data_1D7W
# 
_entry.id   1D7W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1D7W         
RCSB  RCSB009874   
WWPDB D_1000009874 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MHL '1MHL contains the native protein structure solved to 2.25 Angstroms resolution'      unspecified 
PDB 1MYP '1MYP contains the canine myeloperoxidase structure at 3.0 Angstroms resolution'      unspecified 
PDB 1CXP 
;1CXP contains the cryogenic native protein structure to 1.80 Angstroms 
resolution
;
unspecified 
PDB 1D2V 
;1D2V contains the bromide-bound human myeloperoxidase at 1.75 Angstroms 
resolution
;
unspecified 
PDB 1D5L 
;1D5L contains the cyanide-bound human myeloperoxidase at 1.90 Angstroms 
resolution
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1D7W 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fiedler, T.J.' 1 
'Fenna, R.E.'   2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Human myeloperoxidase: structure of a cyanide complex and its interaction with bromide and thiocyanate substrates at 1.9 A resolution.
;
Biochemistry                40  13990 13997 2001 BICHAW US 0006-2960 0033 ? 11705390 10.1021/bi0111808      
1       'Structure of the Green Heme in Myeloperoxidase' Arch.Biochem.Biophys.       316 653   ?     1995 ABBIA4 US 0003-9861 0158 
? ?        10.1006/abbi.1995.1086 
2       
;2.3 Angstrom Resolution X-Ray Crystal Structure of the Bisubstrate Analogue Inhibitor Salicylhydroxamic Acid Bound to Human Myeloperoxidase: A Model for a Prereaction Complex with Hydrogen Peroxide
;
Biochemistry                35  10967 ?     1996 BICHAW US 0006-2960 0033 ? ?        10.1021/bi960577m      
3       'X-Ray Crystal Structure of Canine Myeloperoxidase at 3 Angstrom Resolution' J.Mol.Biol.                 226 185   ?     
1992 JMOBAK UK 0022-2836 0070 ? ?        ?                      
4       
;Site-Directed Mutagenesis of Human Myeloperoxidase: Further Identification of Residues Involved in Catalytic Activity and Heme Interaction
;
Biochem.Biophys.Res.Commun. 202 73    ?     1994 BBRCA9 US 0006-291X 0146 ? ?        10.1006/bbrc.1994.1895 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Blair-Johnson, M.'   1  ? 
primary 'Fiedler, T.'         2  ? 
primary 'Fenna, R.'           3  ? 
1       'Fenna, R.'           4  ? 
1       'Zeng, J.'            5  ? 
1       'Davey, C.'           6  ? 
2       'Davey, C.A.'         7  ? 
2       'Fenna, R.E.'         8  ? 
3       'Zeng, J.'            9  ? 
3       'Fenna, R.E.'         10 ? 
4       'Jacquet, A.'         11 ? 
4       'Garcia-Quintana, L.' 12 ? 
4       'Deleersnyder, V.'    13 ? 
4       'Fenna, R.'           14 ? 
4       'Bollen, A.'          15 ? 
4       'Moguilevsky, N.'     16 ? 
# 
_cell.entry_id           1D7W 
_cell.length_a           111.338 
_cell.length_b           63.324 
_cell.length_c           92.263 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.41 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1D7W 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat MYELOPEROXIDASE 11903.343 2   1.11.1.7 ? 'LIGHT CHAIN' ? 
2  polymer     nat MYELOPEROXIDASE 53234.191 2   1.11.1.7 ? 'HEAVY CHAIN' ? 
3  branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1056.964  2   ?        ? ?             ? 
4  non-polymer syn 'BROMIDE ION' 79.904    8   ?        ? ?             ? 
5  non-polymer syn 'SULFATE ION' 96.063    5   ?        ? ?             ? 
6  non-polymer syn 'CYANIDE ION' 26.017    2   ?        ? ?             ? 
7  non-polymer syn 'ACETATE ION' 59.044    12  ?        ? ?             ? 
8  non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2   ?        ? ?             ? 
9  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4   ?        ? ?             ? 
10 non-polymer syn 'CALCIUM ION' 40.078    2   ?        ? ?             ? 
11 water       nat water 18.015    806 ?        ? ?             ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQ
ERSLMFMQWGQLLDHDLDFTPEPA
;
;CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQ
ERSLMFMQWGQLLDHDLDFTPEPA
;
A,B ? 
2 'polypeptide(L)' no yes 
;VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRS(CSO)PACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLR
NMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLN
PRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDN
RYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDH
GLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRD
GDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
;
;VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSN
QLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWD
GERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQP
MEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPG
YNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRF
WWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   PRO n 
1 3   GLU n 
1 4   GLN n 
1 5   ASP n 
1 6   LYS n 
1 7   TYR n 
1 8   ARG n 
1 9   THR n 
1 10  ILE n 
1 11  THR n 
1 12  GLY n 
1 13  MET n 
1 14  CYS n 
1 15  ASN n 
1 16  ASN n 
1 17  ARG n 
1 18  ARG n 
1 19  SER n 
1 20  PRO n 
1 21  THR n 
1 22  LEU n 
1 23  GLY n 
1 24  ALA n 
1 25  SER n 
1 26  ASN n 
1 27  ARG n 
1 28  ALA n 
1 29  PHE n 
1 30  VAL n 
1 31  ARG n 
1 32  TRP n 
1 33  LEU n 
1 34  PRO n 
1 35  ALA n 
1 36  GLU n 
1 37  TYR n 
1 38  GLU n 
1 39  ASP n 
1 40  GLY n 
1 41  PHE n 
1 42  SER n 
1 43  LEU n 
1 44  PRO n 
1 45  TYR n 
1 46  GLY n 
1 47  TRP n 
1 48  THR n 
1 49  PRO n 
1 50  GLY n 
1 51  VAL n 
1 52  LYS n 
1 53  ARG n 
1 54  ASN n 
1 55  GLY n 
1 56  PHE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  ALA n 
1 62  ARG n 
1 63  ALA n 
1 64  VAL n 
1 65  SER n 
1 66  ASN n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  ARG n 
1 71  PHE n 
1 72  PRO n 
1 73  THR n 
1 74  ASP n 
1 75  GLN n 
1 76  LEU n 
1 77  THR n 
1 78  PRO n 
1 79  ASP n 
1 80  GLN n 
1 81  GLU n 
1 82  ARG n 
1 83  SER n 
1 84  LEU n 
1 85  MET n 
1 86  PHE n 
1 87  MET n 
1 88  GLN n 
1 89  TRP n 
1 90  GLY n 
1 91  GLN n 
1 92  LEU n 
1 93  LEU n 
1 94  ASP n 
1 95  HIS n 
1 96  ASP n 
1 97  LEU n 
1 98  ASP n 
1 99  PHE n 
1 100 THR n 
1 101 PRO n 
1 102 GLU n 
1 103 PRO n 
1 104 ALA n 
2 1   VAL n 
2 2   ASN n 
2 3   CYS n 
2 4   GLU n 
2 5   THR n 
2 6   SER n 
2 7   CYS n 
2 8   VAL n 
2 9   GLN n 
2 10  GLN n 
2 11  PRO n 
2 12  PRO n 
2 13  CYS n 
2 14  PHE n 
2 15  PRO n 
2 16  LEU n 
2 17  LYS n 
2 18  ILE n 
2 19  PRO n 
2 20  PRO n 
2 21  ASN n 
2 22  ASP n 
2 23  PRO n 
2 24  ARG n 
2 25  ILE n 
2 26  LYS n 
2 27  ASN n 
2 28  GLN n 
2 29  ALA n 
2 30  ASP n 
2 31  CYS n 
2 32  ILE n 
2 33  PRO n 
2 34  PHE n 
2 35  PHE n 
2 36  ARG n 
2 37  SER n 
2 38  CSO n 
2 39  PRO n 
2 40  ALA n 
2 41  CYS n 
2 42  PRO n 
2 43  GLY n 
2 44  SER n 
2 45  ASN n 
2 46  ILE n 
2 47  THR n 
2 48  ILE n 
2 49  ARG n 
2 50  ASN n 
2 51  GLN n 
2 52  ILE n 
2 53  ASN n 
2 54  ALA n 
2 55  LEU n 
2 56  THR n 
2 57  SER n 
2 58  PHE n 
2 59  VAL n 
2 60  ASP n 
2 61  ALA n 
2 62  SER n 
2 63  MET n 
2 64  VAL n 
2 65  TYR n 
2 66  GLY n 
2 67  SER n 
2 68  GLU n 
2 69  GLU n 
2 70  PRO n 
2 71  LEU n 
2 72  ALA n 
2 73  ARG n 
2 74  ASN n 
2 75  LEU n 
2 76  ARG n 
2 77  ASN n 
2 78  MET n 
2 79  SER n 
2 80  ASN n 
2 81  GLN n 
2 82  LEU n 
2 83  GLY n 
2 84  LEU n 
2 85  LEU n 
2 86  ALA n 
2 87  VAL n 
2 88  ASN n 
2 89  GLN n 
2 90  ARG n 
2 91  PHE n 
2 92  GLN n 
2 93  ASP n 
2 94  ASN n 
2 95  GLY n 
2 96  ARG n 
2 97  ALA n 
2 98  LEU n 
2 99  LEU n 
2 100 PRO n 
2 101 PHE n 
2 102 ASP n 
2 103 ASN n 
2 104 LEU n 
2 105 HIS n 
2 106 ASP n 
2 107 ASP n 
2 108 PRO n 
2 109 CYS n 
2 110 LEU n 
2 111 LEU n 
2 112 THR n 
2 113 ASN n 
2 114 ARG n 
2 115 SER n 
2 116 ALA n 
2 117 ARG n 
2 118 ILE n 
2 119 PRO n 
2 120 CYS n 
2 121 PHE n 
2 122 LEU n 
2 123 ALA n 
2 124 GLY n 
2 125 ASP n 
2 126 THR n 
2 127 ARG n 
2 128 SER n 
2 129 SER n 
2 130 GLU n 
2 131 MET n 
2 132 PRO n 
2 133 GLU n 
2 134 LEU n 
2 135 THR n 
2 136 SER n 
2 137 MET n 
2 138 HIS n 
2 139 THR n 
2 140 LEU n 
2 141 LEU n 
2 142 LEU n 
2 143 ARG n 
2 144 GLU n 
2 145 HIS n 
2 146 ASN n 
2 147 ARG n 
2 148 LEU n 
2 149 ALA n 
2 150 THR n 
2 151 GLU n 
2 152 LEU n 
2 153 LYS n 
2 154 SER n 
2 155 LEU n 
2 156 ASN n 
2 157 PRO n 
2 158 ARG n 
2 159 TRP n 
2 160 ASP n 
2 161 GLY n 
2 162 GLU n 
2 163 ARG n 
2 164 LEU n 
2 165 TYR n 
2 166 GLN n 
2 167 GLU n 
2 168 ALA n 
2 169 ARG n 
2 170 LYS n 
2 171 ILE n 
2 172 VAL n 
2 173 GLY n 
2 174 ALA n 
2 175 MET n 
2 176 VAL n 
2 177 GLN n 
2 178 ILE n 
2 179 ILE n 
2 180 THR n 
2 181 TYR n 
2 182 ARG n 
2 183 ASP n 
2 184 TYR n 
2 185 LEU n 
2 186 PRO n 
2 187 LEU n 
2 188 VAL n 
2 189 LEU n 
2 190 GLY n 
2 191 PRO n 
2 192 THR n 
2 193 ALA n 
2 194 MET n 
2 195 ARG n 
2 196 LYS n 
2 197 TYR n 
2 198 LEU n 
2 199 PRO n 
2 200 THR n 
2 201 TYR n 
2 202 ARG n 
2 203 SER n 
2 204 TYR n 
2 205 ASN n 
2 206 ASP n 
2 207 SER n 
2 208 VAL n 
2 209 ASP n 
2 210 PRO n 
2 211 ARG n 
2 212 ILE n 
2 213 ALA n 
2 214 ASN n 
2 215 VAL n 
2 216 PHE n 
2 217 THR n 
2 218 ASN n 
2 219 ALA n 
2 220 PHE n 
2 221 ARG n 
2 222 TYR n 
2 223 GLY n 
2 224 HIS n 
2 225 THR n 
2 226 LEU n 
2 227 ILE n 
2 228 GLN n 
2 229 PRO n 
2 230 PHE n 
2 231 MET n 
2 232 PHE n 
2 233 ARG n 
2 234 LEU n 
2 235 ASP n 
2 236 ASN n 
2 237 ARG n 
2 238 TYR n 
2 239 GLN n 
2 240 PRO n 
2 241 MET n 
2 242 GLU n 
2 243 PRO n 
2 244 ASN n 
2 245 PRO n 
2 246 ARG n 
2 247 VAL n 
2 248 PRO n 
2 249 LEU n 
2 250 SER n 
2 251 ARG n 
2 252 VAL n 
2 253 PHE n 
2 254 PHE n 
2 255 ALA n 
2 256 SER n 
2 257 TRP n 
2 258 ARG n 
2 259 VAL n 
2 260 VAL n 
2 261 LEU n 
2 262 GLU n 
2 263 GLY n 
2 264 GLY n 
2 265 ILE n 
2 266 ASP n 
2 267 PRO n 
2 268 ILE n 
2 269 LEU n 
2 270 ARG n 
2 271 GLY n 
2 272 LEU n 
2 273 MET n 
2 274 ALA n 
2 275 THR n 
2 276 PRO n 
2 277 ALA n 
2 278 LYS n 
2 279 LEU n 
2 280 ASN n 
2 281 ARG n 
2 282 GLN n 
2 283 ASN n 
2 284 GLN n 
2 285 ILE n 
2 286 ALA n 
2 287 VAL n 
2 288 ASP n 
2 289 GLU n 
2 290 ILE n 
2 291 ARG n 
2 292 GLU n 
2 293 ARG n 
2 294 LEU n 
2 295 PHE n 
2 296 GLU n 
2 297 GLN n 
2 298 VAL n 
2 299 MET n 
2 300 ARG n 
2 301 ILE n 
2 302 GLY n 
2 303 LEU n 
2 304 ASP n 
2 305 LEU n 
2 306 PRO n 
2 307 ALA n 
2 308 LEU n 
2 309 ASN n 
2 310 MET n 
2 311 GLN n 
2 312 ARG n 
2 313 SER n 
2 314 ARG n 
2 315 ASP n 
2 316 HIS n 
2 317 GLY n 
2 318 LEU n 
2 319 PRO n 
2 320 GLY n 
2 321 TYR n 
2 322 ASN n 
2 323 ALA n 
2 324 TRP n 
2 325 ARG n 
2 326 ARG n 
2 327 PHE n 
2 328 CYS n 
2 329 GLY n 
2 330 LEU n 
2 331 PRO n 
2 332 GLN n 
2 333 PRO n 
2 334 GLU n 
2 335 THR n 
2 336 VAL n 
2 337 GLY n 
2 338 GLN n 
2 339 LEU n 
2 340 GLY n 
2 341 THR n 
2 342 VAL n 
2 343 LEU n 
2 344 ARG n 
2 345 ASN n 
2 346 LEU n 
2 347 LYS n 
2 348 LEU n 
2 349 ALA n 
2 350 ARG n 
2 351 LYS n 
2 352 LEU n 
2 353 MET n 
2 354 GLU n 
2 355 GLN n 
2 356 TYR n 
2 357 GLY n 
2 358 THR n 
2 359 PRO n 
2 360 ASN n 
2 361 ASN n 
2 362 ILE n 
2 363 ASP n 
2 364 ILE n 
2 365 TRP n 
2 366 MET n 
2 367 GLY n 
2 368 GLY n 
2 369 VAL n 
2 370 SER n 
2 371 GLU n 
2 372 PRO n 
2 373 LEU n 
2 374 LYS n 
2 375 ARG n 
2 376 LYS n 
2 377 GLY n 
2 378 ARG n 
2 379 VAL n 
2 380 GLY n 
2 381 PRO n 
2 382 LEU n 
2 383 LEU n 
2 384 ALA n 
2 385 CYS n 
2 386 ILE n 
2 387 ILE n 
2 388 GLY n 
2 389 THR n 
2 390 GLN n 
2 391 PHE n 
2 392 ARG n 
2 393 LYS n 
2 394 LEU n 
2 395 ARG n 
2 396 ASP n 
2 397 GLY n 
2 398 ASP n 
2 399 ARG n 
2 400 PHE n 
2 401 TRP n 
2 402 TRP n 
2 403 GLU n 
2 404 ASN n 
2 405 GLU n 
2 406 GLY n 
2 407 VAL n 
2 408 PHE n 
2 409 SER n 
2 410 MET n 
2 411 GLN n 
2 412 GLN n 
2 413 ARG n 
2 414 GLN n 
2 415 ALA n 
2 416 LEU n 
2 417 ALA n 
2 418 GLN n 
2 419 ILE n 
2 420 SER n 
2 421 LEU n 
2 422 PRO n 
2 423 ARG n 
2 424 ILE n 
2 425 ILE n 
2 426 CYS n 
2 427 ASP n 
2 428 ASN n 
2 429 THR n 
2 430 GLY n 
2 431 ILE n 
2 432 THR n 
2 433 THR n 
2 434 VAL n 
2 435 SER n 
2 436 LYS n 
2 437 ASN n 
2 438 ASN n 
2 439 ILE n 
2 440 PHE n 
2 441 MET n 
2 442 SER n 
2 443 ASN n 
2 444 SER n 
2 445 TYR n 
2 446 PRO n 
2 447 ARG n 
2 448 ASP n 
2 449 PHE n 
2 450 VAL n 
2 451 ASN n 
2 452 CYS n 
2 453 SER n 
2 454 THR n 
2 455 LEU n 
2 456 PRO n 
2 457 ALA n 
2 458 LEU n 
2 459 ASN n 
2 460 LEU n 
2 461 ALA n 
2 462 SER n 
2 463 TRP n 
2 464 ARG n 
2 465 GLU n 
2 466 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? BLOOD ? ? ? ? ? ? ? ? ? NEUTROPHIL ? ? ? 
2 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? BLOOD ? ? ? ? ? ? ? ? ? NEUTROPHIL ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PERM_HUMAN 1 ? ? P05164 ? 
2 UNP PERM_HUMAN 2 ? ? P05164 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1D7W A 1 ? 104 ? P05164 167 ? 270 ? 1   104 
2 1 1D7W B 1 ? 104 ? P05164 167 ? 270 ? 1   104 
3 2 1D7W C 1 ? 466 ? P05164 279 ? 744 ? 113 578 
4 2 1D7W D 1 ? 466 ? P05164 279 ? 744 ? 113 578 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1D7W CSO C 38 ? UNP P05164 CYS 315 'modified residue' 150 1 
4 1D7W CSO D 38 ? UNP P05164 CYS 315 'modified residue' 150 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer                   . 'ACETATE ION'                            ?    'C2 H3 O2 -1'      59.044  
ALA 'L-peptide linking'           y ALANINE                                  ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?    'C4 H7 N O4'       133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?    'C6 H12 O6'        180.156 
BR  non-polymer                   . 'BROMIDE ION'                            ?    'Br -1'            79.904  
CA  non-polymer                   . 'CALCIUM ION'                            ?    'Ca 2'             40.078  
CSO 'L-peptide linking'           n S-HYDROXYCYSTEINE                        ?    'C3 H7 N O3 S'     137.158 
CYN non-polymer                   . 'CYANIDE ION'                            ?    'C N -1'           26.017  
CYS 'L-peptide linking'           y CYSTEINE                                 ?    'C3 H7 N O2 S'     121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?    'C6 H12 O5'        164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE                                  ?    'C2 H5 N O2'       75.067  
HEM non-polymer                   . 'PROTOPORPHYRIN IX CONTAINING FE'        HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking'           y HISTIDINE                                ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER                                    ?    'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?    'C6 H15 N2 O2 1'   147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ?    'C6 H12 O6'        180.156 
MET 'L-peptide linking'           y METHIONINE                               ?    'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?    'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking'           y SERINE                                   ?    'C3 H7 N O3'       105.093 
SO4 non-polymer                   . 'SULFATE ION'                            ?    'O4 S -2'          96.063  
THR 'L-peptide linking'           y THREONINE                                ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE                                   ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1D7W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.28 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_details    
;polyethylene glycol 8000, ammonium sulfate, sodium acetate, calcium acetate, 
sodium cyanide, sodium bromide, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           84.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-06-21 
_diffrn_detector.details                'LONG FOCUSING MIRRORS, ADSC' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1D7W 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.900 
_reflns.number_obs                   92679 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.3 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.890 
_reflns.B_iso_Wilson_estimate        15.25 
_reflns.pdbx_redundancy              3.710 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   89.8 
_reflns_shell.Rmerge_I_obs           0.191 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.890 
_reflns_shell.pdbx_redundancy        3.89 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1D7W 
_refine.ls_number_reflns_obs                     88542 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    87.9 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.27 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  4477 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM 5%' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1D7W 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.260 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9142 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         371 
_refine_hist.number_atoms_solvent             806 
_refine_hist.number_atoms_total               10319 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.28  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.18 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.19  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             7308 
_refine_ls_shell.R_factor_R_work                  0.271 
_refine_ls_shell.percent_reflns_obs               76.80 
_refine_ls_shell.R_factor_R_free                  0.3024 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.00 
_refine_ls_shell.number_reflns_R_free             388 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.606400 
_struct_ncs_oper.matrix[1][2]   0.681360 
_struct_ncs_oper.matrix[1][3]   -0.409900 
_struct_ncs_oper.matrix[2][1]   0.686270 
_struct_ncs_oper.matrix[2][2]   0.188080 
_struct_ncs_oper.matrix[2][3]   -0.702610 
_struct_ncs_oper.matrix[3][1]   -0.401640 
_struct_ncs_oper.matrix[3][2]   -0.707370 
_struct_ncs_oper.matrix[3][3]   -0.581650 
_struct_ncs_oper.vector[1]      48.13749 
_struct_ncs_oper.vector[2]      -7.20248 
_struct_ncs_oper.vector[3]      34.41179 
# 
_struct.entry_id                  1D7W 
_struct.title                     
'CRYSTAL STRUCTURE OF HUMAN MYELOPEROXIDASE ISOFORM C COMPLEXED WITH CYANIDE AND BROMIDE AT PH 4.0' 
_struct.pdbx_descriptor           'MYELOPEROXIDASE (E.C.1.11.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1D7W 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'HEME-PROTEIN, PEROXIDASE, OXIDOREDUCTASE, PEROXIDASE-CYANIDE-BROMIDE COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 1  ? 
D  N N 2  ? 
E  N N 3  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 5  ? 
I  N N 6  ? 
J  N N 7  ? 
K  N N 8  ? 
L  N N 9  ? 
M  N N 9  ? 
N  N N 10 ? 
O  N N 5  ? 
P  N N 5  ? 
Q  N N 7  ? 
R  N N 7  ? 
S  N N 7  ? 
T  N N 7  ? 
U  N N 7  ? 
V  N N 4  ? 
W  N N 4  ? 
X  N N 4  ? 
Y  N N 7  ? 
Z  N N 4  ? 
AA N N 5  ? 
BA N N 7  ? 
CA N N 6  ? 
DA N N 8  ? 
EA N N 9  ? 
FA N N 9  ? 
GA N N 10 ? 
HA N N 5  ? 
IA N N 7  ? 
JA N N 7  ? 
KA N N 7  ? 
LA N N 7  ? 
MA N N 4  ? 
NA N N 4  ? 
OA N N 4  ? 
PA N N 11 ? 
QA N N 11 ? 
RA N N 11 ? 
SA N N 11 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 60  ? VAL A 69  ? LEU A 60  VAL A 69  1 ? 10 
HELX_P HELX_P2  2  PRO A 72  ? LEU A 76  ? PRO A 72  LEU A 76  5 ? 5  
HELX_P HELX_P3  3  LEU A 84  ? ASP A 98  ? LEU A 84  ASP A 98  1 ? 15 
HELX_P HELX_P4  4  ALA B 61  ? GLY B 66  ? ALA C 173 GLY C 178 1 ? 6  
HELX_P HELX_P5  5  GLU B 68  ? ARG B 76  ? GLU C 180 ARG C 188 1 ? 9  
HELX_P HELX_P6  6  ASP B 107 ? ASN B 113 ? ASP C 219 ASN C 225 1 ? 7  
HELX_P HELX_P7  7  MET B 131 ? ASN B 156 ? MET C 243 ASN C 268 1 ? 26 
HELX_P HELX_P8  8  ASP B 160 ? ASP B 183 ? ASP C 272 ASP C 295 1 ? 24 
HELX_P HELX_P9  9  TYR B 184 ? GLY B 190 ? TYR C 296 GLY C 302 1 ? 7  
HELX_P HELX_P10 10 GLY B 190 ? LEU B 198 ? GLY C 302 LEU C 310 1 ? 9  
HELX_P HELX_P11 11 ALA B 213 ? PHE B 220 ? ALA C 325 PHE C 332 1 ? 8  
HELX_P HELX_P12 12 ARG B 221 ? ILE B 227 ? ARG C 333 ILE C 339 5 ? 7  
HELX_P HELX_P13 13 SER B 250 ? VAL B 252 ? SER C 362 VAL C 364 5 ? 3  
HELX_P HELX_P14 14 SER B 256 ? GLU B 262 ? SER C 368 GLU C 374 1 ? 7  
HELX_P HELX_P15 15 ILE B 265 ? THR B 275 ? ILE C 377 THR C 387 1 ? 11 
HELX_P HELX_P16 16 VAL B 287 ? GLU B 292 ? VAL C 399 GLU C 404 1 ? 6  
HELX_P HELX_P17 17 PHE B 295 ? MET B 299 ? PHE C 407 MET C 411 5 ? 5  
HELX_P HELX_P18 18 ASP B 304 ? HIS B 316 ? ASP C 416 HIS C 428 1 ? 13 
HELX_P HELX_P19 19 GLY B 320 ? CYS B 328 ? GLY C 432 CYS C 440 1 ? 9  
HELX_P HELX_P20 20 THR B 335 ? ARG B 344 ? THR C 447 ARG C 456 1 ? 10 
HELX_P HELX_P21 21 ASN B 345 ? GLY B 357 ? ASN C 457 GLY C 469 1 ? 13 
HELX_P HELX_P22 22 THR B 358 ? ILE B 362 ? THR C 470 ILE C 474 5 ? 5  
HELX_P HELX_P23 23 ASP B 363 ? GLU B 371 ? ASP C 475 GLU C 483 1 ? 9  
HELX_P HELX_P24 24 GLY B 380 ? GLY B 397 ? GLY C 492 GLY C 509 1 ? 18 
HELX_P HELX_P25 25 SER B 409 ? ALA B 417 ? SER C 521 ALA C 529 1 ? 9  
HELX_P HELX_P26 26 SER B 420 ? THR B 429 ? SER C 532 THR C 541 1 ? 10 
HELX_P HELX_P27 27 SER B 453 ? LEU B 455 ? SER C 565 LEU C 567 5 ? 3  
HELX_P HELX_P28 28 LEU B 460 ? ARG B 464 ? LEU C 572 ARG C 576 5 ? 5  
HELX_P HELX_P29 29 LEU C 60  ? VAL C 69  ? LEU B 60  VAL B 69  1 ? 10 
HELX_P HELX_P30 30 PRO C 72  ? LEU C 76  ? PRO B 72  LEU B 76  5 ? 5  
HELX_P HELX_P31 31 LEU C 84  ? ASP C 98  ? LEU B 84  ASP B 98  1 ? 15 
HELX_P HELX_P32 32 ALA D 61  ? GLY D 66  ? ALA D 173 GLY D 178 1 ? 6  
HELX_P HELX_P33 33 GLU D 68  ? LEU D 75  ? GLU D 180 LEU D 187 1 ? 8  
HELX_P HELX_P34 34 ASP D 107 ? THR D 112 ? ASP D 219 THR D 224 1 ? 6  
HELX_P HELX_P35 35 MET D 131 ? ASN D 156 ? MET D 243 ASN D 268 1 ? 26 
HELX_P HELX_P36 36 ASP D 160 ? ASP D 183 ? ASP D 272 ASP D 295 1 ? 24 
HELX_P HELX_P37 37 ASP D 183 ? GLY D 190 ? ASP D 295 GLY D 302 1 ? 8  
HELX_P HELX_P38 38 LEU D 189 ? LEU D 198 ? LEU D 301 LEU D 310 1 ? 10 
HELX_P HELX_P39 39 VAL D 215 ? PHE D 220 ? VAL D 327 PHE D 332 1 ? 6  
HELX_P HELX_P40 40 ARG D 221 ? ILE D 227 ? ARG D 333 ILE D 339 5 ? 7  
HELX_P HELX_P41 41 SER D 250 ? VAL D 252 ? SER D 362 VAL D 364 5 ? 3  
HELX_P HELX_P42 42 SER D 256 ? GLU D 262 ? SER D 368 GLU D 374 1 ? 7  
HELX_P HELX_P43 43 ILE D 265 ? ALA D 274 ? ILE D 377 ALA D 386 1 ? 10 
HELX_P HELX_P44 44 VAL D 287 ? GLU D 292 ? VAL D 399 GLU D 404 1 ? 6  
HELX_P HELX_P45 45 PHE D 295 ? MET D 299 ? PHE D 407 MET D 411 5 ? 5  
HELX_P HELX_P46 46 ASP D 304 ? HIS D 316 ? ASP D 416 HIS D 428 1 ? 13 
HELX_P HELX_P47 47 GLY D 320 ? CYS D 328 ? GLY D 432 CYS D 440 1 ? 9  
HELX_P HELX_P48 48 THR D 335 ? ARG D 344 ? THR D 447 ARG D 456 1 ? 10 
HELX_P HELX_P49 49 ASN D 345 ? GLY D 357 ? ASN D 457 GLY D 469 1 ? 13 
HELX_P HELX_P50 50 THR D 358 ? ILE D 362 ? THR D 470 ILE D 474 5 ? 5  
HELX_P HELX_P51 51 ASP D 363 ? GLU D 371 ? ASP D 475 GLU D 483 1 ? 9  
HELX_P HELX_P52 52 GLY D 380 ? GLY D 397 ? GLY D 492 GLY D 509 1 ? 18 
HELX_P HELX_P53 53 SER D 409 ? ALA D 417 ? SER D 521 ALA D 529 1 ? 9  
HELX_P HELX_P54 54 SER D 420 ? THR D 429 ? SER D 532 THR D 541 1 ? 10 
HELX_P HELX_P55 55 SER D 453 ? LEU D 455 ? SER D 565 LEU D 567 5 ? 3  
HELX_P HELX_P56 56 LEU D 460 ? ARG D 464 ? LEU D 572 ARG D 576 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 1   SG  ? ? ? 1_555 A  CYS 14  SG  ? ? A CYS 1   A CYS 14   1_555 ? ? ? ? ? ? ? 1.978 ? ? 
disulf2  disulf ?    ? B  CYS 3   SG  ? ? ? 1_555 B  CYS 13  SG  ? ? C CYS 115 C CYS 125  1_555 ? ? ? ? ? ? ? 2.077 ? ? 
disulf3  disulf ?    ? B  CYS 7   SG  ? ? ? 1_555 B  CYS 31  SG  ? ? C CYS 119 C CYS 143  1_555 ? ? ? ? ? ? ? 2.052 ? ? 
disulf4  disulf ?    ? B  CYS 41  SG  ? ? ? 1_555 D  CYS 41  SG  ? ? C CYS 153 D CYS 153  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf5  disulf ?    ? B  CYS 109 SG  ? ? ? 1_555 B  CYS 120 SG  ? ? C CYS 221 C CYS 232  1_555 ? ? ? ? ? ? ? 1.999 ? ? 
disulf6  disulf ?    ? B  CYS 328 SG  ? ? ? 1_555 B  CYS 385 SG  ? ? C CYS 440 C CYS 497  1_555 ? ? ? ? ? ? ? 2.011 ? ? 
disulf7  disulf ?    ? B  CYS 426 SG  ? ? ? 1_555 B  CYS 452 SG  ? ? C CYS 538 C CYS 564  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf8  disulf ?    ? C  CYS 1   SG  ? ? ? 1_555 C  CYS 14  SG  ? ? B CYS 1   B CYS 14   1_555 ? ? ? ? ? ? ? 1.988 ? ? 
disulf9  disulf ?    ? D  CYS 3   SG  ? ? ? 1_555 D  CYS 13  SG  ? ? D CYS 115 D CYS 125  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf10 disulf ?    ? D  CYS 7   SG  ? ? ? 1_555 D  CYS 31  SG  ? ? D CYS 119 D CYS 143  1_555 ? ? ? ? ? ? ? 2.071 ? ? 
disulf11 disulf ?    ? D  CYS 109 SG  ? ? ? 1_555 D  CYS 120 SG  ? ? D CYS 221 D CYS 232  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf12 disulf ?    ? D  CYS 328 SG  ? ? ? 1_555 D  CYS 385 SG  ? ? D CYS 440 D CYS 497  1_555 ? ? ? ? ? ? ? 2.018 ? ? 
disulf13 disulf ?    ? D  CYS 426 SG  ? ? ? 1_555 D  CYS 452 SG  ? ? D CYS 538 D CYS 564  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
covale1  covale none ? A  ASP 94  OD1 ? ? ? 1_555 K  HEM .   CMD ? ? A ASP 94  A HEM 605  1_555 ? ? ? ? ? ? ? 1.554 ? ? 
covale2  covale none ? K  HEM .   CMB ? ? ? 1_555 B  GLU 130 OE2 ? ? A HEM 605 C GLU 242  1_555 ? ? ? ? ? ? ? 1.553 ? ? 
covale3  covale none ? K  HEM .   CBB ? ? ? 1_555 B  MET 131 SD  ? ? A HEM 605 C MET 243  1_555 ? ? ? ? ? ? ? 1.624 ? ? 
covale4  covale both ? B  SER 37  C   ? ? ? 1_555 B  CSO 38  N   ? ? C SER 149 C CSO 150  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale5  covale both ? B  CSO 38  C   ? ? ? 1_555 B  PRO 39  N   ? ? C CSO 150 C PRO 151  1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale6  covale one  ? B  ASN 77  ND2 ? ? ? 1_555 L  NAG .   C1  ? ? C ASN 189 C NAG 1620 1_555 ? ? ? ? ? ? ? 1.429 ? 
