILE C 1 6  ? 18.310 15.931 59.548 1.00 30.55  ? 6   ILE C CA  1 
ATOM   1378 C C   . ILE C 1 6  ? 18.180 17.413 59.929 1.00 26.70  ? 6   ILE C C   1 
ATOM   1379 O O   . ILE C 1 6  ? 17.902 17.750 61.094 1.00 24.72  ? 6   ILE C O   1 
ATOM   1380 C CB  . ILE C 1 6  ? 16.918 15.251 59.346 1.00 25.75  ? 6   ILE C CB  1 
ATOM   1381 C CG1 . ILE C 1 6  ? 17.108 13.827 58.877 1.00 22.38  ? 6   ILE C CG1 1 
ATOM   1382 C CG2 . ILE C 1 6  ? 16.136 15.952 58.259 1.00 25.37  ? 6   ILE C CG2 1 
ATOM   1383 C CD1 . ILE C 1 6  ? 15.859 12.945 58.931 1.00 16.10  ? 6   ILE C CD1 1 
ATOM   1384 N N   . TYR C 1 7  ? 18.479 18.313 59.000 1.00 20.28  ? 7   TYR C N   1 
ATOM   1385 C CA  . TYR C 1 7  ? 18.436 19.719 59.292 1.00 19.97  ? 7   TYR C CA  1 
ATOM   1386 C C   . TYR C 1 7  ? 17.245 20.317 58.557 1.00 19.30  ? 7   TYR C C   1 
ATOM   1387 O O   . TYR C 1 7  ? 17.067 20.056 57.369 1.00 17.40  ? 7   TYR C O   1 
ATOM   1388 C CB  . TYR C 1 7  ? 19.727 20.345 58.822 1.00 20.33  ? 7   TYR C CB  1 
ATOM   1389 C CG  . TYR C 1 7  ? 19.888 21.824 59.147 1.00 23.49  ? 7   TYR C CG  1 
ATOM   1390 C CD1 . TYR C 1 7  ? 20.366 22.241 60.395 1.00 26.00  ? 7   TYR C CD1 1 
ATOM   1391 C CD2 . TYR C 1 7  ? 19.586 22.777 58.157 1.00 26.36  ? 7   TYR C CD2 1 
ATOM   1392 C CE1 . TYR C 1 7  ? 20.548 23.614 60.642 1.00 26.16  ? 7   TYR C CE1 1 
ATOM   1393 C CE2 . TYR C 1 7  ? 19.757 24.145 58.394 1.00 29.77  ? 7   TYR C CE2 1 
ATOM   1394 C CZ  . TYR C 1 7  ? 20.240 24.556 59.642 1.00 31.52  ? 7   TYR C CZ  1 
ATOM   1395 O OH  . TYR C 1 7  ? 20.398 25.919 59.871 1.00 35.17  ? 7   TYR C OH  1 
ATOM   1396 N N   . TYR C 1 8  ? 16.441 21.126 59.238 1.00 15.51  ? 8   TYR C N   1 
ATOM   1397 C CA  . TYR C 1 8  ? 15.313 21.799 58.646 1.00 15.52  ? 8   TYR C CA  1 
ATOM   1398 C C   . TYR C 1 8  ? 15.697 23.255 58.557 1.00 18.82  ? 8   TYR C C   1 
ATOM   1399 O O   . TYR C 1 8  ? 16.042 23.836 59.587 1.00 20.17  ? 8   TYR C O   1 
ATOM   1400 C CB  . TYR C 1 8  ? 14.081 21.691 59.512 1.00 12.23  ? 8   TYR C CB  1 
ATOM   1401 C CG  . TYR C 1 8  ? 13.650 20.276 59.711 1.00 12.09  ? 8   TYR C CG  1 
ATOM   1402 C CD1 . TYR C 1 8  ? 14.286 19.511 60.693 1.00 12.53  ? 8   TYR C CD1 1 
ATOM   1403 C CD2 . TYR C 1 8  ? 12.670 19.739 58.877 1.00 12.19  ? 8   TYR C CD2 1 
ATOM   1404 C CE1 . TYR C 1 8  ? 13.943 18.182 60.841 1.00 9.93   ? 8   TYR C CE1 1 
ATOM   1405 C CE2 . TYR C 1 8  ? 12.346 18.403 59.029 1.00 11.86  ? 8   TYR C CE2 1 
ATOM   1406 C CZ  . TYR C 1 8  ? 12.985 17.652 60.003 1.00 10.29  ? 8   TYR C CZ  1 
ATOM   1407 O OH  . TYR C 1 8  ? 12.690 16.322 60.138 1.00 14.26  ? 8   TYR C OH  1 
ATOM   1408 N N   . SER C 1 9  ? 15.728 23.883 57.385 1.00 20.43  ? 9   SER C N   1 
ATOM   1409 C CA  . SER C 1 9  ? 16.011 25.293 57.297 1.00 22.71  ? 9   SER C CA  1 
ATOM   1410 C C   . SER C 1 9  ? 14.791 26.193 57.569 1.00 22.73  ? 9   SER C C   1 
ATOM   1411 O O   . SER C 1 9  ? 13.641 25.740 57.645 1.00 23.61  ? 9   SER C O   1 
ATOM   1412 C CB  . SER C 1 9  ? 16.597 25.532 55.910 1.00 30.26  ? 9   SER C CB  1 
ATOM   1413 O OG  . SER C 1 9  ? 15.733 25.131 54.850 1.00 38.07  ? 9   SER C OG  1 
ATOM   1414 N N   . ASP C 1 10 ? 15.055 27.497 57.754 1.00 24.85  ? 10  ASP C N   1 
ATOM   1415 C CA  . ASP C 1 10 ? 14.020 28.507 57.980 1.00 27.52  ? 10  ASP C CA  1 
ATOM   1416 C C   . ASP C 1 10 ? 13.135 28.588 56.733 1.00 24.30  ? 10  ASP C C   1 
ATOM   1417 O O   . ASP C 1 10 ? 13.583 28.269 55.627 1.00 26.58  ? 10  ASP C O   1 
ATOM   1418 C CB  . ASP C 1 10 ? 14.654 29.906 58.247 1.00 32.09  ? 10  ASP C CB  1 
ATOM   1419 C CG  . ASP C 1 10 ? 15.668 30.008 59.404 1.00 38.78  ? 10  ASP C CG  1 
ATOM   1420 O OD1 . ASP C 1 10 ? 15.499 29.340 60.432 1.00 38.88  ? 10  ASP C OD1 1 
ATOM   1421 O OD2 . ASP C 1 10 ? 16.642 30.758 59.268 1.00 42.30  ? 10  ASP C OD2 1 
ATOM   1422 N N   . LYS C 1 11 ? 11.897 28.988 56.868 1.00 21.13  ? 11  LYS C N   1 
ATOM   1423 C CA  . LYS C 1 11 ? 11.016 29.092 55.742 1.00 18.56  ? 11  LYS C CA  1 
ATOM   1424 C C   . LYS C 1 11 ? 11.189 30.415 55.009 1.00 19.97  ? 11  LYS C C   1 
ATOM   1425 O O   . LYS C 1 11 ? 11.739 31.409 55.529 1.00 18.89  ? 11  LYS C O   1 
ATOM   1426 C CB  . LYS C 1 11 ? 9.625  28.931 56.245 1.00 18.43  ? 11  LYS C CB  1 
ATOM   1427 C CG  . LYS C 1 11 ? 9.504  27.578 56.879 1.00 19.49  ? 11  LYS C CG  1 
ATOM   1428 C CD  . LYS C 1 11 ? 8.287  27.721 57.728 1.00 28.20  ? 11  LYS C CD  1 
ATOM   1429 C CE  . LYS C 1 11 ? 8.384  26.766 58.906 1.00 36.43  ? 11  LYS C CE  1 
ATOM   1430 N NZ  . LYS C 1 11 ? 7.418  27.148 59.917 1.00 36.76  ? 11  LYS C NZ  1 
ATOM   1431 N N   . TYR C 1 12 ? 10.824 30.375 53.722 1.00 17.20  ? 12  TYR C N   1 
ATOM   1432 C CA  . TYR C 1 12 ? 10.754 31.588 52.940 1.00 14.50  ? 12  TYR C CA  1 
ATOM   1433 C C   . TYR C 1 12 ? 9.479  31.437 52.106 1.00 14.51  ? 12  TYR C C   1 
ATOM   1434 O O   . TYR C 1 12 ? 8.878  30.354 52.089 1.00 15.01  ? 12  TYR C O   1 
ATOM   1435 C CB  . TYR C 1 12 ? 12.017 31.762 52.068 1.00 11.48  ? 12  TYR C CB  1 
ATOM   1436 C CG  . TYR C 1 12 ? 12.362 30.625 51.129 1.00 14.90  ? 12  TYR C CG  1 
ATOM   1437 C CD1 . TYR C 1 12 ? 12.914 29.425 51.605 1.00 14.74  ? 12  TYR C CD1 1 
ATOM   1438 C CD2 . TYR C 1 12 ? 12.132 30.813 49.767 1.00 16.28  ? 12  TYR C CD2 1 
ATOM   1439 C CE1 . TYR C 1 12 ? 13.234 28.406 50.695 1.00 18.54  ? 12  TYR C CE1 1 
ATOM   1440 C CE2 . TYR C 1 12 ? 12.452 29.806 48.848 1.00 17.00  ? 12  TYR C CE2 1 
ATOM   1441 C CZ  . TYR C 1 12 ? 12.994 28.610 49.317 1.00 14.42  ? 12  TYR C CZ  1 
ATOM   1442 O OH  . TYR C 1 12 ? 13.217 27.608 48.408 1.00 15.63  ? 12  TYR C OH  1 
ATOM   1443 N N   . PHE C 1 13 ? 9.035  32.473 51.400 1.00 13.80  ? 13  PHE C N   1 
ATOM   1444 C CA  . PHE C 1 13 ? 7.767  32.413 50.703 1.00 14.60  ? 13  PHE C CA  1 
ATOM   1445 C C   . PHE C 1 13 ? 7.764  33.327 49.491 1.00 14.27  ? 13  PHE C C   1 
ATOM   1446 O O   . PHE C 1 13 ? 8.541  34.282 49.360 1.00 11.94  ? 13  PHE C O   1 
ATOM   1447 C CB  . PHE C 1 13 ? 6.584  32.826 51.668 1.00 14.48  ? 13  PHE C CB  1 
ATOM   1448 C CG  . PHE C 1 13 ? 6.732  34.193 52.318 1.00 8.59   ? 13  PHE C CG  1 
ATOM   1449 C CD1 . PHE C 1 13 ? 7.576  34.349 53.433 1.00 16.16  ? 13  PHE C CD1 1 
ATOM   1450 C CD2 . PHE C 1 13 ? 6.076  35.282 51.788 1.00 9.90   ? 13  PHE C CD2 1 
ATOM   1451 C CE1 . PHE C 1 13 ? 7.751  35.618 53.989 1.00 15.20  ? 13  PHE C CE1 1 
ATOM   1452 C CE2 . PHE C 1 13 ? 6.250  36.532 52.340 1.00 11.08  ? 13  PHE C CE2 1 
ATOM   1453 C CZ  . PHE C 1 13 ? 7.086  36.707 53.439 1.00 14.11  ? 13  PHE C CZ  1 
ATOM   1454 N N   . ASP C 1 14 ? 6.766  33.070 48.662 1.00 15.33  ? 14  ASP C N   1 
ATOM   1455 C CA  . ASP C 1 14 ? 6.491  33.999 47.573 1.00 18.73  ? 14  ASP C CA  1 
ATOM   1456 C C   . ASP C 1 14 ? 5.050  34.531 47.672 1.00 18.75  ? 14  ASP C C   1 
ATOM   1457 O O   . ASP C 1 14 ? 4.437  34.506 48.749 1.00 15.29  ? 14  ASP C O   1 
ATOM   1458 C CB  . ASP C 1 14 ? 6.771  33.282 46.222 1.00 14.82  ? 14  ASP C CB  1 
ATOM   1459 C CG  . ASP C 1 14 ? 6.011  32.035 45.802 1.00 17.68  ? 14  ASP C CG  1 
ATOM   1460 O OD1 . ASP C 1 14 ? 4.906  31.714 46.279 1.00 13.15  ? 14  ASP C OD1 1 
ATOM   1461 O OD2 . ASP C 1 14 ? 6.562  31.373 44.928 1.00 13.31  ? 14  ASP C OD2 1 
ATOM   1462 N N   . GLU C 1 15 ? 4.450  34.999 46.575 1.00 18.76  ? 15  GLU C N   1 
ATOM   1463 C CA  . GLU C 1 15 ? 3.069  35.455 46.560 1.00 14.94  ? 15  GLU C CA  1 
ATOM   1464 C C   . GLU C 1 15 ? 2.071  34.354 46.905 1.00 13.86  ? 15  GLU C C   1 
ATOM   1465 O O   . GLU C 1 15 ? 0.975  34.661 47.325 1.00 15.97  ? 15  GLU C O   1 
ATOM   1466 C CB  . GLU C 1 15 ? 2.768  36.004 45.185 1.00 13.84  ? 15  GLU C CB  1 
ATOM   1467 C CG  . GLU C 1 15 ? 3.552  37.269 44.886 1.00 13.84  ? 15  GLU C CG  1 
ATOM   1468 C CD  . GLU C 1 15 ? 3.524  37.707 43.434 1.00 14.09  ? 15  GLU C CD  1 
ATOM   1469 O OE1 . GLU C 1 15 ? 3.508  36.888 42.538 1.00 17.46  ? 15  GLU C OE1 1 
ATOM   1470 O OE2 . GLU C 1 15 ? 3.523  38.891 43.198 1.00 16.16  ? 15  GLU C OE2 1 
ATOM   1471 N N   . HIS C 1 16 ? 2.336  33.056 46.761 1.00 16.00  ? 16  HIS C N   1 
ATOM   1472 C CA  . HIS C 1 16 ? 1.385  31.985 47.022 1.00 15.07  ? 16  HIS C CA  1 
ATOM   1473 C C   . HIS C 1 16 ? 1.827  30.838 47.909 1.00 12.87  ? 16  HIS C C   1 
ATOM   1474 O O   . HIS C 1 16 ? 0.962  30.147 48.456 1.00 14.32  ? 16  HIS C O   1 
ATOM   1475 C CB  . HIS C 1 16 ? 0.898  31.358 45.674 1.00 21.14  ? 16  HIS C CB  1 
ATOM   1476 C CG  . HIS C 1 16 ? 0.193  32.390 44.778 1.00 27.70  ? 16  HIS C CG  1 
ATOM   1477 N ND1 . HIS C 1 16 ? -1.034 32.924 44.907 1.00 28.32  ? 16  HIS C ND1 1 
ATOM   1478 C CD2 . HIS C 1 16 ? 0.821  33.041 43.729 1.00 28.95  ? 16  HIS C CD2 1 
ATOM   1479 C CE1 . HIS C 1 16 ? -1.148 33.869 43.998 1.00 28.85  ? 16  HIS C CE1 1 
ATOM   1480 N NE2 . HIS C 1 16 ? -0.035 33.939 43.297 1.00 30.12  ? 16  HIS C NE2 1 
ATOM   1481 N N   . TYR C 1 17 ? 3.117  30.554 48.085 1.00 11.95  ? 17  TYR C N   1 
ATOM   1482 C CA  . TYR C 1 17 ? 3.581  29.381 48.808 1.00 10.14  ? 17  TYR C CA  1 
ATOM   1483 C C   . TYR C 1 17 ? 4.636  29.751 49.812 1.00 8.40   ? 17  TYR C C   1 
ATOM   1484 O O   . TYR C 1 17 ? 5.277  30.796 49.705 1.00 7.87   ? 17  TYR C O   1 
ATOM   1485 C CB  . TYR C 1 17 ? 4.312  28.334 47.998 1.00 11.94  ? 17  TYR C CB  1 
ATOM   1486 C CG  . TYR C 1 17 ? 3.458  27.691 46.980 1.00 15.38  ? 17  TYR C CG  1 
ATOM   1487 C CD1 . TYR C 1 17 ? 2.698  26.601 47.365 1.00 17.66  ? 17  TYR C CD1 1 
ATOM   1488 C CD2 . TYR C 1 17 ? 3.402  28.225 45.694 1.00 17.92  ? 17  TYR C CD2 1 
ATOM   1489 C CE1 . TYR C 1 17 ? 1.844  26.026 46.436 1.00 21.30  ? 17  TYR C CE1 1 
ATOM   1490 C CE2 . TYR C 1 17 ? 2.546  27.656 44.771 1.00 19.62  ? 17  TYR C CE2 1 
ATOM   1491 C CZ  . TYR C 1 17 ? 1.783  26.570 45.155 1.00 20.60  ? 17  TYR C CZ  1 
ATOM   1492 O OH  . TYR C 1 17 ? 0.940  26.003 44.242 1.00 28.95  ? 17  TYR C OH  1 
ATOM   1493 N N   . GLU C 1 18 ? 4.794  28.837 50.756 1.00 10.48  ? 18  GLU C N   1 
ATOM   1494 C CA  . GLU C 1 18 ? 5.964  28.919 51.574 1.00 12.42  ? 18  GLU C CA  1 
ATOM   1495 C C   . GLU C 1 18 ? 6.764  27.676 51.315 1.00 9.78   ? 18  GLU C C   1 
ATOM   1496 O O   . GLU C 1 18 ? 6.237  26.635 50.873 1.00 9.19   ? 18  GLU C O   1 
ATOM   1497 C CB  . GLU C 1 18 ? 5.630  29.030 53.033 1.00 15.91  ? 18  GLU C CB  1 
ATOM   1498 C CG  . GLU C 1 18 ? 4.726  28.031 53.640 1.00 16.53  ? 18  GLU C CG  1 
ATOM   1499 C CD  . GLU C 1 18 ? 4.581  28.286 55.124 1.00 18.52  ? 18  GLU C CD  1 
ATOM   1500 O OE1 . GLU C 1 18 ? 4.997  29.326 55.651 1.00 24.54  ? 18  GLU C OE1 1 
ATOM   1501 O OE2 . GLU C 1 18 ? 4.035  27.419 55.776 1.00 19.80  ? 18  GLU C OE2 1 
ATOM   1502 N N   . TYR C 1 19 ? 8.069  27.807 51.559 1.00 12.33  ? 19  TYR C N   1 
ATOM   1503 C CA  . TYR C 1 19 ? 9.015  26.784 51.110 1.00 10.97  ? 19  TYR C CA  1 
ATOM   1504 C C   . TYR C 1 19 ? 9.991  26.534 52.180 1.00 9.12   ? 19  TYR C C   1 
ATOM   1505 O O   . TYR C 1 19 ? 10.243 27.465 52.948 1.00 9.72   ? 19  TYR C O   1 
ATOM   1506 C CB  . TYR C 1 19 ? 9.897  27.204 49.930 1.00 10.71  ? 19  TYR C CB  1 
ATOM   1507 C CG  . TYR C 1 19 ? 9.179  27.676 48.677 1.00 10.40  ? 19  TYR C CG  1 
ATOM   1508 C CD1 . TYR C 1 19 ? 8.606  28.952 48.603 1.00 10.32  ? 19  TYR C CD1 1 
ATOM   1509 C CD2 . TYR C 1 19 ? 9.050  26.790 47.617 1.00 13.70  ? 19  TYR C CD2 1 
ATOM   1510 C CE1 . TYR C 1 19 ? 7.893  29.326 47.463 1.00 13.83  ? 19  TYR C CE1 1 
ATOM   1511 C CE2 . TYR C 1 19 ? 8.325  27.166 46.475 1.00 13.14  ? 19  TYR C CE2 1 
ATOM   1512 C CZ  . TYR C 1 19 ? 7.752  28.419 46.412 1.00 10.82  ? 19  TYR C CZ  1 
ATOM   1513 O OH  . TYR C 1 19 ? 6.986  28.726 45.315 1.00 14.14  ? 19  TYR C OH  1 
ATOM   1514 N N   . ARG C 1 20 ? 10.582 25.343 52.136 1.00 11.20  ? 20  ARG C N   1 
ATOM   1515 C CA  . ARG C 1 20 ? 11.751 25.120 52.976 1.00 14.39  ? 20  ARG C CA  1 
ATOM   1516 C C   . ARG C 1 20 ? 12.620 24.000 52.418 1.00 15.89  ? 20  ARG C C   1 
ATOM   1517 O O   . ARG C 1 20 ? 12.168 23.149 51.642 1.00 16.37  ? 20  ARG C O   1 
ATOM   1518 C CB  . ARG C 1 20 ? 11.352 24.756 54.446 1.00 14.63  ? 20  ARG C CB  1 