N-Glycosylation 
covale7  covale one  ? B  ASN 113 ND2 ? ? ? 1_555 M  NAG .   C1  ? ? C ASN 225 C NAG 1630 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
covale8  covale one  ? B  ASN 205 ND2 ? ? ? 1_555 E  NAG .   C1  ? ? C ASN 317 E NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale9  covale none ? C  ASP 94  OD1 ? ? ? 1_555 DA HEM .   CMD ? ? B ASP 94  B HEM 605  1_555 ? ? ? ? ? ? ? 1.560 ? ? 
covale10 covale none ? DA HEM .   CMB ? ? ? 1_555 D  GLU 130 OE2 ? ? B HEM 605 D GLU 242  1_555 ? ? ? ? ? ? ? 1.564 ? ? 
covale11 covale none ? DA HEM .   CBB ? ? ? 1_555 D  MET 131 SD  ? ? B HEM 605 D MET 243  1_555 ? ? ? ? ? ? ? 1.614 ? ? 
covale12 covale both ? D  SER 37  C   ? ? ? 1_555 D  CSO 38  N   ? ? D SER 149 D CSO 150  1_555 ? ? ? ? ? ? ? 1.338 ? ? 
covale13 covale both ? D  CSO 38  C   ? ? ? 1_555 D  PRO 39  N   ? ? D CSO 150 D PRO 151  1_555 ? ? ? ? ? ? ? 1.348 ? ? 
covale14 covale one  ? D  ASN 77  ND2 ? ? ? 1_555 EA NAG .   C1  ? ? D ASN 189 D NAG 2620 1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale15 covale one  ? D  ASN 113 ND2 ? ? ? 1_555 FA NAG .   C1  ? ? D ASN 225 D NAG 2630 1_555 ? ? ? ? ? ? ? 1.462 ? 
N-Glycosylation 
covale16 covale one  ? D  ASN 205 ND2 ? ? ? 1_555 F  NAG .   C1  ? ? D ASN 317 F NAG 1    1_555 ? ? ? ? ? ? ? 1.454 ? 
N-Glycosylation 
covale17 covale both ? E  NAG .   O4  ? ? ? 1_555 E  NAG .   C1  ? ? E NAG 1   E NAG 2    1_555 ? ? ? ? ? ? ? 1.378 ? ? 
covale18 covale both ? E  NAG .   O6  ? ? ? 1_555 E  FUC .   C1  ? ? E NAG 1   E FUC 6    1_555 ? ? ? ? ? ? ? 1.391 ? ? 
covale19 covale both ? E  NAG .   O4  ? ? ? 1_555 E  BMA .   C1  ? ? E NAG 2   E BMA 3    1_555 ? ? ? ? ? ? ? 1.391 ? ? 
covale20 covale both ? E  BMA .   O3  ? ? ? 1_555 E  MAN .   C1  ? ? E BMA 3   E MAN 4    1_555 ? ? ? ? ? ? ? 1.377 ? ? 
covale21 covale both ? E  BMA .   O6  ? ? ? 1_555 E  MAN .   C1  ? ? E BMA 3   E MAN 5    1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale22 covale both ? F  NAG .   O4  ? ? ? 1_555 F  NAG .   C1  ? ? F NAG 1   F NAG 2    1_555 ? ? ? ? ? ? ? 1.375 ? ? 
covale23 covale both ? F  NAG .   O6  ? ? ? 1_555 F  FUC .   C1  ? ? F NAG 1   F FUC 6    1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale24 covale both ? F  NAG .   O4  ? ? ? 1_555 F  BMA .   C1  ? ? F NAG 2   F BMA 3    1_555 ? ? ? ? ? ? ? 1.382 ? ? 
covale25 covale both ? F  BMA .   O3  ? ? ? 1_555 F  MAN .   C1  ? ? F BMA 3   F MAN 4    1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale26 covale both ? F  BMA .   O6  ? ? ? 1_555 F  MAN .   C1  ? ? F BMA 3   F MAN 5    1_555 ? ? ? ? ? ? ? 1.399 ? ? 
metalc1  metalc ?    ? A  ASP 96  O   ? ? ? 1_555 N  CA  .   CA  ? ? A ASP 96  C CA  1600 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc2  metalc ?    ? A  ASP 96  OD2 ? ? ? 1_555 N  CA  .   CA  ? ? A ASP 96  C CA  1600 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc3  metalc ?    ? K  HEM .   FE  ? ? ? 1_555 I  CYN .   C   ? ? A HEM 605 A CYN 1844 1_555 ? ? ? ? ? ? ? 2.057 ? ? 
metalc4  metalc ?    ? K  HEM .   FE  ? ? ? 1_555 I  CYN .   N   ? ? A HEM 605 A CYN 1844 1_555 ? ? ? ? ? ? ? 2.810 ? ? 
metalc5  metalc ?    ? K  HEM .   FE  ? ? ? 1_555 B  HIS 224 NE2 ? ? A HEM 605 C HIS 336  1_555 ? ? ? ? ? ? ? 2.177 ? ? 
metalc6  metalc ?    ? B  THR 56  O   ? ? ? 1_555 N  CA  .   CA  ? ? C THR 168 C CA  1600 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc7  metalc ?    ? B  THR 56  OG1 ? ? ? 1_555 N  CA  .   CA  ? ? C THR 168 C CA  1600 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc8  metalc ?    ? B  PHE 58  O   ? ? ? 1_555 N  CA  .   CA  ? ? C PHE 170 C CA  1600 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc9  metalc ?    ? B  ASP 60  OD1 ? ? ? 1_555 N  CA  .   CA  ? ? C ASP 172 C CA  1600 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc10 metalc ?    ? B  SER 62  OG  ? ? ? 1_555 N  CA  .   CA  ? ? C SER 174 C CA  1600 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc11 metalc ?    ? C  ASP 96  O   ? ? ? 1_555 GA CA  .   CA  ? ? B ASP 96  D CA  2600 1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc12 metalc ?    ? C  ASP 96  OD2 ? ? ? 1_555 GA CA  .   CA  ? ? B ASP 96  D CA  2600 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc13 metalc ?    ? DA HEM .   FE  ? ? ? 1_555 CA CYN .   C   ? ? B HEM 605 B CYN 2844 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc14 metalc ?    ? DA HEM .   FE  ? ? ? 1_555 CA CYN .   N   ? ? B HEM 605 B CYN 2844 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc15 metalc ?    ? DA HEM .   FE  ? ? ? 1_555 D  HIS 224 NE2 ? ? B HEM 605 D HIS 336  1_555 ? ? ? ? ? ? ? 2.239 ? ? 
metalc16 metalc ?    ? D  THR 56  O   ? ? ? 1_555 GA CA  .   CA  ? ? D THR 168 D CA  2600 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc17 metalc ?    ? D  THR 56  OG1 ? ? ? 1_555 GA CA  .   CA  ? ? D THR 168 D CA  2600 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc18 metalc ?    ? D  PHE 58  O   ? ? ? 1_555 GA CA  .   CA  ? ? D PHE 170 D CA  2600 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc19 metalc ?    ? D  ASP 60  OD1 ? ? ? 1_555 GA CA  .   CA  ? ? D ASP 172 D CA  2600 1_555 ? ? ? ? ? ? ? 2.544 ? ? 
metalc20 metalc ?    ? D  SER 62  OG  ? ? ? 1_555 GA CA  .   CA  ? ? D SER 174 D CA  2600 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 11  B . ? PRO 123 C PRO 12  B ? PRO 124 C 1 0.21  
2 GLU 242 B . ? GLU 354 C PRO 243 B ? PRO 355 C 1 0.58  
3 ASN 437 B . ? ASN 549 C ASN 438 B ? ASN 550 C 1 1.08  
4 TYR 445 B . ? TYR 557 C PRO 446 B ? PRO 558 C 1 1.74  
5 PRO 11  D . ? PRO 123 D PRO 12  D ? PRO 124 D 1 0.29  
6 GLU 242 D . ? GLU 354 D PRO 243 D ? PRO 355 D 1 0.65  
7 ASN 437 D . ? ASN 549 D ASN 438 D ? ASN 550 D 1 -0.68 
8 TYR 445 D . ? TYR 557 D PRO 446 D ? PRO 558 D 1 0.59  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 27  ? ALA A 28  ? ARG A 27  ALA A 28  
A 2 ILE B 52  ? ASN B 53  ? ILE C 164 ASN C 165 
B 1 PRO A 78  ? SER A 83  ? PRO A 78  SER A 83  
B 2 PRO B 276 ? LYS B 278 ? PRO C 388 LYS C 390 
C 1 LEU B 16  ? LYS B 17  ? LEU C 128 LYS C 129 
C 2 CYS B 31  ? ILE B 32  ? CYS C 143 ILE C 144 
D 1 PHE B 230 ? PHE B 232 ? PHE C 342 PHE C 344 
D 2 ARG B 246 ? PRO B 248 ? ARG C 358 PRO C 360 
E 1 THR B 433 ? SER B 435 ? THR C 545 SER C 547 
E 2 PHE B 449 ? ASN B 451 ? PHE C 561 ASN C 563 
F 1 ARG C 27  ? ALA C 28  ? ARG B 27  ALA B 28  
F 2 ILE D 52  ? ASN D 53  ? ILE D 164 ASN D 165 
G 1 PRO C 78  ? SER C 83  ? PRO B 78  SER B 83  
G 2 PRO D 276 ? LYS D 278 ? PRO D 388 LYS D 390 
H 1 LEU D 16  ? LYS D 17  ? LEU D 128 LYS D 129 
H 2 CYS D 31  ? ILE D 32  ? CYS D 143 ILE D 144 
I 1 PHE D 230 ? PHE D 232 ? PHE D 342 PHE D 344 
I 2 ARG D 246 ? PRO D 248 ? ARG D 358 PRO D 360 
J 1 THR D 433 ? SER D 435 ? THR D 545 SER D 547 
J 2 PHE D 449 ? ASN D 451 ? PHE D 561 ASN D 563 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 27  ? O ARG A 27  N ASN B 53  ? N ASN C 165 
B 1 2 N ASP A 79  ? N ASP A 79  O ALA B 277 ? O ALA C 389 
C 1 2 N LEU B 16  ? N LEU C 128 O ILE B 32  ? O ILE C 144 
D 1 2 N MET B 231 ? N MET C 343 O VAL B 247 ? O VAL C 359 
E 1 2 O VAL B 434 ? O VAL C 546 N VAL B 450 ? N VAL C 562 
F 1 2 O ARG C 27  ? O ARG B 27  N ASN D 53  ? N ASN D 165 
G 1 2 N ASP C 79  ? N ASP B 79  O ALA D 277 ? O ALA D 389 
H 1 2 N LEU D 16  ? N LEU D 128 O ILE D 32  ? O ILE D 144 
I 1 2 N MET D 231 ? N MET D 343 O VAL D 247 ? O VAL D 359 
J 1 2 O VAL D 434 ? O VAL D 546 N VAL D 450 ? N VAL D 562 
# 
_database_PDB_matrix.entry_id          1D7W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1D7W 
_atom_sites.fract_transf_matrix[1][1]   0.008982 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001168 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015792 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010930 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
CA 
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . CYS A  1  1   ? 43.653  -14.638 19.725  1.00 36.38 ? 1    CYS A N   1 
ATOM   2     C  CA  . CYS A  1  1   ? 43.979  -14.970 18.307  1.00 35.37 ? 1    CYS A CA  1 
ATOM   3     C  C   . CYS A  1  1   ? 45.456  -15.277 18.157  1.00 39.12 ? 1    CYS A C   1 
ATOM   4     O  O   . CYS A  1  1   ? 46.298  -14.557 18.707  1.00 40.08 ? 1    CYS A O   1 
ATOM   5     C  CB  . CYS A  1  1   ? 43.591  -13.813 17.380  1.00 30.77 ? 1    CYS A CB  1 
ATOM   6     S  SG  . CYS A  1  1   ? 41.801  -13.568 17.204  1.00 18.02 ? 1    CYS A SG  1 
ATOM   7     N  N   . PRO A  1  2   ? 45.783  -16.330 17.368  1.00 42.42 ? 2    PRO A N   1 
ATOM   8     C  CA  . PRO A  1  2   ? 47.168  -16.790 17.123  1.00 44.46 ? 2    PRO A CA  1 
ATOM   9     C  C   . PRO A  1  2   ? 48.177  -15.661 16.992  1.00 46.76 ? 2    PRO A C   1 
ATOM   10    O  O   . PRO A  1  2   ? 47.872  -14.610 16.400  1.00 48.16 ? 2    PRO A O   1 
ATOM   11    C  CB  . PRO A  1  2   ? 47.029  -17.593 15.836  1.00 44.21 ? 2    PRO A CB  1 
ATOM   12    C  CG  . PRO A  1  2   ? 45.699  -18.244 16.028  1.00 44.00 ? 2    PRO A CG  1 
ATOM   13    C  CD  . PRO A  1  2   ? 44.820  -17.145 16.580  1.00 43.53 ? 2    PRO A CD  1 
ATOM   14    N  N   . GLU A  1  3   ? 49.371  -15.892 17.568  1.00 47.95 ? 3    GLU A N   1 
ATOM   15    C  CA  . GLU A  1  3   ? 50.487  -14.941 17.558  1.00 47.71 ? 3    GLU A CA  1 
ATOM   16    C  C   . GLU A  1  3   ? 50.723  -14.455 16.149  1.00 46.70 ? 3    GLU A C   1 
ATOM   17    O  O   . GLU A  1  3   ? 50.551  -13.269 15.865  1.00 46.35 ? 3    GLU A O   1 
ATOM   18    C  CB  . GLU A  1  3   ? 51.757  -15.630 18.070  1.00 49.95 ? 3    GLU A CB  1 
ATOM   19    C  CG  . GLU A  1  3   ? 52.933  -14.694 18.343  1.00 51.86 ? 3    GLU A CG  1 
ATOM   20    C  CD  . GLU A  1  3   ? 52.968  -14.165 19.772  1.00 51.42 ? 3    GLU A CD  1 
ATOM   21    O  OE1 . GLU A  1  3   ? 53.067  -12.933 19.948  1.00 51.63 ? 3    GLU A OE1 1 
ATOM   22    O  OE2 . GLU A  1  3   ? 52.906  -14.983 20.718  1.00 52.09 ? 3    GLU A OE2 1 
ATOM   23    N  N   . GLN A  1  4   ? 51.119  -15.405 15.283  1.00 46.62 ? 4    GLN A N   1 
ATOM   24    C  CA  . GLN A  1  4   ? 51.347  -15.192 13.847  1.00 46.16 ? 4    GLN A CA  1 
ATOM   25    C  C   . GLN A  1  4   ? 50.667  -16.312 13.058  1.00 44.66 ? 4    GLN A C   1 
ATOM   26    O  O   . GLN A  1  4   ? 50.612  -17.457 13.513  1.00 45.91 ? 4    GLN A O   1 
ATOM   27    C  CB  . GLN A  1  4   ? 52.845  -15.188 13.509  1.00 47.97 ? 4    GLN A CB  1 
ATOM   28    C  CG  . GLN A  1  4   ? 53.134  -14.876 12.048  1.00 49.61 ? 4    GLN A CG  1 
ATOM   29    C  CD  . GLN A  1  4   ? 54.548  -15.224 11.629  1.00 52.38 ? 4    GLN A CD  1 
ATOM   30    O  OE1 . GLN A  1  4   ? 55.506  -14.517 11.962  1.00 54.77 ? 4    GLN A OE1 1 
ATOM   31    N  NE2 . GLN A  1  4   ? 54.689  -16.320 10.887  1.00 51.54 ? 4    GLN A NE2 1 
ATOM   32    N  N   . ASP A  1  5   ? 50.164  -15.976 11.874  1.00 41.79 ? 5    ASP A N   1 
ATOM   33    C  CA  . ASP A  1  5   ? 49.442  -16.916 11.014  1.00 37.77 ? 5    ASP A CA  1 
ATOM   34    C  C   . ASP A  1  5   ? 49.717  -16.644 9.540   1.00 33.91 ? 5    ASP A C   1 
ATOM   35    O  O   . ASP A  1  5   ? 49.988  -15.512 9.139   1.00 34.32 ? 5    ASP A O   1 
ATOM   36    C  CB  . ASP A  1  5   ? 47.922  -16.859 11.308  1.00 37.81 ? 5    ASP A CB  1 
ATOM   37    C  CG  . ASP A  1  5   ? 47.365  -15.450 11.511  1.00 37.89 ? 5    ASP A CG  1 
ATOM   38    O  OD1 . ASP A  1  5   ? 46.310  -15.155 10.941  1.00 38.45 ? 5    ASP A OD1 1 
ATOM   39    O  OD2 . ASP A  1  5   ? 47.970  -14.645 12.255  1.00 37.80 ? 5    ASP A OD2 1 
ATOM   40    N  N   . LYS A  1  6   ? 49.659  -17.681 8.738   1.00 29.22 ? 6    LYS A N   1 
ATOM   41    C  CA  . LYS A  1  6   ? 49.945  -17.539 7.314   1.00 26.70 ? 6    LYS A CA  1 
ATOM   42    C  C   . LYS A  1  6   ? 48.679  -17.517 6.465   1.00 20.56 ? 6    LYS A C   1 
ATOM   43    O  O   . LYS A  1  6   ? 48.665  -16.984 5.345   1.00 20.26 ? 6    LYS A O   1 
ATOM   44    C  CB  . LYS A  1  6   ? 50.852  -18.690 6.843   1.00 30.36 ? 6    LYS A CB  1 
ATOM   45    C  CG  . LYS A  1  6   ? 52.279  -18.645 7.382   1.00 32.11 ? 6    LYS A CG  1 
ATOM   46    C  CD  . LYS A  1  6   ? 52.994  -19.972 7.168   1.00 33.72 ? 6    LYS A CD  1 
ATOM   47    C  CE  . LYS A  1  6   ? 52.939  -20.425 5.714   1.00 31.14 ? 6    LYS A CE  1 
ATOM   48    N  NZ  . LYS A  1  6   ? 53.378  -21.842 5.577   1.00 31.85 ? 6    LYS A NZ  1 
ATOM   49    N  N   . TYR A  1  7   ? 47.614  -18.074 7.008   1.00 16.43 ? 7    TYR A N   1 
ATOM   50    C  CA  . TYR A  1  7   ? 46.370  -18.218 6.257   1.00 13.73 ? 7    TYR A CA  1 
ATOM   51    C  C   . TYR A  1  7   ? 45.152  -17.710 7.024   1.00 11.25 ? 7    TYR A C   1 
ATOM   52    O  O   . TYR A  1  7   ? 45.112  -17.710 8.257   1.00 9.86  ? 7    TYR A O   1 
ATOM   53    C  CB  . TYR A  1  7   ? 46.150  -19.707 5.900   1.00 11.58 ? 7    TYR A CB  1 
ATOM   54    C  CG  . TYR A  1  7   ? 47.351  -20.345 5.265   1.00 11.50 ? 7    TYR A CG  1 
ATOM   55    C  CD1 . TYR A  1  7   ? 47.819  -19.908 4.008   1.00 12.57 ? 7    TYR A CD1 1 
ATOM   56    C  CD2 . TYR A  1  7   ? 48.084  -21.314 5.948   1.00 11.59 ? 7    TYR A CD2 1 
ATOM   57    C  CE1 . TYR A  1  7   ? 48.991  -20.410 3.457   1.00 10.25 ? 7    TYR A CE1 1 
ATOM   58    C  CE2 . TYR A  1  7   ? 49.262  -21.821 5.401   1.00 12.78 ? 7    TYR A CE2 1 
ATOM   59    C  CZ  . TYR A  1  7   ? 49.714  -21.366 4.165   1.00 11.71 ? 7    TYR A CZ  1 
ATOM   60    O  OH  . TYR A  1  7   ? 50.902  -21.835 3.657   1.00 10.94 ? 7    TYR A OH  1 
ATOM   61    N  N   . ARG A  1  8   ? 44.148  -17.274 6.271   1.00 9.85  ? 8    ARG A N   1 
ATOM   62    C  CA  . ARG A  1  8   ? 42.878  -16.882 6.853   1.00 6.58  ? 8    ARG A CA  1 
ATOM   63    C  C   . ARG A  1  8   ? 42.268  -18.090 7.538   1.00 6.80  ? 8    ARG A C   1 
ATOM   64    O  O   . ARG A  1  8   ? 42.456  -19.228 7.055   1.00 6.66  ? 8    ARG A O   1 
ATOM   65    C  CB  . ARG A  1  8   ? 41.877  -16.547 5.775   1.00 3.81  ? 8    ARG A CB  1 
ATOM   66    C  CG  . ARG A  1  8   ? 42.279  -15.597 4.710   1.00 3.59  ? 8    ARG A CG  1 
ATOM   67    C  CD  . ARG A  1  8   ? 41.163  -15.550 3.655   1.00 6.16  ? 8    ARG A CD  1 
ATOM   68    N  NE  . ARG A  1  8   ? 41.363  -14.473 2.707   1.00 8.88  ? 8    ARG A NE  1 
ATOM   69    C  CZ  . ARG A  1  8   ? 41.078  -13.163 2.948   1.00 8.13  ? 8    ARG A CZ  1 
ATOM   70    N  NH1 . ARG A  1  8   ? 40.459  -12.785 4.083   1.00 8.60  ? 8    ARG A NH1 1 
ATOM   71    N  NH2 . ARG A  1  8   ? 41.373  -12.245 2.028   1.00 6.86  ? 8    ARG A NH2 1 
ATOM   72    N  N   . THR A  1  9   ? 41.507  -17.864 8.608   1.00 4.27  ? 9    THR A N   1 
ATOM   73    C  CA  . THR A  1  9   ? 40.672  -18.943 9.125   1.00 5.90  ? 9    THR A CA  1 
ATOM   74    C  C   . THR A  1  9   ? 39.510  -19.190 8.142   1.00 6.08  ? 9    THR A C   1 
ATOM   75    O  O   . THR A  1  9   ? 39.278  -18.396 7.220   1.00 7.01  ? 9    THR A O   1 
ATOM   76    C  CB  . THR A  1  9   ? 40.069  -18.600 10.486  1.00 3.80  ? 9    THR A CB  1 
ATOM   77    O  OG1 . THR A  1  9   ? 39.256  -17.426 10.340  1.00 4.97  ? 9    THR A OG1 1 
ATOM   78    C  CG2 . THR A  1  9   ? 41.181  -18.354 11.519  1.00 8.69  ? 9    THR A CG2 1 
ATOM   79    N  N   . ILE A  1  10  ? 38.800  -20.299 8.311   1.00 5.48  ? 10   ILE A N   1 
ATOM   80    C  CA  . ILE A  1  10  ? 37.623  -20.568 7.490   1.00 4.89  ? 10   ILE A CA  1 
ATOM   81    C  C   . ILE A  1  10  ? 36.471  -19.633 7.852   1.00 4.23  ? 10   ILE A C   1 
ATOM   82    O  O   . ILE A  1  10  ? 35.777  -19.137 6.964   1.00 4.92  ? 10   ILE A O   1 
ATOM   83    C  CB  . ILE A  1  10  ? 37.175  -22.041 7.627   1.00 5.80  ? 10   ILE A CB  1 
ATOM   84    C  CG1 . ILE A  1  10  ? 38.201  -22.936 6.894   1.00 7.28  ? 10   ILE A CG1 1 
ATOM   85    C  CG2 . ILE A  1  10  ? 35.745  -22.251 7.052   1.00 6.39  ? 10   ILE A CG2 1 
ATOM   86    C  CD1 . ILE A  1  10  ? 38.150  -22.844 5.371   1.00 9.43  ? 10   ILE A CD1 1 
ATOM   87    N  N   . THR A  1  11  ? 36.276  -19.383 9.153   1.00 6.32  ? 11   THR A N   1 
ATOM   88    C  CA  . THR A  1  11  ? 35.180  -18.509 9.609   1.00 7.16  ? 11   THR A CA  1 
ATOM   89    C  C   . THR A  1  11  ? 35.448  -17.019 9.464   1.00 6.69  ? 11   THR A C   1 
ATOM   90    O  O   . THR A  1  11  ? 34.523  -16.245 9.627   1.00 5.19  ? 11   THR A O   1 
ATOM   91    C  CB  . THR A  1  11  ? 34.775  -18.725 11.079  1.00 7.00  ? 11   THR A CB  1 
ATOM   92    O  OG1 . THR A  1  11  ? 35.914  -18.549 11.911  1.00 9.25  ? 11   THR A OG1 1 
ATOM   93    C  CG2 . THR A  1  11  ? 34.151  -20.091 11.295  1.00 5.19  ? 11   THR A CG2 1 
ATOM   94    N  N   . GLY A  1  12  ? 36.697  -16.614 9.171   1.00 4.27  ? 12   GLY A N   1 
ATOM   95    C  CA  . GLY A  1  12  ? 37.005  -15.188 9.092   1.00 2.90  ? 12   GLY A CA  1 
ATOM   96    C  C   . GLY A  1  12  ? 37.436  -14.645 10.436  1.00 4.06  ? 12   GLY A C   1 
ATOM   97    O  O   . GLY A  1  12  ? 37.949  -13.525 10.547  1.00 3.70  ? 12   GLY A O   1 
ATOM   98    N  N   . MET A  1  13  ? 37.213  -15.453 11.458  1.00 5.12  ? 13   MET A N   1 
ATOM   99    C  CA  . MET A  1  13  ? 37.601  -15.169 12.838  1.00 7.74  ? 13   MET A CA  1 
ATOM   100   C  C   . MET A  1  13  ? 39.092  -14.782 12.912  1.00 8.93  ? 13   MET A C   1 
ATOM   101   O  O   . MET A  1  13  ? 39.926  -15.383 12.243  1.00 8.48  ? 13   MET A O   1 
ATOM   102   C  CB  . MET A  1  13  ? 37.349  -16.436 13.667  1.00 11.85 ? 13   MET A CB  1 
ATOM   103   C  CG  . MET A  1  13  ? 38.043  -16.498 15.004  1.00 18.18 ? 13   MET A CG  1 
ATOM   104   S  SD  . MET A  1  13  ? 37.304  -15.403 16.211  1.00 32.66 ? 13   MET A SD  1 
ATOM   105   C  CE  . MET A  1  13  ? 37.143  -16.522 17.598  1.00 26.57 ? 13   MET A CE  1 
ATOM   106   N  N   . CYS A  1  14  ? 39.401  -13.764 13.715  1.00 8.36  ? 14   CYS A N   1 
ATOM   107   C  CA  . CYS A  1  14  ? 40.774  -13.292 13.938  1.00 9.72  ? 14   CYS A CA  1 
ATOM   108   C  C   . CYS A  1  14  ? 41.390  -12.526 12.756  1.00 8.05  ? 14   CYS A C   1 
ATOM   109   O  O   . CYS A  1  14  ? 42.562  -12.144 12.828  1.00 9.09  ? 14   CYS A O   1 
ATOM   110   C  CB  . CYS A  1  14  ? 41.695  -14.454 14.386  1.00 11.57 ? 14   CYS A CB  1 
ATOM   111   S  SG  . CYS A  1  14  ? 41.317  -15.096 16.045  1.00 14.30 ? 14   CYS A SG  1 
ATOM   112   N  N   . ASN A  1  15  ? 40.616  -12.263 11.676  1.00 5.20  ? 15   ASN A N   1 
ATOM   113   C  CA  . ASN A  1  15  ? 41.142  -11.391 10.621  1.00 5.58  ? 15   ASN A CA  1 
ATOM   114   C  C   . ASN A  1  15  ? 41.505  -10.027 11.246  1.00 3.01  ? 15   ASN A C   1 
ATOM   115   O  O   . ASN A  1  15  ? 42.600  -9.518  11.052  1.00 4.87  ? 15   ASN A O   1 
ATOM   116   C  CB  . ASN A  1  15  ? 40.140  -11.230 9.444   1.00 4.05  ? 15   ASN A CB  1 
ATOM   117   C  CG  . ASN A  1  15  ? 40.725  -10.493 8.221   1.00 4.93  ? 15   ASN A CG  1 