ATOM   1519 C CG  . ARG C 1 20 ? 10.651 23.393 54.597 1.00 17.02  ? 20  ARG C CG  1 
ATOM   1520 C CD  . ARG C 1 20 ? 11.257 22.615 55.747 1.00 24.42  ? 20  ARG C CD  1 
ATOM   1521 N NE  . ARG C 1 20 ? 11.173 23.405 56.964 1.00 26.32  ? 20  ARG C NE  1 
ATOM   1522 C CZ  . ARG C 1 20 ? 10.336 23.091 57.944 1.00 21.85  ? 20  ARG C CZ  1 
ATOM   1523 N NH1 . ARG C 1 20 ? 9.538  22.024 57.876 1.00 18.89  ? 20  ARG C NH1 1 
ATOM   1524 N NH2 . ARG C 1 20 ? 10.279 23.928 58.970 1.00 24.21  ? 20  ARG C NH2 1 
ATOM   1525 N N   . HIS C 1 21 ? 13.890 23.983 52.797 1.00 17.00  ? 21  HIS C N   1 
ATOM   1526 C CA  . HIS C 1 21 ? 14.829 22.942 52.425 1.00 17.68  ? 21  HIS C CA  1 
ATOM   1527 C C   . HIS C 1 21 ? 15.042 22.041 53.616 1.00 16.59  ? 21  HIS C C   1 
ATOM   1528 O O   . HIS C 1 21 ? 15.072 22.507 54.747 1.00 15.67  ? 21  HIS C O   1 
ATOM   1529 C CB  . HIS C 1 21 ? 16.191 23.468 52.113 1.00 20.15  ? 21  HIS C CB  1 
ATOM   1530 C CG  . HIS C 1 21 ? 16.245 24.508 51.030 1.00 27.26  ? 21  HIS C CG  1 
ATOM   1531 N ND1 . HIS C 1 21 ? 17.233 25.362 50.794 1.00 32.90  ? 21  HIS C ND1 1 
ATOM   1532 C CD2 . HIS C 1 21 ? 15.282 24.681 50.059 1.00 31.33  ? 21  HIS C CD2 1 
ATOM   1533 C CE1 . HIS C 1 21 ? 16.896 26.015 49.711 1.00 34.94  ? 21  HIS C CE1 1 
ATOM   1534 N NE2 . HIS C 1 21 ? 15.729 25.610 49.273 1.00 30.80  ? 21  HIS C NE2 1 
ATOM   1535 N N   . VAL C 1 22 ? 15.256 20.768 53.380 1.00 15.60  ? 22  VAL C N   1 
ATOM   1536 C CA  . VAL C 1 22 ? 15.581 19.820 54.411 1.00 16.60  ? 22  VAL C CA  1 
ATOM   1537 C C   . VAL C 1 22 ? 16.920 19.243 53.943 1.00 19.71  ? 22  VAL C C   1 
ATOM   1538 O O   . VAL C 1 22 ? 17.041 18.889 52.768 1.00 18.90  ? 22  VAL C O   1 
ATOM   1539 C CB  . VAL C 1 22 ? 14.465 18.748 54.488 1.00 13.68  ? 22  VAL C CB  1 
ATOM   1540 C CG1 . VAL C 1 22 ? 14.881 17.499 55.208 1.00 9.33   ? 22  VAL C CG1 1 
ATOM   1541 C CG2 . VAL C 1 22 ? 13.322 19.361 55.255 1.00 13.07  ? 22  VAL C CG2 1 
ATOM   1542 N N   . MET C 1 23 ? 17.949 19.189 54.799 1.00 19.46  ? 23  MET C N   1 
ATOM   1543 C CA  . MET C 1 23 ? 19.220 18.567 54.497 1.00 19.13  ? 23  MET C CA  1 
ATOM   1544 C C   . MET C 1 23 ? 19.295 17.221 55.124 1.00 19.50  ? 23  MET C C   1 
ATOM   1545 O O   . MET C 1 23 ? 19.026 17.068 56.314 1.00 21.27  ? 23  MET C O   1 
ATOM   1546 C CB  . MET C 1 23 ? 20.322 19.355 55.033 1.00 23.47  ? 23  MET C CB  1 
ATOM   1547 C CG  . MET C 1 23 ? 20.563 20.301 53.947 1.00 28.79  ? 23  MET C CG  1 
ATOM   1548 S SD  . MET C 1 23 ? 21.257 21.719 54.744 1.00 43.98  ? 23  MET C SD  1 
ATOM   1549 C CE  . MET C 1 23 ? 19.660 22.453 54.554 1.00 40.27  ? 23  MET C CE  1 
ATOM   1550 N N   . LEU C 1 24 ? 19.610 16.220 54.339 1.00 20.39  ? 24  LEU C N   1 
ATOM   1551 C CA  . LEU C 1 24 ? 19.723 14.868 54.838 1.00 24.14  ? 24  LEU C CA  1 
ATOM   1552 C C   . LEU C 1 24 ? 21.198 14.494 55.010 1.00 26.78  ? 24  LEU C C   1 
ATOM   1553 O O   . LEU C 1 24 ? 22.054 14.899 54.209 1.00 29.50  ? 24  LEU C O   1 
ATOM   1554 C CB  . LEU C 1 24 ? 19.116 13.900 53.877 1.00 19.31  ? 24  LEU C CB  1 
ATOM   1555 C CG  . LEU C 1 24 ? 17.695 14.134 53.508 1.00 22.04  ? 24  LEU C CG  1 
ATOM   1556 C CD1 . LEU C 1 24 ? 17.322 13.102 52.477 1.00 23.68  ? 24  LEU C CD1 1 
ATOM   1557 C CD2 . LEU C 1 24 ? 16.811 14.018 54.737 1.00 22.99  ? 24  LEU C CD2 1 
ATOM   1558 N N   . PRO C 1 25 ? 21.572 13.707 56.014 1.00 28.73  ? 25  PRO C N   1 
ATOM   1559 C CA  . PRO C 1 25 ? 22.817 12.958 55.988 1.00 31.61  ? 25  PRO C CA  1 
ATOM   1560 C C   . PRO C 1 25 ? 22.932 12.106 54.710 1.00 33.38  ? 25  PRO C C   1 
ATOM   1561 O O   . PRO C 1 25 ? 21.988 11.494 54.202 1.00 28.14  ? 25  PRO C O   1 
ATOM   1562 C CB  . PRO C 1 25 ? 22.765 12.188 57.304 1.00 32.21  ? 25  PRO C CB  1 
ATOM   1563 C CG  . PRO C 1 25 ? 21.302 12.056 57.647 1.00 31.35  ? 25  PRO C CG  1 
ATOM   1564 C CD  . PRO C 1 25 ? 20.796 13.436 57.219 1.00 31.24  ? 25  PRO C CD  1 
ATOM   1565 N N   . ARG C 1 26 ? 24.145 12.083 54.178 1.00 38.95  ? 26  ARG C N   1 
ATOM   1566 C CA  . ARG C 1 26 ? 24.480 11.429 52.928 1.00 43.64  ? 26  ARG C CA  1 
ATOM   1567 C C   . ARG C 1 26 ? 23.953 10.015 52.896 1.00 42.88  ? 26  ARG C C   1 
ATOM   1568 O O   . ARG C 1 26 ? 23.343 9.568  51.922 1.00 44.27  ? 26  ARG C O   1 
ATOM   1569 C CB  . ARG C 1 26 ? 25.998 11.490 52.800 1.00 50.94  ? 26  ARG C CB  1 
ATOM   1570 C CG  . ARG C 1 26 ? 26.679 10.811 51.614 1.00 60.33  ? 26  ARG C CG  1 
ATOM   1571 C CD  . ARG C 1 26 ? 28.147 10.491 51.963 1.00 67.20  ? 26  ARG C CD  1 
ATOM   1572 N NE  . ARG C 1 26 ? 28.254 9.688  53.181 1.00 73.79  ? 26  ARG C NE  1 
ATOM   1573 C CZ  . ARG C 1 26 ? 29.318 8.940  53.503 1.00 77.81  ? 26  ARG C CZ  1 
ATOM   1574 N NH1 . ARG C 1 26 ? 30.405 8.845  52.730 1.00 80.55  ? 26  ARG C NH1 1 
ATOM   1575 N NH2 . ARG C 1 26 ? 29.285 8.269  54.653 1.00 79.80  ? 26  ARG C NH2 1 
ATOM   1576 N N   . GLU C 1 27 ? 24.054 9.381  54.051 1.00 40.91  ? 27  GLU C N   1 
ATOM   1577 C CA  . GLU C 1 27 ? 23.639 8.008  54.214 1.00 43.78  ? 27  GLU C CA  1 
ATOM   1578 C C   . GLU C 1 27 ? 22.184 7.775  53.791 1.00 43.08  ? 27  GLU C C   1 
ATOM   1579 O O   . GLU C 1 27 ? 21.835 6.923  52.970 1.00 42.85  ? 27  GLU C O   1 
ATOM   1580 C CB  . GLU C 1 27 ? 23.835 7.612  55.681 1.00 49.43  ? 27  GLU C CB  1 
ATOM   1581 C CG  . GLU C 1 27 ? 25.253 7.796  56.243 1.00 58.14  ? 27  GLU C CG  1 
ATOM   1582 C CD  . GLU C 1 27 ? 25.593 9.216  56.718 1.00 63.51  ? 27  GLU C CD  1 
ATOM   1583 O OE1 . GLU C 1 27 ? 25.031 9.654  57.726 1.00 67.11  ? 27  GLU C OE1 1 
ATOM   1584 O OE2 . GLU C 1 27 ? 26.419 9.883  56.085 1.00 64.68  ? 27  GLU C OE2 1 
ATOM   1585 N N   . LEU C 1 28 ? 21.362 8.696  54.283 1.00 41.78  ? 28  LEU C N   1 
ATOM   1586 C CA  . LEU C 1 28 ? 19.919 8.691  54.154 1.00 36.99  ? 28  LEU C CA  1 
ATOM   1587 C C   . LEU C 1 28 ? 19.509 9.140  52.770 1.00 33.18  ? 28  LEU C C   1 
ATOM   1588 O O   . LEU C 1 28 ? 18.547 8.606  52.222 1.00 30.23  ? 28  LEU C O   1 
ATOM   1589 C CB  . LEU C 1 28 ? 19.398 9.605  55.242 1.00 34.15  ? 28  LEU C CB  1 
ATOM   1590 C CG  . LEU C 1 28 ? 17.987 9.480  55.693 1.00 36.26  ? 28  LEU C CG  1 
ATOM   1591 C CD1 . LEU C 1 28 ? 17.674 8.047  56.071 1.00 33.42  ? 28  LEU C CD1 1 
ATOM   1592 C CD2 . LEU C 1 28 ? 17.795 10.415 56.880 1.00 35.79  ? 28  LEU C CD2 1 
ATOM   1593 N N   . SER C 1 29 ? 20.231 10.056 52.142 1.00 30.12  ? 29  SER C N   1 
ATOM   1594 C CA  . SER C 1 29 ? 19.850 10.451 50.819 1.00 29.89  ? 29  SER C CA  1 
ATOM   1595 C C   . SER C 1 29 ? 19.988 9.324  49.823 1.00 30.51  ? 29  SER C C   1 
ATOM   1596 O O   . SER C 1 29 ? 19.406 9.346  48.747 1.00 27.80  ? 29  SER C O   1 
ATOM   1597 C CB  . SER C 1 29 ? 20.673 11.618 50.412 1.00 33.52  ? 29  SER C CB  1 
ATOM   1598 O OG  . SER C 1 29 ? 22.083 11.577 50.640 1.00 38.72  ? 29  SER C OG  1 
ATOM   1599 N N   . LYS C 1 30 ? 20.674 8.253  50.187 1.00 33.64  ? 30  LYS C N   1 
ATOM   1600 C CA  . LYS C 1 30 ? 20.740 7.109  49.300 1.00 37.93  ? 30  LYS C CA  1 
ATOM   1601 C C   . LYS C 1 30 ? 19.384 6.425  49.249 1.00 37.50  ? 30  LYS C C   1 
ATOM   1602 O O   . LYS C 1 30 ? 19.144 5.624  48.345 1.00 38.27  ? 30  LYS C O   1 
ATOM   1603 C CB  . LYS C 1 30 ? 21.796 6.095  49.774 1.00 41.70  ? 30  LYS C CB  1 
ATOM   1604 C CG  . LYS C 1 30 ? 23.177 6.736  49.782 1.00 48.70  ? 30  LYS C CG  1 
ATOM   1605 C CD  . LYS C 1 30 ? 24.302 5.734  50.033 1.00 54.31  ? 30  LYS C CD  1 
ATOM   1606 C CE  . LYS C 1 30 ? 25.655 6.458  50.164 1.00 56.30  ? 30  LYS C CE  1 
ATOM   1607 N NZ  . LYS C 1 30 ? 25.953 7.339  49.040 1.00 57.83  ? 30  LYS C NZ  1 
ATOM   1608 N N   . GLN C 1 31 ? 18.502 6.718  50.214 1.00 35.66  ? 31  GLN C N   1 
ATOM   1609 C CA  . GLN C 1 31 ? 17.153 6.169  50.252 1.00 35.20  ? 31  GLN C CA  1 
ATOM   1610 C C   . GLN C 1 31 ? 16.096 6.949  49.450 1.00 30.55  ? 31  GLN C C   1 
ATOM   1611 O O   . GLN C 1 31 ? 14.971 6.468  49.235 1.00 29.91  ? 31  GLN C O   1 
ATOM   1612 C CB  . GLN C 1 31 ? 16.666 6.070  51.698 1.00 38.00  ? 31  GLN C CB  1 
ATOM   1613 C CG  . GLN C 1 31 ? 16.869 4.716  52.322 1.00 47.10  ? 31  GLN C CG  1 
ATOM   1614 C CD  . GLN C 1 31 ? 18.334 4.420  52.591 1.00 54.71  ? 31  GLN C CD  1 
ATOM   1615 O OE1 . GLN C 1 31 ? 18.957 3.641  51.867 1.00 58.68  ? 31  GLN C OE1 1 
ATOM   1616 N NE2 . GLN C 1 31 ? 18.937 4.997  53.637 1.00 55.38  ? 31  GLN C NE2 1 
ATOM   1617 N N   . VAL C 1 32 ? 16.405 8.171  49.033 1.00 25.76  ? 32  VAL C N   1 
ATOM   1618 C CA  . VAL C 1 32 ? 15.462 8.981  48.295 1.00 23.79  ? 32  VAL C CA  1 
ATOM   1619 C C   . VAL C 1 32 ? 15.286 8.420  46.873 1.00 25.13  ? 32  VAL C C   1 
ATOM   1620 O O   . VAL C 1 32 ? 16.305 8.176  46.201 1.00 22.68  ? 32  VAL C O   1 
ATOM   1621 C CB  . VAL C 1 32 ? 15.997 10.423 48.313 1.00 18.71  ? 32  VAL C CB  1 
ATOM   1622 C CG1 . VAL C 1 32 ? 15.142 11.379 47.473 1.00 17.54  ? 32  VAL C CG1 1 
ATOM   1623 C CG2 . VAL C 1 32 ? 15.999 10.873 49.767 1.00 15.84  ? 32  VAL C CG2 1 
ATOM   1624 N N   . PRO C 1 33 ? 14.028 8.189  46.390 1.00 23.80  ? 33  PRO C N   1 
ATOM   1625 C CA  . PRO C 1 33 ? 13.717 7.699  45.044 1.00 23.00  ? 33  PRO C CA  1 
ATOM   1626 C C   . PRO C 1 33 ? 14.278 8.658  44.017 1.00 19.48  ? 33  PRO C C   1 
ATOM   1627 O O   . PRO C 1 33 ? 14.285 9.880  44.235 1.00 19.71  ? 33  PRO C O   1 
ATOM   1628 C CB  . PRO C 1 33 ? 12.193 7.612  44.960 1.00 22.48  ? 33  PRO C CB  1 
ATOM   1629 C CG  . PRO C 1 33 ? 11.761 7.540  46.395 1.00 22.53  ? 33  PRO C CG  1 
ATOM   1630 C CD  . PRO C 1 33 ? 12.766 8.471  47.079 1.00 25.06  ? 33  PRO C CD  1 
ATOM   1631 N N   . LYS C 1 34 ? 14.760 8.141  42.904 1.00 19.15  ? 34  LYS C N   1 
ATOM   1632 C CA  . LYS C 1 34 ? 15.265 9.049  41.892 1.00 20.29  ? 34  LYS C CA  1 
ATOM   1633 C C   . LYS C 1 34 ? 14.339 9.306  40.738 1.00 15.03  ? 34  LYS C C   1 
ATOM   1634 O O   . LYS C 1 34 ? 14.479 10.311 40.052 1.00 17.21  ? 34  LYS C O   1 
ATOM   1635 C CB  . LYS C 1 34 ? 16.595 8.566  41.314 1.00 28.35  ? 34  LYS C CB  1 
ATOM   1636 C CG  . LYS C 1 34 ? 16.948 7.079  41.284 1.00 40.64  ? 34  LYS C CG  1 
ATOM   1637 C CD  . LYS C 1 34 ? 18.376 6.851  40.744 1.00 45.01  ? 34  LYS C CD  1 
ATOM   1638 C CE  . LYS C 1 34 ? 19.415 7.777  41.385 1.00 48.18  ? 34  LYS C CE  1 
ATOM   1639 N NZ  . LYS C 1 34 ? 19.387 7.751  42.843 1.00 50.83  ? 34  LYS C NZ  1 
ATOM   1640 N N   . THR C 1 35 ? 13.331 8.470  40.582 1.00 16.08  ? 35  THR C N   1 
ATOM   1641 C CA  . THR C 1 35 ? 12.421 8.533  39.446 1.00 17.88  ? 35  THR C CA  1 
ATOM   1642 C C   . THR C 1 35 ? 11.095 9.202  39.668 1.00 16.46  ? 35  THR C C   1 
ATOM   1643 O O   . THR C 1 35 ? 10.303 9.342  38.731 1.00 17.02  ? 35  THR C O   1 
ATOM   1644 C CB  . THR C 1 35 ? 12.201 7.107  38.960 1.00 17.15  ? 35  THR C CB  1 
ATOM   1645 O OG1 . THR C 1 35 ? 11.885 6.312  40.104 1.00 23.25  ? 35  THR C OG1 1 
ATOM   1646 C CG2 . THR C 1 35 ? 13.445 6.538  38.300 1.00 17.22  ? 35  THR C CG2 1 
ATOM   1647 N N   . HIS C 1 36 ? 10.798 9.573  40.911 1.00 16.71  ? 36  HIS C N   1 
ATOM   1648 C CA  . HIS C 1 36 ? 9.510  10.177 41.191 1.00 15.27  ? 36  HIS C CA  1 
ATOM   1649 C C   . HIS C 1 36 ? 9.606  10.945 42.481 1.00 12.94  ? 36  HIS C C   1 
ATOM   1650 O O   . HIS C 1 36 ? 10.532 10.718 43.283 1.00 14.39  ? 36  HIS C O   1 
ATOM   1651 C CB  . HIS C 1 36 ? 8.427  9.093  41.292 1.00 9.80   ? 36  HIS C CB  1 
ATOM   1652 C CG  . HIS C 1 36 ? 8.511  8.145  42.478 1.00 15.15  ? 36  HIS C CG  1 
ATOM   1653 N ND1 . HIS C 1 36 ? 7.949  8.261  43.689 1.00 15.34  ? 36  HIS C ND1 1 
ATOM   1654 C CD2 . HIS C 1 36 ? 9.190  6.952  42.455 1.00 16.06  ? 36  HIS C CD2 1 
ATOM   1655 C CE1 . HIS C 1 36 ? 8.266  7.195  44.377 1.00 14.68  ? 36  HIS C CE1 1 
ATOM   1656 N NE2 . HIS C 1 36 ? 9.005  6.418  43.637 1.00 18.37  ? 36  HIS C NE2 1 
ATOM   1657 N N   . LEU C 1 37 ? 8.647  11.864 42.602 1.00 13.00  ? 37  LEU C N   1 
ATOM   1658 C CA  . LEU C 1 37 ? 8.432  12.677 43.802 1.00 12.45  ? 37  LEU C CA  1 
ATOM   1659 C C   . LEU C 1 37 ? 7.777  11.781 44.844 1.00 8.81   ? 37  LEU C C   1 
ATOM   1660 O O   . LEU C 1 37 ? 7.228  10.740 44.521 1.00 11.47  ? 37  LEU C O   1 