ATOM   118   O  OD1 . ASN A  1  15  ? 41.049  -9.303  8.288   1.00 7.66  ? 15   ASN A OD1 1 
ATOM   119   N  ND2 . ASN A  1  15  ? 40.850  -11.177 7.091   1.00 6.85  ? 15   ASN A ND2 1 
ATOM   120   N  N   . ASN A  1  16  ? 40.590  -9.458  12.009  1.00 3.17  ? 16   ASN A N   1 
ATOM   121   C  CA  . ASN A  1  16  ? 40.840  -8.239  12.776  1.00 6.51  ? 16   ASN A CA  1 
ATOM   122   C  C   . ASN A  1  16  ? 41.246  -8.619  14.199  1.00 7.60  ? 16   ASN A C   1 
ATOM   123   O  O   . ASN A  1  16  ? 40.446  -9.152  14.963  1.00 6.73  ? 16   ASN A O   1 
ATOM   124   C  CB  . ASN A  1  16  ? 39.572  -7.368  12.842  1.00 6.32  ? 16   ASN A CB  1 
ATOM   125   C  CG  . ASN A  1  16  ? 39.823  -5.975  13.392  1.00 5.78  ? 16   ASN A CG  1 
ATOM   126   O  OD1 . ASN A  1  16  ? 39.779  -5.740  14.608  1.00 6.73  ? 16   ASN A OD1 1 
ATOM   127   N  ND2 . ASN A  1  16  ? 40.075  -5.041  12.482  1.00 7.67  ? 16   ASN A ND2 1 
ATOM   128   N  N   . ARG A  1  17  ? 42.472  -8.322  14.568  1.00 8.96  ? 17   ARG A N   1 
ATOM   129   C  CA  . ARG A  1  17  ? 42.957  -8.705  15.903  1.00 11.85 ? 17   ARG A CA  1 
ATOM   130   C  C   . ARG A  1  17  ? 42.213  -8.055  17.084  1.00 10.96 ? 17   ARG A C   1 
ATOM   131   O  O   . ARG A  1  17  ? 41.892  -8.747  18.050  1.00 12.92 ? 17   ARG A O   1 
ATOM   132   C  CB  . ARG A  1  17  ? 44.451  -8.416  16.023  1.00 14.13 ? 17   ARG A CB  1 
ATOM   133   C  CG  . ARG A  1  17  ? 45.325  -9.625  15.794  1.00 17.44 ? 17   ARG A CG  1 
ATOM   134   C  CD  . ARG A  1  17  ? 45.236  -10.127 14.370  1.00 20.50 ? 17   ARG A CD  1 
ATOM   135   N  NE  . ARG A  1  17  ? 46.081  -11.310 14.199  1.00 24.27 ? 17   ARG A NE  1 
ATOM   136   C  CZ  . ARG A  1  17  ? 47.386  -11.282 13.956  1.00 22.27 ? 17   ARG A CZ  1 
ATOM   137   N  NH1 . ARG A  1  17  ? 48.005  -10.113 13.792  1.00 23.09 ? 17   ARG A NH1 1 
ATOM   138   N  NH2 . ARG A  1  17  ? 48.064  -12.429 13.844  1.00 20.58 ? 17   ARG A NH2 1 
ATOM   139   N  N   . ARG A  1  18  ? 41.937  -6.757  17.020  1.00 7.27  ? 18   ARG A N   1 
ATOM   140   C  CA  . ARG A  1  18  ? 41.294  -6.078  18.142  1.00 9.87  ? 18   ARG A CA  1 
ATOM   141   C  C   . ARG A  1  18  ? 39.813  -6.460  18.322  1.00 10.44 ? 18   ARG A C   1 
ATOM   142   O  O   . ARG A  1  18  ? 39.292  -6.482  19.440  1.00 8.67  ? 18   ARG A O   1 
ATOM   143   C  CB  . ARG A  1  18  ? 41.457  -4.555  18.004  1.00 11.46 ? 18   ARG A CB  1 
ATOM   144   C  CG  . ARG A  1  18  ? 42.863  -4.056  18.373  1.00 12.61 ? 18   ARG A CG  1 
ATOM   145   C  CD  . ARG A  1  18  ? 42.938  -2.531  18.460  1.00 10.64 ? 18   ARG A CD  1 
ATOM   146   N  NE  . ARG A  1  18  ? 42.806  -1.889  17.152  1.00 11.21 ? 18   ARG A NE  1 
ATOM   147   C  CZ  . ARG A  1  18  ? 41.859  -1.007  16.814  1.00 9.77  ? 18   ARG A CZ  1 
ATOM   148   N  NH1 . ARG A  1  18  ? 40.905  -0.659  17.670  1.00 8.38  ? 18   ARG A NH1 1 
ATOM   149   N  NH2 . ARG A  1  18  ? 41.863  -0.492  15.606  1.00 12.64 ? 18   ARG A NH2 1 
ATOM   150   N  N   . SER A  1  19  ? 39.143  -6.759  17.216  1.00 11.43 ? 19   SER A N   1 
ATOM   151   C  CA  . SER A  1  19  ? 37.734  -7.182  17.232  1.00 12.61 ? 19   SER A CA  1 
ATOM   152   C  C   . SER A  1  19  ? 37.649  -8.374  16.275  1.00 11.51 ? 19   SER A C   1 
ATOM   153   O  O   . SER A  1  19  ? 37.170  -8.261  15.145  1.00 7.22  ? 19   SER A O   1 
ATOM   154   C  CB  . SER A  1  19  ? 36.854  -5.997  16.762  1.00 15.88 ? 19   SER A CB  1 
ATOM   155   O  OG  . SER A  1  19  ? 35.480  -6.174  17.106  1.00 22.10 ? 19   SER A OG  1 
ATOM   156   N  N   . PRO A  1  20  ? 38.105  -9.553  16.769  1.00 10.63 ? 20   PRO A N   1 
ATOM   157   C  CA  . PRO A  1  20  ? 38.189  -10.791 15.993  1.00 11.42 ? 20   PRO A CA  1 
ATOM   158   C  C   . PRO A  1  20  ? 36.909  -11.397 15.362  1.00 9.79  ? 20   PRO A C   1 
ATOM   159   O  O   . PRO A  1  20  ? 37.024  -12.396 14.652  1.00 8.17  ? 20   PRO A O   1 
ATOM   160   C  CB  . PRO A  1  20  ? 38.935  -11.752 16.952  1.00 10.99 ? 20   PRO A CB  1 
ATOM   161   C  CG  . PRO A  1  20  ? 38.510  -11.290 18.294  1.00 9.52  ? 20   PRO A CG  1 
ATOM   162   C  CD  . PRO A  1  20  ? 38.525  -9.796  18.185  1.00 10.86 ? 20   PRO A CD  1 
ATOM   163   N  N   . THR A  1  21  ? 35.718  -10.827 15.598  1.00 9.23  ? 21   THR A N   1 
ATOM   164   C  CA  . THR A  1  21  ? 34.525  -11.383 14.949  1.00 8.90  ? 21   THR A CA  1 
ATOM   165   C  C   . THR A  1  21  ? 34.167  -10.610 13.665  1.00 9.79  ? 21   THR A C   1 
ATOM   166   O  O   . THR A  1  21  ? 33.367  -11.099 12.853  1.00 8.46  ? 21   THR A O   1 
ATOM   167   C  CB  . THR A  1  21  ? 33.243  -11.426 15.872  1.00 7.97  ? 21   THR A CB  1 
ATOM   168   O  OG1 . THR A  1  21  ? 32.737  -10.098 16.111  1.00 7.74  ? 21   THR A OG1 1 
ATOM   169   C  CG2 . THR A  1  21  ? 33.519  -12.144 17.198  1.00 4.36  ? 21   THR A CG2 1 
ATOM   170   N  N   . LEU A  1  22  ? 34.773  -9.411  13.471  1.00 7.84  ? 22   LEU A N   1 
ATOM   171   C  CA  . LEU A  1  22  ? 34.417  -8.561  12.318  1.00 6.96  ? 22   LEU A CA  1 
ATOM   172   C  C   . LEU A  1  22  ? 34.754  -9.224  11.001  1.00 7.30  ? 22   LEU A C   1 
ATOM   173   O  O   . LEU A  1  22  ? 35.916  -9.598  10.736  1.00 7.91  ? 22   LEU A O   1 
ATOM   174   C  CB  . LEU A  1  22  ? 35.080  -7.170  12.405  1.00 6.81  ? 22   LEU A CB  1 
ATOM   175   C  CG  . LEU A  1  22  ? 34.878  -6.382  13.708  1.00 8.11  ? 22   LEU A CG  1 
ATOM   176   C  CD1 . LEU A  1  22  ? 35.690  -5.103  13.673  1.00 5.98  ? 22   LEU A CD1 1 
ATOM   177   C  CD2 . LEU A  1  22  ? 33.403  -6.092  13.951  1.00 7.39  ? 22   LEU A CD2 1 
ATOM   178   N  N   . GLY A  1  23  ? 33.718  -9.390  10.174  1.00 5.46  ? 23   GLY A N   1 
ATOM   179   C  CA  . GLY A  1  23  ? 33.885  -10.043 8.899   1.00 4.07  ? 23   GLY A CA  1 
ATOM   180   C  C   . GLY A  1  23  ? 33.773  -11.552 9.000   1.00 3.72  ? 23   GLY A C   1 
ATOM   181   O  O   . GLY A  1  23  ? 33.744  -12.254 7.984   1.00 3.12  ? 23   GLY A O   1 
ATOM   182   N  N   . ALA A  1  24  ? 33.726  -12.058 10.231  1.00 3.80  ? 24   ALA A N   1 
ATOM   183   C  CA  . ALA A  1  24  ? 33.565  -13.487 10.468  1.00 5.32  ? 24   ALA A CA  1 
ATOM   184   C  C   . ALA A  1  24  ? 32.116  -13.933 10.182  1.00 7.28  ? 24   ALA A C   1 
ATOM   185   O  O   . ALA A  1  24  ? 31.205  -13.119 10.204  1.00 8.84  ? 24   ALA A O   1 
ATOM   186   C  CB  . ALA A  1  24  ? 33.935  -13.818 11.903  1.00 5.39  ? 24   ALA A CB  1 
ATOM   187   N  N   . SER A  1  25  ? 31.926  -15.225 9.912   1.00 7.13  ? 25   SER A N   1 
ATOM   188   C  CA  . SER A  1  25  ? 30.604  -15.796 9.614   1.00 7.09  ? 25   SER A CA  1 
ATOM   189   C  C   . SER A  1  25  ? 29.674  -15.897 10.868  1.00 5.98  ? 25   SER A C   1 
ATOM   190   O  O   . SER A  1  25  ? 30.132  -15.930 12.009  1.00 3.48  ? 25   SER A O   1 
ATOM   191   C  CB  . SER A  1  25  ? 30.819  -17.173 8.962   1.00 5.22  ? 25   SER A CB  1 
ATOM   192   O  OG  . SER A  1  25  ? 31.469  -18.052 9.849   1.00 4.01  ? 25   SER A OG  1 
ATOM   193   N  N   . ASN A  1  26  ? 28.353  -15.939 10.638  1.00 4.91  ? 26   ASN A N   1 
ATOM   194   C  CA  . ASN A  1  26  ? 27.349  -16.080 11.706  1.00 5.87  ? 26   ASN A CA  1 
ATOM   195   C  C   . ASN A  1  26  ? 27.389  -14.950 12.734  1.00 5.29  ? 26   ASN A C   1 
ATOM   196   O  O   . ASN A  1  26  ? 27.295  -15.172 13.939  1.00 5.30  ? 26   ASN A O   1 
ATOM   197   C  CB  . ASN A  1  26  ? 27.458  -17.470 12.379  1.00 7.31  ? 26   ASN A CB  1 
ATOM   198   C  CG  . ASN A  1  26  ? 27.209  -18.570 11.357  1.00 13.58 ? 26   ASN A CG  1 
ATOM   199   O  OD1 . ASN A  1  26  ? 26.222  -18.518 10.615  1.00 14.95 ? 26   ASN A OD1 1 
ATOM   200   N  ND2 . ASN A  1  26  ? 28.103  -19.554 11.276  1.00 9.00  ? 26   ASN A ND2 1 
ATOM   201   N  N   . ARG A  1  27  ? 27.496  -13.706 12.217  1.00 4.91  ? 27   ARG A N   1 
ATOM   202   C  CA  . ARG A  1  27  ? 27.458  -12.483 13.024  1.00 3.65  ? 27   ARG A CA  1 
ATOM   203   C  C   . ARG A  1  27  ? 26.418  -11.530 12.418  1.00 4.65  ? 27   ARG A C   1 
ATOM   204   O  O   . ARG A  1  27  ? 26.115  -11.646 11.236  1.00 2.98  ? 27   ARG A O   1 
ATOM   205   C  CB  . ARG A  1  27  ? 28.838  -11.811 13.047  1.00 2.82  ? 27   ARG A CB  1 
ATOM   206   C  CG  . ARG A  1  27  ? 29.962  -12.679 13.661  1.00 6.35  ? 27   ARG A CG  1 
ATOM   207   C  CD  . ARG A  1  27  ? 29.793  -12.929 15.164  1.00 6.11  ? 27   ARG A CD  1 
ATOM   208   N  NE  . ARG A  1  27  ? 30.606  -14.071 15.627  1.00 9.73  ? 27   ARG A NE  1 
ATOM   209   C  CZ  . ARG A  1  27  ? 30.540  -14.612 16.848  1.00 10.59 ? 27   ARG A CZ  1 
ATOM   210   N  NH1 . ARG A  1  27  ? 29.689  -14.134 17.750  1.00 12.51 ? 27   ARG A NH1 1 
ATOM   211   N  NH2 . ARG A  1  27  ? 31.324  -15.634 17.169  1.00 13.65 ? 27   ARG A NH2 1 
ATOM   212   N  N   . ALA A  1  28  ? 25.848  -10.619 13.226  1.00 7.06  ? 28   ALA A N   1 
ATOM   213   C  CA  . ALA A  1  28  ? 24.846  -9.664  12.708  1.00 6.46  ? 28   ALA A CA  1 
ATOM   214   C  C   . ALA A  1  28  ? 25.485  -8.705  11.741  1.00 8.60  ? 28   ALA A C   1 
ATOM   215   O  O   . ALA A  1  28  ? 26.668  -8.363  11.871  1.00 8.81  ? 28   ALA A O   1 
ATOM   216   C  CB  . ALA A  1  28  ? 24.235  -8.847  13.826  1.00 4.40  ? 28   ALA A CB  1 
ATOM   217   N  N   . PHE A  1  29  ? 24.728  -8.276  10.757  1.00 7.97  ? 29   PHE A N   1 
ATOM   218   C  CA  . PHE A  1  29  ? 25.225  -7.275  9.837   1.00 5.33  ? 29   PHE A CA  1 
ATOM   219   C  C   . PHE A  1  29  ? 25.540  -5.998  10.601  1.00 2.83  ? 29   PHE A C   1 
ATOM   220   O  O   . PHE A  1  29  ? 24.996  -5.773  11.701  1.00 3.59  ? 29   PHE A O   1 
ATOM   221   C  CB  . PHE A  1  29  ? 24.161  -6.974  8.759   1.00 3.27  ? 29   PHE A CB  1 
ATOM   222   C  CG  . PHE A  1  29  ? 23.954  -8.088  7.783   1.00 3.49  ? 29   PHE A CG  1 
ATOM   223   C  CD1 . PHE A  1  29  ? 22.794  -8.849  7.822   1.00 3.05  ? 29   PHE A CD1 1 
ATOM   224   C  CD2 . PHE A  1  29  ? 24.908  -8.370  6.805   1.00 2.00  ? 29   PHE A CD2 1 
ATOM   225   C  CE1 . PHE A  1  29  ? 22.590  -9.878  6.905   1.00 2.69  ? 29   PHE A CE1 1 
ATOM   226   C  CE2 . PHE A  1  29  ? 24.709  -9.392  5.884   1.00 3.99  ? 29   PHE A CE2 1 
ATOM   227   C  CZ  . PHE A  1  29  ? 23.551  -10.153 5.930   1.00 3.17  ? 29   PHE A CZ  1 
ATOM   228   N  N   . VAL A  1  30  ? 26.412  -5.182  10.055  1.00 4.09  ? 30   VAL A N   1 
ATOM   229   C  CA  . VAL A  1  30  ? 26.619  -3.854  10.657  1.00 7.87  ? 30   VAL A CA  1 
ATOM   230   C  C   . VAL A  1  30  ? 25.521  -2.886  10.105  1.00 6.15  ? 30   VAL A C   1 
ATOM   231   O  O   . VAL A  1  30  ? 25.077  -3.025  8.978   1.00 4.86  ? 30   VAL A O   1 
ATOM   232   C  CB  . VAL A  1  30  ? 28.070  -3.262  10.392  1.00 7.79  ? 30   VAL A CB  1 
ATOM   233   C  CG1 . VAL A  1  30  ? 28.300  -2.949  8.905   1.00 2.00  ? 30   VAL A CG1 1 
ATOM   234   C  CG2 . VAL A  1  30  ? 28.294  -2.013  11.260  1.00 5.02  ? 30   VAL A CG2 1 
ATOM   235   N  N   . ARG A  1  31  ? 25.067  -1.974  10.935  1.00 6.65  ? 31   ARG A N   1 
ATOM   236   C  CA  . ARG A  1  31  ? 24.078  -0.991  10.515  1.00 7.93  ? 31   ARG A CA  1 
ATOM   237   C  C   . ARG A  1  31  ? 24.741  0.351   10.235  1.00 8.51  ? 31   ARG A C   1 
ATOM   238   O  O   . ARG A  1  31  ? 25.331  0.942   11.140  1.00 10.07 ? 31   ARG A O   1 
ATOM   239   C  CB  . ARG A  1  31  ? 23.052  -0.783  11.609  1.00 8.31  ? 31   ARG A CB  1 
ATOM   240   C  CG  . ARG A  1  31  ? 22.094  -1.921  11.787  1.00 7.90  ? 31   ARG A CG  1 
ATOM   241   C  CD  . ARG A  1  31  ? 20.921  -1.811  10.842  1.00 6.33  ? 31   ARG A CD  1 
ATOM   242   N  NE  . ARG A  1  31  ? 19.895  -2.793  11.219  1.00 9.84  ? 31   ARG A NE  1 
ATOM   243   C  CZ  . ARG A  1  31  ? 18.863  -3.148  10.467  1.00 5.83  ? 31   ARG A CZ  1 
ATOM   244   N  NH1 . ARG A  1  31  ? 18.689  -2.594  9.300   1.00 3.48  ? 31   ARG A NH1 1 
ATOM   245   N  NH2 . ARG A  1  31  ? 18.013  -4.050  10.904  1.00 5.36  ? 31   ARG A NH2 1 
ATOM   246   N  N   . TRP A  1  32  ? 24.647  0.819   8.991   1.00 7.04  ? 32   TRP A N   1 
ATOM   247   C  CA  . TRP A  1  32  ? 25.100  2.153   8.645   1.00 6.23  ? 32   TRP A CA  1 
ATOM   248   C  C   . TRP A  1  32  ? 24.040  3.194   8.967   1.00 6.35  ? 32   TRP A C   1 
ATOM   249   O  O   . TRP A  1  32  ? 24.347  4.366   9.107   1.00 8.74  ? 32   TRP A O   1 
ATOM   250   C  CB  . TRP A  1  32  ? 25.462  2.246   7.174   1.00 7.88  ? 32   TRP A CB  1 
ATOM   251   C  CG  . TRP A  1  32  ? 26.783  1.609   6.815   1.00 8.50  ? 32   TRP A CG  1 
ATOM   252   C  CD1 . TRP A  1  32  ? 27.721  1.093   7.675   1.00 6.37  ? 32   TRP A CD1 1 
ATOM   253   C  CD2 . TRP A  1  32  ? 27.225  1.297   5.483   1.00 6.58  ? 32   TRP A CD2 1 
ATOM   254   N  NE1 . TRP A  1  32  ? 28.706  0.473   6.949   1.00 9.35  ? 32   TRP A NE1 1 
ATOM   255   C  CE2 . TRP A  1  32  ? 28.422  0.577   5.601   1.00 10.70 ? 32   TRP A CE2 1 
ATOM   256   C  CE3 . TRP A  1  32  ? 26.715  1.551   4.212   1.00 4.92  ? 32   TRP A CE3 1 
ATOM   257   C  CZ2 . TRP A  1  32  ? 29.111  0.088   4.471   1.00 11.68 ? 32   TRP A CZ2 1 
ATOM   258   C  CZ3 . TRP A  1  32  ? 27.390  1.079   3.103   1.00 5.65  ? 32   TRP A CZ3 1 
ATOM   259   C  CH2 . TRP A  1  32  ? 28.573  0.356   3.235   1.00 10.43 ? 32   TRP A CH2 1 
ATOM   260   N  N   . LEU A  1  33  ? 22.793  2.780   9.060   1.00 3.77  ? 33   LEU A N   1 
ATOM   261   C  CA  . LEU A  1  33  ? 21.729  3.666   9.509   1.00 6.08  ? 33   LEU A CA  1 
ATOM   262   C  C   . LEU A  1  33  ? 20.811  2.892   10.466  1.00 5.53  ? 33   LEU A C   1 
ATOM   263   O  O   . LEU A  1  33  ? 20.685  1.654   10.363  1.00 6.23  ? 33   LEU A O   1 
ATOM   264   C  CB  . LEU A  1  33  ? 20.886  4.242   8.316   1.00 4.74  ? 33   LEU A CB  1 
ATOM   265   C  CG  . LEU A  1  33  ? 21.476  5.387   7.438   1.00 2.59  ? 33   LEU A CG  1 
ATOM   266   C  CD1 . LEU A  1  33  ? 20.489  5.733   6.332   1.00 3.19  ? 33   LEU A CD1 1 
ATOM   267   C  CD2 . LEU A  1  33  ? 21.753  6.641   8.256   1.00 3.00  ? 33   LEU A CD2 1 
ATOM   268   N  N   . PRO A  1  34  ? 20.221  3.572   11.451  1.00 4.98  ? 34   PRO A N   1 
ATOM   269   C  CA  . PRO A  1  34  ? 19.324  2.920   12.403  1.00 6.91  ? 34   PRO A CA  1 
ATOM   270   C  C   . PRO A  1  34  ? 18.161  2.280   11.643  1.00 6.56  ? 34   PRO A C   1 
ATOM   271   O  O   . PRO A  1  34  ? 17.679  2.848   10.629  1.00 6.28  ? 34   PRO A O   1 
ATOM   272   C  CB  . PRO A  1  34  ? 18.877  4.066   13.312  1.00 6.91  ? 34   PRO A CB  1 
ATOM   273   C  CG  . PRO A  1  34  ? 20.042  4.991   13.244  1.00 6.79  ? 34   PRO A CG  1 
ATOM   274   C  CD  . PRO A  1  34  ? 20.395  4.991   11.782  1.00 5.50  ? 34   PRO A CD  1 
ATOM   275   N  N   . ALA A  1  35  ? 17.766  1.075   12.087  1.00 5.51  ? 35   ALA A N   1 
ATOM   276   C  CA  . ALA A  1  35  ? 16.657  0.357   11.464  1.00 3.97  ? 35   ALA A CA  1 
ATOM   277   C  C   . ALA A  1  35  ? 15.319  1.062   11.673  1.00 3.33  ? 35   ALA A C   1 
ATOM   278   O  O   . ALA A  1  35  ? 15.090  1.766   12.684  1.00 2.95  ? 35   ALA A O   1 
ATOM   279   C  CB  . ALA A  1  35  ? 16.567  -1.061  11.981  1.00 2.85  ? 35   ALA A CB  1 
ATOM   280   N  N   . GLU A  1  36  ? 14.443  0.854   10.683  1.00 3.89  ? 36   GLU A N   1 
ATOM   281   C  CA  . GLU A  1  36  ? 13.106  1.442   10.636  1.00 5.54  ? 36   GLU A CA  1 
ATOM   282   C  C   . GLU A  1  36  ? 12.028  0.366   10.544  1.00 3.05  ? 36   GLU A C   1 
ATOM   283   O  O   . GLU A  1  36  ? 11.751  -0.166  9.471   1.00 4.41  ? 36   GLU A O   1 
ATOM   284   C  CB  . GLU A  1  36  ? 13.026  2.413   9.453   1.00 2.51  ? 36   GLU A CB  1 
ATOM   285   C  CG  . GLU A  1  36  ? 14.003  3.566   9.614   1.00 6.76  ? 36   GLU A CG  1 
ATOM   286   C  CD  . GLU A  1  36  ? 13.800  4.714   8.647   1.00 9.13  ? 36   GLU A CD  1 
ATOM   287   O  OE1 . GLU A  1  36  ? 12.795  4.734   7.878   1.00 9.19  ? 36   GLU A OE1 1 
ATOM   288   O  OE2 . GLU A  1  36  ? 14.642  5.612   8.657   1.00 10.04 ? 36   GLU A OE2 1 
ATOM   289   N  N   . TYR A  1  37  ? 11.462  0.064   11.701  1.00 3.48  ? 37   TYR A N   1 
ATOM   290   C  CA  . TYR A  1  37  ? 10.417  -0.933  11.856  1.00 6.14  ? 37   TYR A CA  1 
ATOM   291   C  C   . TYR A  1  37  ? 9.130   -0.256  12.275  1.00 7.21  ? 37   TYR A C   1 
ATOM   292   O  O   . TYR A  1  37  ? 9.155   0.822   12.859  1.00 8.05  ? 37   TYR A O   1 
ATOM   293   C  CB  . TYR A  1  37  ? 10.798  -1.967  12.934  1.00 5.51  ? 37   TYR A CB  1 
ATOM   294   C  CG  . TYR A  1  37  ? 11.934  -2.902  12.553  1.00 8.86  ? 37   TYR A CG  1 
ATOM   295   C  CD1 . TYR A  1  37  ? 11.774  -3.859  11.522  1.00 6.38  ? 37   TYR A CD1 1 
ATOM   296   C  CD2 . TYR A  1  37  ? 13.177  -2.826  13.221  1.00 8.49  ? 37   TYR A CD2 1 
ATOM   297   C  CE1 . TYR A  1  37  ? 12.817  -4.712  11.174  1.00 8.56  ? 37   TYR A CE1 1 
ATOM   298   C  CE2 . TYR A  1  37  ? 14.221  -3.674  12.875  1.00 8.03  ? 37   TYR A CE2 1 
ATOM   299   C  CZ  . TYR A  1  37  ? 14.037  -4.617  11.859  1.00 9.78  ? 37   TYR A CZ  1 
ATOM   300   O  OH  . TYR A  1  37  ? 15.041  -5.496  11.571  1.00 8.76  ? 37   TYR A OH  1 
ATOM   301   N  N   . GLU A  1  38  ? 8.008   -0.939  12.007  1.00 9.18  ? 38   GLU A N   1 
ATOM   302   C  CA  . GLU A  1  38  ? 6.664   -0.428  12.282  1.00 10.44 ? 38   GLU A CA  1 
ATOM   303   C  C   . GLU A  1  38  ? 6.504   -0.025  13.755  1.00 10.92 ? 38   GLU A C   1 
ATOM   304   O  O   . GLU A  1  38  ? 5.955   1.036   14.065  1.00 11.46 ? 38   GLU A O   1 
ATOM   305   C  CB  . GLU A  1  38  ? 5.673   -1.535  11.906  1.00 13.73 ? 38   GLU A CB  1 
ATOM   306   C  CG  . GLU A  1  38  ? 4.210   -1.146  11.804  1.00 11.50 ? 38   GLU A CG  1 
ATOM   307   C  CD  . GLU A  1  38  ? 3.373   -2.353  11.398  1.00 13.10 ? 38   GLU A CD  1 
ATOM   308   O  OE1 . GLU A  1  38  ? 2.917   -2.413  10.222  1.00 7.93  ? 38   GLU A OE1 1 
ATOM   309   O  OE2 . GLU A  1  38  ? 3.201   -3.253  12.248  1.00 10.88 ? 38   GLU A OE2 1 
ATOM   310   N  N   . ASP A  1  39  ? 6.998   -0.882  14.637  1.00 9.18  ? 39   ASP A N   1 
ATOM   311   C  CA  . ASP A  1  39  ? 6.953   -0.686  16.075  1.00 8.22  ? 39   ASP A CA  1 
ATOM   312   C  C   . ASP A  1  39  ? 8.284   -0.157  16.600  1.00 8.64  ? 39   ASP A C   1 
ATOM   313   O  O   . ASP A  1  39  ? 8.509   -0.097  17.794  1.00 9.14  ? 39   ASP A O   1 
ATOM   314   C  CB  . ASP A  1  39  ? 6.650   -2.010  16.752  1.00 9.41  ? 39   ASP A CB  1 
ATOM   315   C  CG  . ASP A  1  39  ? 7.633   -3.139  16.381  1.00 10.70 ? 39   ASP A CG  1 
ATOM   316   O  OD1 . ASP A  1  39  ? 7.411   -4.266  16.861  1.00 6.27  ? 39   ASP A OD1 1 
ATOM   317   O  OD2 . ASP A  1  39  ? 8.626   -2.896  15.609  1.00 9.05  ? 39   ASP A OD2 1 