ATOM   1661 C CB  . LEU C 1 37 ? 7.553  13.851 43.469 1.00 9.66   ? 37  LEU C CB  1 
ATOM   1662 C CG  . LEU C 1 37 ? 8.142  14.953 42.641 1.00 8.82   ? 37  LEU C CG  1 
ATOM   1663 C CD1 . LEU C 1 37 ? 7.020  15.928 42.356 1.00 3.35   ? 37  LEU C CD1 1 
ATOM   1664 C CD2 . LEU C 1 37 ? 9.331  15.599 43.353 1.00 7.69   ? 37  LEU C CD2 1 
ATOM   1665 N N   . MET C 1 38 ? 8.010  12.123 46.101 1.00 10.42  ? 38  MET C N   1 
ATOM   1666 C CA  . MET C 1 38 ? 7.626  11.298 47.235 1.00 11.99  ? 38  MET C CA  1 
ATOM   1667 C C   . MET C 1 38 ? 6.327  11.773 47.864 1.00 10.02  ? 38  MET C C   1 
ATOM   1668 O O   . MET C 1 38 ? 6.031  12.976 47.941 1.00 9.55   ? 38  MET C O   1 
ATOM   1669 C CB  . MET C 1 38 ? 8.661  11.325 48.337 1.00 9.47   ? 38  MET C CB  1 
ATOM   1670 C CG  . MET C 1 38 ? 9.894  10.511 48.040 1.00 14.88  ? 38  MET C CG  1 
ATOM   1671 S SD  . MET C 1 38 ? 10.952 10.520 49.507 1.00 16.34  ? 38  MET C SD  1 
ATOM   1672 C CE  . MET C 1 38 ? 11.685 12.090 49.242 1.00 9.14   ? 38  MET C CE  1 
ATOM   1673 N N   . SER C 1 39 ? 5.558  10.777 48.225 1.00 12.01  ? 39  SER C N   1 
ATOM   1674 C CA  . SER C 1 39 ? 4.391  10.994 49.065 1.00 15.33  ? 39  SER C CA  1 
ATOM   1675 C C   . SER C 1 39 ? 4.831  11.304 50.488 1.00 14.45  ? 39  SER C C   1 
ATOM   1676 O O   . SER C 1 39 ? 5.984  11.083 50.880 1.00 12.37  ? 39  SER C O   1 
ATOM   1677 C CB  . SER C 1 39 ? 3.501  9.754  49.102 1.00 12.68  ? 39  SER C CB  1 
ATOM   1678 O OG  . SER C 1 39 ? 4.118  8.575  49.650 1.00 13.38  ? 39  SER C OG  1 
ATOM   1679 N N   . GLU C 1 40 ? 3.921  11.816 51.310 1.00 16.92  ? 40  GLU C N   1 
ATOM   1680 C CA  . GLU C 1 40 ? 4.229  12.055 52.724 1.00 20.03  ? 40  GLU C CA  1 
ATOM   1681 C C   . GLU C 1 40 ? 4.580  10.741 53.408 1.00 17.55  ? 40  GLU C C   1 
ATOM   1682 O O   . GLU C 1 40 ? 5.497  10.682 54.233 1.00 20.80  ? 40  GLU C O   1 
ATOM   1683 C CB  . GLU C 1 40 ? 3.037  12.716 53.429 1.00 19.22  ? 40  GLU C CB  1 
ATOM   1684 C CG  . GLU C 1 40 ? 3.407  13.021 54.869 1.00 29.51  ? 40  GLU C CG  1 
ATOM   1685 C CD  . GLU C 1 40 ? 2.457  13.931 55.637 1.00 31.91  ? 40  GLU C CD  1 
ATOM   1686 O OE1 . GLU C 1 40 ? 2.003  14.917 55.059 1.00 33.27  ? 40  GLU C OE1 1 
ATOM   1687 O OE2 . GLU C 1 40 ? 2.196  13.659 56.811 1.00 33.21  ? 40  GLU C OE2 1 
ATOM   1688 N N   . GLU C 1 41 ? 3.941  9.654  53.010 1.00 17.09  ? 41  GLU C N   1 
ATOM   1689 C CA  . GLU C 1 41 ? 4.228  8.353  53.592 1.00 21.42  ? 41  GLU C CA  1 
ATOM   1690 C C   . GLU C 1 41 ? 5.698  7.963  53.439 1.00 21.19  ? 41  GLU C C   1 
ATOM   1691 O O   . GLU C 1 41 ? 6.362  7.553  54.390 1.00 24.58  ? 41  GLU C O   1 
ATOM   1692 C CB  . GLU C 1 41 ? 3.380  7.271  52.943 1.00 23.69  ? 41  GLU C CB  1 
ATOM   1693 C CG  . GLU C 1 41 ? 1.861  7.338  53.198 1.00 29.77  ? 41  GLU C CG  1 
ATOM   1694 C CD  . GLU C 1 41 ? 1.091  8.513  52.585 1.00 29.99  ? 41  GLU C CD  1 
ATOM   1695 O OE1 . GLU C 1 41 ? 1.341  8.804  51.427 1.00 33.48  ? 41  GLU C OE1 1 
ATOM   1696 O OE2 . GLU C 1 41 ? 0.245  9.130  53.247 1.00 29.93  ? 41  GLU C OE2 1 
ATOM   1697 N N   . GLU C 1 42 ? 6.239  8.171  52.254 1.00 20.10  ? 42  GLU C N   1 
ATOM   1698 C CA  . GLU C 1 42 ? 7.612  7.883  51.953 1.00 16.18  ? 42  GLU C CA  1 
ATOM   1699 C C   . GLU C 1 42 ? 8.574  8.851  52.571 1.00 14.70  ? 42  GLU C C   1 
ATOM   1700 O O   . GLU C 1 42 ? 9.600  8.380  53.018 1.00 16.83  ? 42  GLU C O   1 
ATOM   1701 C CB  . GLU C 1 42 ? 7.847  7.901  50.465 1.00 17.75  ? 42  GLU C CB  1 
ATOM   1702 C CG  . GLU C 1 42 ? 7.059  6.853  49.744 1.00 18.58  ? 42  GLU C CG  1 
ATOM   1703 C CD  . GLU C 1 42 ? 7.097  7.099  48.258 1.00 22.83  ? 42  GLU C CD  1 
ATOM   1704 O OE1 . GLU C 1 42 ? 6.718  8.177  47.835 1.00 27.53  ? 42  GLU C OE1 1 
ATOM   1705 O OE2 . GLU C 1 42 ? 7.486  6.219  47.505 1.00 32.55  ? 42  GLU C OE2 1 
ATOM   1706 N N   . TRP C 1 43 ? 8.399  10.165 52.614 1.00 14.88  ? 43  TRP C N   1 
ATOM   1707 C CA  . TRP C 1 43 ? 9.406  10.965 53.254 1.00 14.82  ? 43  TRP C CA  1 
ATOM   1708 C C   . TRP C 1 43 ? 9.321  10.847 54.768 1.00 18.87  ? 43  TRP C C   1 
ATOM   1709 O O   . TRP C 1 43 ? 10.326 11.053 55.448 1.00 17.86  ? 43  TRP C O   1 
ATOM   1710 C CB  . TRP C 1 43 ? 9.320  12.448 52.796 1.00 15.28  ? 43  TRP C CB  1 
ATOM   1711 C CG  . TRP C 1 43 ? 8.084  13.341 52.734 1.00 17.45  ? 43  TRP C CG  1 
ATOM   1712 C CD1 . TRP C 1 43 ? 7.479  13.642 51.526 1.00 20.53  ? 43  TRP C CD1 1 
ATOM   1713 C CD2 . TRP C 1 43 ? 7.497  14.023 53.771 1.00 19.32  ? 43  TRP C CD2 1 
ATOM   1714 N NE1 . TRP C 1 43 ? 6.522  14.523 51.788 1.00 18.71  ? 43  TRP C NE1 1 
ATOM   1715 C CE2 . TRP C 1 43 ? 6.500  14.772 53.105 1.00 19.54  ? 43  TRP C CE2 1 
ATOM   1716 C CE3 . TRP C 1 43 ? 7.667  14.120 55.158 1.00 20.23  ? 43  TRP C CE3 1 
ATOM   1717 C CZ2 . TRP C 1 43 ? 5.656  15.626 53.809 1.00 23.66  ? 43  TRP C CZ2 1 
ATOM   1718 C CZ3 . TRP C 1 43 ? 6.825  14.977 55.872 1.00 25.35  ? 43  TRP C CZ3 1 
ATOM   1719 C CH2 . TRP C 1 43 ? 5.831  15.720 55.196 1.00 25.61  ? 43  TRP C CH2 1 
ATOM   1720 N N   . ARG C 1 44 ? 8.181  10.475 55.360 1.00 19.61  ? 44  ARG C N   1 
ATOM   1721 C CA  . ARG C 1 44 ? 8.093  10.218 56.785 1.00 22.70  ? 44  ARG C CA  1 
ATOM   1722 C C   . ARG C 1 44 ? 8.877  8.966  57.115 1.00 22.38  ? 44  ARG C C   1 
ATOM   1723 O O   . ARG C 1 44 ? 9.557  8.976  58.132 1.00 20.70  ? 44  ARG C O   1 
ATOM   1724 C CB  . ARG C 1 44 ? 6.665  10.038 57.220 1.00 23.89  ? 44  ARG C CB  1 
ATOM   1725 C CG  . ARG C 1 44 ? 6.057  11.398 57.303 1.00 28.35  ? 44  ARG C CG  1 
ATOM   1726 C CD  . ARG C 1 44 ? 5.237  11.563 58.573 1.00 35.49  ? 44  ARG C CD  1 
ATOM   1727 N NE  . ARG C 1 44 ? 4.402  12.750 58.425 1.00 41.02  ? 44  ARG C NE  1 
ATOM   1728 C CZ  . ARG C 1 44 ? 4.657  13.927 59.010 1.00 41.51  ? 44  ARG C CZ  1 
ATOM   1729 N NH1 . ARG C 1 44 ? 5.709  14.078 59.800 1.00 43.10  ? 44  ARG C NH1 1 
ATOM   1730 N NH2 . ARG C 1 44 ? 3.894  14.992 58.732 1.00 42.56  ? 44  ARG C NH2 1 
ATOM   1731 N N   . ARG C 1 45 ? 8.880  7.927  56.270 1.00 25.89  ? 45  ARG C N   1 
ATOM   1732 C CA  . ARG C 1 45 ? 9.728  6.749  56.460 1.00 28.50  ? 45  ARG C CA  1 
ATOM   1733 C C   . ARG C 1 45 ? 11.223 7.064  56.475 1.00 30.38  ? 45  ARG C C   1 
ATOM   1734 O O   . ARG C 1 45 ? 12.004 6.249  56.965 1.00 30.97  ? 45  ARG C O   1 
ATOM   1735 C CB  . ARG C 1 45 ? 9.514  5.705  55.362 1.00 33.44  ? 45  ARG C CB  1 
ATOM   1736 C CG  . ARG C 1 45 ? 8.351  4.754  55.627 1.00 41.80  ? 45  ARG C CG  1 
ATOM   1737 C CD  . ARG C 1 45 ? 7.862  3.941  54.421 1.00 47.29  ? 45  ARG C CD  1 
ATOM   1738 N NE  . ARG C 1 45 ? 6.412  3.727  54.550 1.00 56.17  ? 45  ARG C NE  1 
ATOM   1739 C CZ  . ARG C 1 45 ? 5.522  3.929  53.556 1.00 58.14  ? 45  ARG C CZ  1 
ATOM   1740 N NH1 . ARG C 1 45 ? 5.882  4.338  52.326 1.00 59.47  ? 45  ARG C NH1 1 
ATOM   1741 N NH2 . ARG C 1 45 ? 4.219  3.804  53.836 1.00 57.73  ? 45  ARG C NH2 1 
ATOM   1742 N N   . LEU C 1 46 ? 11.668 8.204  55.915 1.00 28.99  ? 46  LEU C N   1 
ATOM   1743 C CA  . LEU C 1 46 ? 13.060 8.638  55.938 1.00 24.87  ? 46  LEU C CA  1 
ATOM   1744 C C   . LEU C 1 46 ? 13.391 9.281  57.280 1.00 24.57  ? 46  LEU C C   1 
ATOM   1745 O O   . LEU C 1 46 ? 14.560 9.382  57.677 1.00 24.67  ? 46  LEU C O   1 
ATOM   1746 C CB  . LEU C 1 46 ? 13.291 9.650  54.818 1.00 27.15  ? 46  LEU C CB  1 
ATOM   1747 C CG  . LEU C 1 46 ? 14.012 9.294  53.535 1.00 29.65  ? 46  LEU C CG  1 
ATOM   1748 C CD1 . LEU C 1 46 ? 13.779 7.861  53.118 1.00 31.27  ? 46  LEU C CD1 1 
ATOM   1749 C CD2 . LEU C 1 46 ? 13.491 10.224 52.470 1.00 28.63  ? 46  LEU C CD2 1 
ATOM   1750 N N   . GLY C 1 47 ? 12.384 9.757  58.016 1.00 22.89  ? 47  GLY C N   1 
ATOM   1751 C CA  . GLY C 1 47 ? 12.626 10.408 59.290 1.00 22.08  ? 47  GLY C CA  1 
ATOM   1752 C C   . GLY C 1 47 ? 12.311 11.877 59.234 1.00 20.11  ? 47  GLY C C   1 
ATOM   1753 O O   . GLY C 1 47 ? 12.492 12.594 60.218 1.00 20.35  ? 47  GLY C O   1 
ATOM   1754 N N   . VAL C 1 48 ? 11.810 12.365 58.097 1.00 18.86  ? 48  VAL C N   1 
ATOM   1755 C CA  . VAL C 1 48 ? 11.493 13.772 57.942 1.00 16.43  ? 48  VAL C CA  1 
ATOM   1756 C C   . VAL C 1 48 ? 10.182 13.966 58.708 1.00 17.18  ? 48  VAL C C   1 
ATOM   1757 O O   . VAL C 1 48 ? 9.255  13.175 58.528 1.00 17.75  ? 48  VAL C O   1 
ATOM   1758 C CB  . VAL C 1 48 ? 11.318 14.098 56.450 1.00 16.04  ? 48  VAL C CB  1 
ATOM   1759 C CG1 . VAL C 1 48 ? 11.034 15.576 56.295 1.00 13.26  ? 48  VAL C CG1 1 
ATOM   1760 C CG2 . VAL C 1 48 ? 12.581 13.719 55.661 1.00 16.34  ? 48  VAL C CG2 1 
ATOM   1761 N N   . GLN C 1 49 ? 10.102 14.972 59.577 1.00 20.55  ? 49  GLN C N   1 
ATOM   1762 C CA  . GLN C 1 49 ? 8.952  15.246 60.431 1.00 24.90  ? 49  GLN C CA  1 
ATOM   1763 C C   . GLN C 1 49 ? 8.649  16.716 60.248 1.00 20.39  ? 49  GLN C C   1 
ATOM   1764 O O   . GLN C 1 49 ? 9.485  17.595 60.459 1.00 21.84  ? 49  GLN C O   1 
ATOM   1765 C CB  . GLN C 1 49 ? 9.333  14.905 61.885 1.00 33.32  ? 49  GLN C CB  1 
ATOM   1766 C CG  . GLN C 1 49 ? 8.432  15.351 63.048 1.00 48.32  ? 49  GLN C CG  1 
ATOM   1767 C CD  . GLN C 1 49 ? 7.007  14.783 63.040 1.00 56.58  ? 49  GLN C CD  1 
ATOM   1768 O OE1 . GLN C 1 49 ? 6.025  15.531 63.126 1.00 58.39  ? 49  GLN C OE1 1 
ATOM   1769 N NE2 . GLN C 1 49 ? 6.805  13.465 62.930 1.00 59.85  ? 49  GLN C NE2 1 
ATOM   1770 N N   . GLN C 1 50 ? 7.450  17.018 59.783 1.00 18.25  ? 50  GLN C N   1 
ATOM   1771 C CA  . GLN C 1 50 ? 7.099  18.384 59.440 1.00 15.34  ? 50  GLN C CA  1 
ATOM   1772 C C   . GLN C 1 50 ? 5.665  18.526 59.836 1.00 13.79  ? 50  GLN C C   1 
ATOM   1773 O O   . GLN C 1 50 ? 4.983  17.499 59.894 1.00 15.68  ? 50  GLN C O   1 
ATOM   1774 C CB  . GLN C 1 50 ? 7.182  18.593 57.932 1.00 13.60  ? 50  GLN C CB  1 
ATOM   1775 C CG  . GLN C 1 50 ? 8.578  18.501 57.439 1.00 16.07  ? 50  GLN C CG  1 
ATOM   1776 C CD  . GLN C 1 50 ? 8.719  18.871 56.005 1.00 12.73  ? 50  GLN C CD  1 
ATOM   1777 O OE1 . GLN C 1 50 ? 9.180  19.950 55.708 1.00 21.22  ? 50  GLN C OE1 1 
ATOM   1778 N NE2 . GLN C 1 50 ? 8.355  18.012 55.073 1.00 15.24  ? 50  GLN C NE2 1 
ATOM   1779 N N   . SER C 1 51 ? 5.118  19.713 59.998 1.00 16.31  ? 51  SER C N   1 
ATOM   1780 C CA  . SER C 1 51 ? 3.692  19.829 60.239 1.00 16.68  ? 51  SER C CA  1 
ATOM   1781 C C   . SER C 1 51 ? 2.884  19.555 58.965 1.00 18.04  ? 51  SER C C   1 
ATOM   1782 O O   . SER C 1 51 ? 3.375  19.024 57.951 1.00 19.10  ? 51  SER C O   1 
ATOM   1783 C CB  . SER C 1 51 ? 3.455  21.208 60.811 1.00 16.27  ? 51  SER C CB  1 
ATOM   1784 O OG  . SER C 1 51 ? 3.816  22.157 59.837 1.00 22.36  ? 51  SER C OG  1 
ATOM   1785 N N   . LEU C 1 52 ? 1.597  19.885 59.006 1.00 17.66  ? 52  LEU C N   1 
ATOM   1786 C CA  . LEU C 1 52 ? 0.617  19.570 57.983 1.00 17.08  ? 52  LEU C CA  1 
ATOM   1787 C C   . LEU C 1 52 ? 0.752  20.248 56.620 1.00 11.22  ? 52  LEU C C   1 
ATOM   1788 O O   . LEU C 1 52 ? 0.953  21.437 56.533 1.00 9.10   ? 52  LEU C O   1 
ATOM   1789 C CB  . LEU C 1 52 ? -0.750 19.897 58.622 1.00 21.75  ? 52  LEU C CB  1 
ATOM   1790 C CG  . LEU C 1 52 ? -2.170 19.428 58.190 1.00 20.42  ? 52  LEU C CG  1 
ATOM   1791 C CD1 . LEU C 1 52 ? -2.879 20.675 57.763 1.00 21.37  ? 52  LEU C CD1 1 
ATOM   1792 C CD2 . LEU C 1 52 ? -2.174 18.311 57.170 1.00 19.98  ? 52  LEU C CD2 1 
ATOM   1793 N N   . GLY C 1 53 ? 0.575  19.493 55.552 1.00 12.49  ? 53  GLY C N   1 
ATOM   1794 C CA  . GLY C 1 53 ? 0.429  20.042 54.200 1.00 15.65  ? 53  GLY C CA  1 
ATOM   1795 C C   . GLY C 1 53 ? 1.662  20.341 53.346 1.00 16.01  ? 53  GLY C C   1 
ATOM   1796 O O   . GLY C 1 53 ? 1.482  20.931 52.280 1.00 13.44  ? 53  GLY C O   1 
ATOM   1797 N N   . TRP C 1 54 ? 2.887  19.996 53.767 1.00 15.46  ? 54  TRP C N   1 
ATOM   1798 C CA  . TRP C 1 54 ? 4.111  20.243 53.002 1.00 14.09  ? 54  TRP C CA  1 
ATOM   1799 C C   . TRP C 1 54 ? 4.180  19.195 51.913 1.00 14.59  ? 54  TRP C C   1 
ATOM   1800 O O   . TRP C 1 54 ? 3.900  18.020 52.143 1.00 13.34  ? 54  TRP C O   1 
ATOM   1801 C CB  . TRP C 1 54 ? 5.339  20.086 53.851 1.00 9.93   ? 54  TRP C CB  1 
ATOM   1802 C CG  . TRP C 1 54 ? 5.564  21.252 54.787 1.00 9.65   ? 54  TRP C CG  1 