ATOM   318   N  N   . GLY A  1  40  ? 9.177   0.160   15.695  1.00 10.00 ? 40   GLY A N   1 
ATOM   319   C  CA  . GLY A  1  40  ? 10.461  0.679   16.094  1.00 11.35 ? 40   GLY A CA  1 
ATOM   320   C  C   . GLY A  1  40  ? 11.514  -0.386  16.367  1.00 10.24 ? 40   GLY A C   1 
ATOM   321   O  O   . GLY A  1  40  ? 12.726  -0.061  16.421  1.00 9.34  ? 40   GLY A O   1 
ATOM   322   N  N   . PHE A  1  41  ? 11.114  -1.649  16.532  1.00 7.01  ? 41   PHE A N   1 
ATOM   323   C  CA  . PHE A  1  41  ? 12.150  -2.620  16.835  1.00 9.43  ? 41   PHE A CA  1 
ATOM   324   C  C   . PHE A  1  41  ? 12.023  -3.976  16.167  1.00 9.74  ? 41   PHE A C   1 
ATOM   325   O  O   . PHE A  1  41  ? 12.996  -4.733  16.238  1.00 9.86  ? 41   PHE A O   1 
ATOM   326   C  CB  . PHE A  1  41  ? 12.282  -2.824  18.354  1.00 9.87  ? 41   PHE A CB  1 
ATOM   327   C  CG  . PHE A  1  41  ? 11.021  -3.321  18.969  1.00 11.95 ? 41   PHE A CG  1 
ATOM   328   C  CD1 . PHE A  1  41  ? 10.019  -2.430  19.306  1.00 12.96 ? 41   PHE A CD1 1 
ATOM   329   C  CD2 . PHE A  1  41  ? 10.799  -4.686  19.136  1.00 10.23 ? 41   PHE A CD2 1 
ATOM   330   C  CE1 . PHE A  1  41  ? 8.810   -2.897  19.797  1.00 16.94 ? 41   PHE A CE1 1 
ATOM   331   C  CE2 . PHE A  1  41  ? 9.601   -5.157  19.623  1.00 14.20 ? 41   PHE A CE2 1 
ATOM   332   C  CZ  . PHE A  1  41  ? 8.601   -4.265  19.954  1.00 14.48 ? 41   PHE A CZ  1 
ATOM   333   N  N   . SER A  1  42  ? 10.909  -4.302  15.509  1.00 5.47  ? 42   SER A N   1 
ATOM   334   C  CA  . SER A  1  42  ? 10.810  -5.670  15.004  1.00 8.46  ? 42   SER A CA  1 
ATOM   335   C  C   . SER A  1  42  ? 9.856   -5.892  13.839  1.00 8.76  ? 42   SER A C   1 
ATOM   336   O  O   . SER A  1  42  ? 10.213  -6.562  12.866  1.00 8.78  ? 42   SER A O   1 
ATOM   337   C  CB  . SER A  1  42  ? 10.411  -6.606  16.139  1.00 10.46 ? 42   SER A CB  1 
ATOM   338   O  OG  . SER A  1  42  ? 10.388  -7.939  15.681  1.00 17.77 ? 42   SER A OG  1 
ATOM   339   N  N   . LEU A  1  43  ? 8.635   -5.403  13.961  1.00 6.54  ? 43   LEU A N   1 
ATOM   340   C  CA  . LEU A  1  43  ? 7.632   -5.607  12.908  1.00 8.48  ? 43   LEU A CA  1 
ATOM   341   C  C   . LEU A  1  43  ? 7.922   -4.770  11.671  1.00 5.77  ? 43   LEU A C   1 
ATOM   342   O  O   . LEU A  1  43  ? 8.151   -3.553  11.743  1.00 5.79  ? 43   LEU A O   1 
ATOM   343   C  CB  . LEU A  1  43  ? 6.220   -5.307  13.443  1.00 9.13  ? 43   LEU A CB  1 
ATOM   344   C  CG  . LEU A  1  43  ? 5.718   -6.230  14.570  1.00 10.99 ? 43   LEU A CG  1 
ATOM   345   C  CD1 . LEU A  1  43  ? 4.355   -5.753  15.062  1.00 11.31 ? 43   LEU A CD1 1 
ATOM   346   C  CD2 . LEU A  1  43  ? 5.654   -7.685  14.094  1.00 11.05 ? 43   LEU A CD2 1 
ATOM   347   N  N   . PRO A  1  44  ? 7.927   -5.411  10.513  1.00 5.54  ? 44   PRO A N   1 
ATOM   348   C  CA  . PRO A  1  44  ? 8.200   -4.745  9.229   1.00 7.97  ? 44   PRO A CA  1 
ATOM   349   C  C   . PRO A  1  44  ? 7.051   -3.845  8.753   1.00 5.03  ? 44   PRO A C   1 
ATOM   350   O  O   . PRO A  1  44  ? 5.881   -4.076  9.075   1.00 3.35  ? 44   PRO A O   1 
ATOM   351   C  CB  . PRO A  1  44  ? 8.454   -5.924  8.275   1.00 4.78  ? 44   PRO A CB  1 
ATOM   352   C  CG  . PRO A  1  44  ? 7.536   -6.957  8.818   1.00 4.67  ? 44   PRO A CG  1 
ATOM   353   C  CD  . PRO A  1  44  ? 7.701   -6.858  10.321  1.00 6.35  ? 44   PRO A CD  1 
ATOM   354   N  N   . TYR A  1  45  ? 7.398   -2.794  8.029   1.00 5.65  ? 45   TYR A N   1 
ATOM   355   C  CA  . TYR A  1  45  ? 6.352   -1.970  7.434   1.00 10.08 ? 45   TYR A CA  1 
ATOM   356   C  C   . TYR A  1  45  ? 5.544   -2.850  6.461   1.00 10.21 ? 45   TYR A C   1 
ATOM   357   O  O   . TYR A  1  45  ? 6.115   -3.672  5.718   1.00 7.74  ? 45   TYR A O   1 
ATOM   358   C  CB  . TYR A  1  45  ? 6.932   -0.714  6.754   1.00 8.06  ? 45   TYR A CB  1 
ATOM   359   C  CG  . TYR A  1  45  ? 7.115   0.432   7.745   1.00 8.10  ? 45   TYR A CG  1 
ATOM   360   C  CD1 . TYR A  1  45  ? 8.387   0.911   8.097   1.00 7.75  ? 45   TYR A CD1 1 
ATOM   361   C  CD2 . TYR A  1  45  ? 6.004   0.989   8.388   1.00 8.65  ? 45   TYR A CD2 1 
ATOM   362   C  CE1 . TYR A  1  45  ? 8.522   1.900   9.068   1.00 9.18  ? 45   TYR A CE1 1 
ATOM   363   C  CE2 . TYR A  1  45  ? 6.128   1.965   9.347   1.00 7.85  ? 45   TYR A CE2 1 
ATOM   364   C  CZ  . TYR A  1  45  ? 7.379   2.417   9.699   1.00 10.62 ? 45   TYR A CZ  1 
ATOM   365   O  OH  . TYR A  1  45  ? 7.498   3.296   10.751  1.00 8.53  ? 45   TYR A OH  1 
ATOM   366   N  N   . GLY A  1  46  ? 4.221   -2.735  6.568   1.00 8.66  ? 46   GLY A N   1 
ATOM   367   C  CA  . GLY A  1  46  ? 3.326   -3.588  5.796   1.00 8.00  ? 46   GLY A CA  1 
ATOM   368   C  C   . GLY A  1  46  ? 2.723   -4.719  6.624   1.00 5.30  ? 46   GLY A C   1 
ATOM   369   O  O   . GLY A  1  46  ? 1.868   -5.450  6.150   1.00 5.53  ? 46   GLY A O   1 
ATOM   370   N  N   . TRP A  1  47  ? 3.171   -4.864  7.856   1.00 4.57  ? 47   TRP A N   1 
ATOM   371   C  CA  . TRP A  1  47  ? 2.681   -5.922  8.736   1.00 7.08  ? 47   TRP A CA  1 
ATOM   372   C  C   . TRP A  1  47  ? 1.271   -5.648  9.318   1.00 8.99  ? 47   TRP A C   1 
ATOM   373   O  O   . TRP A  1  47  ? 0.432   -6.545  9.316   1.00 11.49 ? 47   TRP A O   1 
ATOM   374   C  CB  . TRP A  1  47  ? 3.669   -6.142  9.896   1.00 8.35  ? 47   TRP A CB  1 
ATOM   375   C  CG  . TRP A  1  47  ? 3.341   -7.290  10.811  1.00 7.30  ? 47   TRP A CG  1 
ATOM   376   C  CD1 . TRP A  1  47  ? 2.491   -7.275  11.871  1.00 9.11  ? 47   TRP A CD1 1 
ATOM   377   C  CD2 . TRP A  1  47  ? 3.868   -8.626  10.734  1.00 7.40  ? 47   TRP A CD2 1 
ATOM   378   N  NE1 . TRP A  1  47  ? 2.442   -8.520  12.454  1.00 9.03  ? 47   TRP A NE1 1 
ATOM   379   C  CE2 . TRP A  1  47  ? 3.275   -9.367  11.774  1.00 8.29  ? 47   TRP A CE2 1 
ATOM   380   C  CE3 . TRP A  1  47  ? 4.788   -9.273  9.884   1.00 8.32  ? 47   TRP A CE3 1 
ATOM   381   C  CZ2 . TRP A  1  47  ? 3.555   -10.723 11.988  1.00 8.77  ? 47   TRP A CZ2 1 
ATOM   382   C  CZ3 . TRP A  1  47  ? 5.070   -10.617 10.100  1.00 5.89  ? 47   TRP A CZ3 1 
ATOM   383   C  CH2 . TRP A  1  47  ? 4.453   -11.326 11.142  1.00 9.45  ? 47   TRP A CH2 1 
ATOM   384   N  N   . THR A  1  48  ? 1.024   -4.450  9.845   1.00 6.50  ? 48   THR A N   1 
ATOM   385   C  CA  . THR A  1  48  ? -0.263  -4.169  10.475  1.00 7.32  ? 48   THR A CA  1 
ATOM   386   C  C   . THR A  1  48  ? -1.122  -3.348  9.574   1.00 7.27  ? 48   THR A C   1 
ATOM   387   O  O   . THR A  1  48  ? -0.733  -2.274  9.184   1.00 6.42  ? 48   THR A O   1 
ATOM   388   C  CB  . THR A  1  48  ? -0.095  -3.398  11.786  1.00 7.70  ? 48   THR A CB  1 
ATOM   389   O  OG1 . THR A  1  48  ? 0.820   -4.103  12.613  1.00 13.20 ? 48   THR A OG1 1 
ATOM   390   C  CG2 . THR A  1  48  ? -1.410  -3.251  12.522  1.00 6.93  ? 48   THR A CG2 1 
ATOM   391   N  N   . PRO A  1  49  ? -2.301  -3.858  9.213   1.00 11.08 ? 49   PRO A N   1 
ATOM   392   C  CA  . PRO A  1  49  ? -3.262  -3.147  8.338   1.00 13.70 ? 49   PRO A CA  1 
ATOM   393   C  C   . PRO A  1  49  ? -3.605  -1.771  8.909   1.00 13.29 ? 49   PRO A C   1 
ATOM   394   O  O   . PRO A  1  49  ? -3.916  -1.635  10.105  1.00 12.85 ? 49   PRO A O   1 
ATOM   395   C  CB  . PRO A  1  49  ? -4.484  -4.063  8.336   1.00 14.82 ? 49   PRO A CB  1 
ATOM   396   C  CG  . PRO A  1  49  ? -3.860  -5.405  8.525   1.00 16.44 ? 49   PRO A CG  1 
ATOM   397   C  CD  . PRO A  1  49  ? -2.813  -5.182  9.593   1.00 12.20 ? 49   PRO A CD  1 
ATOM   398   N  N   . GLY A  1  50  ? -3.537  -0.764  8.055   1.00 13.51 ? 50   GLY A N   1 
ATOM   399   C  CA  . GLY A  1  50  ? -3.843  0.574   8.485   1.00 14.37 ? 50   GLY A CA  1 
ATOM   400   C  C   . GLY A  1  50  ? -2.647  1.319   9.044   1.00 13.76 ? 50   GLY A C   1 
ATOM   401   O  O   . GLY A  1  50  ? -2.743  2.511   9.346   1.00 14.94 ? 50   GLY A O   1 
ATOM   402   N  N   . VAL A  1  51  ? -1.524  0.648   9.217   1.00 12.63 ? 51   VAL A N   1 
ATOM   403   C  CA  . VAL A  1  51  ? -0.358  1.372   9.713   1.00 10.71 ? 51   VAL A CA  1 
ATOM   404   C  C   . VAL A  1  51  ? 0.432   1.974   8.554   1.00 10.00 ? 51   VAL A C   1 
ATOM   405   O  O   . VAL A  1  51  ? 0.947   1.268   7.679   1.00 10.32 ? 51   VAL A O   1 
ATOM   406   C  CB  . VAL A  1  51  ? 0.551   0.516   10.649  1.00 9.62  ? 51   VAL A CB  1 
ATOM   407   C  CG1 . VAL A  1  51  ? 1.760   1.330   11.083  1.00 10.28 ? 51   VAL A CG1 1 
ATOM   408   C  CG2 . VAL A  1  51  ? -0.228  0.112   11.895  1.00 7.23  ? 51   VAL A CG2 1 
ATOM   409   N  N   . LYS A  1  52  ? 0.438   3.309   8.537   1.00 10.45 ? 52   LYS A N   1 
ATOM   410   C  CA  . LYS A  1  52  ? 1.117   4.110   7.540   1.00 11.08 ? 52   LYS A CA  1 
ATOM   411   C  C   . LYS A  1  52  ? 2.576   4.269   7.874   1.00 11.64 ? 52   LYS A C   1 
ATOM   412   O  O   . LYS A  1  52  ? 2.980   4.143   9.035   1.00 9.28  ? 52   LYS A O   1 
ATOM   413   C  CB  . LYS A  1  52  ? 0.503   5.506   7.458   1.00 10.90 ? 52   LYS A CB  1 
ATOM   414   C  CG  . LYS A  1  52  ? -0.692  5.611   6.530   1.00 15.30 ? 52   LYS A CG  1 
ATOM   415   C  CD  . LYS A  1  52  ? -1.920  4.891   7.062   1.00 16.56 ? 52   LYS A CD  1 
ATOM   416   C  CE  . LYS A  1  52  ? -2.574  5.654   8.206   1.00 18.34 ? 52   LYS A CE  1 
ATOM   417   N  NZ  . LYS A  1  52  ? -3.993  5.225   8.414   1.00 24.92 ? 52   LYS A NZ  1 
ATOM   418   N  N   . ARG A  1  53  ? 3.358   4.512   6.842   1.00 11.28 ? 53   ARG A N   1 
ATOM   419   C  CA  . ARG A  1  53  ? 4.748   4.819   7.022   1.00 10.26 ? 53   ARG A CA  1 
ATOM   420   C  C   . ARG A  1  53  ? 4.968   6.304   6.697   1.00 10.04 ? 53   ARG A C   1 
ATOM   421   O  O   . ARG A  1  53  ? 4.769   6.742   5.534   1.00 7.83  ? 53   ARG A O   1 
ATOM   422   C  CB  . ARG A  1  53  ? 5.619   3.922   6.129   1.00 8.84  ? 53   ARG A CB  1 
ATOM   423   C  CG  . ARG A  1  53  ? 7.113   4.074   6.427   1.00 10.66 ? 53   ARG A CG  1 
ATOM   424   C  CD  . ARG A  1  53  ? 8.021   3.398   5.412   1.00 7.78  ? 53   ARG A CD  1 
ATOM   425   N  NE  . ARG A  1  53  ? 9.406   3.471   5.874   1.00 9.18  ? 53   ARG A NE  1 
ATOM   426   C  CZ  . ARG A  1  53  ? 10.406  2.685   5.484   1.00 10.07 ? 53   ARG A CZ  1 
ATOM   427   N  NH1 . ARG A  1  53  ? 10.204  1.767   4.547   1.00 10.76 ? 53   ARG A NH1 1 
ATOM   428   N  NH2 . ARG A  1  53  ? 11.625  2.836   6.016   1.00 6.72  ? 53   ARG A NH2 1 
ATOM   429   N  N   . ASN A  1  54  ? 5.317   7.085   7.745   1.00 13.27 ? 54   ASN A N   1 
ATOM   430   C  CA  . ASN A  1  54  ? 5.632   8.510   7.597   1.00 14.72 ? 54   ASN A CA  1 
ATOM   431   C  C   . ASN A  1  54  ? 4.529   9.221   6.778   1.00 13.08 ? 54   ASN A C   1 
ATOM   432   O  O   . ASN A  1  54  ? 4.803   9.912   5.796   1.00 12.50 ? 54   ASN A O   1 
ATOM   433   C  CB  . ASN A  1  54  ? 7.023   8.623   6.910   1.00 20.87 ? 54   ASN A CB  1 
ATOM   434   C  CG  . ASN A  1  54  ? 7.701   10.006  6.913   1.00 26.19 ? 54   ASN A CG  1 
ATOM   435   O  OD1 . ASN A  1  54  ? 8.867   10.135  6.500   1.00 29.33 ? 54   ASN A OD1 1 
ATOM   436   N  ND2 . ASN A  1  54  ? 6.998   11.044  7.373   1.00 27.42 ? 54   ASN A ND2 1 
ATOM   437   N  N   . GLY A  1  55  ? 3.275   8.970   7.140   1.00 11.10 ? 55   GLY A N   1 
ATOM   438   C  CA  . GLY A  1  55  ? 2.165   9.691   6.516   1.00 11.72 ? 55   GLY A CA  1 
ATOM   439   C  C   . GLY A  1  55  ? 1.476   9.045   5.310   1.00 10.81 ? 55   GLY A C   1 
ATOM   440   O  O   . GLY A  1  55  ? 0.438   9.537   4.879   1.00 7.50  ? 55   GLY A O   1 
ATOM   441   N  N   . PHE A  1  56  ? 2.035   7.960   4.754   1.00 7.94  ? 56   PHE A N   1 
ATOM   442   C  CA  . PHE A  1  56  ? 1.437   7.339   3.574   1.00 6.48  ? 56   PHE A CA  1 
ATOM   443   C  C   . PHE A  1  56  ? 1.298   5.859   3.745   1.00 8.77  ? 56   PHE A C   1 
ATOM   444   O  O   . PHE A  1  56  ? 1.998   5.250   4.549   1.00 10.06 ? 56   PHE A O   1 
ATOM   445   C  CB  . PHE A  1  56  ? 2.292   7.609   2.333   1.00 6.96  ? 56   PHE A CB  1 
ATOM   446   C  CG  . PHE A  1  56  ? 2.421   9.079   1.986   1.00 9.10  ? 56   PHE A CG  1 
ATOM   447   C  CD1 . PHE A  1  56  ? 1.547   9.663   1.068   1.00 7.51  ? 56   PHE A CD1 1 
ATOM   448   C  CD2 . PHE A  1  56  ? 3.356   9.892   2.626   1.00 4.71  ? 56   PHE A CD2 1 
ATOM   449   C  CE1 . PHE A  1  56  ? 1.596   11.028  0.803   1.00 9.91  ? 56   PHE A CE1 1 
ATOM   450   C  CE2 . PHE A  1  56  ? 3.410   11.258  2.370   1.00 9.57  ? 56   PHE A CE2 1 
ATOM   451   C  CZ  . PHE A  1  56  ? 2.526   11.826  1.459   1.00 8.68  ? 56   PHE A CZ  1 
ATOM   452   N  N   . PRO A  1  57  ? 0.356   5.239   3.038   1.00 8.86  ? 57   PRO A N   1 
ATOM   453   C  CA  . PRO A  1  57  ? 0.186   3.806   3.121   1.00 8.55  ? 57   PRO A CA  1 
ATOM   454   C  C   . PRO A  1  57  ? 1.414   3.088   2.555   1.00 5.66  ? 57   PRO A C   1 
ATOM   455   O  O   . PRO A  1  57  ? 2.091   3.604   1.662   1.00 4.17  ? 57   PRO A O   1 
ATOM   456   C  CB  . PRO A  1  57  ? -1.096  3.534   2.310   1.00 10.04 ? 57   PRO A CB  1 
ATOM   457   C  CG  . PRO A  1  57  ? -1.174  4.687   1.368   1.00 13.02 ? 57   PRO A CG  1 
ATOM   458   C  CD  . PRO A  1  57  ? -0.678  5.866   2.170   1.00 12.41 ? 57   PRO A CD  1 
ATOM   459   N  N   . VAL A  1  58  ? 1.709   1.930   3.112   1.00 5.19  ? 58   VAL A N   1 
ATOM   460   C  CA  . VAL A  1  58  ? 2.787   1.095   2.634   1.00 5.48  ? 58   VAL A CA  1 
ATOM   461   C  C   . VAL A  1  58  ? 2.375   0.484   1.312   1.00 5.09  ? 58   VAL A C   1 
ATOM   462   O  O   . VAL A  1  58  ? 1.351   -0.182  1.253   1.00 4.49  ? 58   VAL A O   1 
ATOM   463   C  CB  . VAL A  1  58  ? 3.130   -0.025  3.678   1.00 6.65  ? 58   VAL A CB  1 
ATOM   464   C  CG1 . VAL A  1  58  ? 4.180   -1.003  3.132   1.00 4.84  ? 58   VAL A CG1 1 
ATOM   465   C  CG2 . VAL A  1  58  ? 3.622   0.626   4.974   1.00 5.12  ? 58   VAL A CG2 1 
ATOM   466   N  N   . ALA A  1  59  ? 3.150   0.776   0.255   1.00 3.64  ? 59   ALA A N   1 
ATOM   467   C  CA  . ALA A  1  59  ? 2.887   0.268   -1.077  1.00 4.82  ? 59   ALA A CA  1 
ATOM   468   C  C   . ALA A  1  59  ? 3.195   -1.227  -1.146  1.00 7.32  ? 59   ALA A C   1 
ATOM   469   O  O   . ALA A  1  59  ? 4.278   -1.648  -0.739  1.00 5.66  ? 59   ALA A O   1 
ATOM   470   C  CB  . ALA A  1  59  ? 3.731   1.008   -2.107  1.00 2.66  ? 59   ALA A CB  1 
ATOM   471   N  N   . LEU A  1  60  ? 2.234   -2.033  -1.640  1.00 5.39  ? 60   LEU A N   1 
ATOM   472   C  CA  . LEU A  1  60  ? 2.483   -3.461  -1.792  1.00 4.27  ? 60   LEU A CA  1 
ATOM   473   C  C   . LEU A  1  60  ? 3.698   -3.664  -2.681  1.00 5.43  ? 60   LEU A C   1 
ATOM   474   O  O   . LEU A  1  60  ? 3.786   -3.049  -3.746  1.00 5.40  ? 60   LEU A O   1 
ATOM   475   C  CB  . LEU A  1  60  ? 1.244   -4.166  -2.389  1.00 4.65  ? 60   LEU A CB  1 
ATOM   476   C  CG  . LEU A  1  60  ? 0.200   -4.686  -1.382  1.00 5.98  ? 60   LEU A CG  1 
ATOM   477   C  CD1 . LEU A  1  60  ? -0.270  -3.571  -0.471  1.00 9.07  ? 60   LEU A CD1 1 
ATOM   478   C  CD2 . LEU A  1  60  ? -0.977  -5.318  -2.124  1.00 5.35  ? 60   LEU A CD2 1 
ATOM   479   N  N   . ALA A  1  61  ? 4.672   -4.491  -2.214  1.00 3.40  ? 61   ALA A N   1 
ATOM   480   C  CA  . ALA A  1  61  ? 5.874   -4.766  -3.011  1.00 4.29  ? 61   ALA A CA  1 
ATOM   481   C  C   . ALA A  1  61  ? 5.486   -5.254  -4.395  1.00 4.14  ? 61   ALA A C   1 
ATOM   482   O  O   . ALA A  1  61  ? 6.105   -4.880  -5.391  1.00 5.16  ? 61   ALA A O   1 
ATOM   483   C  CB  . ALA A  1  61  ? 6.754   -5.822  -2.330  1.00 2.46  ? 61   ALA A CB  1 
ATOM   484   N  N   . ARG A  1  62  ? 4.461   -6.104  -4.439  1.00 4.61  ? 62   ARG A N   1 
ATOM   485   C  CA  . ARG A  1  62  ? 3.980   -6.648  -5.695  1.00 4.22  ? 62   ARG A CA  1 
ATOM   486   C  C   . ARG A  1  62  ? 3.320   -5.547  -6.573  1.00 4.76  ? 62   ARG A C   1 
ATOM   487   O  O   . ARG A  1  62  ? 3.488   -5.537  -7.797  1.00 5.56  ? 62   ARG A O   1 
ATOM   488   C  CB  . ARG A  1  62  ? 3.019   -7.808  -5.401  1.00 5.67  ? 62   ARG A CB  1 
ATOM   489   C  CG  . ARG A  1  62  ? 2.339   -8.441  -6.619  1.00 8.16  ? 62   ARG A CG  1 
ATOM   490   C  CD  . ARG A  1  62  ? 3.316   -9.038  -7.629  1.00 5.90  ? 62   ARG A CD  1 
ATOM   491   N  NE  . ARG A  1  62  ? 2.572   -9.727  -8.686  1.00 8.61  ? 62   ARG A NE  1 
ATOM   492   C  CZ  . ARG A  1  62  ? 3.106   -10.331 -9.738  1.00 11.79 ? 62   ARG A CZ  1 
ATOM   493   N  NH1 . ARG A  1  62  ? 4.436   -10.360 -9.894  1.00 12.28 ? 62   ARG A NH1 1 
ATOM   494   N  NH2 . ARG A  1  62  ? 2.321   -10.913 -10.637 1.00 8.25  ? 62   ARG A NH2 1 
ATOM   495   N  N   . ALA A  1  63  ? 2.592   -4.631  -5.972  1.00 3.56  ? 63   ALA A N   1 
ATOM   496   C  CA  . ALA A  1  63  ? 2.028   -3.534  -6.756  1.00 5.77  ? 63   ALA A CA  1 
ATOM   497   C  C   . ALA A  1  63  ? 3.160   -2.677  -7.416  1.00 6.13  ? 63   ALA A C   1 
ATOM   498   O  O   . ALA A  1  63  ? 3.083   -2.327  -8.595  1.00 4.28  ? 63   ALA A O   1 
ATOM   499   C  CB  . ALA A  1  63  ? 1.135   -2.684  -5.863  1.00 4.67  ? 63   ALA A CB  1 
ATOM   500   N  N   . VAL A  1  64  ? 4.222   -2.361  -6.638  1.00 6.65  ? 64   VAL A N   1 
ATOM   501   C  CA  . VAL A  1  64  ? 5.366   -1.579  -7.130  1.00 4.38  ? 64   VAL A CA  1 
ATOM   502   C  C   . VAL A  1  64  ? 6.012   -2.294  -8.307  1.00 3.98  ? 64   VAL A C   1 
ATOM   503   O  O   . VAL A  1  64  ? 6.258   -1.716  -9.364  1.00 4.87  ? 64   VAL A O   1 
ATOM   504   C  CB  . VAL A  1  64  ? 6.393   -1.370  -6.002  1.00 2.16  ? 64   VAL A CB  1 
ATOM   505   C  CG1 . VAL A  1  64  ? 7.593   -0.593  -6.508  1.00 5.08  ? 64   VAL A CG1 1 
ATOM   506   C  CG2 . VAL A  1  64  ? 5.738   -0.612  -4.872  1.00 2.91  ? 64   VAL A CG2 1 
ATOM   507   N  N   . SER A  1  65  ? 6.249   -3.574  -8.128  1.00 4.61  ? 65   SER A N   1 
ATOM   508   C  CA  . SER A  1  65  ? 6.804   -4.395  -9.173  1.00 5.07  ? 65   SER A CA  1 
ATOM   509   C  C   . SER A  1  65  ? 5.936   -4.345  -10.446 1.00 5.76  ? 65   SER A C   1 
ATOM   510   O  O   . SER A  1  65  ? 6.437   -4.106  -11.555 1.00 4.29  ? 65   SER A O   1 
ATOM   511   C  CB  . SER A  1  65  ? 6.898   -5.822  -8.667  1.00 3.01  ? 65   SER A CB  1 
ATOM   512   O  OG  . SER A  1  65  ? 7.413   -6.647  -9.687  1.00 6.70  ? 65   SER A OG  1 
ATOM   513   N  N   . ASN A  1  66  ? 4.621   -4.558  -10.278 1.00 5.62  ? 66   ASN A N   1 
ATOM   514   C  CA  . ASN A  1  66  ? 3.700   -4.558  -11.429 1.00 7.10  ? 66   ASN A CA  1 
ATOM   515   C  C   . ASN A  1  66  ? 3.630   -3.199  -12.153 1.00 7.20  ? 66   ASN A C   1 
ATOM   516   O  O   . ASN A  1  66  ? 3.522   -3.159  -13.373 1.00 7.41  ? 66   ASN A O   1 
ATOM   517   C  CB  . ASN A  1  66  ? 2.275   -4.948  -10.995 1.00 5.01  ? 66   ASN A CB  1 
ATOM   518   C  CG  . ASN A  1  66  ? 2.095   -6.390  -10.541 1.00 4.46  ? 66   ASN A CG  1 