ATOM   1803 C CD1 . TRP C 1 54 ? 5.261  21.100 56.120 1.00 8.93   ? 54  TRP C CD1 1 
ATOM   1804 C CD2 . TRP C 1 54 ? 6.109  22.492 54.491 1.00 10.03  ? 54  TRP C CD2 1 
ATOM   1805 N NE1 . TRP C 1 54 ? 5.619  22.222 56.667 1.00 9.67   ? 54  TRP C NE1 1 
ATOM   1806 C CE2 . TRP C 1 54 ? 6.125  23.082 55.763 1.00 10.04  ? 54  TRP C CE2 1 
ATOM   1807 C CE3 . TRP C 1 54 ? 6.599  23.228 53.415 1.00 9.31   ? 54  TRP C CE3 1 
ATOM   1808 C CZ2 . TRP C 1 54 ? 6.615  24.375 55.976 1.00 11.08  ? 54  TRP C CZ2 1 
ATOM   1809 C CZ3 . TRP C 1 54 ? 7.086  24.515 53.621 1.00 10.00  ? 54  TRP C CZ3 1 
ATOM   1810 C CH2 . TRP C 1 54 ? 7.102  25.095 54.888 1.00 12.52  ? 54  TRP C CH2 1 
ATOM   1811 N N   . VAL C 1 55 ? 4.558  19.607 50.712 1.00 16.03  ? 55  VAL C N   1 
ATOM   1812 C CA  . VAL C 1 55 ? 4.608  18.703 49.552 1.00 15.04  ? 55  VAL C CA  1 
ATOM   1813 C C   . VAL C 1 55 ? 6.038  18.689 48.932 1.00 9.42   ? 55  VAL C C   1 
ATOM   1814 O O   . VAL C 1 55 ? 6.622  19.754 48.726 1.00 7.77   ? 55  VAL C O   1 
ATOM   1815 C CB  . VAL C 1 55 ? 3.476  19.204 48.511 1.00 15.82  ? 55  VAL C CB  1 
ATOM   1816 C CG1 . VAL C 1 55 ? 3.637  18.596 47.108 1.00 18.98  ? 55  VAL C CG1 1 
ATOM   1817 C CG2 . VAL C 1 55 ? 2.098  18.790 49.052 1.00 17.57  ? 55  VAL C CG2 1 
ATOM   1818 N N   . HIS C 1 56 ? 6.586  17.498 48.648 1.00 10.29  ? 56  HIS C N   1 
ATOM   1819 C CA  . HIS C 1 56 ? 7.848  17.311 47.945 1.00 12.53  ? 56  HIS C CA  1 
ATOM   1820 C C   . HIS C 1 56 ? 7.463  17.578 46.472 1.00 12.00  ? 56  HIS C C   1 
ATOM   1821 O O   . HIS C 1 56 ? 6.814  16.769 45.795 1.00 12.80  ? 56  HIS C O   1 
ATOM   1822 C CB  . HIS C 1 56 ? 8.318  15.880 48.169 1.00 8.06   ? 56  HIS C CB  1 
ATOM   1823 C CG  . HIS C 1 56 ? 9.672  15.580 47.501 1.00 12.34  ? 56  HIS C CG  1 
ATOM   1824 N ND1 . HIS C 1 56 ? 10.777 16.330 47.346 1.00 13.74  ? 56  HIS C ND1 1 
ATOM   1825 C CD2 . HIS C 1 56 ? 9.944  14.358 46.942 1.00 6.99   ? 56  HIS C CD2 1 
ATOM   1826 C CE1 . HIS C 1 56 ? 11.667 15.594 46.724 1.00 9.68   ? 56  HIS C CE1 1 
ATOM   1827 N NE2 . HIS C 1 56 ? 11.148 14.410 46.492 1.00 12.93  ? 56  HIS C NE2 1 
ATOM   1828 N N   . TYR C 1 57 ? 7.793  18.791 46.041 1.00 12.13  ? 57  TYR C N   1 
ATOM   1829 C CA  . TYR C 1 57 ? 7.353  19.288 44.753 1.00 12.46  ? 57  TYR C CA  1 
ATOM   1830 C C   . TYR C 1 57 ? 8.482  19.289 43.723 1.00 13.43  ? 57  TYR C C   1 
ATOM   1831 O O   . TYR C 1 57 ? 8.185  19.439 42.554 1.00 14.81  ? 57  TYR C O   1 
ATOM   1832 C CB  . TYR C 1 57 ? 6.789  20.748 44.869 1.00 8.18   ? 57  TYR C CB  1 
ATOM   1833 C CG  . TYR C 1 57 ? 7.864  21.829 45.062 1.00 13.91  ? 57  TYR C CG  1 
ATOM   1834 C CD1 . TYR C 1 57 ? 8.569  21.885 46.265 1.00 12.87  ? 57  TYR C CD1 1 
ATOM   1835 C CD2 . TYR C 1 57 ? 8.177  22.760 44.067 1.00 8.94   ? 57  TYR C CD2 1 
ATOM   1836 C CE1 . TYR C 1 57 ? 9.574  22.831 46.484 1.00 13.52  ? 57  TYR C CE1 1 
ATOM   1837 C CE2 . TYR C 1 57 ? 9.191  23.733 44.300 1.00 9.94   ? 57  TYR C CE2 1 
ATOM   1838 C CZ  . TYR C 1 57 ? 9.887  23.748 45.509 1.00 11.67  ? 57  TYR C CZ  1 
ATOM   1839 O OH  . TYR C 1 57 ? 10.929 24.634 45.760 1.00 15.08  ? 57  TYR C OH  1 
ATOM   1840 N N   . MET C 1 58 ? 9.761  19.176 44.055 1.00 12.81  ? 58  MET C N   1 
ATOM   1841 C CA  . MET C 1 58 ? 10.836 19.323 43.068 1.00 12.05  ? 58  MET C CA  1 
ATOM   1842 C C   . MET C 1 58 ? 12.051 18.597 43.562 1.00 12.73  ? 58  MET C C   1 
ATOM   1843 O O   . MET C 1 58 ? 12.291 18.559 44.787 1.00 13.08  ? 58  MET C O   1 
ATOM   1844 C CB  . MET C 1 58 ? 11.223 20.802 42.874 1.00 12.97  ? 58  MET C CB  1 
ATOM   1845 C CG  . MET C 1 58 ? 12.438 21.028 41.973 1.00 16.61  ? 58  MET C CG  1 
ATOM   1846 S SD  . MET C 1 58 ? 12.394 22.622 41.182 1.00 23.04  ? 58  MET C SD  1 
ATOM   1847 C CE  . MET C 1 58 ? 12.842 23.513 42.612 1.00 19.84  ? 58  MET C CE  1 
ATOM   1848 N N   . ILE C 1 59 ? 12.752 17.956 42.626 1.00 15.32  ? 59  ILE C N   1 
ATOM   1849 C CA  . ILE C 1 59 ? 14.055 17.374 42.914 1.00 13.81  ? 59  ILE C CA  1 
ATOM   1850 C C   . ILE C 1 59 ? 15.089 18.504 42.814 1.00 13.88  ? 59  ILE C C   1 
ATOM   1851 O O   . ILE C 1 59 ? 15.058 19.411 41.975 1.00 14.12  ? 59  ILE C O   1 
ATOM   1852 C CB  . ILE C 1 59 ? 14.353 16.259 41.903 1.00 18.82  ? 59  ILE C CB  1 
ATOM   1853 C CG1 . ILE C 1 59 ? 13.350 15.128 42.044 1.00 17.58  ? 59  ILE C CG1 1 
ATOM   1854 C CG2 . ILE C 1 59 ? 15.784 15.742 42.138 1.00 17.64  ? 59  ILE C CG2 1 
ATOM   1855 C CD1 . ILE C 1 59 ? 13.318 14.326 43.341 1.00 19.01  ? 59  ILE C CD1 1 
ATOM   1856 N N   . HIS C 1 60 ? 16.031 18.536 43.736 1.00 15.54  ? 60  HIS C N   1 
ATOM   1857 C CA  . HIS C 1 60 ? 17.054 19.567 43.692 1.00 19.44  ? 60  HIS C CA  1 
ATOM   1858 C C   . HIS C 1 60 ? 18.063 19.199 42.581 1.00 19.73  ? 60  HIS C C   1 
ATOM   1859 O O   . HIS C 1 60 ? 18.456 18.058 42.368 1.00 18.41  ? 60  HIS C O   1 
ATOM   1860 C CB  . HIS C 1 60 ? 17.750 19.637 45.062 1.00 22.04  ? 60  HIS C CB  1 
ATOM   1861 C CG  . HIS C 1 60 ? 18.789 20.736 45.182 1.00 19.59  ? 60  HIS C CG  1 
ATOM   1862 N ND1 . HIS C 1 60 ? 18.593 22.035 45.272 1.00 22.38  ? 60  HIS C ND1 1 
ATOM   1863 C CD2 . HIS C 1 60 ? 20.142 20.527 45.181 1.00 23.42  ? 60  HIS C CD2 1 
ATOM   1864 C CE1 . HIS C 1 60 ? 19.749 22.640 45.319 1.00 21.93  ? 60  HIS C CE1 1 
ATOM   1865 N NE2 . HIS C 1 60 ? 20.672 21.723 45.261 1.00 26.06  ? 60  HIS C NE2 1 
ATOM   1866 N N   . GLU C 1 61 ? 18.593 20.234 41.985 1.00 23.72  ? 61  GLU C N   1 
ATOM   1867 C CA  . GLU C 1 61 ? 19.570 20.257 40.900 1.00 29.63  ? 61  GLU C CA  1 
ATOM   1868 C C   . GLU C 1 61 ? 20.788 19.554 41.480 1.00 32.86  ? 61  GLU C C   1 
ATOM   1869 O O   . GLU C 1 61 ? 21.344 20.055 42.461 1.00 32.88  ? 61  GLU C O   1 
ATOM   1870 C CB  . GLU C 1 61 ? 19.910 21.694 40.590 1.00 33.28  ? 61  GLU C CB  1 
ATOM   1871 C CG  . GLU C 1 61 ? 18.742 22.726 40.501 1.00 47.79  ? 61  GLU C CG  1 
ATOM   1872 C CD  . GLU C 1 61 ? 17.679 22.851 41.635 1.00 51.91  ? 61  GLU C CD  1 
ATOM   1873 O OE1 . GLU C 1 61 ? 17.960 23.500 42.648 1.00 54.94  ? 61  GLU C OE1 1 
ATOM   1874 O OE2 . GLU C 1 61 ? 16.591 22.253 41.537 1.00 53.95  ? 61  GLU C OE2 1 
ATOM   1875 N N   . PRO C 1 62 ? 21.217 18.386 41.018 1.00 38.44  ? 62  PRO C N   1 
ATOM   1876 C CA  . PRO C 1 62 ? 22.369 17.666 41.557 1.00 41.24  ? 62  PRO C CA  1 
ATOM   1877 C C   . PRO C 1 62 ? 23.605 18.470 41.201 1.00 41.68  ? 62  PRO C C   1 
ATOM   1878 O O   . PRO C 1 62 ? 23.759 19.059 40.116 1.00 43.46  ? 62  PRO C O   1 
ATOM   1879 C CB  . PRO C 1 62 ? 22.320 16.298 40.897 1.00 42.94  ? 62  PRO C CB  1 
ATOM   1880 C CG  . PRO C 1 62 ? 20.873 16.182 40.411 1.00 43.59  ? 62  PRO C CG  1 
ATOM   1881 C CD  . PRO C 1 62 ? 20.601 17.624 39.935 1.00 42.45  ? 62  PRO C CD  1 
ATOM   1882 N N   . GLU C 1 63 ? 24.482 18.512 42.176 1.00 44.27  ? 63  GLU C N   1 
ATOM   1883 C CA  . GLU C 1 63 ? 25.660 19.334 42.038 1.00 45.96  ? 63  GLU C CA  1 
ATOM   1884 C C   . GLU C 1 63 ? 26.785 18.536 41.344 1.00 42.86  ? 63  GLU C C   1 
ATOM   1885 O O   . GLU C 1 63 ? 26.901 17.319 41.565 1.00 40.96  ? 63  GLU C O   1 
ATOM   1886 C CB  . GLU C 1 63 ? 25.987 19.815 43.452 1.00 51.09  ? 63  GLU C CB  1 
ATOM   1887 C CG  . GLU C 1 63 ? 24.885 20.742 44.030 1.00 58.08  ? 63  GLU C CG  1 
ATOM   1888 C CD  . GLU C 1 63 ? 24.105 20.234 45.256 1.00 62.56  ? 63  GLU C CD  1 
ATOM   1889 O OE1 . GLU C 1 63 ? 23.757 19.040 45.305 1.00 64.41  ? 63  GLU C OE1 1 
ATOM   1890 O OE2 . GLU C 1 63 ? 23.845 21.052 46.158 1.00 64.97  ? 63  GLU C OE2 1 
ATOM   1891 N N   . PRO C 1 64 ? 27.573 19.140 40.420 1.00 39.78  ? 64  PRO C N   1 
ATOM   1892 C CA  . PRO C 1 64 ? 28.659 18.480 39.713 1.00 36.82  ? 64  PRO C CA  1 
ATOM   1893 C C   . PRO C 1 64 ? 29.737 17.995 40.671 1.00 32.06  ? 64  PRO C C   1 
ATOM   1894 O O   . PRO C 1 64 ? 29.902 18.463 41.804 1.00 35.82  ? 64  PRO C O   1 
ATOM   1895 C CB  . PRO C 1 64 ? 29.140 19.527 38.732 1.00 37.92  ? 64  PRO C CB  1 
ATOM   1896 C CG  . PRO C 1 64 ? 28.937 20.802 39.506 1.00 39.27  ? 64  PRO C CG  1 
ATOM   1897 C CD  . PRO C 1 64 ? 27.545 20.562 40.064 1.00 39.82  ? 64  PRO C CD  1 
ATOM   1898 N N   . HIS C 1 65 ? 30.412 16.955 40.241 1.00 29.09  ? 65  HIS C N   1 
ATOM   1899 C CA  . HIS C 1 65 ? 31.514 16.426 40.988 1.00 25.57  ? 65  HIS C CA  1 
ATOM   1900 C C   . HIS C 1 65 ? 32.710 17.133 40.370 1.00 22.86  ? 65  HIS C C   1 
ATOM   1901 O O   . HIS C 1 65 ? 32.985 17.076 39.170 1.00 18.67  ? 65  HIS C O   1 
ATOM   1902 C CB  . HIS C 1 65 ? 31.521 14.928 40.800 1.00 32.03  ? 65  HIS C CB  1 
ATOM   1903 C CG  . HIS C 1 65 ? 30.343 14.268 41.527 1.00 39.90  ? 65  HIS C CG  1 
ATOM   1904 N ND1 . HIS C 1 65 ? 29.051 14.238 41.188 1.00 41.32  ? 65  HIS C ND1 1 
ATOM   1905 C CD2 . HIS C 1 65 ? 30.462 13.541 42.692 1.00 42.42  ? 65  HIS C CD2 1 
ATOM   1906 C CE1 . HIS C 1 65 ? 28.400 13.535 42.079 1.00 45.22  ? 65  HIS C CE1 1 
ATOM   1907 N NE2 . HIS C 1 65 ? 29.259 13.118 42.981 1.00 42.34  ? 65  HIS C NE2 1 
ATOM   1908 N N   . ILE C 1 66 ? 33.329 17.913 41.235 1.00 17.56  ? 66  ILE C N   1 
ATOM   1909 C CA  . ILE C 1 66 ? 34.396 18.782 40.884 1.00 15.60  ? 66  ILE C CA  1 
ATOM   1910 C C   . ILE C 1 66 ? 35.727 18.261 41.417 1.00 18.57  ? 66  ILE C C   1 
ATOM   1911 O O   . ILE C 1 66 ? 35.782 17.878 42.596 1.00 17.71  ? 66  ILE C O   1 
ATOM   1912 C CB  . ILE C 1 66 ? 34.013 20.149 41.453 1.00 14.71  ? 66  ILE C CB  1 
ATOM   1913 C CG1 . ILE C 1 66 ? 32.775 20.630 40.703 1.00 16.51  ? 66  ILE C CG1 1 
ATOM   1914 C CG2 . ILE C 1 66 ? 35.154 21.144 41.308 1.00 13.35  ? 66  ILE C CG2 1 
ATOM   1915 C CD1 . ILE C 1 66 ? 32.433 22.104 40.860 1.00 23.26  ? 66  ILE C CD1 1 
ATOM   1916 N N   . LEU C 1 67 ? 36.780 18.209 40.571 1.00 16.21  ? 67  LEU C N   1 
ATOM   1917 C CA  . LEU C 1 67 ? 38.155 17.948 40.973 1.00 14.65  ? 67  LEU C CA  1 
ATOM   1918 C C   . LEU C 1 67 ? 38.901 19.281 41.013 1.00 14.12  ? 67  LEU C C   1 
ATOM   1919 O O   . LEU C 1 67 ? 38.641 20.198 40.222 1.00 16.66  ? 67  LEU C O   1 
ATOM   1920 C CB  . LEU C 1 67 ? 38.881 17.012 40.006 1.00 14.48  ? 67  LEU C CB  1 
ATOM   1921 C CG  . LEU C 1 67 ? 38.443 15.578 39.885 1.00 9.77   ? 67  LEU C CG  1 
ATOM   1922 C CD1 . LEU C 1 67 ? 39.494 14.836 39.081 1.00 14.43  ? 67  LEU C CD1 1 
ATOM   1923 C CD2 . LEU C 1 67 ? 38.399 14.889 41.216 1.00 8.63   ? 67  LEU C CD2 1 
ATOM   1924 N N   . LEU C 1 68 ? 39.788 19.472 41.982 1.00 13.19  ? 68  LEU C N   1 
ATOM   1925 C CA  . LEU C 1 68 ? 40.494 20.736 42.135 1.00 13.99  ? 68  LEU C CA  1 
ATOM   1926 C C   . LEU C 1 68 ? 41.982 20.482 41.879 1.00 12.41  ? 68  LEU C C   1 
ATOM   1927 O O   . LEU C 1 68 ? 42.586 19.576 42.487 1.00 11.60  ? 68  LEU C O   1 
ATOM   1928 C CB  . LEU C 1 68 ? 40.299 21.314 43.585 1.00 11.33  ? 68  LEU C CB  1 
ATOM   1929 C CG  . LEU C 1 68 ? 38.853 21.494 44.110 1.00 16.98  ? 68  LEU C CG  1 
ATOM   1930 C CD1 . LEU C 1 68 ? 38.804 21.967 45.532 1.00 13.32  ? 68  LEU C CD1 1 
ATOM   1931 C CD2 . LEU C 1 68 ? 38.201 22.598 43.349 1.00 18.16  ? 68  LEU C CD2 1 
ATOM   1932 N N   . PHE C 1 69 ? 42.567 21.297 40.992 1.00 12.75  ? 69  PHE C N   1 
ATOM   1933 C CA  . PHE C 1 69 ? 44.000 21.241 40.650 1.00 9.55   ? 69  PHE C CA  1 
ATOM   1934 C C   . PHE C 1 69 ? 44.580 22.639 40.706 1.00 7.59   ? 69  PHE C C   1 
ATOM   1935 O O   . PHE C 1 69 ? 43.912 23.660 40.510 1.00 8.13   ? 69  PHE C O   1 
ATOM   1936 C CB  . PHE C 1 69 ? 44.278 20.727 39.233 1.00 8.89   ? 69  PHE C CB  1 
ATOM   1937 C CG  . PHE C 1 69 ? 43.721 19.356 38.949 1.00 9.35   ? 69  PHE C CG  1 
ATOM   1938 C CD1 . PHE C 1 69 ? 44.492 18.239 39.237 1.00 5.92   ? 69  PHE C CD1 1 
ATOM   1939 C CD2 . PHE C 1 69 ? 42.430 19.217 38.421 1.00 8.74   ? 69  PHE C CD2 1 
ATOM   1940 C CE1 . PHE C 1 69 ? 43.978 16.977 39.007 1.00 8.17   ? 69  PHE C CE1 1 
ATOM   1941 C CE2 . PHE C 1 69 ? 41.922 17.946 38.197 1.00 8.65   ? 69  PHE C CE2 1 
ATOM   1942 C CZ  . PHE C 1 69 ? 42.691 16.822 38.488 1.00 8.55   ? 69  PHE C CZ  1 
ATOM   1943 N N   . ARG C 1 70 ? 45.858 22.676 41.065 1.00 10.54  ? 70  ARG C N   1 
ATOM   1944 C CA  . ARG C 1 70 ? 46.619 23.895 41.059 1.00 11.03  ? 70  ARG C CA  1 