ATOM   519   O  OD1 . ASN A  1  66  ? 2.838   -7.291  -10.903 1.00 3.05  ? 66   ASN A OD1 1 
ATOM   520   N  ND2 . ASN A  1  66  ? 1.055   -6.608  -9.742  1.00 7.40  ? 66   ASN A ND2 1 
ATOM   521   N  N   . GLU A  1  67  ? 3.692   -2.093  -11.405 1.00 7.81  ? 67   GLU A N   1 
ATOM   522   C  CA  . GLU A  1  67  ? 3.521   -0.757  -11.996 1.00 9.38  ? 67   GLU A CA  1 
ATOM   523   C  C   . GLU A  1  67  ? 4.815   -0.088  -12.432 1.00 9.34  ? 67   GLU A C   1 
ATOM   524   O  O   . GLU A  1  67  ? 4.809   0.762   -13.329 1.00 8.87  ? 67   GLU A O   1 
ATOM   525   C  CB  . GLU A  1  67  ? 2.800   0.165   -11.016 1.00 12.24 ? 67   GLU A CB  1 
ATOM   526   C  CG  . GLU A  1  67  ? 1.361   -0.241  -10.768 1.00 18.53 ? 67   GLU A CG  1 
ATOM   527   C  CD  . GLU A  1  67  ? 0.613   -0.512  -12.067 1.00 23.36 ? 67   GLU A CD  1 
ATOM   528   O  OE1 . GLU A  1  67  ? -0.106  -1.529  -12.132 1.00 27.98 ? 67   GLU A OE1 1 
ATOM   529   O  OE2 . GLU A  1  67  ? 0.752   0.282   -13.024 1.00 28.08 ? 67   GLU A OE2 1 
ATOM   530   N  N   . ILE A  1  68  ? 5.918   -0.451  -11.799 1.00 7.82  ? 68   ILE A N   1 
ATOM   531   C  CA  . ILE A  1  68  ? 7.186   0.190   -12.112 1.00 5.66  ? 68   ILE A CA  1 
ATOM   532   C  C   . ILE A  1  68  ? 8.133   -0.728  -12.837 1.00 5.43  ? 68   ILE A C   1 
ATOM   533   O  O   . ILE A  1  68  ? 8.756   -0.309  -13.796 1.00 9.26  ? 68   ILE A O   1 
ATOM   534   C  CB  . ILE A  1  68  ? 7.871   0.687   -10.831 1.00 7.55  ? 68   ILE A CB  1 
ATOM   535   C  CG1 . ILE A  1  68  ? 6.922   1.648   -10.105 1.00 12.40 ? 68   ILE A CG1 1 
ATOM   536   C  CG2 . ILE A  1  68  ? 9.179   1.386   -11.166 1.00 5.68  ? 68   ILE A CG2 1 
ATOM   537   C  CD1 . ILE A  1  68  ? 7.383   2.030   -8.719  1.00 18.04 ? 68   ILE A CD1 1 
ATOM   538   N  N   . VAL A  1  69  ? 8.223   -1.985  -12.402 1.00 6.86  ? 69   VAL A N   1 
ATOM   539   C  CA  . VAL A  1  69  ? 9.238   -2.916  -12.931 1.00 6.95  ? 69   VAL A CA  1 
ATOM   540   C  C   . VAL A  1  69  ? 8.832   -3.661  -14.213 1.00 8.08  ? 69   VAL A C   1 
ATOM   541   O  O   . VAL A  1  69  ? 9.636   -3.789  -15.157 1.00 5.67  ? 69   VAL A O   1 
ATOM   542   C  CB  . VAL A  1  69  ? 9.635   -3.948  -11.859 1.00 5.73  ? 69   VAL A CB  1 
ATOM   543   C  CG1 . VAL A  1  69  ? 10.817  -4.768  -12.351 1.00 3.83  ? 69   VAL A CG1 1 
ATOM   544   C  CG2 . VAL A  1  69  ? 9.977   -3.235  -10.553 1.00 4.99  ? 69   VAL A CG2 1 
ATOM   545   N  N   . ARG A  1  70  ? 7.582   -4.138  -14.256 1.00 9.11  ? 70   ARG A N   1 
ATOM   546   C  CA  . ARG A  1  70  ? 7.077   -4.866  -15.415 1.00 7.81  ? 70   ARG A CA  1 
ATOM   547   C  C   . ARG A  1  70  ? 7.305   -4.118  -16.760 1.00 7.52  ? 70   ARG A C   1 
ATOM   548   O  O   . ARG A  1  70  ? 7.125   -2.899  -16.887 1.00 7.99  ? 70   ARG A O   1 
ATOM   549   C  CB  . ARG A  1  70  ? 5.599   -5.140  -15.196 1.00 9.75  ? 70   ARG A CB  1 
ATOM   550   C  CG  . ARG A  1  70  ? 4.911   -5.932  -16.289 1.00 13.01 ? 70   ARG A CG  1 
ATOM   551   C  CD  . ARG A  1  70  ? 3.401   -5.885  -16.059 1.00 19.71 ? 70   ARG A CD  1 
ATOM   552   N  NE  . ARG A  1  70  ? 2.650   -6.750  -16.974 1.00 27.88 ? 70   ARG A NE  1 
ATOM   553   C  CZ  . ARG A  1  70  ? 1.326   -6.674  -17.201 1.00 28.82 ? 70   ARG A CZ  1 
ATOM   554   N  NH1 . ARG A  1  70  ? 0.596   -5.767  -16.568 1.00 31.01 ? 70   ARG A NH1 1 
ATOM   555   N  NH2 . ARG A  1  70  ? 0.739   -7.510  -18.056 1.00 27.08 ? 70   ARG A NH2 1 
ATOM   556   N  N   . PHE A  1  71  ? 7.742   -4.854  -17.747 1.00 5.56  ? 71   PHE A N   1 
ATOM   557   C  CA  . PHE A  1  71  ? 7.916   -4.312  -19.075 1.00 7.22  ? 71   PHE A CA  1 
ATOM   558   C  C   . PHE A  1  71  ? 7.843   -5.443  -20.095 1.00 7.03  ? 71   PHE A C   1 
ATOM   559   O  O   . PHE A  1  71  ? 8.014   -6.619  -19.733 1.00 7.92  ? 71   PHE A O   1 
ATOM   560   C  CB  . PHE A  1  71  ? 9.248   -3.528  -19.201 1.00 6.10  ? 71   PHE A CB  1 
ATOM   561   C  CG  . PHE A  1  71  ? 10.490  -4.354  -19.401 1.00 4.24  ? 71   PHE A CG  1 
ATOM   562   C  CD1 . PHE A  1  71  ? 11.163  -4.892  -18.329 1.00 5.50  ? 71   PHE A CD1 1 
ATOM   563   C  CD2 . PHE A  1  71  ? 10.981  -4.565  -20.682 1.00 5.00  ? 71   PHE A CD2 1 
ATOM   564   C  CE1 . PHE A  1  71  ? 12.330  -5.638  -18.536 1.00 6.73  ? 71   PHE A CE1 1 
ATOM   565   C  CE2 . PHE A  1  71  ? 12.133  -5.304  -20.909 1.00 6.28  ? 71   PHE A CE2 1 
ATOM   566   C  CZ  . PHE A  1  71  ? 12.811  -5.840  -19.837 1.00 8.60  ? 71   PHE A CZ  1 
ATOM   567   N  N   . PRO A  1  72  ? 7.553   -5.108  -21.372 1.00 8.42  ? 72   PRO A N   1 
ATOM   568   C  CA  . PRO A  1  72  ? 7.443   -6.082  -22.478 1.00 11.54 ? 72   PRO A CA  1 
ATOM   569   C  C   . PRO A  1  72  ? 8.776   -6.721  -22.824 1.00 10.88 ? 72   PRO A C   1 
ATOM   570   O  O   . PRO A  1  72  ? 9.671   -6.042  -23.297 1.00 12.49 ? 72   PRO A O   1 
ATOM   571   C  CB  . PRO A  1  72  ? 6.914   -5.243  -23.649 1.00 10.20 ? 72   PRO A CB  1 
ATOM   572   C  CG  . PRO A  1  72  ? 6.278   -4.092  -22.959 1.00 8.16  ? 72   PRO A CG  1 
ATOM   573   C  CD  . PRO A  1  72  ? 7.241   -3.761  -21.864 1.00 6.68  ? 72   PRO A CD  1 
ATOM   574   N  N   . THR A  1  73  ? 8.877   -8.038  -22.623 1.00 11.58 ? 73   THR A N   1 
ATOM   575   C  CA  . THR A  1  73  ? 10.122  -8.798  -22.875 1.00 13.74 ? 73   THR A CA  1 
ATOM   576   C  C   . THR A  1  73  ? 10.751  -8.529  -24.259 1.00 14.53 ? 73   THR A C   1 
ATOM   577   O  O   . THR A  1  73  ? 11.973  -8.571  -24.400 1.00 15.54 ? 73   THR A O   1 
ATOM   578   C  CB  . THR A  1  73  ? 9.881   -10.321 -22.706 1.00 11.64 ? 73   THR A CB  1 
ATOM   579   O  OG1 . THR A  1  73  ? 9.369   -10.548 -21.394 1.00 12.22 ? 73   THR A OG1 1 
ATOM   580   C  CG2 . THR A  1  73  ? 11.158  -11.130 -22.893 1.00 11.94 ? 73   THR A CG2 1 
ATOM   581   N  N   . ASP A  1  74  ? 9.951   -8.248  -25.283 1.00 12.57 ? 74   ASP A N   1 
ATOM   582   C  CA  . ASP A  1  74  ? 10.572  -7.993  -26.578 1.00 12.82 ? 74   ASP A CA  1 
ATOM   583   C  C   . ASP A  1  74  ? 11.185  -6.584  -26.675 1.00 11.40 ? 74   ASP A C   1 
ATOM   584   O  O   . ASP A  1  74  ? 11.755  -6.232  -27.698 1.00 13.39 ? 74   ASP A O   1 
ATOM   585   C  CB  . ASP A  1  74  ? 9.589   -8.275  -27.747 1.00 16.21 ? 74   ASP A CB  1 
ATOM   586   C  CG  . ASP A  1  74  ? 8.366   -7.383  -27.820 1.00 16.28 ? 74   ASP A CG  1 
ATOM   587   O  OD1 . ASP A  1  74  ? 7.507   -7.641  -28.695 1.00 16.92 ? 74   ASP A OD1 1 
ATOM   588   O  OD2 . ASP A  1  74  ? 8.266   -6.430  -27.021 1.00 17.47 ? 74   ASP A OD2 1 
ATOM   589   N  N   . GLN A  1  75  ? 11.077  -5.790  -25.595 1.00 12.17 ? 75   GLN A N   1 
ATOM   590   C  CA  . GLN A  1  75  ? 11.690  -4.449  -25.528 1.00 12.90 ? 75   GLN A CA  1 
ATOM   591   C  C   . GLN A  1  75  ? 13.080  -4.516  -24.909 1.00 11.62 ? 75   GLN A C   1 
ATOM   592   O  O   . GLN A  1  75  ? 13.819  -3.535  -24.926 1.00 11.13 ? 75   GLN A O   1 
ATOM   593   C  CB  . GLN A  1  75  ? 10.838  -3.488  -24.681 1.00 15.64 ? 75   GLN A CB  1 
ATOM   594   C  CG  . GLN A  1  75  ? 9.468   -3.148  -25.268 1.00 17.05 ? 75   GLN A CG  1 
ATOM   595   C  CD  . GLN A  1  75  ? 9.585   -2.264  -26.472 1.00 18.09 ? 75   GLN A CD  1 
ATOM   596   O  OE1 . GLN A  1  75  ? 10.498  -1.435  -26.566 1.00 21.75 ? 75   GLN A OE1 1 
ATOM   597   N  NE2 . GLN A  1  75  ? 8.674   -2.433  -27.409 1.00 22.25 ? 75   GLN A NE2 1 
ATOM   598   N  N   . LEU A  1  76  ? 13.426  -5.685  -24.370 1.00 12.83 ? 76   LEU A N   1 
ATOM   599   C  CA  . LEU A  1  76  ? 14.728  -5.909  -23.708 1.00 11.53 ? 76   LEU A CA  1 
ATOM   600   C  C   . LEU A  1  76  ? 15.872  -5.354  -24.555 1.00 10.35 ? 76   LEU A C   1 
ATOM   601   O  O   . LEU A  1  76  ? 15.987  -5.619  -25.751 1.00 10.40 ? 76   LEU A O   1 
ATOM   602   C  CB  . LEU A  1  76  ? 14.919  -7.416  -23.455 1.00 10.62 ? 76   LEU A CB  1 
ATOM   603   C  CG  . LEU A  1  76  ? 16.087  -7.844  -22.555 1.00 13.70 ? 76   LEU A CG  1 
ATOM   604   C  CD1 . LEU A  1  76  ? 15.804  -9.203  -21.955 1.00 11.63 ? 76   LEU A CD1 1 
ATOM   605   C  CD2 . LEU A  1  76  ? 17.393  -7.884  -23.350 1.00 15.51 ? 76   LEU A CD2 1 
ATOM   606   N  N   . THR A  1  77  ? 16.708  -4.569  -23.942 1.00 11.66 ? 77   THR A N   1 
ATOM   607   C  CA  . THR A  1  77  ? 17.813  -3.944  -24.651 1.00 10.76 ? 77   THR A CA  1 
ATOM   608   C  C   . THR A  1  77  ? 19.109  -4.623  -24.278 1.00 9.83  ? 77   THR A C   1 
ATOM   609   O  O   . THR A  1  77  ? 19.482  -4.610  -23.108 1.00 6.27  ? 77   THR A O   1 
ATOM   610   C  CB  . THR A  1  77  ? 17.929  -2.436  -24.285 1.00 11.03 ? 77   THR A CB  1 
ATOM   611   O  OG1 . THR A  1  77  ? 16.688  -1.769  -24.589 1.00 10.45 ? 77   THR A OG1 1 
ATOM   612   C  CG2 . THR A  1  77  ? 19.097  -1.776  -25.028 1.00 10.00 ? 77   THR A CG2 1 
ATOM   613   N  N   . PRO A  1  78  ? 19.791  -5.257  -25.250 1.00 9.87  ? 78   PRO A N   1 
ATOM   614   C  CA  . PRO A  1  78  ? 21.064  -5.916  -25.003 1.00 11.32 ? 78   PRO A CA  1 
ATOM   615   C  C   . PRO A  1  78  ? 22.096  -4.845  -24.666 1.00 11.01 ? 78   PRO A C   1 
ATOM   616   O  O   . PRO A  1  78  ? 22.091  -3.764  -25.270 1.00 8.79  ? 78   PRO A O   1 
ATOM   617   C  CB  . PRO A  1  78  ? 21.407  -6.611  -26.336 1.00 10.67 ? 78   PRO A CB  1 
ATOM   618   C  CG  . PRO A  1  78  ? 20.095  -6.690  -27.038 1.00 12.46 ? 78   PRO A CG  1 
ATOM   619   C  CD  . PRO A  1  78  ? 19.385  -5.422  -26.659 1.00 11.32 ? 78   PRO A CD  1 
ATOM   620   N  N   . ASP A  1  79  ? 22.939  -5.135  -23.669 1.00 11.62 ? 79   ASP A N   1 
ATOM   621   C  CA  . ASP A  1  79  ? 24.026  -4.225  -23.314 1.00 11.06 ? 79   ASP A CA  1 
ATOM   622   C  C   . ASP A  1  79  ? 25.158  -4.446  -24.286 1.00 11.53 ? 79   ASP A C   1 
ATOM   623   O  O   . ASP A  1  79  ? 25.806  -5.478  -24.269 1.00 13.64 ? 79   ASP A O   1 
ATOM   624   C  CB  . ASP A  1  79  ? 24.530  -4.475  -21.886 1.00 7.83  ? 79   ASP A CB  1 
ATOM   625   C  CG  . ASP A  1  79  ? 25.399  -3.338  -21.370 1.00 5.57  ? 79   ASP A CG  1 
ATOM   626   O  OD1 . ASP A  1  79  ? 25.421  -3.127  -20.156 1.00 8.30  ? 79   ASP A OD1 1 
ATOM   627   O  OD2 . ASP A  1  79  ? 26.047  -2.651  -22.165 1.00 6.28  ? 79   ASP A OD2 1 
ATOM   628   N  N   . GLN A  1  80  ? 25.382  -3.491  -25.147 1.00 12.39 ? 80   GLN A N   1 
ATOM   629   C  CA  . GLN A  1  80  ? 26.440  -3.632  -26.118 1.00 14.65 ? 80   GLN A CA  1 
ATOM   630   C  C   . GLN A  1  80  ? 27.842  -3.676  -25.501 1.00 12.82 ? 80   GLN A C   1 
ATOM   631   O  O   . GLN A  1  80  ? 28.755  -4.209  -26.128 1.00 10.38 ? 80   GLN A O   1 
ATOM   632   C  CB  . GLN A  1  80  ? 26.315  -2.531  -27.158 1.00 17.79 ? 80   GLN A CB  1 
ATOM   633   C  CG  . GLN A  1  80  ? 25.069  -2.749  -28.015 1.00 24.98 ? 80   GLN A CG  1 
ATOM   634   C  CD  . GLN A  1  80  ? 24.851  -1.652  -29.014 1.00 30.02 ? 80   GLN A CD  1 
ATOM   635   O  OE1 . GLN A  1  80  ? 25.821  -1.051  -29.494 1.00 33.15 ? 80   GLN A OE1 1 
ATOM   636   N  NE2 . GLN A  1  80  ? 23.576  -1.372  -29.335 1.00 31.68 ? 80   GLN A NE2 1 
ATOM   637   N  N   . GLU A  1  81  ? 27.988  -3.176  -24.253 1.00 11.14 ? 81   GLU A N   1 
ATOM   638   C  CA  . GLU A  1  81  ? 29.306  -3.133  -23.605 1.00 9.73  ? 81   GLU A CA  1 
ATOM   639   C  C   . GLU A  1  81  ? 29.421  -3.998  -22.359 1.00 8.69  ? 81   GLU A C   1 
ATOM   640   O  O   . GLU A  1  81  ? 30.343  -3.799  -21.572 1.00 7.15  ? 81   GLU A O   1 
ATOM   641   C  CB  . GLU A  1  81  ? 29.745  -1.684  -23.294 1.00 10.46 ? 81   GLU A CB  1 
ATOM   642   C  CG  . GLU A  1  81  ? 30.109  -0.853  -24.528 1.00 16.93 ? 81   GLU A CG  1 
ATOM   643   C  CD  . GLU A  1  81  ? 31.089  -1.543  -25.506 1.00 18.99 ? 81   GLU A CD  1 
ATOM   644   O  OE1 . GLU A  1  81  ? 32.029  -2.244  -25.059 1.00 19.44 ? 81   GLU A OE1 1 
ATOM   645   O  OE2 . GLU A  1  81  ? 30.910  -1.368  -26.734 1.00 21.13 ? 81   GLU A OE2 1 
ATOM   646   N  N   . ARG A  1  82  ? 28.481  -4.945  -22.168 1.00 7.27  ? 82   ARG A N   1 
ATOM   647   C  CA  . ARG A  1  82  ? 28.590  -5.922  -21.078 1.00 8.71  ? 82   ARG A CA  1 
ATOM   648   C  C   . ARG A  1  82  ? 28.164  -7.348  -21.534 1.00 10.00 ? 82   ARG A C   1 
ATOM   649   O  O   . ARG A  1  82  ? 27.190  -7.559  -22.292 1.00 7.61  ? 82   ARG A O   1 
ATOM   650   C  CB  . ARG A  1  82  ? 27.789  -5.532  -19.789 1.00 7.62  ? 82   ARG A CB  1 
ATOM   651   C  CG  . ARG A  1  82  ? 28.162  -4.209  -19.072 1.00 6.40  ? 82   ARG A CG  1 
ATOM   652   C  CD  . ARG A  1  82  ? 29.544  -4.193  -18.392 1.00 4.65  ? 82   ARG A CD  1 
ATOM   653   N  NE  . ARG A  1  82  ? 29.766  -2.915  -17.651 1.00 5.18  ? 82   ARG A NE  1 
ATOM   654   C  CZ  . ARG A  1  82  ? 30.245  -1.777  -18.204 1.00 2.00  ? 82   ARG A CZ  1 
ATOM   655   N  NH1 . ARG A  1  82  ? 30.622  -1.768  -19.455 1.00 6.65  ? 82   ARG A NH1 1 
ATOM   656   N  NH2 . ARG A  1  82  ? 30.367  -0.675  -17.496 1.00 4.90  ? 82   ARG A NH2 1 
ATOM   657   N  N   . SER A  1  83  ? 28.937  -8.322  -21.079 1.00 10.18 ? 83   SER A N   1 
ATOM   658   C  CA  . SER A  1  83  ? 28.665  -9.735  -21.313 1.00 9.06  ? 83   SER A CA  1 
ATOM   659   C  C   . SER A  1  83  ? 27.791  -10.237 -20.194 1.00 6.66  ? 83   SER A C   1 
ATOM   660   O  O   . SER A  1  83  ? 27.755  -9.646  -19.125 1.00 4.97  ? 83   SER A O   1 
ATOM   661   C  CB  . SER A  1  83  ? 29.987  -10.543 -21.301 1.00 9.36  ? 83   SER A CB  1 
ATOM   662   O  OG  . SER A  1  83  ? 30.642  -10.418 -20.036 1.00 2.00  ? 83   SER A OG  1 
ATOM   663   N  N   . LEU A  1  84  ? 27.100  -11.325 -20.439 1.00 6.98  ? 84   LEU A N   1 
ATOM   664   C  CA  . LEU A  1  84  ? 26.292  -11.963 -19.410 1.00 5.78  ? 84   LEU A CA  1 
ATOM   665   C  C   . LEU A  1  84  ? 27.209  -12.436 -18.233 1.00 4.70  ? 84   LEU A C   1 
ATOM   666   O  O   . LEU A  1  84  ? 26.756  -12.617 -17.102 1.00 2.00  ? 84   LEU A O   1 
ATOM   667   C  CB  . LEU A  1  84  ? 25.535  -13.132 -20.059 1.00 7.92  ? 84   LEU A CB  1 
ATOM   668   C  CG  . LEU A  1  84  ? 24.207  -13.577 -19.434 1.00 9.20  ? 84   LEU A CG  1 
ATOM   669   C  CD1 . LEU A  1  84  ? 23.469  -12.393 -18.820 1.00 7.28  ? 84   LEU A CD1 1 
ATOM   670   C  CD2 . LEU A  1  84  ? 23.354  -14.244 -20.510 1.00 8.48  ? 84   LEU A CD2 1 
ATOM   671   N  N   . MET A  1  85  ? 28.518  -12.605 -18.534 1.00 5.32  ? 85   MET A N   1 
ATOM   672   C  CA  . MET A  1  85  ? 29.524  -12.970 -17.510 1.00 6.63  ? 85   MET A CA  1 
ATOM   673   C  C   . MET A  1  85  ? 29.613  -11.875 -16.414 1.00 4.67  ? 85   MET A C   1 
ATOM   674   O  O   . MET A  1  85  ? 29.886  -12.162 -15.254 1.00 4.52  ? 85   MET A O   1 
ATOM   675   C  CB  . MET A  1  85  ? 30.897  -13.186 -18.181 1.00 7.25  ? 85   MET A CB  1 
ATOM   676   C  CG  . MET A  1  85  ? 32.027  -13.650 -17.220 1.00 10.06 ? 85   MET A CG  1 
ATOM   677   S  SD  . MET A  1  85  ? 31.683  -15.236 -16.391 1.00 8.71  ? 85   MET A SD  1 
ATOM   678   C  CE  . MET A  1  85  ? 32.123  -16.404 -17.695 1.00 7.09  ? 85   MET A CE  1 
ATOM   679   N  N   . PHE A  1  86  ? 29.349  -10.614 -16.815 1.00 8.31  ? 86   PHE A N   1 
ATOM   680   C  CA  . PHE A  1  86  ? 29.291  -9.451  -15.903 1.00 6.48  ? 86   PHE A CA  1 
ATOM   681   C  C   . PHE A  1  86  ? 28.182  -9.687  -14.884 1.00 4.09  ? 86   PHE A C   1 
ATOM   682   O  O   . PHE A  1  86  ? 28.373  -9.450  -13.674 1.00 2.00  ? 86   PHE A O   1 
ATOM   683   C  CB  . PHE A  1  86  ? 29.055  -8.146  -16.726 1.00 7.44  ? 86   PHE A CB  1 
ATOM   684   C  CG  . PHE A  1  86  ? 28.881  -6.872  -15.923 1.00 8.60  ? 86   PHE A CG  1 
ATOM   685   C  CD1 . PHE A  1  86  ? 29.965  -6.294  -15.227 1.00 6.20  ? 86   PHE A CD1 1 
ATOM   686   C  CD2 . PHE A  1  86  ? 27.627  -6.227  -15.870 1.00 5.47  ? 86   PHE A CD2 1 
ATOM   687   C  CE1 . PHE A  1  86  ? 29.802  -5.121  -14.505 1.00 3.14  ? 86   PHE A CE1 1 
ATOM   688   C  CE2 . PHE A  1  86  ? 27.460  -5.055  -15.150 1.00 2.00  ? 86   PHE A CE2 1 
ATOM   689   C  CZ  . PHE A  1  86  ? 28.544  -4.505  -14.468 1.00 4.28  ? 86   PHE A CZ  1 
ATOM   690   N  N   . MET A  1  87  ? 27.039  -10.183 -15.399 1.00 3.86  ? 87   MET A N   1 
ATOM   691   C  CA  . MET A  1  87  ? 25.916  -10.579 -14.546 1.00 5.21  ? 87   MET A CA  1 
ATOM   692   C  C   . MET A  1  87  ? 26.348  -11.728 -13.620 1.00 4.25  ? 87   MET A C   1 
ATOM   693   O  O   . MET A  1  87  ? 26.254  -11.627 -12.386 1.00 3.06  ? 87   MET A O   1 
ATOM   694   C  CB  . MET A  1  87  ? 24.688  -11.029 -15.406 1.00 4.26  ? 87   MET A CB  1 
ATOM   695   C  CG  . MET A  1  87  ? 23.444  -11.431 -14.594 1.00 6.17  ? 87   MET A CG  1 
ATOM   696   S  SD  . MET A  1  87  ? 23.611  -13.024 -13.728 1.00 9.10  ? 87   MET A SD  1 
ATOM   697   C  CE  . MET A  1  87  ? 23.519  -14.146 -15.112 1.00 9.71  ? 87   MET A CE  1 
ATOM   698   N  N   . GLN A  1  88  ? 26.890  -12.793 -14.207 1.00 3.67  ? 88   GLN A N   1 
ATOM   699   C  CA  . GLN A  1  88  ? 27.200  -13.972 -13.420 1.00 3.81  ? 88   GLN A CA  1 
ATOM   700   C  C   . GLN A  1  88  ? 28.293  -13.763 -12.352 1.00 4.73  ? 88   GLN A C   1 
ATOM   701   O  O   . GLN A  1  88  ? 28.161  -14.284 -11.246 1.00 4.38  ? 88   GLN A O   1 
ATOM   702   C  CB  . GLN A  1  88  ? 27.521  -15.165 -14.325 1.00 2.47  ? 88   GLN A CB  1 
ATOM   703   C  CG  . GLN A  1  88  ? 27.347  -16.515 -13.639 1.00 3.23  ? 88   GLN A CG  1 
ATOM   704   C  CD  . GLN A  1  88  ? 26.000  -16.643 -12.913 1.00 5.71  ? 88   GLN A CD  1 
ATOM   705   O  OE1 . GLN A  1  88  ? 24.923  -16.747 -13.548 1.00 6.18  ? 88   GLN A OE1 1 
ATOM   706   N  NE2 . GLN A  1  88  ? 26.049  -16.642 -11.581 1.00 5.14  ? 88   GLN A NE2 1 
ATOM   707   N  N   . TRP A  1  89  ? 29.344  -12.981 -12.654 1.00 6.92  ? 89   TRP A N   1 
ATOM   708   C  CA  . TRP A  1  89  ? 30.404  -12.765 -11.645 1.00 6.67  ? 89   TRP A CA  1 
ATOM   709   C  C   . TRP A  1  89  ? 29.843  -12.080 -10.414 1.00 7.03  ? 89   TRP A C   1 
ATOM   710   O  O   . TRP A  1  89  ? 30.233  -12.397 -9.291  1.00 6.41  ? 89   TRP A O   1 
ATOM   711   C  CB  . TRP A  1  89  ? 31.556  -11.917 -12.195 1.00 7.18  ? 89   TRP A CB  1 
ATOM   712   C  CG  . TRP A  1  89  ? 32.710  -11.826 -11.239 1.00 5.68  ? 89   TRP A CG  1 
ATOM   713   C  CD1 . TRP A  1  89  ? 32.988  -10.801 -10.365 1.00 5.92  ? 89   TRP A CD1 1 
ATOM   714   C  CD2 . TRP A  1  89  ? 33.705  -12.835 -11.012 1.00 6.94  ? 89   TRP A CD2 1 
ATOM   715   N  NE1 . TRP A  1  89  ? 34.098  -11.111 -9.589  1.00 6.27  ? 89   TRP A NE1 1 
ATOM   716   C  CE2 . TRP A  1  89  ? 34.558  -12.359 -9.963  1.00 6.80  ? 89   TRP A CE2 1 
ATOM   717   C  CE3 . TRP A  1  89  ? 33.970  -14.100 -11.590 1.00 5.35  ? 89   TRP A CE3 1 
ATOM   718   C  CZ2 . TRP A  1  89  ? 35.648  -13.110 -9.488  1.00 4.67  ? 89   TRP A CZ2 1 
ATOM   719   C  CZ3 . TRP A  1  89  ? 35.064  -14.847 -11.115 1.00 6.27  ? 89   TRP A CZ3 1 
ATOM   720   C  CH2 . TRP A  1  89  ? 35.887  -14.348 -10.073 1.00 4.83  ? 89   TRP A CH2 1 
ATOM   721   N  N   . GLY A  1  90  ? 28.908  -11.130 -10.657 1.00 6.14  ? 90   GLY A N   1 
ATOM   722   C  CA  . GLY A  1  90  ? 28.247  -10.406 -9.591  1.00 3.22  ? 90   GLY A CA  1 
ATOM   723   C  C   . GLY A  1  90  ? 27.545  -11.320 -8.647  1.00 2.00  ? 90   GLY A C   1 
ATOM   724   O  O   . GLY A  1  90  ? 27.655  -11.168 -7.449  1.00 2.51  ? 90   GLY A O   1 
ATOM   725   N  N   . GLN A  1  91  ? 26.811  -12.269 -9.193  1.00 2.65  ? 91   GLN A N   1 
ATOM   726   C  CA  . GLN A  1  91  ? 26.118  -13.231 -8.354  1.00 4.14  ? 91   GLN A CA  1 
ATOM   727   C  C   . GLN A  1  91  ? 27.107  -14.137 -7.583  1.00 2.51  ? 91   GLN A C   1 
ATOM   728   O  O   . GLN A  1  91  ? 26.907  -14.388 -6.401  1.00 2.00  ? 91   GLN A O   1 
ATOM   729   C  CB  . GLN A  1  91  ? 25.167  -14.108 -9.176  1.00 4.90  ? 91   GLN A CB  1 
ATOM   730   C  CG  . GLN A  1  91  ? 24.346  -15.032 -8.258  1.00 5.99  ? 91   GLN A CG  1 
ATOM   731   C  CD  . GLN A  1  91  ? 23.424  -15.998 -8.998  1.00 3.98  ? 91   GLN A CD  1 
ATOM   732   O  OE1 . GLN A  1  91  ? 23.701  -16.375 -10.133 1.00 2.11  ? 91   GLN A OE1 1 
ATOM   733   N  NE2 . GLN A  1  91  ? 22.325  -16.392 -8.341  1.00 5.57  ? 91   GLN A NE2 1 
ATOM   734   N  N   . LEU A  1  92  ? 28.151  -14.620 -8.270  1.00 2.79  ? 92   LEU A N   1 
ATOM   735   C  CA  . LEU A  1  92  ? 29.193  -15.463 -7.655  1.00 4.40  ? 92   LEU A CA  1 
ATOM   736   C  C   . LEU A  1  92  ? 29.870  -14.716 -6.500  1.00 3.06  ? 92   LEU A C   1 
ATOM   737   O  O   . LEU A  1  92  ? 30.091  -15.267 -5.410  1.00 2.49  ? 92   LEU A O   1 
ATOM   738   C  CB  . LEU A  1  92  ? 30.248  -15.818 -8.701  1.00 4.52  ? 92   LEU A CB  1 
ATOM   739   C  CG  . LEU A  1  92  ? 31.386  -16.755 -8.243  1.00 4.52  ? 92   LEU A CG  1 
ATOM   740   C  CD1 . LEU A  1  92  ? 30.853  -18.159 -7.965  1.00 4.30  ? 92   LEU A CD1 1 
ATOM   741   C  CD2 . LEU A  1  92  ? 32.471  -16.804 -9.310  1.00 3.01  ? 92   LEU A CD2 1 
ATOM   742   N  N   . LEU A  1  93  ? 30.174  -13.444 -6.768  1.00 4.00  ? 93   LEU A N   1 
ATOM   743   C  CA  . LEU A  1  93  ? 30.810  -12.552 -5.792  1.00 5.71  ? 93   LEU A CA  1 
ATOM   744   C  C   . LEU A  1  93  ? 29.897  -12.267 -4.638  1.00 4.18  ? 93   LEU A C   1 
ATOM   745   O  O   . LEU A  1  93  ? 30.352  -12.211 -3.518  1.00 4.72  ? 93   LEU A O   1 
ATOM   746   C  CB  . LEU A  1  93  ? 31.205  -11.236 -6.465  1.00 3.92  ? 93   LEU A CB  1 
ATOM   747   C  CG  . LEU A  1  93  ? 31.794  -10.127 -5.576  1.00 5.12  ? 93   LEU A CG  1 
ATOM   748   C  CD1 . LEU A  1  93  ? 33.021  -10.613 -4.820  1.00 3.09  ? 93   LEU A CD1 1 
ATOM   749   C  CD2 . LEU A  1  93  ? 32.130  -8.940  -6.451  1.00 2.00  ? 93   LEU A CD2 1 
ATOM   750   N  N   . ASP A  1  94  ? 28.597  -12.033 -4.944  1.00 6.67  ? 94   ASP A N   1 
ATOM   751   C  CA  . ASP A  1  94  ? 27.590  -11.804 -3.888  1.00 5.61  ? 94   ASP A CA  1 
ATOM   752   C  C   . ASP A  1  94  ? 27.643  -12.963 -2.872  1.00 3.60  ? 94   ASP A C   1 
ATOM   753   O  O   . ASP A  1  94  ? 27.586  -12.734 -1.650  1.00 2.04  ? 94   ASP A O   1 
ATOM   754   C  CB  . ASP A  1  94  ? 26.158  -11.693 -4.507  1.00 4.33  ? 94   ASP A CB  1 
ATOM   755   C  CG  . ASP A  1  94  ? 25.065  -11.394 -3.471  1.00 7.98  ? 94   ASP A CG  1 
ATOM   756   O  OD1 . ASP A  1  94  ? 24.659  -10.178 -3.333  1.00 3.72  ? 94   ASP A OD1 1 
ATOM   757   O  OD2 . ASP A  1  94  ? 24.608  -12.365 -2.787  1.00 4.53  ? 94   ASP A OD2 1 
ATOM   758   N  N   . HIS A  1  95  ? 27.802  -14.197 -3.427  1.00 4.31  ? 95   HIS A N   1 
ATOM   759   C  CA  . HIS A  1  95  ? 27.819  -15.452 -2.656  1.00 5.21  ? 95   HIS A CA  1 
ATOM   760   C  C   . HIS A  1  95  ? 29.121  -15.655 -1.859  1.00 5.09  ? 95   HIS A C   1 
ATOM   761   O  O   . HIS A  1  95  ? 29.198  -16.564 -1.024  1.00 4.62  ? 95   HIS A O   1 
ATOM   762   C  CB  . HIS A  1  95  ? 27.515  -16.650 -3.572  1.00 2.51  ? 95   HIS A CB  1 
ATOM   763   C  CG  . HIS A  1  95  ? 26.105  -16.598 -4.133  1.00 4.62  ? 95   HIS A CG  1 
ATOM   764   N  ND1 . HIS A  1  95  ? 25.544  -17.619 -4.865  1.00 2.96  ? 95   HIS A ND1 1 
ATOM   765   C  CD2 . HIS A  1  95  ? 25.155  -15.634 -4.071  1.00 4.36  ? 95   HIS A CD2 1 
ATOM   766   C  CE1 . HIS A  1  95  ? 24.322  -17.296 -5.227  1.00 2.27  ? 95   HIS A CE1 1 
ATOM   767   N  NE2 . HIS A  1  95  ? 24.062  -16.096 -4.758  1.00 5.14  ? 95   HIS A NE2 1 
ATOM   768   N  N   . ASP A  1  96  ? 30.121  -14.800 -2.120  1.00 4.21  ? 96   ASP A N   1 
ATOM   769   C  CA  . ASP A  1  96  ? 31.334  -14.765 -1.302  1.00 3.53  ? 96   ASP A CA  1 
ATOM   770   C  C   . ASP A  1  96  ? 31.085  -13.819 -0.120  1.00 3.22  ? 96   ASP A C   1 
ATOM   771   O  O   . ASP A  1  96  ? 31.631  -14.006 0.944   1.00 2.84  ? 96   ASP A O   1 
ATOM   772   C  CB  . ASP A  1  96  ? 32.521  -14.218 -2.152  1.00 4.50  ? 96   ASP A CB  1 
ATOM   773   C  CG  . ASP A  1  96  ? 33.967  -14.500 -1.648  1.00 3.91  ? 96   ASP A CG  1 
ATOM   774   O  OD1 . ASP A  1  96  ? 34.874  -14.433 -2.498  1.00 2.71  ? 96   ASP A OD1 1 
ATOM   775   O  OD2 . ASP A  1  96  ? 34.193  -14.770 -0.424  1.00 6.10  ? 96   ASP A OD2 1 
ATOM   776   N  N   . LEU A  1  97  ? 30.205  -12.813 -0.315  1.00 3.52  ? 97   LEU A N   1 
ATOM   777   C  CA  . LEU A  1  97  ? 30.034  -11.727 0.670   1.00 6.24  ? 97   LEU A CA  1 
ATOM   778   C  C   . LEU A  1  97  ? 28.887  -11.905 1.665   1.00 6.23  ? 97   LEU A C   1 
ATOM   779   O  O   . LEU A  1  97  ? 29.070  -11.642 2.861   1.00 6.62  ? 97   LEU A O   1 
ATOM   780   C  CB  . LEU A  1  97  ? 29.864  -10.359 -0.048  1.00 7.18  ? 97   LEU A CB  1 
ATOM   781   C  CG  . LEU A  1  97  ? 30.896  -10.019 -1.146  1.00 10.41 ? 97   LEU A CG  1 
ATOM   782   C  CD1 . LEU A  1  97  ? 30.661  -8.616  -1.692  1.00 7.48  ? 97   LEU A CD1 1 
ATOM   783   C  CD2 . LEU A  1  97  ? 32.310  -10.164 -0.604  1.00 5.33  ? 97   LEU A CD2 1 
ATOM   784   N  N   . ASP A  1  98  ? 27.686  -12.315 1.185   1.00 5.53  ? 98   ASP A N   1 
ATOM   785   C  CA  . ASP A  1  98  ? 26.575  -12.422 2.113   1.00 5.03  ? 98   ASP A CA  1 
ATOM   786   C  C   . ASP A  1  98  ? 25.518  -13.458 1.747   1.00 3.12  ? 98   ASP A C   1 
ATOM   787   O  O   . ASP A  1  98  ? 25.194  -13.664 0.594   1.00 3.55  ? 98   ASP A O   1 
ATOM   788   C  CB  . ASP A  1  98  ? 25.907  -11.034 2.341   1.00 5.38  ? 98   ASP A CB  1 
ATOM   789   C  CG  . ASP A  1  98  ? 25.535  -10.294 1.054   1.00 5.17  ? 98   ASP A CG  1 
ATOM   790   O  OD1 . ASP A  1  98  ? 26.415  -9.728  0.400   1.00 4.19  ? 98   ASP A OD1 1 
ATOM   791   O  OD2 . ASP A  1  98  ? 24.354  -10.277 0.701   1.00 5.62  ? 98   ASP A OD2 1 
ATOM   792   N  N   . PHE A  1  99  ? 25.040  -14.119 2.789   1.00 3.52  ? 99   PHE A N   1 
ATOM   793   C  CA  . PHE A  1  99  ? 23.917  -15.038 2.771   1.00 5.53  ? 99   PHE A CA  1 
ATOM   794   C  C   . PHE A  1  99  ? 23.143  -14.811 4.052   1.00 5.38  ? 99   PHE A C   1 
ATOM   795   O  O   . PHE A  1  99  ? 23.681  -14.985 5.156   1.00 6.38  ? 99   PHE A O   1 
ATOM   796   C  CB  . PHE A  1  99  ? 24.352  -16.513 2.685   1.00 5.09  ? 99   PHE A CB  1 
ATOM   797   C  CG  . PHE A  1  99  ? 23.176  -17.445 2.676   1.00 5.21  ? 99   PHE A CG  1 
ATOM   798   C  CD1 . PHE A  1  99  ? 22.212  -17.346 1.676   1.00 6.92  ? 99   PHE A CD1 1 
ATOM   799   C  CD2 . PHE A  1  99  ? 22.983  -18.372 3.714   1.00 7.15  ? 99   PHE A CD2 1 
ATOM   800   C  CE1 . PHE A  1  99  ? 21.069  -18.144 1.701   1.00 8.00  ? 99   PHE A CE1 1 
ATOM   801   C  CE2 . PHE A  1  99  ? 21.841  -19.173 3.751   1.00 9.73  ? 99   PHE A CE2 1 
ATOM   802   C  CZ  . PHE A  1  99  ? 20.879  -19.055 2.740   1.00 6.77  ? 99   PHE A CZ  1 
ATOM   803   N  N   . THR A  1  100 ? 21.890  -14.384 3.905   1.00 5.56  ? 100  THR A N   1 
ATOM   804   C  CA  . THR A  1  100 ? 21.002  -14.071 5.035   1.00 8.16  ? 100  THR A CA  1 
ATOM   805   C  C   . THR A  1  100 ? 20.103  -15.259 5.283   1.00 6.37  ? 100  THR A C   1 
ATOM   806   O  O   . THR A  1  100 ? 19.166  -15.483 4.542   1.00 7.32  ? 100  THR A O   1 
ATOM   807   C  CB  . THR A  1  100 ? 20.144  -12.823 4.695   1.00 5.71  ? 100  THR A CB  1 
ATOM   808   O  OG1 . THR A  1  100 ? 21.022  -11.775 4.248   1.00 9.62  ? 100  THR A OG1 1 
ATOM   809   C  CG2 . THR A  1  100 ? 19.389  -12.336 5.899   1.00 3.42  ? 100  THR A CG2 1 
ATOM   810   N  N   . PRO A  1  101 ? 20.377  -16.047 6.320   1.00 6.92  ? 101  PRO A N   1 
ATOM   811   C  CA  . PRO A  1  101 ? 19.597  -17.244 6.620   1.00 7.66  ? 101  PRO A CA  1 
ATOM   812   C  C   . PRO A  1  101 ? 18.187  -16.952 7.057   1.00 7.39  ? 101  PRO A C   1 
ATOM   813   O  O   . PRO A  1  101 ? 17.881  -15.899 7.595   1.00 9.34  ? 101  PRO A O   1 
ATOM   814   C  CB  . PRO A  1  101 ? 20.411  -17.935 7.709   1.00 8.17  ? 101  PRO A CB  1 
ATOM   815   C  CG  . PRO A  1  101 ? 20.998  -16.773 8.431   1.00 10.08 ? 101  PRO A CG  1 
ATOM   816   C  CD  . PRO A  1  101 ? 21.442  -15.842 7.327   1.00 8.54  ? 101  PRO A CD  1 
ATOM   817   N  N   . GLU A  1  102 ? 17.343  -17.907 6.802   1.00 9.12  ? 102  GLU A N   1 
ATOM   818   C  CA  . GLU A  1  102 ? 15.943  -17.885 7.177   1.00 9.40  ? 102  GLU A CA  1 
ATOM   819   C  C   . GLU A  1  102 ? 15.617  -19.272 7.704   1.00 10.35 ? 102  GLU A C   1 
ATOM   820   O  O   . GLU A  1  102 ? 16.354  -20.203 7.421   1.00 10.65 ? 102  GLU A O   1 
ATOM   821   C  CB  . GLU A  1  102 ? 15.063  -17.688 5.936   1.00 11.12 ? 102  GLU A CB  1 
ATOM   822   C  CG  . GLU A  1  102 ? 15.235  -16.392 5.165   1.00 12.78 ? 102  GLU A CG  1 
ATOM   823   C  CD  . GLU A  1  102 ? 14.640  -16.448 3.748   1.00 11.36 ? 102  GLU A CD  1 
ATOM   824   O  OE1 . GLU A  1  102 ? 15.039  -15.604 2.916   1.00 12.41 ? 102  GLU A OE1 1 
ATOM   825   O  OE2 . GLU A  1  102 ? 13.781  -17.337 3.457   1.00 10.89 ? 102  GLU A OE2 1 
ATOM   826   N  N   . PRO A  1  103 ? 14.561  -19.448 8.502   1.00 11.58 ? 103  PRO A N   1 
ATOM   827   C  CA  . PRO A  1  103 ? 14.183  -20.780 8.975   1.00 14.71 ? 103  PRO A CA  1 
ATOM   828   C  C   . PRO A  1  103 ? 13.647  -21.579 7.764   1.00 16.71 ? 103  PRO A C   1 
ATOM   829   O  O   . PRO A  1  103 ? 13.079  -21.011 6.836   1.00 18.04 ? 103  PRO A O   1 
ATOM   830   C  CB  . PRO A  1  103 ? 13.122  -20.483 10.038  1.00 15.37 ? 103  PRO A CB  1 
ATOM   831   C  CG  . PRO A  1  103 ? 12.521  -19.214 9.557   1.00 13.91 ? 103  PRO A CG  1 
ATOM   832   C  CD  . PRO A  1  103 ? 13.694  -18.405 9.079   1.00 13.30 ? 103  PRO A CD  1 
ATOM   833   N  N   . ALA A  1  104 ? 13.880  -22.881 7.738   1.00 20.06 ? 104  ALA A N   1 
ATOM   834   C  CA  . ALA A  1  104 ? 13.458  -23.700 6.608   1.00 22.64 ? 104  ALA A CA  1 
ATOM   835   C  C   . ALA A  1  104 ? 11.935  -23.844 6.526   1.00 24.62 ? 104  ALA A C   1 
ATOM   836   O  O   . ALA A  1  104 ? 11.413  -23.861 5.384   1.00 28.35 ? 104  ALA A O   1 
ATOM   837   C  CB  . ALA A  1  104 ? 14.130  -25.070 6.682   1.00 21.84 ? 104  ALA A CB  1 
ATOM   838   O  OXT . ALA A  1  104 ? 11.284  -23.934 7.591   1.00 24.86 ? 104  ALA A OXT 1 
ATOM   839   N  N   . VAL B  2  1   ? 2.579   -24.198 10.133  1.00 43.87 ? 113  VAL C N   1 
ATOM   840   C  CA  . VAL B  2  1   ? 2.959   -22.830 9.641   1.00 43.35 ? 113  VAL C CA  1 
ATOM   841   C  C   . VAL B  2  1   ? 3.281   -22.870 8.139   1.00 41.70 ? 113  VAL C C   1 
ATOM   842   O  O   . VAL B  2  1   ? 2.379   -22.697 7.292   1.00 44.91 ? 113  VAL C O   1 
ATOM   843   C  CB  . VAL B  2  1   ? 4.180   -22.252 10.423  1.00 43.18 ? 113  VAL C CB  1 
ATOM   844   C  CG1 . VAL B  2  1   ? 4.646   -20.945 9.804   1.00 45.14 ? 113  VAL C CG1 1 
ATOM   845   C  CG2 . VAL B  2  1   ? 3.812   -22.014 11.875  1.00 44.37 ? 113  VAL C CG2 1 
ATOM   846   N  N   . ASN B  2  2   ? 4.559   -23.110 7.821   1.00 35.00 ? 114  ASN C N   1 
ATOM   847   C  CA  . ASN B  2  2   ? 5.034   -23.188 6.450   1.00 29.11 ? 114  ASN C CA  1 
ATOM   848   C  C   . ASN B  2  2   ? 4.695   -21.935 5.663   1.00 23.52 ? 114  ASN C C   1 
ATOM   849   O  O   . ASN B  2  2   ? 3.540   -21.713 5.275   1.00 23.02 ? 114  ASN C O   1 
ATOM   850   C  CB  . ASN B  2  2   ? 4.471   -24.435 5.738   1.00 30.41 ? 114  ASN C CB  1 
ATOM   851   C  CG  . ASN B  2  2   ? 5.342   -24.860 4.575   1.00 32.01 ? 114  ASN C CG  1 
ATOM   852   O  OD1 . ASN B  2  2   ? 5.848   -24.017 3.830   1.00 33.75 ? 114  ASN C OD1 1 
ATOM   853   N  ND2 . ASN B  2  2   ? 5.536   -26.169 4.420   1.00 31.79 ? 114  ASN C ND2 1 
ATOM   854   N  N   . CYS B  2  3   ? 5.708   -21.119 5.430   1.00 16.61 ? 115  CYS C N   1 
ATOM   855   C  CA  . CYS B  2  3   ? 5.531   -19.897 4.681   1.00 13.25 ? 115  CYS C CA  1 
ATOM   856   C  C   . CYS B  2  3   ? 5.346   -20.201 3.197   1.00 12.29 ? 115  CYS C C   1 
ATOM   857   O  O   . CYS B  2  3   ? 4.974   -19.334 2.417   1.00 9.43  ? 115  CYS C O   1 
ATOM   858   C  CB  . CYS B  2  3   ? 6.733   -18.960 4.903   1.00 8.47  ? 115  CYS C CB  1 
ATOM   859   S  SG  . CYS B  2  3   ? 7.123   -18.670 6.668   1.00 9.18  ? 115  CYS C SG  1 
ATOM   860   N  N   . GLU B  2  4   ? 5.596   -21.442 2.809   1.00 13.84 ? 116  GLU C N   1 
ATOM   861   C  CA  . GLU B  2  4   ? 5.492   -21.800 1.406   1.00 18.20 ? 116  GLU C CA  1 
ATOM   862   C  C   . GLU B  2  4   ? 4.127   -22.368 1.007   1.00 17.91 ? 116  GLU C C   1 
ATOM   863   O  O   . GLU B  2  4   ? 3.810   -22.402 -0.174  1.00 18.82 ? 116  GLU C O   1 
ATOM   864   C  CB  . GLU B  2  4   ? 6.575   -22.811 1.043   1.00 23.42 ? 116  GLU C CB  1 
ATOM   865   C  CG  . GLU B  2  4   ? 7.939   -22.210 0.789   1.00 30.36 ? 116  GLU C CG  1 
ATOM   866   C  CD  . GLU B  2  4   ? 8.922   -23.243 0.271   1.00 37.67 ? 116  GLU C CD  1 
ATOM   867   O  OE1 . GLU B  2  4   ? 9.844   -22.854 -0.484  1.00 42.16 ? 116  GLU C OE1 1 
ATOM   868   O  OE2 . GLU B  2  4   ? 8.776   -24.450 0.608   1.00 40.69 ? 116  GLU C OE2 1 
ATOM   869   N  N   . THR B  2  5   ? 3.327   -22.815 1.981   1.00 17.64 ? 117  THR C N   1 
ATOM   870   C  CA  . THR B  2  5   ? 2.043   -23.459 1.682   1.00 16.94 ? 117  THR C CA  1 
ATOM   871   C  C   . THR B  2  5   ? 0.842   -22.643 2.157   1.00 18.01 ? 117  THR C C   1 
ATOM   872   O  O   . THR B  2  5   ? -0.284  -22.960 1.807   1.00 21.02 ? 117  THR C O   1 
ATOM   873   C  CB  . THR B  2  5   ? 1.965   -24.882 2.304   1.00 16.36 ? 117  THR C CB  1 
ATOM   874   O  OG1 . THR B  2  5   ? 1.841   -24.795 3.736   1.00 16.98 ? 117  THR C OG1 1 
ATOM   875   C  CG2 . THR B  2  5   ? 3.223   -25.678 1.966   1.00 16.49 ? 117  THR C CG2 1 
ATOM   876   N  N   . SER B  2  6   ? 1.060   -21.602 2.952   1.00 15.66 ? 118  SER C N   1 
ATOM   877   C  CA  . SER B  2  6   ? -0.063  -20.792 3.416   1.00 15.61 ? 118  SER C CA  1 
ATOM   878   C  C   . SER B  2  6   ? 0.231   -19.316 3.235   1.00 14.56 ? 118  SER C C   1 
ATOM   879   O  O   . SER B  2  6   ? 1.362   -18.934 2.958   1.00 13.55 ? 118  SER C O   1 
ATOM   880   C  CB  . SER B  2  6   ? -0.364  -21.054 4.906   1.00 17.48 ? 118  SER C CB  1 
ATOM   881   O  OG  . SER B  2  6   ? 0.587   -20.401 5.750   1.00 19.34 ? 118  SER C OG  1 
ATOM   882   N  N   . CYS B  2  7   ? -0.801  -18.494 3.392   1.00 11.73 ? 119  CYS C N   1 
ATOM   883   C  CA  . CYS B  2  7   ? -0.662  -17.058 3.340   1.00 8.53  ? 119  CYS C CA  1 
ATOM   884   C  C   . CYS B  2  7   ? -0.892  -16.499 4.714   1.00 7.72  ? 119  CYS C C   1 
ATOM   885   O  O   . CYS B  2  7   ? -1.133  -15.311 4.876   1.00 9.72  ? 119  CYS C O   1 
ATOM   886   C  CB  . CYS B  2  7   ? -1.664  -16.453 2.342   1.00 6.04  ? 119  CYS C CB  1 
ATOM   887   S  SG  . CYS B  2  7   ? -1.201  -16.774 0.636   1.00 9.20  ? 119  CYS C SG  1 
ATOM   888   N  N   . VAL B  2  8   ? -0.823  -17.359 5.723   1.00 6.76  ? 120  VAL C N   1 
ATOM   889   C  CA  . VAL B  2  8   ? -1.048  -16.905 7.076   1.00 6.18  ? 120  VAL C CA  1 
ATOM   890   C  C   . VAL B  2  8   ? 0.115   -16.009 7.519   1.00 8.68  ? 120  VAL C C   1 
ATOM   891   O  O   . VAL B  2  8   ? 1.258   -16.386 7.356   1.00 7.13  ? 120  VAL C O   1 
ATOM   892   C  CB  . VAL B  2  8   ? -1.195  -18.097 8.029   1.00 6.30  ? 120  VAL C CB  1 
ATOM   893   C  CG1 . VAL B  2  8   ? -1.346  -17.599 9.459   1.00 6.81  ? 120  VAL C CG1 1 
ATOM   894   C  CG2 . VAL B  2  8   ? -2.418  -18.921 7.620   1.00 6.09  ? 120  VAL C CG2 1 
ATOM   895   N  N   . GLN B  2  9   ? -0.187  -14.803 8.015   1.00 7.34  ? 121  GLN C N   1 
ATOM   896   C  CA  . GLN B  2  9   ? 0.862   -13.898 8.486   1.00 11.31 ? 121  GLN C CA  1 
ATOM   897   C  C   . GLN B  2  9   ? 1.088   -14.072 9.987   1.00 11.64 ? 121  GLN C C   1 
ATOM   898   O  O   . GLN B  2  9   ? 0.470   -13.404 10.835  1.00 11.22 ? 121  GLN C O   1 
ATOM   899   C  CB  . GLN B  2  9   ? 0.555   -12.428 8.165   1.00 11.16 ? 121  GLN C CB  1 
ATOM   900   C  CG  . GLN B  2  9   ? 1.743   -11.522 8.480   1.00 14.74 ? 121  GLN C CG  1 
ATOM   901   C  CD  . GLN B  2  9   ? 1.456   -10.034 8.346   1.00 14.23 ? 121  GLN C CD  1 
ATOM   902   O  OE1 . GLN B  2  9   ? 1.774   -9.408  7.326   1.00 15.11 ? 121  GLN C OE1 1 
ATOM   903   N  NE2 . GLN B  2  9   ? 0.875   -9.461  9.389   1.00 12.68 ? 121  GLN C NE2 1 
ATOM   904   N  N   . GLN B  2  10  ? 1.984   -14.998 10.290  1.00 11.17 ? 122  GLN C N   1 
ATOM   905   C  CA  . GLN B  2  10  ? 2.372   -15.373 11.636  1.00 11.65 ? 122  GLN C CA  1 
ATOM   906   C  C   . GLN B  2  10  ? 3.840   -15.753 11.553  1.00 11.37 ? 122  GLN C C   1 
ATOM   907   O  O   . GLN B  2  10  ? 4.274   -16.247 10.516  1.00 11.69 ? 122  GLN C O   1 
ATOM   908   C  CB  . GLN B  2  10  ? 1.584   -16.614 12.090  1.00 12.12 ? 122  GLN C CB  1 
ATOM   909   C  CG  . GLN B  2  10  ? 2.156   -17.912 11.510  1.00 23.95 ? 122  GLN C CG  1 
ATOM   910   C  CD  . GLN B  2  10  ? 1.230   -19.130 11.513  1.00 30.70 ? 122  GLN C CD  1 
ATOM   911   O  OE1 . GLN B  2  10  ? 1.208   -19.899 10.543  1.00 34.11 ? 122  GLN C OE1 1 
ATOM   912   N  NE2 . GLN B  2  10  ? 0.472   -19.326 12.593  1.00 35.61 ? 122  GLN C NE2 1 
ATOM   913   N  N   . PRO B  2  11  ? 4.627   -15.510 12.601  1.00 10.49 ? 123  PRO C N   1 
ATOM   914   C  CA  . PRO B  2  11  ? 6.042   -15.868 12.623  1.00 11.45 ? 123  PRO C CA  1 
ATOM   915   C  C   . PRO B  2  11  ? 6.273   -17.312 12.140  1.00 12.92 ? 123  PRO C C   1 
ATOM   916   O  O   . PRO B  2  11  ? 5.528   -18.233 12.500  1.00 12.51 ? 123  PRO C O   1 
ATOM   917   C  CB  . PRO B  2  11  ? 6.383   -15.685 14.095  1.00 11.89 ? 123  PRO C CB  1 
ATOM   918   C  CG  . PRO B  2  11  ? 5.567   -14.497 14.441  1.00 9.88  ? 123  PRO C CG  1 
ATOM   919   C  CD  . PRO B  2  11  ? 4.235   -14.830 13.850  1.00 9.41  ? 123  PRO C CD  1 