ATOM   1945 C C   . ARG C 1 70 ? 48.057 23.588 40.594 1.00 10.32  ? 70  ARG C C   1 
ATOM   1946 O O   . ARG C 1 70 ? 48.469 22.426 40.591 1.00 9.54   ? 70  ARG C O   1 
ATOM   1947 C CB  . ARG C 1 70 ? 46.674 24.536 42.455 1.00 10.65  ? 70  ARG C CB  1 
ATOM   1948 C CG  . ARG C 1 70 ? 47.562 23.832 43.460 1.00 10.87  ? 70  ARG C CG  1 
ATOM   1949 C CD  . ARG C 1 70 ? 47.570 24.695 44.691 1.00 10.89  ? 70  ARG C CD  1 
ATOM   1950 N NE  . ARG C 1 70 ? 48.286 23.944 45.701 1.00 14.21  ? 70  ARG C NE  1 
ATOM   1951 C CZ  . ARG C 1 70 ? 48.339 24.351 46.975 1.00 18.09  ? 70  ARG C CZ  1 
ATOM   1952 N NH1 . ARG C 1 70 ? 47.720 25.477 47.358 1.00 15.25  ? 70  ARG C NH1 1 
ATOM   1953 N NH2 . ARG C 1 70 ? 49.020 23.595 47.849 1.00 20.27  ? 70  ARG C NH2 1 
ATOM   1954 N N   . ARG C 1 71 ? 48.834 24.572 40.148 1.00 12.21  ? 71  ARG C N   1 
ATOM   1955 C CA  . ARG C 1 71 ? 50.236 24.332 39.848 1.00 13.76  ? 71  ARG C CA  1 
ATOM   1956 C C   . ARG C 1 71 ? 50.957 25.657 40.015 1.00 12.66  ? 71  ARG C C   1 
ATOM   1957 O O   . ARG C 1 71 ? 50.305 26.700 39.860 1.00 12.69  ? 71  ARG C O   1 
ATOM   1958 C CB  . ARG C 1 71 ? 50.451 23.808 38.399 1.00 16.45  ? 71  ARG C CB  1 
ATOM   1959 C CG  . ARG C 1 71 ? 50.212 24.718 37.254 1.00 9.50   ? 71  ARG C CG  1 
ATOM   1960 C CD  . ARG C 1 71 ? 50.734 24.037 36.001 1.00 9.78   ? 71  ARG C CD  1 
ATOM   1961 N NE  . ARG C 1 71 ? 50.185 24.901 34.964 1.00 10.18  ? 71  ARG C NE  1 
ATOM   1962 C CZ  . ARG C 1 71 ? 50.145 24.656 33.650 1.00 9.72   ? 71  ARG C CZ  1 
ATOM   1963 N NH1 . ARG C 1 71 ? 50.633 23.538 33.116 1.00 9.30   ? 71  ARG C NH1 1 
ATOM   1964 N NH2 . ARG C 1 71 ? 49.513 25.551 32.881 1.00 8.85   ? 71  ARG C NH2 1 
ATOM   1965 N N   . PRO C 1 72 ? 52.256 25.706 40.403 1.00 13.83  ? 72  PRO C N   1 
ATOM   1966 C CA  . PRO C 1 72 ? 53.002 26.945 40.586 1.00 13.64  ? 72  PRO C CA  1 
ATOM   1967 C C   . PRO C 1 72 ? 52.901 27.882 39.403 1.00 11.66  ? 72  PRO C C   1 
ATOM   1968 O O   . PRO C 1 72 ? 53.023 27.421 38.262 1.00 15.95  ? 72  PRO C O   1 
ATOM   1969 C CB  . PRO C 1 72 ? 54.423 26.507 40.817 1.00 12.49  ? 72  PRO C CB  1 
ATOM   1970 C CG  . PRO C 1 72 ? 54.328 25.125 41.315 1.00 10.46  ? 72  PRO C CG  1 
ATOM   1971 C CD  . PRO C 1 72 ? 53.161 24.569 40.541 1.00 8.94   ? 72  PRO C CD  1 
ATOM   1972 N N   . LEU C 1 73 ? 52.723 29.177 39.607 1.00 10.44  ? 73  LEU C N   1 
ATOM   1973 C CA  . LEU C 1 73 ? 52.791 30.092 38.489 1.00 12.83  ? 73  LEU C CA  1 
ATOM   1974 C C   . LEU C 1 73 ? 54.273 30.112 38.071 1.00 14.90  ? 73  LEU C C   1 
ATOM   1975 O O   . LEU C 1 73 ? 55.149 29.773 38.889 1.00 14.36  ? 73  LEU C O   1 
ATOM   1976 C CB  . LEU C 1 73 ? 52.399 31.511 38.869 1.00 9.25   ? 73  LEU C CB  1 
ATOM   1977 C CG  . LEU C 1 73 ? 50.924 31.828 39.013 1.00 13.49  ? 73  LEU C CG  1 
ATOM   1978 C CD1 . LEU C 1 73 ? 50.784 33.189 39.611 1.00 14.34  ? 73  LEU C CD1 1 
ATOM   1979 C CD2 . LEU C 1 73 ? 50.228 31.820 37.670 1.00 16.08  ? 73  LEU C CD2 1 
ATOM   1980 N N   . PRO C 1 74 ? 54.661 30.528 36.847 1.00 19.78  ? 74  PRO C N   1 
ATOM   1981 C CA  . PRO C 1 74 ? 56.055 30.862 36.521 1.00 18.42  ? 74  PRO C CA  1 
ATOM   1982 C C   . PRO C 1 74 ? 56.515 31.881 37.558 1.00 18.06  ? 74  PRO C C   1 
ATOM   1983 O O   . PRO C 1 74 ? 55.798 32.827 37.929 1.00 16.07  ? 74  PRO C O   1 
ATOM   1984 C CB  . PRO C 1 74 ? 56.002 31.428 35.121 1.00 16.39  ? 74  PRO C CB  1 
ATOM   1985 C CG  . PRO C 1 74 ? 54.775 30.757 34.529 1.00 19.28  ? 74  PRO C CG  1 
ATOM   1986 C CD  . PRO C 1 74 ? 53.788 30.795 35.697 1.00 16.95  ? 74  PRO C CD  1 
ATOM   1987 N N   . LYS C 1 75 ? 57.735 31.647 37.996 1.00 17.45  ? 75  LYS C N   1 
ATOM   1988 C CA  . LYS C 1 75 ? 58.382 32.490 38.973 1.00 21.18  ? 75  LYS C CA  1 
ATOM   1989 C C   . LYS C 1 75 ? 58.241 33.996 38.797 1.00 20.26  ? 75  LYS C C   1 
ATOM   1990 O O   . LYS C 1 75 ? 57.966 34.699 39.764 1.00 19.53  ? 75  LYS C O   1 
ATOM   1991 C CB  . LYS C 1 75 ? 59.843 32.108 38.987 1.00 26.99  ? 75  LYS C CB  1 
ATOM   1992 C CG  . LYS C 1 75 ? 60.353 32.196 40.387 1.00 33.52  ? 75  LYS C CG  1 
ATOM   1993 C CD  . LYS C 1 75 ? 61.035 30.895 40.767 1.00 44.61  ? 75  LYS C CD  1 
ATOM   1994 C CE  . LYS C 1 75 ? 60.096 29.685 40.911 1.00 51.73  ? 75  LYS C CE  1 
ATOM   1995 N NZ  . LYS C 1 75 ? 59.792 29.013 39.650 1.00 56.67  ? 75  LYS C NZ  1 
ATOM   1996 N N   . ASP C 1 76 ? 58.389 34.563 37.600 1.00 18.78  ? 76  ASP C N   1 
ATOM   1997 C CA  . ASP C 1 76 ? 58.269 35.996 37.417 1.00 18.41  ? 76  ASP C CA  1 
ATOM   1998 C C   . ASP C 1 76 ? 56.836 36.490 37.399 1.00 16.12  ? 76  ASP C C   1 
ATOM   1999 O O   . ASP C 1 76 ? 56.573 37.689 37.341 1.00 14.57  ? 76  ASP C O   1 
ATOM   2000 C CB  . ASP C 1 76 ? 58.979 36.415 36.122 1.00 24.04  ? 76  ASP C CB  1 
ATOM   2001 C CG  . ASP C 1 76 ? 58.656 35.642 34.837 1.00 32.42  ? 76  ASP C CG  1 
ATOM   2002 O OD1 . ASP C 1 76 ? 57.521 35.192 34.631 1.00 31.42  ? 76  ASP C OD1 1 
ATOM   2003 O OD2 . ASP C 1 76 ? 59.565 35.499 34.020 1.00 32.80  ? 76  ASP C OD2 1 
ATOM   2004 N N   . GLN C 1 77 ? 55.877 35.576 37.391 1.00 15.33  ? 77  GLN C N   1 
ATOM   2005 C CA  . GLN C 1 77 ? 54.470 35.950 37.523 1.00 17.51  ? 77  GLN C CA  1 
ATOM   2006 C C   . GLN C 1 77 ? 54.014 35.981 38.983 1.00 14.88  ? 77  GLN C C   1 
ATOM   2007 O O   . GLN C 1 77 ? 52.921 36.457 39.288 1.00 13.21  ? 77  GLN C O   1 
ATOM   2008 C CB  . GLN C 1 77 ? 53.625 34.962 36.757 1.00 19.13  ? 77  GLN C CB  1 
ATOM   2009 C CG  . GLN C 1 77 ? 53.614 35.370 35.304 1.00 21.21  ? 77  GLN C CG  1 
ATOM   2010 C CD  . GLN C 1 77 ? 52.911 34.332 34.500 1.00 22.18  ? 77  GLN C CD  1 
ATOM   2011 O OE1 . GLN C 1 77 ? 51.837 33.855 34.867 1.00 21.25  ? 77  GLN C OE1 1 
ATOM   2012 N NE2 . GLN C 1 77 ? 53.549 33.882 33.436 1.00 19.33  ? 77  GLN C NE2 1 
ATOM   2013 N N   . GLN C 1 78 ? 54.839 35.423 39.868 1.00 10.95  ? 78  GLN C N   1 
ATOM   2014 C CA  . GLN C 1 78 ? 54.503 35.376 41.261 1.00 11.07  ? 78  GLN C CA  1 
ATOM   2015 C C   . GLN C 1 78 ? 54.675 36.693 41.967 1.00 13.86  ? 78  GLN C C   1 
ATOM   2016 O O   . GLN C 1 78 ? 55.365 37.589 41.465 1.00 15.21  ? 78  GLN C O   1 
ATOM   2017 C CB  . GLN C 1 78 ? 55.351 34.332 41.925 1.00 9.06   ? 78  GLN C CB  1 
ATOM   2018 C CG  . GLN C 1 78 ? 55.049 32.963 41.370 1.00 12.45  ? 78  GLN C CG  1 
ATOM   2019 C CD  . GLN C 1 78 ? 55.771 31.885 42.142 1.00 16.39  ? 78  GLN C CD  1 
ATOM   2020 O OE1 . GLN C 1 78 ? 56.034 32.050 43.339 1.00 21.58  ? 78  GLN C OE1 1 
ATOM   2021 N NE2 . GLN C 1 78 ? 56.107 30.743 41.552 1.00 15.37  ? 78  GLN C NE2 1 
ATOM   2022 N N   . LYS C 1 79 ? 53.995 36.875 43.099 1.00 18.24  ? 79  LYS C N   1 
ATOM   2023 C CA  . LYS C 1 79 ? 54.214 38.033 43.941 1.00 18.29  ? 79  LYS C CA  1 
ATOM   2024 C C   . LYS C 1 79 ? 54.519 37.334 45.262 1.00 19.85  ? 79  LYS C C   1 
ATOM   2025 O O   . LYS C 1 79 ? 53.662 37.151 46.138 1.00 23.67  ? 79  LYS C O   1 
ATOM   2026 C CB  . LYS C 1 79 ? 52.968 38.908 44.041 1.00 20.91  ? 79  LYS C CB  1 
ATOM   2027 C CG  . LYS C 1 79 ? 53.378 40.193 44.807 1.00 26.26  ? 79  LYS C CG  1 
ATOM   2028 C CD  . LYS C 1 79 ? 52.461 40.602 45.962 1.00 28.40  ? 79  LYS C CD  1 
ATOM   2029 C CE  . LYS C 1 79 ? 51.067 40.852 45.435 1.00 33.27  ? 79  LYS C CE  1 
ATOM   2030 N NZ  . LYS C 1 79 ? 50.199 41.318 46.492 1.00 37.64  ? 79  LYS C NZ  1 
ATOM   2031 O OXT . LYS C 1 79 ? 55.646 36.861 45.383 1.00 20.19  ? 79  LYS C OXT 1 
HETATM 2032 S S   . SO4 D 2 .  ? 19.116 13.710 26.590 1.00 64.54  ? 300 SO4 A S   1 
HETATM 2033 O O1  . SO4 D 2 .  ? 19.572 13.031 27.749 1.00 69.03  ? 300 SO4 A O1  1 
HETATM 2034 O O2  . SO4 D 2 .  ? 17.731 13.983 26.614 1.00 63.49  ? 300 SO4 A O2  1 
HETATM 2035 O O3  . SO4 D 2 .  ? 19.473 12.938 25.447 1.00 68.33  ? 300 SO4 A O3  1 
HETATM 2036 O O4  . SO4 D 2 .  ? 19.805 14.925 26.483 1.00 65.74  ? 300 SO4 A O4  1 
HETATM 2037 S S   . SO4 E 2 .  ? 15.504 49.644 35.500 1.00 41.75  ? 301 SO4 B S   1 
HETATM 2038 O O1  . SO4 E 2 .  ? 14.645 49.239 34.450 1.00 45.70  ? 301 SO4 B O1  1 
HETATM 2039 O O2  . SO4 E 2 .  ? 15.658 51.035 35.625 1.00 42.57  ? 301 SO4 B O2  1 
HETATM 2040 O O3  . SO4 E 2 .  ? 16.732 49.025 35.245 1.00 45.29  ? 301 SO4 B O3  1 
HETATM 2041 O O4  . SO4 E 2 .  ? 15.026 49.262 36.763 1.00 48.78  ? 301 SO4 B O4  1 
HETATM 2042 S S   . SO4 F 2 .  ? 7.182  22.577 60.797 1.00 29.90  ? 302 SO4 C S   1 
HETATM 2043 O O1  . SO4 F 2 .  ? 7.412  21.445 60.009 1.00 30.55  ? 302 SO4 C O1  1 
HETATM 2044 O O2  . SO4 F 2 .  ? 6.463  22.028 61.862 1.00 35.57  ? 302 SO4 C O2  1 
HETATM 2045 O O3  . SO4 F 2 .  ? 6.452  23.569 60.136 1.00 26.85  ? 302 SO4 C O3  1 
HETATM 2046 O O4  . SO4 F 2 .  ? 8.362  23.187 61.257 1.00 31.54  ? 302 SO4 C O4  1 
HETATM 2047 O O   . HOH G 3 .  ? 22.692 13.446 31.803 1.00 62.29  ? 303 HOH A O   1 
HETATM 2048 O O   . HOH G 3 .  ? 4.132  24.411 40.041 1.00 55.19  ? 304 HOH A O   1 
HETATM 2049 O O   . HOH G 3 .  ? 6.065  21.568 40.597 1.00 19.19  ? 305 HOH A O   1 
HETATM 2050 O O   . HOH G 3 .  ? 6.400  14.686 38.757 1.00 20.45  ? 306 HOH A O   1 
HETATM 2051 O O   . HOH G 3 .  ? 14.643 25.804 22.397 1.00 14.24  ? 308 HOH A O   1 
HETATM 2052 O O   . HOH G 3 .  ? 23.285 28.920 16.613 1.00 23.93  ? 309 HOH A O   1 
HETATM 2053 O O   . HOH G 3 .  ? 26.201 32.904 28.055 1.00 43.25  ? 310 HOH A O   1 
HETATM 2054 O O   . HOH G 3 .  ? 21.842 39.067 19.821 1.00 23.15  ? 311 HOH A O   1 
HETATM 2055 O O   . HOH G 3 .  ? 12.071 25.633 18.453 1.00 38.42  ? 312 HOH A O   1 
HETATM 2056 O O   . HOH G 3 .  ? 13.075 35.239 23.831 1.00 52.82  ? 313 HOH A O   1 
HETATM 2057 O O   . HOH G 3 .  ? -0.193 19.220 46.099 1.00 22.46  ? 325 HOH A O   1 
HETATM 2058 O O   . HOH G 3 .  ? 20.304 29.715 29.514 1.00 27.52  ? 330 HOH A O   1 
HETATM 2059 O O   . HOH G 3 .  ? 43.480 43.973 59.668 1.00 29.85  ? 335 HOH A O   1 
HETATM 2060 O O   . HOH G 3 .  ? 8.807  20.477 24.694 1.00 50.19  ? 337 HOH A O   1 
HETATM 2061 O O   . HOH G 3 .  ? 19.781 32.903 23.945 1.00 23.93  ? 338 HOH A O   1 
HETATM 2062 O O   . HOH G 3 .  ? 5.752  22.996 37.680 1.00 36.57  ? 346 HOH A O   1 
HETATM 2063 O O   . HOH G 3 .  ? 12.274 24.797 21.251 1.00 24.76  ? 358 HOH A O   1 
HETATM 2064 O O   . HOH G 3 .  ? 49.845 42.153 53.252 1.00 21.45  ? 365 HOH A O   1 
HETATM 2065 O O   . HOH G 3 .  ? 30.917 19.457 17.056 1.00 60.43  ? 374 HOH A O   1 
HETATM 2066 O O   . HOH G 3 .  ? 26.975 14.148 35.532 1.00 33.22  ? 375 HOH A O   1 
HETATM 2067 O O   . HOH G 3 .  ? 22.199 35.509 27.419 1.00 53.12  ? 381 HOH A O   1 
HETATM 2068 O O   . HOH G 3 .  ? 32.493 18.265 19.964 1.00 63.83  ? 387 HOH A O   1 
HETATM 2069 O O   . HOH G 3 .  ? 9.444  26.008 34.862 1.00 33.27  ? 390 HOH A O   1 
HETATM 2070 O O   . HOH G 3 .  ? 20.266 12.777 34.290 1.00 44.81  ? 391 HOH A O   1 
HETATM 2071 O O   . HOH G 3 .  ? 25.485 31.647 32.737 1.00 40.30  ? 392 HOH A O   1 
HETATM 2072 O O   . HOH G 3 .  ? 34.663 27.707 30.594 1.00 50.03  ? 393 HOH A O   1 
HETATM 2073 O O   . HOH G 3 .  ? 23.375 33.124 28.506 1.00 43.81  ? 394 HOH A O   1 
HETATM 2074 O O   . HOH G 3 .  ? 18.572 29.137 13.078 1.00 28.18  ? 395 HOH A O   1 
HETATM 2075 O O   . HOH G 3 .  ? 12.974 29.017 23.422 1.00 39.91  ? 398 HOH A O   1 
HETATM 2076 O O   . HOH G 3 .  ? 15.253 28.128 8.223  1.00 69.45  ? 402 HOH A O   1 
HETATM 2077 O O   . HOH G 3 .  ? 15.771 20.739 15.079 1.00 41.09  ? 403 HOH A O   1 
HETATM 2078 O O   . HOH G 3 .  ? 23.137 14.184 15.324 1.00 47.72  ? 404 HOH A O   1 
HETATM 2079 O O   . HOH G 3 .  ? 5.287  27.834 32.222 1.00 58.02  ? 406 HOH A O   1 
HETATM 2080 O O   . HOH G 3 .  ? 10.969 41.626 24.882 1.00 44.16  ? 425 HOH A O   1 
HETATM 2081 O O   . HOH G 3 .  ? 38.246 37.419 50.051 1.00 29.83  ? 427 HOH A O   1 
HETATM 2082 O O   . HOH G 3 .  ? 48.981 37.344 58.321 1.00 34.37  ? 432 HOH A O   1 
HETATM 2083 O O   . HOH G 3 .  ? 28.289 17.884 23.016 1.00 27.30  ? 442 HOH A O   1 
HETATM 2084 O O   . HOH G 3 .  ? 29.548 18.900 20.796 1.00 45.24  ? 445 HOH A O   1 
HETATM 2085 O O   . HOH G 3 .  ? 13.122 38.145 20.321 1.00 90.05  ? 451 HOH A O   1 
HETATM 2086 O O   . HOH G 3 .  ? 24.084 15.709 13.113 1.00 44.25  ? 512 HOH A O   1 
HETATM 2087 O O   . HOH G 3 .  ? 36.399 28.457 24.821 1.00 39.39  ? 529 HOH A O   1 
HETATM 2088 O O   . HOH G 3 .  ? 11.557 11.067 25.973 1.00 52.46  ? 555 HOH A O   1 
HETATM 2089 O O   . HOH G 3 .  ? 15.709 29.091 14.034 1.00 49.82  ? 569 HOH A O   1 
HETATM 2090 O O   . HOH G 3 .  ? 27.572 14.234 24.531 1.00 59.38  ? 570 HOH A O   1 
HETATM 2091 O O   . HOH G 3 .  ? -0.381 22.819 36.934 1.00 52.65  ? 576 HOH A O   1 
HETATM 2092 O O   . HOH G 3 .  ? 7.778  15.403 26.557 1.00 80.99  ? 579 HOH A O   1 
HETATM 2093 O O   . HOH G 3 .  ? 33.083 36.683 39.706 1.00 43.71  ? 583 HOH A O   1 
HETATM 2094 O O   . HOH G 3 .  ? 13.730 24.793 14.979 1.00 44.61  ? 586 HOH A O   1 
HETATM 2095 O O   . HOH G 3 .  ? 23.637 41.334 17.872 1.00 40.07  ? 613 HOH A O   1 
HETATM 2096 O O   . HOH G 3 .  ? 35.663 41.061 36.980 1.00 57.32  ? 632 HOH A O   1 
HETATM 2097 O O   . HOH G 3 .  ? 43.751 39.738 67.234 1.00 56.28  ? 668 HOH A O   1 
HETATM 2098 O O   . HOH G 3 .  ? 17.585 24.425 34.164 1.00 44.09  ? 683 HOH A O   1 
HETATM 2099 O O   . HOH G 3 .  ? 4.966  24.256 28.690 1.00 49.29  ? 688 HOH A O   1 
HETATM 2100 O O   . HOH G 3 .  ? 24.839 40.591 38.078 1.00 43.98  ? 695 HOH A O   1 
HETATM 2101 O O   . HOH G 3 .  ? 22.339 18.049 16.195 1.00 47.09  ? 717 HOH A O   1 
HETATM 2102 O O   . HOH G 3 .  ? 12.803 22.147 21.274 1.00 30.77  ? 800 HOH A O   1 
HETATM 2103 O O   . HOH G 3 .  ? 21.837 21.251 38.045 1.00 63.36  ? 845 HOH A O   1 
HETATM 2104 O O   . HOH G 3 .  ? 23.832 33.793 32.120 1.00 58.66  ? 856 HOH A O   1 
HETATM 2105 O O   . HOH G 3 .  ? 37.383 14.478 16.677 1.00 46.08  ? 858 HOH A O   1 
HETATM 2106 O O   . HOH G 3 .  ? 12.436 12.394 34.638 1.00 56.07  ? 877 HOH A O   1 
HETATM 2107 O O   . HOH G 3 .  ? 9.845  14.693 29.157 1.00 71.06  ? 879 HOH A O   1 
HETATM 2108 O O   . HOH G 3 .  ? 22.919 31.585 17.487 1.00 85.61  ? 880 HOH A O   1 
HETATM 2109 O O   . HOH G 3 .  ? 2.558  26.477 41.112 1.00 82.92  ? 882 HOH A O   1 
HETATM 2110 O O   . HOH G 3 .  ? 44.469 33.652 52.586 1.00 36.70  ? 894 HOH A O   1 
HETATM 2111 O O   . HOH G 3 .  ? 7.987  24.135 40.509 1.00 71.66  ? 911 HOH A O   1 
HETATM 2112 O O   . HOH H 3 .  ? 14.853 38.437 50.340 1.00 17.68  ? 314 HOH B O   1 
HETATM 2113 O O   . HOH H 3 .  ? 13.378 39.233 48.173 1.00 14.14  ? 315 HOH B O   1 
HETATM 2114 O O   . HOH H 3 .  ? 8.455  42.267 60.234 1.00 28.45  ? 316 HOH B O   1 
HETATM 2115 O O   . HOH H 3 .  ? 26.061 44.654 37.120 1.00 47.20  ? 317 HOH B O   1 
HETATM 2116 O O   . HOH H 3 .  ? 26.540 31.867 55.433 1.00 50.50  ? 318 HOH B O   1 
HETATM 2117 O O   . HOH H 3 .  ? 3.312  38.927 51.452 1.00 20.40  ? 321 HOH B O   1 
HETATM 2118 O O   . HOH H 3 .  ? 9.956  41.863 52.512 1.00 14.01  ? 331 HOH B O   1 
HETATM 2119 O O   . HOH H 3 .  ? 6.606  45.137 44.762 1.00 16.32  ? 332 HOH B O   1 
HETATM 2120 O O   . HOH H 3 .  ? 4.000  34.583 55.165 1.00 47.08  ? 339 HOH B O   1 
HETATM 2121 O O   . HOH H 3 .  ? 12.723 39.452 54.777 1.00 31.41  ? 341 HOH B O   1 
HETATM 2122 O O   . HOH H 3 .  ? 5.014  42.545 45.927 1.00 24.23  ? 342 HOH B O   1 
HETATM 2123 O O   . HOH H 3 .  ? 53.048 7.924  53.784 1.00 23.95  ? 345 HOH B O   1 
HETATM 2124 O O   . HOH H 3 .  ? 4.201  45.959 43.255 1.00 19.06  ? 349 HOH B O   1 
HETATM 2125 O O   . HOH H 3 .  ? 15.251 32.943 42.389 1.00 51.23  ? 350 HOH B O   1 
HETATM 2126 O O   . HOH H 3 .  ? 9.480  29.764 32.646 1.00 38.19  ? 356 HOH B O   1 
HETATM 2127 O O   . HOH H 3 .  ? 49.088 15.977 62.952 1.00 43.08  ? 366 HOH B O   1 
HETATM 2128 O O   . HOH H 3 .  ? 50.649 15.765 45.922 1.00 40.04  ? 373 HOH B O   1 
HETATM 2129 O O   . HOH H 3 .  ? 16.202 41.831 27.293 1.00 71.66  ? 397 HOH B O   1 
HETATM 2130 O O   . HOH H 3 .  ? 5.995  37.963 26.058 1.00 46.45  ? 405 HOH B O   1 
HETATM 2131 O O   . HOH H 3 .  ? 14.667 40.893 55.932 1.00 51.33  ? 407 HOH B O   1 
HETATM 2132 O O   . HOH H 3 .  ? 6.722  43.403 58.859 1.00 43.77  ? 408 HOH B O   1 
HETATM 2133 O O   . HOH H 3 .  ? 2.878  50.999 46.661 1.00 32.96  ? 409 HOH B O   1 
HETATM 2134 O O   . HOH H 3 .  ? 49.192 20.529 59.137 1.00 34.16  ? 411 HOH B O   1 
HETATM 2135 O O   . HOH H 3 .  ? 47.331 8.396  63.370 1.00 69.91  ? 412 HOH B O   1 
HETATM 2136 O O   . HOH H 3 .  ? 24.837 48.808 41.351 1.00 49.50  ? 423 HOH B O   1 
HETATM 2137 O O   . HOH H 3 .  ? 11.417 36.931 55.817 1.00 36.48  ? 429 HOH B O   1 
HETATM 2138 O O   . HOH H 3 .  ? 8.157  32.105 33.567 1.00 49.10  ? 433 HOH B O   1 
HETATM 2139 O O   . HOH H 3 .  ? 27.399 32.637 52.969 1.00 55.19  ? 435 HOH B O   1 
HETATM 2140 O O   . HOH H 3 .  ? 50.136 8.098  63.569 1.00 73.13  ? 436 HOH B O   1 
HETATM 2141 O O   . HOH H 3 .  ? 5.397  35.453 57.418 1.00 73.94  ? 437 HOH B O   1 
HETATM 2142 O O   . HOH H 3 .  ? 30.982 31.507 60.594 1.00 32.33  ? 439 HOH B O   1 
HETATM 2143 O O   . HOH H 3 .  ? 2.986  43.920 48.220 1.00 37.61  ? 441 HOH B O   1 
HETATM 2144 O O   . HOH H 3 .  ? 19.759 54.754 46.971 1.00 58.31  ? 443 HOH B O   1 
HETATM 2145 O O   . HOH H 3 .  ? 11.839 35.711 26.200 1.00 35.05  ? 446 HOH B O   1 
HETATM 2146 O O   . HOH H 3 .  ? 9.888  50.736 53.580 1.00 34.01  ? 448 HOH B O   1 
HETATM 2147 O O   . HOH H 3 .  ? 18.790 41.335 56.833 1.00 60.22  ? 516 HOH B O   1 
HETATM 2148 O O   . HOH H 3 .  ? 51.925 8.024  65.742 1.00 57.47  ? 531 HOH B O   1 
HETATM 2149 O O   . HOH H 3 .  ? 17.163 60.917 37.338 1.00 60.66  ? 533 HOH B O   1 
HETATM 2150 O O   . HOH H 3 .  ? 4.323  33.120 34.612 1.00 69.59  ? 534 HOH B O   1 
HETATM 2151 O O   . HOH H 3 .  ? 8.974  32.685 24.316 1.00 98.56  ? 535 HOH B O   1 
HETATM 2152 O O   . HOH H 3 .  ? 15.677 26.325 45.625 1.00 59.08  ? 561 HOH B O   1 
HETATM 2153 O O   . HOH H 3 .  ? 23.149 40.193 31.698 1.00 68.20  ? 578 HOH B O   1 
HETATM 2154 O O   . HOH H 3 .  ? 9.238  23.727 28.452 1.00 50.80  ? 596 HOH B O   1 
HETATM 2155 O O   . HOH H 3 .  ? 18.082 41.152 30.173 1.00 50.07  ? 673 HOH B O   1 
HETATM 2156 O O   . HOH H 3 .  ? 20.674 38.344 39.196 1.00 50.87  ? 684 HOH B O   1 
HETATM 2157 O O   . HOH H 3 .  ? 25.066 47.257 37.701 1.00 72.22  ? 687 HOH B O   1 
HETATM 2158 O O   . HOH H 3 .  ? 12.313 51.240 32.143 1.00 50.25  ? 691 HOH B O   1 
HETATM 2159 O O   . HOH H 3 .  ? 8.258  25.966 27.009 1.00 45.80  ? 692 HOH B O   1 
HETATM 2160 O O   . HOH H 3 .  ? 15.193 39.410 52.892 1.00 50.38  ? 696 HOH B O   1 
HETATM 2161 O O   . HOH H 3 .  ? 7.118  56.742 39.407 1.00 39.06  ? 699 HOH B O   1 
HETATM 2162 O O   . HOH H 3 .  ? 3.835  52.960 45.003 1.00 57.77  ? 700 HOH B O   1 
HETATM 2163 O O   . HOH H 3 .  ? 17.733 27.811 52.326 1.00 39.73  ? 701 HOH B O   1 
HETATM 2164 O O   . HOH H 3 .  ? 43.526 9.916  63.449 1.00 94.28  ? 703 HOH B O   1 
HETATM 2165 O O   . HOH H 3 .  ? 6.115  45.849 57.928 1.00 33.74  ? 704 HOH B O   1 
HETATM 2166 O O   . HOH H 3 .  ? 1.030  39.035 61.462 1.00 57.28  ? 710 HOH B O   1 
HETATM 2167 O O   . HOH H 3 .  ? 16.828 35.988 52.932 1.00 59.07  ? 801 HOH B O   1 
HETATM 2168 O O   . HOH H 3 .  ? 22.954 53.301 46.721 1.00 54.13  ? 803 HOH B O   1 
HETATM 2169 O O   . HOH H 3 .  ? 14.763 46.515 31.073 1.00 64.90  ? 808 HOH B O   1 
HETATM 2170 O O   . HOH H 3 .  ? 25.882 48.472 56.008 1.00 47.83  ? 813 HOH B O   1 
HETATM 2171 O O   . HOH H 3 .  ? 20.706 53.031 44.897 1.00 43.66  ? 854 HOH B O   1 
HETATM 2172 O O   . HOH H 3 .  ? 22.345 53.486 50.842 1.00 59.59  ? 862 HOH B O   1 
HETATM 2173 O O   . HOH H 3 .  ? 15.590 42.146 30.015 1.00 46.78  ? 863 HOH B O   1 
HETATM 2174 O O   . HOH H 3 .  ? 26.620 29.095 52.532 1.00 64.88  ? 876 HOH B O   1 
HETATM 2175 O O   . HOH H 3 .  ? 35.355 26.706 52.999 1.00 52.75  ? 889 HOH B O   1 
HETATM 2176 O O   . HOH H 3 .  ? 21.173 44.454 32.782 1.00 51.10  ? 899 HOH B O   1 
HETATM 2177 O O   . HOH H 3 .  ? 5.171  28.794 29.549 1.00 79.66  ? 903 HOH B O   1 
HETATM 2178 O O   . HOH H 3 .  ? 36.591 53.699 52.401 1.00 65.56  ? 906 HOH B O   1 
HETATM 2179 O O   . HOH H 3 .  ? 20.628 32.543 45.366 1.00 77.64  ? 909 HOH B O   1 
HETATM 2180 O O   . HOH H 3 .  ? 19.702 31.803 58.218 1.00 66.08  ? 910 HOH B O   1 
HETATM 2181 O O   . HOH I 3 .  ? 8.089  11.036 37.804 1.00 28.77  ? 307 HOH C O   1 
HETATM 2182 O O   . HOH I 3 .  ? 12.076 11.577 45.272 1.00 17.09  ? 319 HOH C O   1 
HETATM 2183 O O   . HOH I 3 .  ? 39.340 17.465 44.075 1.00 7.50   ? 320 HOH C O   1 
HETATM 2184 O O   . HOH I 3 .  ? 5.413  34.927 43.514 1.00 17.08  ? 322 HOH C O   1 
HETATM 2185 O O   . HOH I 3 .  ? 7.053  12.301 40.148 1.00 14.07  ? 323 HOH C O   1 
HETATM 2186 O O   . HOH I 3 .  ? 36.774 16.613 44.824 1.00 16.10  ? 324 HOH C O   1 
HETATM 2187 O O   . HOH I 3 .  ? 50.238 36.488 40.620 1.00 19.77  ? 326 HOH C O   1 
HETATM 2188 O O   . HOH I 3 .  ? 24.978 17.659 37.555 1.00 38.30  ? 327 HOH C O   1 
HETATM 2189 O O   . HOH I 3 .  ? 32.480 17.502 44.170 1.00 37.26  ? 328 HOH C O   1 
HETATM 2190 O O   . HOH I 3 .  ? 4.960  14.999 49.281 1.00 19.48  ? 329 HOH C O   1 
HETATM 2191 O O   . HOH I 3 .  ? 5.745  39.186 40.733 1.00 52.81  ? 333 HOH C O   1 
HETATM 2192 O O   . HOH I 3 .  ? 52.376 39.541 38.219 1.00 29.64  ? 334 HOH C O   1 
HETATM 2193 O O   . HOH I 3 .  ? -0.259 17.372 51.564 1.00 28.57  ? 336 HOH C O   1 
HETATM 2194 O O   . HOH I 3 .  ? 41.205 24.820 41.932 1.00 32.11  ? 343 HOH C O   1 
HETATM 2195 O O   . HOH I 3 .  ? 2.099  15.104 49.746 1.00 26.08  ? 344 HOH C O   1 
HETATM 2196 O O   . HOH I 3 .  ? -1.224 16.173 53.838 1.00 26.13  ? 348 HOH C O   1 
HETATM 2197 O O   . HOH I 3 .  ? 23.971 15.977 60.646 1.00 34.53  ? 351 HOH C O   1 
HETATM 2198 O O   . HOH I 3 .  ? 11.419 6.486  49.566 1.00 63.68  ? 352 HOH C O   1 
HETATM 2199 O O   . HOH I 3 .  ? 0.320  16.710 55.995 1.00 27.40  ? 353 HOH C O   1 
HETATM 2200 O O   . HOH I 3 .  ? 5.052  40.312 38.425 1.00 63.41  ? 354 HOH C O   1 
HETATM 2201 O O   . HOH I 3 .  ? 3.873  31.399 43.577 1.00 40.19  ? 355 HOH C O   1 
HETATM 2202 O O   . HOH I 3 .  ? -1.801 18.492 49.737 1.00 29.61  ? 357 HOH C O   1 
HETATM 2203 O O   . HOH I 3 .  ? 57.222 25.328 39.371 1.00 27.20  ? 359 HOH C O   1 
HETATM 2204 O O   . HOH I 3 .  ? 72.838 28.732 36.759 1.00 60.37  ? 360 HOH C O   1 
HETATM 2205 O O   . HOH I 3 .  ? 12.072 32.571 58.141 1.00 59.79  ? 361 HOH C O   1 
HETATM 2206 O O   . HOH I 3 .  ? -0.393 21.133 50.310 1.00 28.57  ? 362 HOH C O   1 
HETATM 2207 O O   . HOH I 3 .  ? 59.431 29.915 36.167 1.00 32.67  ? 363 HOH C O   1 
HETATM 2208 O O   . HOH I 3 .  ? 0.493  21.782 46.984 1.00 45.45  ? 364 HOH C O   1 
HETATM 2209 O O   . HOH I 3 .  ? 18.269 10.757 45.952 1.00 68.71  ? 367 HOH C O   1 
HETATM 2210 O O   . HOH I 3 .  ? 56.115 34.431 32.342 1.00 39.85  ? 368 HOH C O   1 
HETATM 2211 O O   . HOH I 3 .  ? 50.129 21.581 45.590 1.00 41.10  ? 369 HOH C O   1 
HETATM 2212 O O   . HOH I 3 .  ? 54.827 43.680 45.909 1.00 23.59  ? 370 HOH C O   1 
HETATM 2213 O O   . HOH I 3 .  ? 6.765  33.068 42.330 1.00 49.06  ? 371 HOH C O   1 
HETATM 2214 O O   . HOH I 3 .  ? 17.994 28.511 57.583 1.00 46.08  ? 376 HOH C O   1 
HETATM 2215 O O   . HOH I 3 .  ? 3.363  17.304 55.799 1.00 40.69  ? 378 HOH C O   1 
HETATM 2216 O O   . HOH I 3 .  ? 1.361  2.529  61.721 1.00 56.16  ? 383 HOH C O   1 
HETATM 2217 O O   . HOH I 3 .  ? 6.630  0.821  55.026 1.00 75.77  ? 384 HOH C O   1 
HETATM 2218 O O   . HOH I 3 .  ? 11.413 8.632  33.629 1.00 59.55  ? 388 HOH C O   1 
HETATM 2219 O O   . HOH I 3 .  ? -2.421 29.822 59.307 1.00 56.11  ? 414 HOH C O   1 
HETATM 2220 O O   . HOH I 3 .  ? 27.254 15.114 51.755 1.00 41.29  ? 415 HOH C O   1 
HETATM 2221 O O   . HOH I 3 .  ? 14.165 4.889  42.304 1.00 16.12  ? 417 HOH C O   1 
HETATM 2222 O O   . HOH I 3 .  ? 19.605 12.883 47.824 1.00 57.33  ? 418 HOH C O   1 
HETATM 2223 O O   . HOH I 3 .  ? 19.605 16.038 43.969 1.00 48.97  ? 419 HOH C O   1 
HETATM 2224 O O   . HOH I 3 .  ? 2.114  16.115 52.253 1.00 36.26  ? 420 HOH C O   1 
HETATM 2225 O O   . HOH I 3 .  ? 60.848 33.165 44.292 1.00 36.73  ? 422 HOH C O   1 
HETATM 2226 O O   . HOH I 3 .  ? 0.791  15.269 47.420 1.00 27.78  ? 426 HOH C O   1 
HETATM 2227 O O   . HOH I 3 .  ? 5.522  32.146 55.741 1.00 53.45  ? 430 HOH C O   1 