ATOM   920   N  N   . PRO B  2  12  ? 7.326   -17.534 11.316  1.00 13.01 ? 124  PRO C N   1 
ATOM   921   C  CA  . PRO B  2  12  ? 8.255   -16.486 10.864  1.00 11.11 ? 124  PRO C CA  1 
ATOM   922   C  C   . PRO B  2  12  ? 7.921   -15.963 9.456   1.00 11.30 ? 124  PRO C C   1 
ATOM   923   O  O   . PRO B  2  12  ? 8.802   -15.501 8.721   1.00 11.91 ? 124  PRO C O   1 
ATOM   924   C  CB  . PRO B  2  12  ? 9.569   -17.250 10.907  1.00 10.39 ? 124  PRO C CB  1 
ATOM   925   C  CG  . PRO B  2  12  ? 9.165   -18.559 10.303  1.00 10.66 ? 124  PRO C CG  1 
ATOM   926   C  CD  . PRO B  2  12  ? 7.775   -18.857 10.840  1.00 10.20 ? 124  PRO C CD  1 
ATOM   927   N  N   . CYS B  2  13  ? 6.653   -16.016 9.091   1.00 8.64  ? 125  CYS C N   1 
ATOM   928   C  CA  . CYS B  2  13  ? 6.236   -15.616 7.761   1.00 10.17 ? 125  CYS C CA  1 
ATOM   929   C  C   . CYS B  2  13  ? 5.863   -14.132 7.654   1.00 9.10  ? 125  CYS C C   1 
ATOM   930   O  O   . CYS B  2  13  ? 5.340   -13.538 8.595   1.00 12.39 ? 125  CYS C O   1 
ATOM   931   C  CB  . CYS B  2  13  ? 5.048   -16.505 7.298   1.00 8.10  ? 125  CYS C CB  1 
ATOM   932   S  SG  . CYS B  2  13  ? 5.301   -18.296 7.592   1.00 10.36 ? 125  CYS C SG  1 
ATOM   933   N  N   . PHE B  2  14  ? 6.150   -13.564 6.486   1.00 7.56  ? 126  PHE C N   1 
ATOM   934   C  CA  . PHE B  2  14  ? 5.761   -12.193 6.107   1.00 6.81  ? 126  PHE C CA  1 
ATOM   935   C  C   . PHE B  2  14  ? 5.367   -12.202 4.644   1.00 3.28  ? 126  PHE C C   1 
ATOM   936   O  O   . PHE B  2  14  ? 5.946   -11.499 3.818   1.00 2.28  ? 126  PHE C O   1 
ATOM   937   C  CB  . PHE B  2  14  ? 6.923   -11.224 6.336   1.00 9.09  ? 126  PHE C CB  1 
ATOM   938   C  CG  . PHE B  2  14  ? 6.557   -9.783  6.105   1.00 10.20 ? 126  PHE C CG  1 
ATOM   939   C  CD1 . PHE B  2  14  ? 5.257   -9.340  6.345   1.00 6.74  ? 126  PHE C CD1 1 
ATOM   940   C  CD2 . PHE B  2  14  ? 7.498   -8.882  5.610   1.00 9.81  ? 126  PHE C CD2 1 
ATOM   941   C  CE1 . PHE B  2  14  ? 4.903   -8.029  6.087   1.00 6.73  ? 126  PHE C CE1 1 
ATOM   942   C  CE2 . PHE B  2  14  ? 7.135   -7.558  5.352   1.00 8.73  ? 126  PHE C CE2 1 
ATOM   943   C  CZ  . PHE B  2  14  ? 5.835   -7.138  5.590   1.00 7.96  ? 126  PHE C CZ  1 
ATOM   944   N  N   . PRO B  2  15  ? 4.319   -12.976 4.297   1.00 5.27  ? 127  PRO C N   1 
ATOM   945   C  CA  . PRO B  2  15  ? 3.874   -13.106 2.910   1.00 3.57  ? 127  PRO C CA  1 
ATOM   946   C  C   . PRO B  2  15  ? 3.575   -11.777 2.242   1.00 2.09  ? 127  PRO C C   1 
ATOM   947   O  O   . PRO B  2  15  ? 3.060   -10.883 2.861   1.00 2.75  ? 127  PRO C O   1 
ATOM   948   C  CB  . PRO B  2  15  ? 2.626   -14.021 3.005   1.00 3.56  ? 127  PRO C CB  1 
ATOM   949   C  CG  . PRO B  2  15  ? 2.136   -13.814 4.408   1.00 5.78  ? 127  PRO C CG  1 
ATOM   950   C  CD  . PRO B  2  15  ? 3.401   -13.692 5.228   1.00 4.41  ? 127  PRO C CD  1 
ATOM   951   N  N   . LEU B  2  16  ? 3.962   -11.659 0.967   1.00 4.32  ? 128  LEU C N   1 
ATOM   952   C  CA  . LEU B  2  16  ? 3.592   -10.510 0.137   1.00 6.99  ? 128  LEU C CA  1 
ATOM   953   C  C   . LEU B  2  16  ? 2.081   -10.575 -0.200  1.00 7.82  ? 128  LEU C C   1 
ATOM   954   O  O   . LEU B  2  16  ? 1.583   -11.579 -0.706  1.00 6.11  ? 128  LEU C O   1 
ATOM   955   C  CB  . LEU B  2  16  ? 4.388   -10.449 -1.193  1.00 4.03  ? 128  LEU C CB  1 
ATOM   956   C  CG  . LEU B  2  16  ? 5.852   -9.994  -1.132  1.00 5.53  ? 128  LEU C CG  1 
ATOM   957   C  CD1 . LEU B  2  16  ? 6.701   -11.063 -0.443  1.00 8.67  ? 128  LEU C CD1 1 
ATOM   958   C  CD2 . LEU B  2  16  ? 6.385   -9.773  -2.546  1.00 3.75  ? 128  LEU C CD2 1 
ATOM   959   N  N   . LYS B  2  17  ? 1.388   -9.493  0.122   1.00 9.02  ? 129  LYS C N   1 
ATOM   960   C  CA  . LYS B  2  17  ? -0.008  -9.317  -0.194  1.00 11.64 ? 129  LYS C CA  1 
ATOM   961   C  C   . LYS B  2  17  ? -0.160  -8.984  -1.686  1.00 9.71  ? 129  LYS C C   1 
ATOM   962   O  O   . LYS B  2  17  ? 0.746   -8.424  -2.310  1.00 6.49  ? 129  LYS C O   1 
ATOM   963   C  CB  . LYS B  2  17  ? -0.573  -8.236  0.737   1.00 13.94 ? 129  LYS C CB  1 
ATOM   964   C  CG  . LYS B  2  17  ? -0.988  -8.825  2.089   1.00 20.11 ? 129  LYS C CG  1 
ATOM   965   C  CD  . LYS B  2  17  ? -0.867  -7.855  3.271   1.00 25.74 ? 129  LYS C CD  1 
ATOM   966   C  CE  . LYS B  2  17  ? -1.660  -6.561  3.094   1.00 30.25 ? 129  LYS C CE  1 
ATOM   967   N  NZ  . LYS B  2  17  ? -1.513  -5.644  4.280   1.00 31.13 ? 129  LYS C NZ  1 
ATOM   968   N  N   . ILE B  2  18  ? -1.269  -9.423  -2.283  1.00 9.62  ? 130  ILE C N   1 
ATOM   969   C  CA  . ILE B  2  18  ? -1.494  -9.227  -3.717  1.00 9.75  ? 130  ILE C CA  1 
ATOM   970   C  C   . ILE B  2  18  ? -2.435  -8.064  -3.961  1.00 10.52 ? 130  ILE C C   1 
ATOM   971   O  O   . ILE B  2  18  ? -3.472  -7.939  -3.296  1.00 11.14 ? 130  ILE C O   1 
ATOM   972   C  CB  . ILE B  2  18  ? -2.050  -10.495 -4.368  1.00 7.82  ? 130  ILE C CB  1 
ATOM   973   C  CG1 . ILE B  2  18  ? -1.091  -11.676 -4.097  1.00 12.45 ? 130  ILE C CG1 1 
ATOM   974   C  CG2 . ILE B  2  18  ? -2.240  -10.284 -5.867  1.00 6.78  ? 130  ILE C CG2 1 
ATOM   975   C  CD1 . ILE B  2  18  ? 0.364   -11.441 -4.489  1.00 9.66  ? 130  ILE C CD1 1 
ATOM   976   N  N   . PRO B  2  19  ? -2.075  -7.172  -4.886  1.00 8.07  ? 131  PRO C N   1 
ATOM   977   C  CA  . PRO B  2  19  ? -2.897  -6.013  -5.196  1.00 9.87  ? 131  PRO C CA  1 
ATOM   978   C  C   . PRO B  2  19  ? -4.107  -6.442  -6.000  1.00 11.07 ? 131  PRO C C   1 
ATOM   979   O  O   . PRO B  2  19  ? -4.096  -7.490  -6.635  1.00 10.82 ? 131  PRO C O   1 
ATOM   980   C  CB  . PRO B  2  19  ? -1.957  -5.133  -6.023  1.00 7.59  ? 131  PRO C CB  1 
ATOM   981   C  CG  . PRO B  2  19  ? -1.163  -6.138  -6.777  1.00 7.06  ? 131  PRO C CG  1 
ATOM   982   C  CD  . PRO B  2  19  ? -0.866  -7.217  -5.748  1.00 8.10  ? 131  PRO C CD  1 
ATOM   983   N  N   . PRO B  2  20  ? -5.184  -5.705  -5.927  1.00 12.98 ? 132  PRO C N   1 
ATOM   984   C  CA  . PRO B  2  20  ? -6.375  -6.029  -6.720  1.00 16.41 ? 132  PRO C CA  1 
ATOM   985   C  C   . PRO B  2  20  ? -5.965  -5.912  -8.204  1.00 17.82 ? 132  PRO C C   1 
ATOM   986   O  O   . PRO B  2  20  ? -5.030  -5.148  -8.535  1.00 19.91 ? 132  PRO C O   1 
ATOM   987   C  CB  . PRO B  2  20  ? -7.359  -4.922  -6.317  1.00 17.26 ? 132  PRO C CB  1 
ATOM   988   C  CG  . PRO B  2  20  ? -6.870  -4.501  -4.967  1.00 18.64 ? 132  PRO C CG  1 
ATOM   989   C  CD  . PRO B  2  20  ? -5.376  -4.526  -5.078  1.00 12.80 ? 132  PRO C CD  1 
ATOM   990   N  N   . ASN B  2  21  ? -6.580  -6.679  -9.095  1.00 19.14 ? 133  ASN C N   1 
ATOM   991   C  CA  . ASN B  2  21  ? -6.266  -6.560  -10.552 1.00 22.56 ? 133  ASN C CA  1 
ATOM   992   C  C   . ASN B  2  21  ? -4.825  -6.971  -10.944 1.00 21.84 ? 133  ASN C C   1 
ATOM   993   O  O   . ASN B  2  21  ? -4.273  -6.481  -11.941 1.00 19.79 ? 133  ASN C O   1 
ATOM   994   C  CB  . ASN B  2  21  ? -6.509  -5.117  -11.039 1.00 27.51 ? 133  ASN C CB  1 
ATOM   995   C  CG  . ASN B  2  21  ? -7.959  -4.682  -10.898 1.00 32.77 ? 133  ASN C CG  1 
ATOM   996   O  OD1 . ASN B  2  21  ? -8.241  -3.506  -10.644 1.00 36.24 ? 133  ASN C OD1 1 
ATOM   997   N  ND2 . ASN B  2  21  ? -8.890  -5.634  -11.070 1.00 34.29 ? 133  ASN C ND2 1 
ATOM   998   N  N   . ASP B  2  22  ? -4.210  -7.841  -10.161 1.00 19.37 ? 134  ASP C N   1 
ATOM   999   C  CA  . ASP B  2  22  ? -2.895  -8.327  -10.507 1.00 16.96 ? 134  ASP C CA  1 
ATOM   1000  C  C   . ASP B  2  22  ? -3.004  -9.050  -11.857 1.00 16.76 ? 134  ASP C C   1 
ATOM   1001  O  O   . ASP B  2  22  ? -3.983  -9.745  -12.101 1.00 17.10 ? 134  ASP C O   1 
ATOM   1002  C  CB  . ASP B  2  22  ? -2.428  -9.286  -9.410  1.00 13.19 ? 134  ASP C CB  1 
ATOM   1003  C  CG  . ASP B  2  22  ? -0.954  -9.604  -9.494  1.00 12.96 ? 134  ASP C CG  1 
ATOM   1004  O  OD1 . ASP B  2  22  ? -0.164  -8.936  -8.804  1.00 10.09 ? 134  ASP C OD1 1 
ATOM   1005  O  OD2 . ASP B  2  22  ? -0.587  -10.523 -10.248 1.00 10.52 ? 134  ASP C OD2 1 
ATOM   1006  N  N   . PRO B  2  23  ? -2.025  -8.907  -12.761 1.00 16.82 ? 135  PRO C N   1 
ATOM   1007  C  CA  . PRO B  2  23  ? -2.068  -9.572  -14.079 1.00 17.08 ? 135  PRO C CA  1 
ATOM   1008  C  C   . PRO B  2  23  ? -1.897  -11.113 -14.011 1.00 16.58 ? 135  PRO C C   1 
ATOM   1009  O  O   . PRO B  2  23  ? -2.127  -11.807 -15.011 1.00 16.73 ? 135  PRO C O   1 
ATOM   1010  C  CB  . PRO B  2  23  ? -0.921  -8.889  -14.829 1.00 17.76 ? 135  PRO C CB  1 
ATOM   1011  C  CG  . PRO B  2  23  ? 0.057   -8.629  -13.730 1.00 19.41 ? 135  PRO C CG  1 
ATOM   1012  C  CD  . PRO B  2  23  ? -0.790  -8.118  -12.601 1.00 16.01 ? 135  PRO C CD  1 
ATOM   1013  N  N   . ARG B  2  24  ? -1.492  -11.632 -12.835 1.00 13.59 ? 136  ARG C N   1 
ATOM   1014  C  CA  . ARG B  2  24  ? -1.250  -13.058 -12.657 1.00 13.66 ? 136  ARG C CA  1 
ATOM   1015  C  C   . ARG B  2  24  ? -2.000  -13.656 -11.463 1.00 14.35 ? 136  ARG C C   1 
ATOM   1016  O  O   . ARG B  2  24  ? -2.698  -14.658 -11.609 1.00 15.87 ? 136  ARG C O   1 
ATOM   1017  C  CB  . ARG B  2  24  ? 0.276   -13.373 -12.516 1.00 12.91 ? 136  ARG C CB  1 
ATOM   1018  C  CG  . ARG B  2  24  ? 0.559   -14.844 -12.175 1.00 10.68 ? 136  ARG C CG  1 
ATOM   1019  C  CD  . ARG B  2  24  ? 2.007   -15.241 -12.331 1.00 10.66 ? 136  ARG C CD  1 
ATOM   1020  N  NE  . ARG B  2  24  ? 2.892   -14.501 -11.426 1.00 11.20 ? 136  ARG C NE  1 
ATOM   1021  C  CZ  . ARG B  2  24  ? 3.494   -14.988 -10.315 1.00 11.30 ? 136  ARG C CZ  1 
ATOM   1022  N  NH1 . ARG B  2  24  ? 3.266   -16.236 -9.879  1.00 6.85  ? 136  ARG C NH1 1 
ATOM   1023  N  NH2 . ARG B  2  24  ? 4.324   -14.194 -9.623  1.00 10.09 ? 136  ARG C NH2 1 
ATOM   1024  N  N   . ILE B  2  25  ? -1.834  -13.098 -10.283 1.00 13.83 ? 137  ILE C N   1 
ATOM   1025  C  CA  . ILE B  2  25  ? -2.460  -13.690 -9.103  1.00 15.44 ? 137  ILE C CA  1 
ATOM   1026  C  C   . ILE B  2  25  ? -3.814  -13.054 -8.869  1.00 16.76 ? 137  ILE C C   1 
ATOM   1027  O  O   . ILE B  2  25  ? -3.964  -12.135 -8.061  1.00 17.00 ? 137  ILE C O   1 
ATOM   1028  C  CB  . ILE B  2  25  ? -1.577  -13.549 -7.850  1.00 14.00 ? 137  ILE C CB  1 
ATOM   1029  C  CG1 . ILE B  2  25  ? -0.159  -13.958 -8.184  1.00 15.01 ? 137  ILE C CG1 1 
ATOM   1030  C  CG2 . ILE B  2  25  ? -2.108  -14.420 -6.730  1.00 12.45 ? 137  ILE C CG2 1 
ATOM   1031  C  CD1 . ILE B  2  25  ? 0.779   -13.832 -7.014  1.00 18.51 ? 137  ILE C CD1 1 
ATOM   1032  N  N   . LYS B  2  26  ? -4.794  -13.584 -9.587  1.00 20.43 ? 138  LYS C N   1 
ATOM   1033  C  CA  . LYS B  2  26  ? -6.149  -13.065 -9.607  1.00 23.38 ? 138  LYS C CA  1 
ATOM   1034  C  C   . LYS B  2  26  ? -6.844  -13.165 -8.257  1.00 24.45 ? 138  LYS C C   1 
ATOM   1035  O  O   . LYS B  2  26  ? -7.750  -12.387 -7.958  1.00 23.11 ? 138  LYS C O   1 
ATOM   1036  C  CB  . LYS B  2  26  ? -6.939  -13.782 -10.708 1.00 24.34 ? 138  LYS C CB  1 
ATOM   1037  C  CG  . LYS B  2  26  ? -6.370  -13.524 -12.100 1.00 26.06 ? 138  LYS C CG  1 
ATOM   1038  C  CD  . LYS B  2  26  ? -6.183  -12.027 -12.331 1.00 29.91 ? 138  LYS C CD  1 
ATOM   1039  C  CE  . LYS B  2  26  ? -6.043  -11.671 -13.804 1.00 31.65 ? 138  LYS C CE  1 
ATOM   1040  N  NZ  . LYS B  2  26  ? -5.918  -10.192 -14.007 1.00 33.54 ? 138  LYS C NZ  1 
ATOM   1041  N  N   . ASN B  2  27  ? -6.403  -14.113 -7.443  1.00 25.92 ? 139  ASN C N   1 
ATOM   1042  C  CA  . ASN B  2  27  ? -6.955  -14.292 -6.115  1.00 27.79 ? 139  ASN C CA  1 
ATOM   1043  C  C   . ASN B  2  27  ? -6.317  -13.254 -5.175  1.00 28.11 ? 139  ASN C C   1 
ATOM   1044  O  O   . ASN B  2  27  ? -5.198  -13.427 -4.711  1.00 25.46 ? 139  ASN C O   1 
ATOM   1045  C  CB  . ASN B  2  27  ? -6.690  -15.744 -5.624  1.00 33.67 ? 139  ASN C CB  1 
ATOM   1046  C  CG  . ASN B  2  27  ? -7.376  -16.864 -6.459  1.00 38.82 ? 139  ASN C CG  1 
ATOM   1047  O  OD1 . ASN B  2  27  ? -6.907  -17.247 -7.543  1.00 39.88 ? 139  ASN C OD1 1 
ATOM   1048  N  ND2 . ASN B  2  27  ? -8.483  -17.419 -5.940  1.00 39.46 ? 139  ASN C ND2 1 
ATOM   1049  N  N   . GLN B  2  28  ? -7.052  -12.167 -4.911  1.00 29.25 ? 140  GLN C N   1 
ATOM   1050  C  CA  . GLN B  2  28  ? -6.578  -11.037 -4.091  1.00 28.22 ? 140  GLN C CA  1 
ATOM   1051  C  C   . GLN B  2  28  ? -6.093  -11.457 -2.707  1.00 26.87 ? 140  GLN C C   1 
ATOM   1052  O  O   . GLN B  2  28  ? -5.265  -10.765 -2.110  1.00 27.10 ? 140  GLN C O   1 
ATOM   1053  C  CB  . GLN B  2  28  ? -7.683  -9.992  -3.946  1.00 29.47 ? 140  GLN C CB  1 
ATOM   1054  C  CG  . GLN B  2  28  ? -7.152  -8.580  -3.765  1.00 33.93 ? 140  GLN C CG  1 
ATOM   1055  C  CD  . GLN B  2  28  ? -8.238  -7.506  -3.757  1.00 37.42 ? 140  GLN C CD  1 
ATOM   1056  O  OE1 . GLN B  2  28  ? -9.266  -7.621  -4.451  1.00 39.30 ? 140  GLN C OE1 1 
ATOM   1057  N  NE2 . GLN B  2  28  ? -8.005  -6.445  -2.975  1.00 36.15 ? 140  GLN C NE2 1 
ATOM   1058  N  N   . ALA B  2  29  ? -6.609  -12.580 -2.214  1.00 24.31 ? 141  ALA C N   1 
ATOM   1059  C  CA  . ALA B  2  29  ? -6.265  -13.109 -0.905  1.00 22.02 ? 141  ALA C CA  1 
ATOM   1060  C  C   . ALA B  2  29  ? -5.059  -14.060 -0.935  1.00 20.15 ? 141  ALA C C   1 
ATOM   1061  O  O   . ALA B  2  29  ? -4.569  -14.433 0.132   1.00 21.93 ? 141  ALA C O   1 
ATOM   1062  C  CB  . ALA B  2  29  ? -7.478  -13.807 -0.308  1.00 23.14 ? 141  ALA C CB  1 
ATOM   1063  N  N   . ASP B  2  30  ? -4.603  -14.479 -2.146  1.00 18.40 ? 142  ASP C N   1 
ATOM   1064  C  CA  . ASP B  2  30  ? -3.382  -15.333 -2.308  1.00 17.15 ? 142  ASP C CA  1 
ATOM   1065  C  C   . ASP B  2  30  ? -2.170  -14.512 -1.843  1.00 13.82 ? 142  ASP C C   1 
ATOM   1066  O  O   . ASP B  2  30  ? -2.329  -13.473 -1.199  1.00 14.06 ? 142  ASP C O   1 
ATOM   1067  C  CB  . ASP B  2  30  ? -3.212  -15.782 -3.810  1.00 20.29 ? 142  ASP C CB  1 
ATOM   1068  C  CG  . ASP B  2  30  ? -2.142  -16.883 -4.148  1.00 23.43 ? 142  ASP C CG  1 
ATOM   1069  O  OD1 . ASP B  2  30  ? -2.159  -17.422 -5.304  1.00 23.53 ? 142  ASP C OD1 1 
ATOM   1070  O  OD2 . ASP B  2  30  ? -1.293  -17.210 -3.292  1.00 20.45 ? 142  ASP C OD2 1 
ATOM   1071  N  N   . CYS B  2  31  ? -0.977  -14.955 -2.147  1.00 10.66 ? 143  CYS C N   1 
ATOM   1072  C  CA  . CYS B  2  31  ? 0.217   -14.245 -1.707  1.00 10.31 ? 143  CYS C CA  1 
ATOM   1073  C  C   . CYS B  2  31  ? 1.425   -14.839 -2.359  1.00 9.79  ? 143  CYS C C   1 
ATOM   1074  O  O   . CYS B  2  31  ? 1.329   -15.868 -3.039  1.00 9.76  ? 143  CYS C O   1 
ATOM   1075  C  CB  . CYS B  2  31  ? 0.384   -14.319 -0.155  1.00 9.33  ? 143  CYS C CB  1 
ATOM   1076  S  SG  . CYS B  2  31  ? 0.690   -15.982 0.561   1.00 7.59  ? 143  CYS C SG  1 
ATOM   1077  N  N   . ILE B  2  32  ? 2.552   -14.164 -2.204  1.00 7.67  ? 144  ILE C N   1 
ATOM   1078  C  CA  . ILE B  2  32  ? 3.819   -14.716 -2.663  1.00 6.15  ? 144  ILE C CA  1 
ATOM   1079  C  C   . ILE B  2  32  ? 4.565   -15.119 -1.415  1.00 5.39  ? 144  ILE C C   1 
ATOM   1080  O  O   . ILE B  2  32  ? 4.686   -14.318 -0.498  1.00 4.90  ? 144  ILE C O   1 
ATOM   1081  C  CB  . ILE B  2  32  ? 4.660   -13.687 -3.518  1.00 7.68  ? 144  ILE C CB  1 
ATOM   1082  C  CG1 . ILE B  2  32  ? 3.922   -13.374 -4.842  1.00 7.46  ? 144  ILE C CG1 1 
ATOM   1083  C  CG2 . ILE B  2  32  ? 6.032   -14.257 -3.831  1.00 5.15  ? 144  ILE C CG2 1 
ATOM   1084  C  CD1 . ILE B  2  32  ? 4.488   -12.222 -5.661  1.00 8.14  ? 144  ILE C CD1 1 
ATOM   1085  N  N   . PRO B  2  33  ? 4.995   -16.396 -1.329  1.00 4.64  ? 145  PRO C N   1 
ATOM   1086  C  CA  . PRO B  2  33  ? 5.740   -16.948 -0.165  1.00 6.05  ? 145  PRO C CA  1 
ATOM   1087  C  C   . PRO B  2  33  ? 6.953   -16.084 0.287   1.00 5.30  ? 145  PRO C C   1 
ATOM   1088  O  O   . PRO B  2  33  ? 7.736   -15.619 -0.544  1.00 4.11  ? 145  PRO C O   1 
ATOM   1089  C  CB  . PRO B  2  33  ? 6.194   -18.298 -0.682  1.00 5.93  ? 145  PRO C CB  1 
ATOM   1090  C  CG  . PRO B  2  33  ? 5.058   -18.670 -1.574  1.00 6.34  ? 145  PRO C CG  1 
ATOM   1091  C  CD  . PRO B  2  33  ? 4.808   -17.431 -2.363  1.00 4.23  ? 145  PRO C CD  1 
ATOM   1092  N  N   . PHE B  2  34  ? 7.088   -15.910 1.606   1.00 5.46  ? 146  PHE C N   1 
ATOM   1093  C  CA  . PHE B  2  34  ? 8.173   -15.134 2.189   1.00 5.95  ? 146  PHE C CA  1 
ATOM   1094  C  C   . PHE B  2  34  ? 8.412   -15.478 3.656   1.00 5.09  ? 146  PHE C C   1 
ATOM   1095  O  O   . PHE B  2  34  ? 7.538   -15.353 4.492   1.00 3.84  ? 146  PHE C O   1 
ATOM   1096  C  CB  . PHE B  2  34  ? 7.886   -13.629 2.038   1.00 5.36  ? 146  PHE C CB  1 
ATOM   1097  C  CG  . PHE B  2  34  ? 8.983   -12.700 2.522   1.00 6.45  ? 146  PHE C CG  1 
ATOM   1098  C  CD1 . PHE B  2  34  ? 9.805   -12.055 1.617   1.00 7.22  ? 146  PHE C CD1 1 
ATOM   1099  C  CD2 . PHE B  2  34  ? 9.191   -12.469 3.878   1.00 6.21  ? 146  PHE C CD2 1 
ATOM   1100  C  CE1 . PHE B  2  34  ? 10.818  -11.197 2.033   1.00 6.03  ? 146  PHE C CE1 1 
ATOM   1101  C  CE2 . PHE B  2  34  ? 10.205  -11.614 4.313   1.00 5.82  ? 146  PHE C CE2 1 
ATOM   1102  C  CZ  . PHE B  2  34  ? 11.020  -10.978 3.379   1.00 3.41  ? 146  PHE C CZ  1 
ATOM   1103  N  N   . PHE B  2  35  ? 9.630   -15.909 3.945   1.00 8.29  ? 147  PHE C N   1 
ATOM   1104  C  CA  . PHE B  2  35  ? 10.118  -16.191 5.311   1.00 6.46  ? 147  PHE C CA  1 
ATOM   1105  C  C   . PHE B  2  35  ? 10.964  -15.014 5.774   1.00 6.45  ? 147  PHE C C   1 
ATOM   1106  O  O   . PHE B  2  35  ? 11.870  -14.578 5.041   1.00 4.62  ? 147  PHE C O   1 
ATOM   1107  C  CB  . PHE B  2  35  ? 11.059  -17.406 5.337   1.00 8.21  ? 147  PHE C CB  1 
ATOM   1108  C  CG  . PHE B  2  35  ? 10.441  -18.742 5.014   1.00 10.58 ? 147  PHE C CG  1 
ATOM   1109  C  CD1 . PHE B  2  35  ? 10.287  -19.152 3.679   1.00 10.54 ? 147  PHE C CD1 1 
ATOM   1110  C  CD2 . PHE B  2  35  ? 10.144  -19.647 6.043   1.00 7.41  ? 147  PHE C CD2 1 
ATOM   1111  C  CE1 . PHE B  2  35  ? 9.858   -20.455 3.389   1.00 13.05 ? 147  PHE C CE1 1 
ATOM   1112  C  CE2 . PHE B  2  35  ? 9.719   -20.937 5.751   1.00 8.40  ? 147  PHE C CE2 1 
ATOM   1113  C  CZ  . PHE B  2  35  ? 9.577   -21.347 4.426   1.00 7.44  ? 147  PHE C CZ  1 
ATOM   1114  N  N   . ARG B  2  36  ? 10.692  -14.518 6.970   1.00 2.90  ? 148  ARG C N   1 
ATOM   1115  C  CA  . ARG B  2  36  ? 11.506  -13.455 7.514   1.00 5.59  ? 148  ARG C CA  1 
ATOM   1116  C  C   . ARG B  2  36  ? 12.921  -13.966 7.748   1.00 6.96  ? 148  ARG C C   1 
ATOM   1117  O  O   . ARG B  2  36  ? 13.107  -15.128 8.132   1.00 5.83  ? 148  ARG C O   1 
ATOM   1118  C  CB  . ARG B  2  36  ? 10.949  -12.960 8.849   1.00 7.09  ? 148  ARG C CB  1 
ATOM   1119  C  CG  . ARG B  2  36  ? 9.595   -12.270 8.765   1.00 7.59  ? 148  ARG C CG  1 
ATOM   1120  C  CD  . ARG B  2  36  ? 9.398   -11.333 9.962   1.00 9.26  ? 148  ARG C CD  1 