HETATM 2228 O O   . HOH I 3 .  ? 51.288 41.520 50.424 1.00 27.04  ? 431 HOH C O   1 
HETATM 2229 O O   . HOH I 3 .  ? 51.657 29.070 32.848 1.00 50.32  ? 440 HOH C O   1 
HETATM 2230 O O   . HOH I 3 .  ? 10.439 5.928  52.008 1.00 32.40  ? 444 HOH C O   1 
HETATM 2231 O O   . HOH I 3 .  ? 1.437  35.554 41.098 1.00 28.37  ? 447 HOH C O   1 
HETATM 2232 O O   . HOH I 3 .  ? 57.483 28.385 42.550 1.00 30.60  ? 449 HOH C O   1 
HETATM 2233 O O   . HOH I 3 .  ? -2.693 25.897 46.575 1.00 42.82  ? 450 HOH C O   1 
HETATM 2234 O O   . HOH I 3 .  ? -1.106 28.550 46.790 1.00 35.21  ? 503 HOH C O   1 
HETATM 2235 O O   . HOH I 3 .  ? -4.775 27.193 44.568 1.00 45.44  ? 518 HOH C O   1 
HETATM 2236 O O   . HOH I 3 .  ? 9.247  10.945 60.699 1.00 43.21  ? 541 HOH C O   1 
HETATM 2237 O O   . HOH I 3 .  ? 31.951 12.275 67.607 1.00 48.16  ? 558 HOH C O   1 
HETATM 2238 O O   . HOH I 3 .  ? 3.221  33.031 41.341 1.00 59.76  ? 572 HOH C O   1 
HETATM 2239 O O   . HOH I 3 .  ? 18.980 9.324  60.572 1.00 55.24  ? 585 HOH C O   1 
HETATM 2240 O O   . HOH I 3 .  ? 27.260 12.500 57.253 1.00 63.74  ? 590 HOH C O   1 
HETATM 2241 O O   . HOH I 3 .  ? 22.161 23.767 43.655 1.00 59.33  ? 598 HOH C O   1 
HETATM 2242 O O   . HOH I 3 .  ? 30.328 11.238 65.704 1.00 88.40  ? 600 HOH C O   1 
HETATM 2243 O O   . HOH I 3 .  ? 12.694 27.018 45.721 1.00 71.65  ? 612 HOH C O   1 
HETATM 2244 O O   . HOH I 3 .  ? 33.034 11.754 52.533 1.00 58.89  ? 614 HOH C O   1 
HETATM 2245 O O   . HOH I 3 .  ? 12.017 10.029 36.080 1.00 26.47  ? 616 HOH C O   1 
HETATM 2246 O O   . HOH I 3 .  ? 9.204  3.701  51.298 1.00 60.60  ? 643 HOH C O   1 
HETATM 2247 O O   . HOH I 3 .  ? 28.485 14.591 38.595 1.00 39.51  ? 649 HOH C O   1 
HETATM 2248 O O   . HOH I 3 .  ? 10.037 11.859 36.097 1.00 30.91  ? 660 HOH C O   1 
HETATM 2249 O O   . HOH I 3 .  ? 27.130 9.527  66.357 1.00 67.25  ? 680 HOH C O   1 
HETATM 2250 O O   . HOH I 3 .  ? 14.409 26.836 53.492 1.00 38.76  ? 706 HOH C O   1 
HETATM 2251 O O   . HOH I 3 .  ? 5.019  26.003 61.209 1.00 43.28  ? 708 HOH C O   1 
HETATM 2252 O O   . HOH I 3 .  ? 2.647  31.510 57.394 1.00 51.96  ? 709 HOH C O   1 
HETATM 2253 O O   . HOH I 3 .  ? 2.584  28.525 61.105 1.00 36.42  ? 712 HOH C O   1 
HETATM 2254 O O   . HOH I 3 .  ? 11.135 29.445 59.788 1.00 37.11  ? 713 HOH C O   1 
HETATM 2255 O O   . HOH I 3 .  ? -0.158 10.602 50.339 1.00 26.47  ? 802 HOH C O   1 
HETATM 2256 O O   . HOH I 3 .  ? 4.600  6.054  56.285 1.00 81.30  ? 805 HOH C O   1 
HETATM 2257 O O   . HOH I 3 .  ? 56.080 36.605 30.549 1.00 43.02  ? 807 HOH C O   1 
HETATM 2258 O O   . HOH I 3 .  ? 35.729 14.247 45.914 1.00 51.09  ? 811 HOH C O   1 
HETATM 2259 O O   . HOH I 3 .  ? 36.840 11.863 46.898 1.00 28.45  ? 830 HOH C O   1 
HETATM 2260 O O   . HOH I 3 .  ? 7.984  32.832 56.770 1.00 46.40  ? 842 HOH C O   1 
HETATM 2261 O O   . HOH I 3 .  ? 21.922 24.239 40.335 1.00 90.87  ? 852 HOH C O   1 
HETATM 2262 O O   . HOH I 3 .  ? 25.127 5.244  53.955 1.00 62.67  ? 853 HOH C O   1 
HETATM 2263 O O   . HOH I 3 .  ? 5.612  29.081 58.735 1.00 64.47  ? 860 HOH C O   1 
HETATM 2264 O O   . HOH I 3 .  ? 58.540 26.472 37.346 1.00 70.15  ? 866 HOH C O   1 
HETATM 2265 O O   . HOH I 3 .  ? 26.740 16.067 43.953 1.00 72.21  ? 869 HOH C O   1 
HETATM 2266 O O   . HOH I 3 .  ? -4.908 32.403 45.426 1.00 89.19  ? 871 HOH C O   1 
HETATM 2267 O O   . HOH I 3 .  ? 35.682 12.896 51.964 1.00 70.10  ? 891 HOH C O   1 
HETATM 2268 O O   . HOH I 3 .  ? 16.029 8.427  60.267 1.00 44.75  ? 896 HOH C O   1 
HETATM 2269 O O   . HOH I 3 .  ? 28.550 10.074 48.771 1.00 71.59  ? 897 HOH C O   1 
HETATM 2270 O O   . HOH I 3 .  ? 9.124  26.549 62.474 1.00 74.94  ? 908 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  HIS 3  3  3  HIS HIS A . n 
A 1 4  LYS 4  4  4  LYS LYS A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  ILE 6  6  6  ILE ILE A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  TYR 8  8  8  TYR TYR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 LYS 11 11 11 LYS LYS A . n 
A 1 12 TYR 12 12 12 TYR TYR A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLU 15 15 15 GLU GLU A . n 
A 1 16 HIS 16 16 16 HIS HIS A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 GLU 18 18 18 GLU GLU A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 ARG 20 20 20 ARG ARG A . n 
A 1 21 HIS 21 21 21 HIS HIS A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 MET 23 23 23 MET MET A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 GLU 27 27 27 GLU GLU A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 SER 29 29 29 SER SER A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 HIS 36 36 36 HIS HIS A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 MET 38 38 38 MET MET A . n 
A 1 39 SER 39 39 39 SER SER A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 TRP 43 43 43 TRP TRP A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 ARG 45 45 45 ARG ARG A . n 
A 1 46 LEU 46 46 46 LEU LEU A . n 
A 1 47 GLY 47 47 47 GLY GLY A . n 
A 1 48 VAL 48 48 48 VAL VAL A . n 
A 1 49 GLN 49 49 49 GLN GLN A . n 
A 1 50 GLN 50 50 50 GLN GLN A . n 
A 1 51 SER 51 51 51 SER SER A . n 
A 1 52 LEU 52 52 52 LEU LEU A . n 
A 1 53 GLY 53 53 53 GLY GLY A . n 
A 1 54 TRP 54 54 54 TRP TRP A . n 
A 1 55 VAL 55 55 55 VAL VAL A . n 
A 1 56 HIS 56 56 56 HIS HIS A . n 
A 1 57 TYR 57 57 57 TYR TYR A . n 
A 1 58 MET 58 58 58 MET MET A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 HIS 60 60 60 HIS HIS A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 PRO 62 62 62 PRO PRO A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 PRO 64 64 64 PRO PRO A . n 
A 1 65 HIS 65 65 65 HIS HIS A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 LEU 67 67 67 LEU LEU A . n 
A 1 68 LEU 68 68 68 LEU LEU A . n 
A 1 69 PHE 69 69 69 PHE PHE A . n 
A 1 70 ARG 70 70 70 ARG ARG A . n 
A 1 71 ARG 71 71 71 ARG ARG A . n 
A 1 72 PRO 72 72 72 PRO PRO A . n 
A 1 73 LEU 73 73 73 LEU LEU A . n 
A 1 74 PRO 74 74 74 PRO PRO A . n 
A 1 75 LYS 75 75 75 LYS LYS A . n 
A 1 76 ASP 76 76 ?  ?   ?   A . n 
A 1 77 GLN 77 77 ?  ?   ?   A . n 
A 1 78 GLN 78 78 ?  ?   ?   A . n 
A 1 79 LYS 79 79 ?  ?   ?   A . n 
B 1 1  MET 1  1  ?  ?   ?   B . n 
B 1 2  ALA 2  2  2  ALA ALA B . n 
B 1 3  HIS 3  3  3  HIS HIS B . n 
B 1 4  LYS 4  4  4  LYS LYS B . n 
B 1 5  GLN 5  5  5  GLN GLN B . n 
B 1 6  ILE 6  6  6  ILE ILE B . n 
B 1 7  TYR 7  7  7  TYR TYR B . n 
B 1 8  TYR 8  8  8  TYR TYR B . n 
B 1 9  SER 9  9  9  SER SER B . n 
B 1 10 ASP 10 10 10 ASP ASP B . n 
B 1 11 LYS 11 11 11 LYS LYS B . n 
B 1 12 TYR 12 12 12 TYR TYR B . n 
B 1 13 PHE 13 13 13 PHE PHE B . n 
B 1 14 ASP 14 14 14 ASP ASP B . n 
B 1 15 GLU 15 15 15 GLU GLU B . n 
B 1 16 HIS 16 16 16 HIS HIS B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 GLU 18 18 18 GLU GLU B . n 
B 1 19 TYR 19 19 19 TYR TYR B . n 
B 1 20 ARG 20 20 20 ARG ARG B . n 
B 1 21 HIS 21 21 21 HIS HIS B . n 
B 1 22 VAL 22 22 22 VAL VAL B . n 
B 1 23 MET 23 23 23 MET MET B . n 
B 1 24 LEU 24 24 24 LEU LEU B . n 
B 1 25 PRO 25 25 25 PRO PRO B . n 
B 1 26 ARG 26 26 26 ARG ARG B . n 
B 1 27 GLU 27 27 27 GLU GLU B . n 
B 1 28 LEU 28 28 28 LEU LEU B . n 
B 1 29 SER 29 29 29 SER SER B . n 
B 1 30 LYS 30 30 30 LYS LYS B . n 
B 1 31 GLN 31 31 31 GLN GLN B . n 
B 1 32 VAL 32 32 32 VAL VAL B . n 
B 1 33 PRO 33 33 33 PRO PRO B . n 
B 1 34 LYS 34 34 34 LYS LYS B . n 
B 1 35 THR 35 35 35 THR THR B . n 
B 1 36 HIS 36 36 36 HIS HIS B . n 
B 1 37 LEU 37 37 37 LEU LEU B . n 
B 1 38 MET 38 38 38 MET MET B . n 
B 1 39 SER 39 39 39 SER SER B . n 
B 1 40 GLU 40 40 40 GLU GLU B . n 
B 1 41 GLU 41 41 41 GLU GLU B . n 
B 1 42 GLU 42 42 42 GLU GLU B . n 
B 1 43 TRP 43 43 43 TRP TRP B . n 
B 1 44 ARG 44 44 44 ARG ARG B . n 
B 1 45 ARG 45 45 45 ARG ARG B . n 
B 1 46 LEU 46 46 46 LEU LEU B . n 
B 1 47 GLY 47 47 47 GLY GLY B . n 
B 1 48 VAL 48 48 48 VAL VAL B . n 
B 1 49 GLN 49 49 49 GLN GLN B . n 
B 1 50 GLN 50 50 50 GLN GLN B . n 
B 1 51 SER 51 51 51 SER SER B . n 
B 1 52 LEU 52 52 52 LEU LEU B . n 
B 1 53 GLY 53 53 53 GLY GLY B . n 
B 1 54 TRP 54 54 54 TRP TRP B . n 
B 1 55 VAL 55 55 55 VAL VAL B . n 
B 1 56 HIS 56 56 56 HIS HIS B . n 
B 1 57 TYR 57 57 57 TYR TYR B . n 
B 1 58 MET 58 58 58 MET MET B . n 
B 1 59 ILE 59 59 59 ILE ILE B . n 
B 1 60 HIS 60 60 60 HIS HIS B . n 
B 1 61 GLU 61 61 61 GLU GLU B . n 
B 1 62 PRO 62 62 62 PRO PRO B . n 
B 1 63 GLU 63 63 63 GLU GLU B . n 
B 1 64 PRO 64 64 64 PRO PRO B . n 
B 1 65 HIS 65 65 65 HIS HIS B . n 
B 1 66 ILE 66 66 66 ILE ILE B . n 
B 1 67 LEU 67 67 67 LEU LEU B . n 
B 1 68 LEU 68 68 68 LEU LEU B . n 
B 1 69 PHE 69 69 69 PHE PHE B . n 
B 1 70 ARG 70 70 70 ARG ARG B . n 
B 1 71 ARG 71 71 71 ARG ARG B . n 
B 1 72 PRO 72 72 72 PRO PRO B . n 
B 1 73 LEU 73 73 73 LEU LEU B . n 
B 1 74 PRO 74 74 74 PRO PRO B . n 
B 1 75 LYS 75 75 75 LYS LYS B . n 
B 1 76 ASP 76 76 76 ASP ASP B . n 
B 1 77 GLN 77 77 77 GLN GLN B . n 
B 1 78 GLN 78 78 78 GLN GLN B . n 
B 1 79 LYS 79 79 79 LYS LYS B . n 
C 1 1  MET 1  1  ?  ?   ?   C . n 
C 1 2  ALA 2  2  2  ALA ALA C . n 
C 1 3  HIS 3  3  3  HIS HIS C . n 
C 1 4  LYS 4  4  4  LYS LYS C . n 
C 1 5  GLN 5  5  5  GLN GLN C . n 
C 1 6  ILE 6  6  6  ILE ILE C . n 
C 1 7  TYR 7  7  7  TYR TYR C . n 
C 1 8  TYR 8  8  8  TYR TYR C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 ASP 10 10 10 ASP ASP C . n 
C 1 11 LYS 11 11 11 LYS LYS C . n 
C 1 12 TYR 12 12 12 TYR TYR C . n 
C 1 13 PHE 13 13 13 PHE PHE C . n 
C 1 14 ASP 14 14 14 ASP ASP C . n 
C 1 15 GLU 15 15 15 GLU GLU C . n 
C 1 16 HIS 16 16 16 HIS HIS C . n 
C 1 17 TYR 17 17 17 TYR TYR C . n 
C 1 18 GLU 18 18 18 GLU GLU C . n 
C 1 19 TYR 19 19 19 TYR TYR C . n 
C 1 20 ARG 20 20 20 ARG ARG C . n 
C 1 21 HIS 21 21 21 HIS HIS C . n 
C 1 22 VAL 22 22 22 VAL VAL C . n 
C 1 23 MET 23 23 23 MET MET C . n 
C 1 24 LEU 24 24 24 LEU LEU C . n 
C 1 25 PRO 25 25 25 PRO PRO C . n 
C 1 26 ARG 26 26 26 ARG ARG C . n 
C 1 27 GLU 27 27 27 GLU GLU C . n 
C 1 28 LEU 28 28 28 LEU LEU C . n 
C 1 29 SER 29 29 29 SER SER C . n 
C 1 30 LYS 30 30 30 LYS LYS C . n 
C 1 31 GLN 31 31 31 GLN GLN C . n 
C 1 32 VAL 32 32 32 VAL VAL C . n 
C 1 33 PRO 33 33 33 PRO PRO C . n 
C 1 34 LYS 34 34 34 LYS LYS C . n 
C 1 35 THR 35 35 35 THR THR C . n 
C 1 36 HIS 36 36 36 HIS HIS C . n 
C 1 37 LEU 37 37 37 LEU LEU C . n 
C 1 38 MET 38 38 38 MET MET C . n 
C 1 39 SER 39 39 39 SER SER C . n 
C 1 40 GLU 40 40 40 GLU GLU C . n 
C 1 41 GLU 41 41 41 GLU GLU C . n 
C 1 42 GLU 42 42 42 GLU GLU C . n 
C 1 43 TRP 43 43 43 TRP TRP C . n 
C 1 44 ARG 44 44 44 ARG ARG C . n 
C 1 45 ARG 45 45 45 ARG ARG C . n 
C 1 46 LEU 46 46 46 LEU LEU C . n 
C 1 47 GLY 47 47 47 GLY GLY C . n 
C 1 48 VAL 48 48 48 VAL VAL C . n 
C 1 49 GLN 49 49 49 GLN GLN C . n 
C 1 50 GLN 50 50 50 GLN GLN C . n 
C 1 51 SER 51 51 51 SER SER C . n 
C 1 52 LEU 52 52 52 LEU LEU C . n 
C 1 53 GLY 53 53 53 GLY GLY C . n 
C 1 54 TRP 54 54 54 TRP TRP C . n 
C 1 55 VAL 55 55 55 VAL VAL C . n 
C 1 56 HIS 56 56 56 HIS HIS C . n 
C 1 57 TYR 57 57 57 TYR TYR C . n 
C 1 58 MET 58 58 58 MET MET C . n 
C 1 59 ILE 59 59 59 ILE ILE C . n 
C 1 60 HIS 60 60 60 HIS HIS C . n 
C 1 61 GLU 61 61 61 GLU GLU C . n 
C 1 62 PRO 62 62 62 PRO PRO C . n 
C 1 63 GLU 63 63 63 GLU GLU C . n 
C 1 64 PRO 64 64 64 PRO PRO C . n 
C 1 65 HIS 65 65 65 HIS HIS C . n 
C 1 66 ILE 66 66 66 ILE ILE C . n 
C 1 67 LEU 67 67 67 LEU LEU C . n 
C 1 68 LEU 68 68 68 LEU LEU C . n 
C 1 69 PHE 69 69 69 PHE PHE C . n 
C 1 70 ARG 70 70 70 ARG ARG C . n 
C 1 71 ARG 71 71 71 ARG ARG C . n 
C 1 72 PRO 72 72 72 PRO PRO C . n 
C 1 73 LEU 73 73 73 LEU LEU C . n 
C 1 74 PRO 74 74 74 PRO PRO C . n 
C 1 75 LYS 75 75 75 LYS LYS C . n 
C 1 76 ASP 76 76 76 ASP ASP C . n 
C 1 77 GLN 77 77 77 GLN GLN C . n 
C 1 78 GLN 78 78 78 GLN GLN C . n 
C 1 79 LYS 79 79 79 LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 SO4 1  300 300 SO4 SO4 A . 
E 2 SO4 1  301 301 SO4 SO4 B . 
F 2 SO4 1  302 302 SO4 SO4 C . 
G 3 HOH 1  303 303 HOH HOH A . 
G 3 HOH 2  304 304 HOH HOH A . 
G 3 HOH 3  305 305 HOH HOH A . 
G 3 HOH 4  306 306 HOH HOH A . 
G 3 HOH 5  308 308 HOH HOH A . 
G 3 HOH 6  309 309 HOH HOH A . 
G 3 HOH 7  310 310 HOH HOH A . 
G 3 HOH 8  311 311 HOH HOH A . 
G 3 HOH 9  312 312 HOH HOH A . 
G 3 HOH 10 313 313 HOH HOH A . 
G 3 HOH 11 325 325 HOH HOH A . 
G 3 HOH 12 330 330 HOH HOH A . 
G 3 HOH 13 335 335 HOH HOH A . 
G 3 HOH 14 337 337 HOH HOH A . 
G 3 HOH 15 338 338 HOH HOH A . 
G 3 HOH 16 346 346 HOH HOH A . 
G 3 HOH 17 358 358 HOH HOH A . 
G 3 HOH 18 365 365 HOH HOH A . 
G 3 HOH 19 374 374 HOH HOH A . 
G 3 HOH 20 375 375 HOH HOH A . 
G 3 HOH 21 381 381 HOH HOH A . 
G 3 HOH 22 387 387 HOH HOH A . 
G 3 HOH 23 390 390 HOH HOH A . 
G 3 HOH 24 391 391 HOH HOH A . 
G 3 HOH 25 392 392 HOH HOH A . 
G 3 HOH 26 393 393 HOH HOH A . 
G 3 HOH 27 394 394 HOH HOH A . 
G 3 HOH 28 395 395 HOH HOH A . 
G 3 HOH 29 398 398 HOH HOH A . 
G 3 HOH 30 402 402 HOH HOH A . 
G 3 HOH 31 403 403 HOH HOH A . 
G 3 HOH 32 404 404 HOH HOH A . 
G 3 HOH 33 406 406 HOH HOH A . 
G 3 HOH 34 425 425 HOH HOH A . 
G 3 HOH 35 427 427 HOH HOH A . 
G 3 HOH 36 432 432 HOH HOH A . 
G 3 HOH 37 442 442 HOH HOH A . 
G 3 HOH 38 445 445 HOH HOH A . 
G 3 HOH 39 451 451 HOH HOH A . 
G 3 HOH 40 512 512 HOH HOH A . 
G 3 HOH 41 529 529 HOH HOH A . 
G 3 HOH 42 555 555 HOH HOH A . 
G 3 HOH 43 569 569 HOH HOH A . 
G 3 HOH 44 570 570 HOH HOH A . 
G 3 HOH 45 576 576 HOH HOH A . 
G 3 HOH 46 579 579 HOH HOH A . 
G 3 HOH 47 583 583 HOH HOH A . 
G 3 HOH 48 586 586 HOH HOH A . 
G 3 HOH 49 613 613 HOH HOH A . 
G 3 HOH 50 632 632 HOH HOH A . 
G 3 HOH 51 668 668 HOH HOH A . 
G 3 HOH 52 683 683 HOH HOH A . 
G 3 HOH 53 688 688 HOH HOH A . 
G 3 HOH 54 695 695 HOH HOH A . 
G 3 HOH 55 717 717 HOH HOH A . 
G 3 HOH 56 800 800 HOH HOH A . 
G 3 HOH 57 845 845 HOH HOH A . 
G 3 HOH 58 856 856 HOH HOH A . 
G 3 HOH 59 858 858 HOH HOH A . 
G 3 HOH 60 877 877 HOH HOH A . 
G 3 HOH 61 879 879 HOH HOH A . 
G 3 HOH 62 880 880 HOH HOH A . 
G 3 HOH 63 882 882 HOH HOH A . 
G 3 HOH 64 894 894 HOH HOH A . 
G 3 HOH 65 911 911 HOH HOH A . 
H 3 HOH 1  314 314 HOH HOH B . 
H 3 HOH 2  315 315 HOH HOH B . 
H 3 HOH 3  316 316 HOH HOH B . 
H 3 HOH 4  317 317 HOH HOH B . 
H 3 HOH 5  318 318 HOH HOH B . 
H 3 HOH 6  321 321 HOH HOH B . 
H 3 HOH 7  331 331 HOH HOH B . 
H 3 HOH 8  332 332 HOH HOH B . 
H 3 HOH 9  339 339 HOH HOH B . 
H 3 HOH 10 341 341 HOH HOH B . 
H 3 HOH 11 342 342 HOH HOH B . 
H 3 HOH 12 345 345 HOH HOH B . 
H 3 HOH 13 349 349 HOH HOH B . 
H 3 HOH 14 350 350 HOH HOH B . 
H 3 HOH 15 356 356 HOH HOH B . 
H 3 HOH 16 366 366 HOH HOH B . 
H 3 HOH 17 373 373 HOH HOH B . 
H 3 HOH 18 397 397 HOH HOH B . 
H 3 HOH 19 405 405 HOH HOH B . 
H 3 HOH 20 407 407 HOH HOH B . 
H 3 HOH 21 408 408 HOH HOH B . 
H 3 HOH 22 409 409 HOH HOH B . 
H 3 HOH 23 411 411 HOH HOH B . 
H 3 HOH 24 412 412 HOH HOH B . 
H 3 HOH 25 423 423 HOH HOH B . 
H 3 HOH 26 429 429 HOH HOH B . 
H 3 HOH 27 433 433 HOH HOH B . 
H 3 HOH 28 435 435 HOH HOH B . 
H 3 HOH 29 436 436 HOH HOH B . 
H 3 HOH 30 437 437 HOH HOH B . 
H 3 HOH 31 439 439 HOH HOH B . 
H 3 HOH 32 441 441 HOH HOH B . 
H 3 HOH 33 443 443 HOH HOH B . 
H 3 HOH 34 446 446 HOH HOH B . 
H 3 HOH 35 448 448 HOH HOH B . 
H 3 HOH 36 516 516 HOH HOH B . 
H 3 HOH 37 531 531 HOH HOH B . 
H 3 HOH 38 533 533 HOH HOH B . 
H 3 HOH 39 534 534 HOH HOH B . 
H 3 HOH 40 535 535 HOH HOH B . 
H 3 HOH 41 561 561 HOH HOH B . 
H 3 HOH 42 578 578 HOH HOH B . 
H 3 HOH 43 596 596 HOH HOH B . 
H 3 HOH 44 673 673 HOH HOH B . 
H 3 HOH 45 684 684 HOH HOH B . 
H 3 HOH 46 687 687 HOH HOH B . 
H 3 HOH 47 691 691 HOH HOH B . 
H 3 HOH 48 692 692 HOH HOH B . 
H 3 HOH 49 696 696 HOH HOH B . 
H 3 HOH 50 699 699 HOH HOH B . 
H 3 HOH 51 700 700 HOH HOH B . 
H 3 HOH 52 701 701 HOH HOH B . 
H 3 HOH 53 703 703 HOH HOH B . 
H 3 HOH 54 704 704 HOH HOH B . 
H 3 HOH 55 710 710 HOH HOH B . 
H 3 HOH 56 801 801 HOH HOH B . 
H 3 HOH 57 803 803 HOH HOH B . 
H 3 HOH 58 808 808 HOH HOH B . 
H 3 HOH 59 813 813 HOH HOH B . 
H 3 HOH 60 854 854 HOH HOH B . 
H 3 HOH 61 862 862 HOH HOH B . 
H 3 HOH 62 863 863 HOH HOH B . 
H 3 HOH 63 876 876 HOH HOH B . 
H 3 HOH 64 889 889 HOH HOH B . 
H 3 HOH 65 899 899 HOH HOH B . 
H 3 HOH 66 903 903 HOH HOH B . 
H 3 HOH 67 906 906 HOH HOH B . 
H 3 HOH 68 909 909 HOH HOH B . 
H 3 HOH 69 910 910 HOH HOH B . 
I 3 HOH 1  307 307 HOH HOH C . 
I 3 HOH 2  319 319 HOH HOH C . 
I 3 HOH 3  320 320 HOH HOH C . 
I 3 HOH 4  322 322 HOH HOH C . 
I 3 HOH 5  323 323 HOH HOH C . 
I 3 HOH 6  324 324 HOH HOH C . 
I 3 HOH 7  326 326 HOH HOH C . 
I 3 HOH 8  327 327 HOH HOH C . 
I 3 HOH 9  328 328 HOH HOH C . 
I 3 HOH 10 329 329 HOH HOH C . 
I 3 HOH 11 333 333 HOH HOH C . 
I 3 HOH 12 334 334 HOH HOH C . 
I 3 HOH 13 336 336 HOH HOH C . 
I 3 HOH 14 343 343 HOH HOH C . 
I 3 HOH 15 344 344 HOH HOH C . 
I 3 HOH 16 348 348 HOH HOH C . 
I 3 HOH 17 351 351 HOH HOH C . 
I 3 HOH 18 352 352 HOH HOH C . 
I 3 HOH 19 353 353 HOH HOH C . 
I 3 HOH 20 354 354 HOH HOH C . 
I 3 HOH 21 355 355 HOH HOH C . 
I 3 HOH 22 357 357 HOH HOH C . 
I 3 HOH 23 359 359 HOH HOH C . 
I 3 HOH 24 360 360 HOH HOH C . 
I 3 HOH 25 361 361 HOH HOH C . 
I 3 HOH 26 362 362 HOH HOH C . 
I 3 HOH 27 363 363 HOH HOH C . 
I 3 HOH 28 364 364 HOH HOH C . 
I 3 HOH 29 367 367 HOH HOH C . 
I 3 HOH 30 368 368 HOH HOH C . 
I 3 HOH 31 369 369 HOH HOH C . 
I 3 HOH 32 370 370 HOH HOH C . 
I 3 HOH 33 371 371 HOH HOH C . 
I 3 HOH 34 376 376 HOH HOH C . 
I 3 HOH 35 378 378 HOH HOH C . 
I 3 HOH 36 383 383 HOH HOH C . 
I 3 HOH 37 384 384 HOH HOH C . 
I 3 HOH 38 388 388 HOH HOH C . 
I 3 HOH 39 414 414 HOH HOH C . 
I 3 HOH 40 415 415 HOH HOH C . 
I 3 HOH 41 417 417 HOH HOH C . 
I 3 HOH 42 418 418 HOH HOH C . 
I 3 HOH 43 419 419 HOH HOH C . 
I 3 HOH 44 420 420 HOH HOH C . 
I 3 HOH 45 422 422 HOH HOH C . 
I 3 HOH 46 426 426 HOH HOH C . 
I 3 HOH 47 430 430 HOH HOH C . 
I 3 HOH 48 431 431 HOH HOH C . 
I 3 HOH 49 440 440 HOH HOH C . 
I 3 HOH 50 444 444 HOH HOH C . 
I 3 HOH 51 447 447 HOH HOH C . 
I 3 HOH 52 449 449 HOH HOH C . 
I 3 HOH 53 450 450 HOH HOH C . 
I 3 HOH 54 503 503 HOH HOH C . 
I 3 HOH 55 518 518 HOH HOH C . 
I 3 HOH 56 541 541 HOH HOH C . 
I 3 HOH 57 558 558 HOH HOH C . 
I 3 HOH 58 572 572 HOH HOH C . 
I 3 HOH 59 585 585 HOH HOH C . 
I 3 HOH 60 590 590 HOH HOH C . 
I 3 HOH 61 598 598 HOH HOH C . 
I 3 HOH 62 600 600 HOH HOH C . 
I 3 HOH 63 612 612 HOH HOH C . 
I 3 HOH 64 614 614 HOH HOH C . 
I 3 HOH 65 616 616 HOH HOH C . 
I 3 HOH 66 643 643 HOH HOH C . 
I 3 HOH 67 649 649 HOH HOH C . 
I 3 HOH 68 660 660 HOH HOH C . 
I 3 HOH 69 680 680 HOH HOH C . 
I 3 HOH 70 706 706 HOH HOH C . 
I 3 HOH 71 708 708 HOH HOH C . 
I 3 HOH 72 709 709 HOH HOH C . 
I 3 HOH 73 712 712 HOH HOH C . 
I 3 HOH 74 713 713 HOH HOH C . 
I 3 HOH 75 802 802 HOH HOH C . 
I 3 HOH 76 805 805 HOH HOH C . 
I 3 HOH 77 807 807 HOH HOH C . 
I 3 HOH 78 811 811 HOH HOH C . 
I 3 HOH 79 830 830 HOH HOH C . 
I 3 HOH 80 842 842 HOH HOH C . 
I 3 HOH 81 852 852 HOH HOH C . 
I 3 HOH 82 853 853 HOH HOH C . 
I 3 HOH 83 860 860 HOH HOH C . 
I 3 HOH 84 866 866 HOH HOH C . 
I 3 HOH 85 869 869 HOH HOH C . 
I 3 HOH 86 871 871 HOH HOH C . 
I 3 HOH 87 891 891 HOH HOH C . 
I 3 HOH 88 896 896 HOH HOH C . 
I 3 HOH 89 897 897 HOH HOH C . 
I 3 HOH 90 908 908 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 23390 ? 
1 MORE         -226  ? 
1 'SSA (A^2)'  24520 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_657 -x+1,y,-z+2 -1.0000000000 0.0000000000 0.0000000000 53.0675819951 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 90.7347323609 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-02-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 NE2 A HIS 3  ? ? CD2 A HIS 3  ? ? 1.291 1.373 -0.082 0.011 N 
2  1 NE2 A HIS 16 ? ? CD2 A HIS 16 ? ? 1.303 1.373 -0.070 0.011 N 
3  1 NE2 A HIS 21 ? ? CD2 A HIS 21 ? ? 1.302 1.373 -0.071 0.011 N 
4  1 NE2 A HIS 36 ? ? CD2 A HIS 36 ? ? 1.294 1.373 -0.079 0.011 N 
5  1 NE2 A HIS 65 ? ? CD2 A HIS 65 ? ? 1.306 1.373 -0.067 0.011 N 
6  1 NE2 B HIS 16 ? ? CD2 B HIS 16 ? ? 1.307 1.373 -0.066 0.011 N 
7  1 NE2 B HIS 21 ? ? CD2 B HIS 21 ? ? 1.299 1.373 -0.074 0.011 N 
8  1 NE2 B HIS 36 ? ? CD2 B HIS 36 ? ? 1.299 1.373 -0.074 0.011 N 
9  1 NE2 B HIS 56 ? ? CD2 B HIS 56 ? ? 1.306 1.373 -0.067 0.011 N 
10 1 NE2 C HIS 3  ? ? CD2 C HIS 3  ? ? 1.307 1.373 -0.066 0.011 N 
11 1 NE2 C HIS 21 ? ? CD2 C HIS 21 ? ? 1.296 1.373 -0.077 0.011 N 
12 1 NE2 C HIS 56 ? ? CD2 C HIS 56 ? ? 1.286 1.373 -0.087 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A HIS 3  ? ? CG  A HIS 3  ? ? CD2 A HIS 3  ? ? 119.89 129.70 -9.81  1.60 N 
2  1 NE  A ARG 20 ? ? CZ  A ARG 20 ? ? NH2 A ARG 20 ? ? 116.37 120.30 -3.93  0.50 N 
3  1 CD1 A TRP 43 ? ? CG  A TRP 43 ? ? CD2 A TRP 43 ? ? 112.35 106.30 6.05   0.80 N 
4  1 CE2 A TRP 43 ? ? CD2 A TRP 43 ? ? CG  A TRP 43 ? ? 101.98 107.30 -5.32  0.80 N 
5  1 CD1 A TRP 54 ? ? CG  A TRP 54 ? ? CD2 A TRP 54 ? ? 112.86 106.30 6.56   0.80 N 
6  1 CE2 A TRP 54 ? ? CD2 A TRP 54 ? ? CG  A TRP 54 ? ? 101.87 107.30 -5.43  0.80 N 
7  1 CB  A TYR 57 ? ? CG  A TYR 57 ? ? CD1 A TYR 57 ? ? 116.72 121.00 -4.28  0.60 N 
8  1 NE  A ARG 71 ? ? CZ  A ARG 71 ? ? NH1 A ARG 71 ? ? 123.95 120.30 3.65   0.50 N 
9  1 NE  A ARG 71 ? ? CZ  A ARG 71 ? ? NH2 A ARG 71 ? ? 117.13 120.30 -3.17  0.50 N 
10 1 CB  B TYR 12 ? ? CG  B TYR 12 ? ? CD2 B TYR 12 ? ? 117.23 121.00 -3.77  0.60 N 
11 1 CB  B TYR 17 ? ? CG  B TYR 17 ? ? CD2 B TYR 17 ? ? 117.10 121.00 -3.90  0.60 N 
12 1 NE  B ARG 20 ? ? CZ  B ARG 20 ? ? NH1 B ARG 20 ? ? 123.38 120.30 3.08   0.50 N 
13 1 CD1 B TRP 43 ? ? CG  B TRP 43 ? ? CD2 B TRP 43 ? ? 112.77 106.30 6.47   0.80 N 
14 1 CB  B TRP 43 ? ? CG  B TRP 43 ? ? CD1 B TRP 43 ? ? 118.40 127.00 -8.60  1.30 N 
15 1 CE2 B TRP 43 ? ? CD2 B TRP 43 ? ? CG  B TRP 43 ? ? 100.86 107.30 -6.44  0.80 N 
16 1 NE  B ARG 44 ? ? CZ  B ARG 44 ? ? NH2 B ARG 44 ? ? 116.37 120.30 -3.93  0.50 N 
17 1 CA  B LEU 52 ? ? CB  B LEU 52 ? ? CG  B LEU 52 ? ? 129.45 115.30 14.15  2.30 N 
18 1 CD1 B TRP 54 ? ? CG  B TRP 54 ? ? CD2 B TRP 54 ? ? 112.92 106.30 6.62   0.80 N 
19 1 CE2 B TRP 54 ? ? CD2 B TRP 54 ? ? CG  B TRP 54 ? ? 101.29 107.30 -6.01  0.80 N 
20 1 N   C HIS 3  ? ? CA  C HIS 3  ? ? C   C HIS 3  ? ? 127.88 111.00 16.88  2.70 N 
21 1 N   C LYS 4  ? ? CA  C LYS 4  ? ? C   C LYS 4  ? ? 127.63 111.00 16.63  2.70 N 
22 1 NE  C ARG 20 ? ? CZ  C ARG 20 ? ? NH2 C ARG 20 ? ? 116.72 120.30 -3.58  0.50 N 
23 1 CA  C MET 23 ? ? CB  C MET 23 ? ? CG  C MET 23 ? ? 101.63 113.30 -11.67 1.70 N 
24 1 CG  C MET 23 ? ? SD  C MET 23 ? ? CE  C MET 23 ? ? 85.98  100.20 -14.22 1.60 N 
25 1 CA  C TRP 43 ? ? CB  C TRP 43 ? ? CG  C TRP 43 ? ? 127.95 113.70 14.25  1.90 N 
26 1 CD1 C TRP 43 ? ? CG  C TRP 43 ? ? CD2 C TRP 43 ? ? 111.36 106.30 5.06   0.80 N 
27 1 CE2 C TRP 43 ? ? CD2 C TRP 43 ? ? CG  C TRP 43 ? ? 102.06 107.30 -5.24  0.80 N 
28 1 CD1 C TRP 54 ? ? CG  C TRP 54 ? ? CD2 C TRP 54 ? ? 113.10 106.30 6.80   0.80 N 
29 1 CB  C TRP 54 ? ? CG  C TRP 54 ? ? CD1 C TRP 54 ? ? 118.81 127.00 -8.19  1.30 N 
30 1 CE2 C TRP 54 ? ? CD2 C TRP 54 ? ? CG  C TRP 54 ? ? 100.79 107.30 -6.51  0.80 N 
31 1 CG  C TRP 54 ? ? CD2 C TRP 54 ? ? CE3 C TRP 54 ? ? 140.89 133.90 6.99   0.90 N 
32 1 NE  C ARG 71 ? ? CZ  C ARG 71 ? ? NH2 C ARG 71 ? ? 117.14 120.30 -3.16  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 14 ? ? -117.98 -143.63 
2 1 HIS B 3  ? ? -171.90 -147.45 
3 1 LYS B 4  ? ? -168.52 53.34   
4 1 ASP B 14 ? ? -127.91 -155.90 
5 1 LYS C 4  ? ? 9.42    41.35   
6 1 ASP C 14 ? ? -121.61 -156.82 
7 1 SER C 51 ? ? -73.60  -167.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1  ? A MET 1  
2 1 Y 1 A ASP 76 ? A ASP 76 
3 1 Y 1 A GLN 77 ? A GLN 77 
4 1 Y 1 A GLN 78 ? A GLN 78 
5 1 Y 1 A LYS 79 ? A LYS 79 
6 1 Y 1 B MET 1  ? B MET 1  
7 1 Y 1 C MET 1  ? C MET 1  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#