ATOM   1121  N  NE  . ARG B  2  36  ? 10.284  -10.159 9.912   1.00 8.44  ? 148  ARG C NE  1 
ATOM   1122  C  CZ  . ARG B  2  36  ? 10.359  -9.209  10.843  1.00 5.47  ? 148  ARG C CZ  1 
ATOM   1123  N  NH1 . ARG B  2  36  ? 9.585   -9.266  11.934  1.00 2.61  ? 148  ARG C NH1 1 
ATOM   1124  N  NH2 . ARG B  2  36  ? 11.203  -8.192  10.677  1.00 2.00  ? 148  ARG C NH2 1 
ATOM   1125  N  N   . SER B  2  37  ? 13.913  -13.111 7.504   1.00 6.99  ? 149  SER C N   1 
ATOM   1126  C  CA  . SER B  2  37  ? 15.315  -13.460 7.775   1.00 6.93  ? 149  SER C CA  1 
ATOM   1127  C  C   . SER B  2  37  ? 15.469  -13.693 9.273   1.00 5.82  ? 149  SER C C   1 
ATOM   1128  O  O   . SER B  2  37  ? 14.865  -12.971 10.071  1.00 5.27  ? 149  SER C O   1 
ATOM   1129  C  CB  . SER B  2  37  ? 16.270  -12.323 7.367   1.00 2.00  ? 149  SER C CB  1 
ATOM   1130  O  OG  . SER B  2  37  ? 16.299  -12.142 5.978   1.00 5.25  ? 149  SER C OG  1 
HETATM 1131  N  N   . CSO B  2  38  ? 16.267  -14.696 9.639   1.00 5.81  ? 150  CSO C N   1 
HETATM 1132  C  CA  . CSO B  2  38  ? 16.531  -15.014 11.032  1.00 7.02  ? 150  CSO C CA  1 
HETATM 1133  C  CB  . CSO B  2  38  ? 17.608  -16.101 11.146  1.00 8.16  ? 150  CSO C CB  1 
HETATM 1134  S  SG  . CSO B  2  38  ? 17.190  -17.708 10.455  1.00 11.20 ? 150  CSO C SG  1 
HETATM 1135  C  C   . CSO B  2  38  ? 17.047  -13.796 11.789  1.00 6.47  ? 150  CSO C C   1 
HETATM 1136  O  O   . CSO B  2  38  ? 17.981  -13.110 11.333  1.00 7.75  ? 150  CSO C O   1 
HETATM 1137  O  OD  . CSO B  2  38  ? 16.254  -18.318 11.426  1.00 5.55  ? 150  CSO C OD  1 
ATOM   1138  N  N   . PRO B  2  39  ? 16.458  -13.499 12.952  1.00 6.04  ? 151  PRO C N   1 
ATOM   1139  C  CA  . PRO B  2  39  ? 16.895  -12.378 13.760  1.00 4.12  ? 151  PRO C CA  1 
ATOM   1140  C  C   . PRO B  2  39  ? 18.216  -12.717 14.510  1.00 6.11  ? 151  PRO C C   1 
ATOM   1141  O  O   . PRO B  2  39  ? 18.420  -13.845 14.944  1.00 6.47  ? 151  PRO C O   1 
ATOM   1142  C  CB  . PRO B  2  39  ? 15.709  -12.171 14.695  1.00 5.36  ? 151  PRO C CB  1 
ATOM   1143  C  CG  . PRO B  2  39  ? 15.172  -13.557 14.880  1.00 5.07  ? 151  PRO C CG  1 
ATOM   1144  C  CD  . PRO B  2  39  ? 15.281  -14.182 13.533  1.00 3.19  ? 151  PRO C CD  1 
ATOM   1145  N  N   . ALA B  2  40  ? 19.115  -11.748 14.613  1.00 6.04  ? 152  ALA C N   1 
ATOM   1146  C  CA  . ALA B  2  40  ? 20.365  -11.926 15.355  1.00 7.13  ? 152  ALA C CA  1 
ATOM   1147  C  C   . ALA B  2  40  ? 20.119  -12.272 16.838  1.00 8.89  ? 152  ALA C C   1 
ATOM   1148  O  O   . ALA B  2  40  ? 20.880  -13.060 17.408  1.00 8.74  ? 152  ALA C O   1 
ATOM   1149  C  CB  . ALA B  2  40  ? 21.229  -10.665 15.254  1.00 5.94  ? 152  ALA C CB  1 
ATOM   1150  N  N   . CYS B  2  41  ? 19.061  -11.676 17.459  1.00 8.21  ? 153  CYS C N   1 
ATOM   1151  C  CA  . CYS B  2  41  ? 18.714  -11.927 18.877  1.00 7.94  ? 153  CYS C CA  1 
ATOM   1152  C  C   . CYS B  2  41  ? 17.256  -12.338 19.008  1.00 9.49  ? 153  CYS C C   1 
ATOM   1153  O  O   . CYS B  2  41  ? 16.411  -11.529 19.390  1.00 9.40  ? 153  CYS C O   1 
ATOM   1154  C  CB  . CYS B  2  41  ? 18.949  -10.681 19.726  1.00 7.28  ? 153  CYS C CB  1 
ATOM   1155  S  SG  . CYS B  2  41  ? 18.711  -10.995 21.504  1.00 11.02 ? 153  CYS C SG  1 
ATOM   1156  N  N   . PRO B  2  42  ? 16.960  -13.624 18.786  1.00 10.91 ? 154  PRO C N   1 
ATOM   1157  C  CA  . PRO B  2  42  ? 15.589  -14.171 18.830  1.00 12.99 ? 154  PRO C CA  1 
ATOM   1158  C  C   . PRO B  2  42  ? 14.746  -13.741 20.004  1.00 14.95 ? 154  PRO C C   1 
ATOM   1159  O  O   . PRO B  2  42  ? 15.164  -13.858 21.151  1.00 15.66 ? 154  PRO C O   1 
ATOM   1160  C  CB  . PRO B  2  42  ? 15.801  -15.672 18.813  1.00 13.43 ? 154  PRO C CB  1 
ATOM   1161  C  CG  . PRO B  2  42  ? 17.049  -15.793 18.011  1.00 13.93 ? 154  PRO C CG  1 
ATOM   1162  C  CD  . PRO B  2  42  ? 17.935  -14.698 18.542  1.00 11.61 ? 154  PRO C CD  1 
ATOM   1163  N  N   . GLY B  2  43  ? 13.560  -13.198 19.665  1.00 16.90 ? 155  GLY C N   1 
ATOM   1164  C  CA  . GLY B  2  43  ? 12.529  -12.811 20.624  1.00 18.80 ? 155  GLY C CA  1 
ATOM   1165  C  C   . GLY B  2  43  ? 12.873  -11.705 21.613  1.00 20.26 ? 155  GLY C C   1 
ATOM   1166  O  O   . GLY B  2  43  ? 12.184  -11.554 22.623  1.00 22.08 ? 155  GLY C O   1 
ATOM   1167  N  N   . SER B  2  44  ? 13.894  -10.907 21.350  1.00 18.54 ? 156  SER C N   1 
ATOM   1168  C  CA  . SER B  2  44  ? 14.234  -9.866  22.299  1.00 18.14 ? 156  SER C CA  1 
ATOM   1169  C  C   . SER B  2  44  ? 13.232  -8.718  22.309  1.00 18.93 ? 156  SER C C   1 
ATOM   1170  O  O   . SER B  2  44  ? 12.721  -8.324  21.266  1.00 20.69 ? 156  SER C O   1 
ATOM   1171  C  CB  . SER B  2  44  ? 15.607  -9.296  21.994  1.00 14.80 ? 156  SER C CB  1 
ATOM   1172  O  OG  . SER B  2  44  ? 15.862  -8.170  22.820  1.00 15.46 ? 156  SER C OG  1 
ATOM   1173  N  N   . ASN B  2  45  ? 12.963  -8.170  23.485  1.00 20.44 ? 157  ASN C N   1 
ATOM   1174  C  CA  . ASN B  2  45  ? 12.168  -6.950  23.538  1.00 23.30 ? 157  ASN C CA  1 
ATOM   1175  C  C   . ASN B  2  45  ? 13.010  -5.769  24.048  1.00 21.10 ? 157  ASN C C   1 
ATOM   1176  O  O   . ASN B  2  45  ? 12.539  -4.842  24.717  1.00 21.23 ? 157  ASN C O   1 
ATOM   1177  C  CB  . ASN B  2  45  ? 10.862  -7.144  24.336  1.00 27.77 ? 157  ASN C CB  1 
ATOM   1178  C  CG  . ASN B  2  45  ? 9.663   -7.370  23.391  1.00 30.10 ? 157  ASN C CG  1 
ATOM   1179  O  OD1 . ASN B  2  45  ? 9.706   -6.996  22.214  1.00 31.23 ? 157  ASN C OD1 1 
ATOM   1180  N  ND2 . ASN B  2  45  ? 8.593   -7.977  23.901  1.00 32.35 ? 157  ASN C ND2 1 
ATOM   1181  N  N   . ILE B  2  46  ? 14.279  -5.811  23.694  1.00 18.30 ? 158  ILE C N   1 
ATOM   1182  C  CA  . ILE B  2  46  ? 15.197  -4.737  24.008  1.00 17.07 ? 158  ILE C CA  1 
ATOM   1183  C  C   . ILE B  2  46  ? 15.997  -4.348  22.770  1.00 12.74 ? 158  ILE C C   1 
ATOM   1184  O  O   . ILE B  2  46  ? 16.042  -3.167  22.403  1.00 10.75 ? 158  ILE C O   1 
ATOM   1185  C  CB  . ILE B  2  46  ? 16.100  -5.115  25.229  1.00 18.77 ? 158  ILE C CB  1 
ATOM   1186  C  CG1 . ILE B  2  46  ? 15.257  -4.904  26.498  1.00 18.19 ? 158  ILE C CG1 1 
ATOM   1187  C  CG2 . ILE B  2  46  ? 17.381  -4.270  25.293  1.00 19.74 ? 158  ILE C CG2 1 
ATOM   1188  C  CD1 . ILE B  2  46  ? 15.932  -5.285  27.776  1.00 22.95 ? 158  ILE C CD1 1 
ATOM   1189  N  N   . THR B  2  47  ? 16.545  -5.348  22.078  1.00 11.19 ? 159  THR C N   1 
ATOM   1190  C  CA  . THR B  2  47  ? 17.355  -5.093  20.871  1.00 11.60 ? 159  THR C CA  1 
ATOM   1191  C  C   . THR B  2  47  ? 16.516  -4.620  19.688  1.00 10.63 ? 159  THR C C   1 
ATOM   1192  O  O   . THR B  2  47  ? 15.312  -4.892  19.606  1.00 11.06 ? 159  THR C O   1 
ATOM   1193  C  CB  . THR B  2  47  ? 18.176  -6.361  20.403  1.00 12.46 ? 159  THR C CB  1 
ATOM   1194  O  OG1 . THR B  2  47  ? 17.290  -7.417  19.989  1.00 10.44 ? 159  THR C OG1 1 
ATOM   1195  C  CG2 . THR B  2  47  ? 19.085  -6.885  21.522  1.00 11.99 ? 159  THR C CG2 1 
ATOM   1196  N  N   . ILE B  2  48  ? 17.141  -3.870  18.792  1.00 9.66  ? 160  ILE C N   1 
ATOM   1197  C  CA  . ILE B  2  48  ? 16.489  -3.565  17.521  1.00 9.43  ? 160  ILE C CA  1 
ATOM   1198  C  C   . ILE B  2  48  ? 16.803  -4.735  16.603  1.00 8.18  ? 160  ILE C C   1 
ATOM   1199  O  O   . ILE B  2  48  ? 17.969  -5.062  16.392  1.00 9.59  ? 160  ILE C O   1 
ATOM   1200  C  CB  . ILE B  2  48  ? 17.022  -2.264  16.887  1.00 8.87  ? 160  ILE C CB  1 
ATOM   1201  C  CG1 . ILE B  2  48  ? 16.971  -1.122  17.906  1.00 7.86  ? 160  ILE C CG1 1 
ATOM   1202  C  CG2 . ILE B  2  48  ? 16.186  -1.926  15.670  1.00 7.79  ? 160  ILE C CG2 1 
ATOM   1203  C  CD1 . ILE B  2  48  ? 17.553  0.193   17.412  1.00 7.42  ? 160  ILE C CD1 1 
ATOM   1204  N  N   . ARG B  2  49  ? 15.788  -5.420  16.114  1.00 6.86  ? 161  ARG C N   1 
ATOM   1205  C  CA  . ARG B  2  49  ? 15.997  -6.596  15.286  1.00 5.04  ? 161  ARG C CA  1 
ATOM   1206  C  C   . ARG B  2  49  ? 17.033  -6.353  14.170  1.00 3.78  ? 161  ARG C C   1 
ATOM   1207  O  O   . ARG B  2  49  ? 16.997  -5.344  13.479  1.00 3.96  ? 161  ARG C O   1 
ATOM   1208  C  CB  . ARG B  2  49  ? 14.659  -7.030  14.693  1.00 5.44  ? 161  ARG C CB  1 
ATOM   1209  C  CG  . ARG B  2  49  ? 14.660  -8.330  13.905  1.00 7.51  ? 161  ARG C CG  1 
ATOM   1210  C  CD  . ARG B  2  49  ? 13.282  -8.556  13.320  1.00 7.70  ? 161  ARG C CD  1 
ATOM   1211  N  NE  . ARG B  2  49  ? 13.169  -9.787  12.573  1.00 8.94  ? 161  ARG C NE  1 
ATOM   1212  C  CZ  . ARG B  2  49  ? 12.563  -10.872 13.005  1.00 4.03  ? 161  ARG C CZ  1 
ATOM   1213  N  NH1 . ARG B  2  49  ? 12.029  -10.904 14.215  1.00 5.67  ? 161  ARG C NH1 1 
ATOM   1214  N  NH2 . ARG B  2  49  ? 12.495  -11.926 12.219  1.00 4.96  ? 161  ARG C NH2 1 
ATOM   1215  N  N   . ASN B  2  50  ? 17.976  -7.262  14.050  1.00 2.52  ? 162  ASN C N   1 
ATOM   1216  C  CA  . ASN B  2  50  ? 18.963  -7.230  12.987  1.00 2.90  ? 162  ASN C CA  1 
ATOM   1217  C  C   . ASN B  2  50  ? 19.101  -8.617  12.381  1.00 2.00  ? 162  ASN C C   1 
ATOM   1218  O  O   . ASN B  2  50  ? 18.679  -9.591  12.968  1.00 4.20  ? 162  ASN C O   1 
ATOM   1219  C  CB  . ASN B  2  50  ? 20.317  -6.742  13.505  1.00 5.34  ? 162  ASN C CB  1 
ATOM   1220  C  CG  . ASN B  2  50  ? 21.276  -6.239  12.401  1.00 5.68  ? 162  ASN C CG  1 
ATOM   1221  O  OD1 . ASN B  2  50  ? 20.948  -6.243  11.200  1.00 6.16  ? 162  ASN C OD1 1 
ATOM   1222  N  ND2 . ASN B  2  50  ? 22.475  -5.797  12.808  1.00 4.69  ? 162  ASN C ND2 1 
ATOM   1223  N  N   . GLN B  2  51  ? 19.657  -8.688  11.183  1.00 2.76  ? 163  GLN C N   1 
ATOM   1224  C  CA  . GLN B  2  51  ? 19.821  -9.937  10.491  1.00 3.17  ? 163  GLN C CA  1 
ATOM   1225  C  C   . GLN B  2  51  ? 21.272  -10.435 10.542  1.00 5.92  ? 163  GLN C C   1 
ATOM   1226  O  O   . GLN B  2  51  ? 22.181  -9.740  11.027  1.00 7.46  ? 163  GLN C O   1 
ATOM   1227  C  CB  . GLN B  2  51  ? 19.297  -9.802  9.070   1.00 4.15  ? 163  GLN C CB  1 
ATOM   1228  C  CG  . GLN B  2  51  ? 17.751  -9.629  9.032   1.00 2.83  ? 163  GLN C CG  1 
ATOM   1229  C  CD  . GLN B  2  51  ? 17.258  -8.277  9.557   1.00 2.25  ? 163  GLN C CD  1 
ATOM   1230  O  OE1 . GLN B  2  51  ? 17.870  -7.228  9.329   1.00 3.27  ? 163  GLN C OE1 1 
ATOM   1231  N  NE2 . GLN B  2  51  ? 16.128  -8.285  10.269  1.00 4.13  ? 163  GLN C NE2 1 
ATOM   1232  N  N   . ILE B  2  52  ? 21.464  -11.651 10.089  1.00 4.49  ? 164  ILE C N   1 
ATOM   1233  C  CA  . ILE B  2  52  ? 22.745  -12.340 10.219  1.00 5.08  ? 164  ILE C CA  1 
ATOM   1234  C  C   . ILE B  2  52  ? 23.396  -12.607 8.861   1.00 3.73  ? 164  ILE C C   1 
ATOM   1235  O  O   . ILE B  2  52  ? 22.700  -12.981 7.907   1.00 4.32  ? 164  ILE C O   1 
ATOM   1236  C  CB  . ILE B  2  52  ? 22.485  -13.727 10.915  1.00 5.72  ? 164  ILE C CB  1 
ATOM   1237  C  CG1 . ILE B  2  52  ? 21.895  -13.547 12.300  1.00 4.45  ? 164  ILE C CG1 1 
ATOM   1238  C  CG2 . ILE B  2  52  ? 23.736  -14.598 10.977  1.00 4.93  ? 164  ILE C CG2 1 
ATOM   1239  C  CD1 . ILE B  2  52  ? 21.337  -14.845 12.843  1.00 5.21  ? 164  ILE C CD1 1 
ATOM   1240  N  N   . ASN B  2  53  ? 24.734  -12.403 8.779   1.00 4.17  ? 165  ASN C N   1 
ATOM   1241  C  CA  . ASN B  2  53  ? 25.510  -12.878 7.639   1.00 4.00  ? 165  ASN C CA  1 
ATOM   1242  C  C   . ASN B  2  53  ? 26.111  -14.240 8.016   1.00 5.13  ? 165  ASN C C   1 
ATOM   1243  O  O   . ASN B  2  53  ? 26.882  -14.358 8.979   1.00 3.75  ? 165  ASN C O   1 
ATOM   1244  C  CB  . ASN B  2  53  ? 26.663  -11.935 7.267   1.00 3.41  ? 165  ASN C CB  1 
ATOM   1245  C  CG  . ASN B  2  53  ? 27.281  -12.249 5.895   1.00 3.26  ? 165  ASN C CG  1 
ATOM   1246  O  OD1 . ASN B  2  53  ? 26.995  -13.261 5.272   1.00 2.00  ? 165  ASN C OD1 1 
ATOM   1247  N  ND2 . ASN B  2  53  ? 28.138  -11.359 5.417   1.00 5.03  ? 165  ASN C ND2 1 
ATOM   1248  N  N   . ALA B  2  54  ? 25.747  -15.267 7.249   1.00 4.02  ? 166  ALA C N   1 
ATOM   1249  C  CA  . ALA B  2  54  ? 26.211  -16.640 7.467   1.00 4.44  ? 166  ALA C CA  1 
ATOM   1250  C  C   . ALA B  2  54  ? 27.612  -16.891 6.862   1.00 2.12  ? 166  ALA C C   1 
ATOM   1251  O  O   . ALA B  2  54  ? 28.228  -17.906 7.145   1.00 3.19  ? 166  ALA C O   1 
ATOM   1252  C  CB  . ALA B  2  54  ? 25.180  -17.604 6.860   1.00 3.86  ? 166  ALA C CB  1 
ATOM   1253  N  N   . LEU B  2  55  ? 28.082  -15.938 6.052   1.00 2.00  ? 167  LEU C N   1 
ATOM   1254  C  CA  . LEU B  2  55  ? 29.310  -16.052 5.280   1.00 3.74  ? 167  LEU C CA  1 
ATOM   1255  C  C   . LEU B  2  55  ? 30.389  -15.125 5.786   1.00 3.23  ? 167  LEU C C   1 
ATOM   1256  O  O   . LEU B  2  55  ? 30.102  -14.178 6.517   1.00 2.70  ? 167  LEU C O   1 
ATOM   1257  C  CB  . LEU B  2  55  ? 29.036  -15.672 3.835   1.00 4.10  ? 167  LEU C CB  1 
ATOM   1258  C  CG  . LEU B  2  55  ? 27.825  -16.318 3.158   1.00 6.16  ? 167  LEU C CG  1 
ATOM   1259  C  CD1 . LEU B  2  55  ? 27.743  -15.852 1.716   1.00 2.04  ? 167  LEU C CD1 1 
ATOM   1260  C  CD2 . LEU B  2  55  ? 27.942  -17.843 3.214   1.00 6.08  ? 167  LEU C CD2 1 
ATOM   1261  N  N   . THR B  2  56  ? 31.639  -15.382 5.380   1.00 4.70  ? 168  THR C N   1 
ATOM   1262  C  CA  . THR B  2  56  ? 32.687  -14.428 5.716   1.00 6.37  ? 168  THR C CA  1 
ATOM   1263  C  C   . THR B  2  56  ? 32.519  -13.237 4.782   1.00 4.92  ? 168  THR C C   1 
ATOM   1264  O  O   . THR B  2  56  ? 32.344  -13.412 3.570   1.00 5.25  ? 168  THR C O   1 
ATOM   1265  C  CB  . THR B  2  56  ? 34.130  -14.970 5.565   1.00 2.00  ? 168  THR C CB  1 
ATOM   1266  O  OG1 . THR B  2  56  ? 34.465  -15.018 4.185   1.00 2.23  ? 168  THR C OG1 1 
ATOM   1267  C  CG2 . THR B  2  56  ? 34.281  -16.347 6.184   1.00 3.76  ? 168  THR C CG2 1 
ATOM   1268  N  N   . SER B  2  57  ? 32.585  -12.037 5.354   1.00 6.72  ? 169  SER C N   1 
ATOM   1269  C  CA  . SER B  2  57  ? 32.411  -10.802 4.571   1.00 8.50  ? 169  SER C CA  1 
ATOM   1270  C  C   . SER B  2  57  ? 33.547  -10.647 3.566   1.00 7.01  ? 169  SER C C   1 
ATOM   1271  O  O   . SER B  2  57  ? 33.340  -10.113 2.464   1.00 5.72  ? 169  SER C O   1 
ATOM   1272  C  CB  . SER B  2  57  ? 32.376  -9.574  5.517   1.00 6.71  ? 169  SER C CB  1 
ATOM   1273  O  OG  . SER B  2  57  ? 33.675  -9.296  6.056   1.00 7.21  ? 169  SER C OG  1 
ATOM   1274  N  N   . PHE B  2  58  ? 34.730  -11.158 3.940   1.00 5.65  ? 170  PHE C N   1 
ATOM   1275  C  CA  . PHE B  2  58  ? 35.911  -10.994 3.109   1.00 8.18  ? 170  PHE C CA  1 
ATOM   1276  C  C   . PHE B  2  58  ? 35.753  -11.590 1.717   1.00 7.76  ? 170  PHE C C   1 
ATOM   1277  O  O   . PHE B  2  58  ? 35.037  -12.582 1.529   1.00 8.11  ? 170  PHE C O   1 
ATOM   1278  C  CB  . PHE B  2  58  ? 37.168  -11.615 3.789   1.00 7.47  ? 170  PHE C CB  1 
ATOM   1279  C  CG  . PHE B  2  58  ? 37.439  -11.042 5.134   1.00 4.82  ? 170  PHE C CG  1 
ATOM   1280  C  CD1 . PHE B  2  58  ? 37.842  -9.709  5.268   1.00 5.48  ? 170  PHE C CD1 1 
ATOM   1281  C  CD2 . PHE B  2  58  ? 37.162  -11.782 6.285   1.00 4.87  ? 170  PHE C CD2 1 
ATOM   1282  C  CE1 . PHE B  2  58  ? 37.944  -9.119  6.526   1.00 6.12  ? 170  PHE C CE1 1 
ATOM   1283  C  CE2 . PHE B  2  58  ? 37.264  -11.195 7.551   1.00 4.91  ? 170  PHE C CE2 1 
ATOM   1284  C  CZ  . PHE B  2  58  ? 37.651  -9.855  7.667   1.00 2.00  ? 170  PHE C CZ  1 
ATOM   1285  N  N   . VAL B  2  59  ? 36.397  -10.944 0.756   1.00 5.58  ? 171  VAL C N   1 
ATOM   1286  C  CA  . VAL B  2  59  ? 36.551  -11.485 -0.578  1.00 6.11  ? 171  VAL C CA  1 
ATOM   1287  C  C   . VAL B  2  59  ? 37.677  -12.547 -0.505  1.00 6.73  ? 171  VAL C C   1 
ATOM   1288  O  O   . VAL B  2  59  ? 38.857  -12.262 -0.765  1.00 6.24  ? 171  VAL C O   1 
ATOM   1289  C  CB  . VAL B  2  59  ? 36.938  -10.387 -1.560  1.00 3.09  ? 171  VAL C CB  1 
ATOM   1290  C  CG1 . VAL B  2  59  ? 37.042  -10.974 -2.953  1.00 6.38  ? 171  VAL C CG1 1 
ATOM   1291  C  CG2 . VAL B  2  59  ? 35.918  -9.280  -1.523  1.00 2.08  ? 171  VAL C CG2 1 
ATOM   1292  N  N   . ASP B  2  60  ? 37.282  -13.773 -0.108  1.00 7.73  ? 172  ASP C N   1 
ATOM   1293  C  CA  . ASP B  2  60  ? 38.217  -14.865 0.188   1.00 4.88  ? 172  ASP C CA  1 
ATOM   1294  C  C   . ASP B  2  60  ? 37.800  -16.184 -0.454  1.00 5.47  ? 172  ASP C C   1 
ATOM   1295  O  O   . ASP B  2  60  ? 38.254  -17.239 -0.058  1.00 5.57  ? 172  ASP C O   1 
ATOM   1296  C  CB  . ASP B  2  60  ? 38.305  -15.007 1.717   1.00 4.03  ? 172  ASP C CB  1 
ATOM   1297  C  CG  . ASP B  2  60  ? 36.966  -15.302 2.395   1.00 4.26  ? 172  ASP C CG  1 
ATOM   1298  O  OD1 . ASP B  2  60  ? 35.941  -15.367 1.710   1.00 3.90  ? 172  ASP C OD1 1 
ATOM   1299  O  OD2 . ASP B  2  60  ? 36.951  -15.470 3.621   1.00 6.71  ? 172  ASP C OD2 1 
ATOM   1300  N  N   . ALA B  2  61  ? 36.938  -16.108 -1.466  1.00 6.87  ? 173  ALA C N   1 
ATOM   1301  C  CA  . ALA B  2  61  ? 36.402  -17.284 -2.151  1.00 6.09  ? 173  ALA C CA  1 
ATOM   1302  C  C   . ALA B  2  61  ? 35.761  -18.309 -1.179  1.00 6.91  ? 173  ALA C C   1 
ATOM   1303  O  O   . ALA B  2  61  ? 35.849  -19.538 -1.375  1.00 5.44  ? 173  ALA C O   1 
ATOM   1304  C  CB  . ALA B  2  61  ? 37.495  -17.918 -3.007  1.00 8.39  ? 173  ALA C CB  1 
ATOM   1305  N  N   . SER B  2  62  ? 35.087  -17.805 -0.124  1.00 4.26  ? 174  SER C N   1 
ATOM   1306  C  CA  . SER B  2  62  ? 34.434  -18.693 0.835   1.00 6.10  ? 174  SER C CA  1 
ATOM   1307  C  C   . SER B  2  62  ? 33.241  -19.425 0.182   1.00 3.65  ? 174  SER C C   1 
ATOM   1308  O  O   . SER B  2  62  ? 32.729  -20.374 0.751   1.00 4.77  ? 174  SER C O   1 
ATOM   1309  C  CB  . SER B  2  62  ? 33.989  -17.921 2.083   1.00 2.00  ? 174  SER C CB  1 
ATOM   1310  O  OG  . SER B  2  62  ? 33.133  -16.838 1.732   1.00 2.00  ? 174  SER C OG  1 
ATOM   1311  N  N   . MET B  2  63  ? 32.828  -18.986 -1.018  1.00 4.27  ? 175  MET C N   1 
ATOM   1312  C  CA  . MET B  2  63  ? 31.747  -19.658 -1.743  1.00 7.27  ? 175  MET C CA  1 
ATOM   1313  C  C   . MET B  2  63  ? 32.249  -20.991 -2.327  1.00 8.12  ? 175  MET C C   1 
ATOM   1314  O  O   . MET B  2  63  ? 31.446  -21.839 -2.753  1.00 6.22  ? 175  MET C O   1 
ATOM   1315  C  CB  . MET B  2  63  ? 31.152  -18.756 -2.863  1.00 4.37  ? 175  MET C CB  1 
ATOM   1316  C  CG  . MET B  2  63  ? 32.013  -18.585 -4.117  1.00 7.72  ? 175  MET C CG  1 
ATOM   1317  S  SD  . MET B  2  63  ? 33.447  -17.530 -3.836  1.00 7.74  ? 175  MET C SD  1 
ATOM   1318  C  CE  . MET B  2  63  ? 33.477  -16.574 -5.339  1.00 3.91  ? 175  MET C CE  1 
ATOM   1319  N  N   . VAL B  2  64  ? 33.601  -21.133 -2.341  1.00 6.81  ? 176  VAL C N   1 
ATOM   1320  C  CA  . VAL B  2  64  ? 34.340  -22.330 -2.788  1.00 5.69  ? 176  VAL C CA  1 
ATOM   1321  C  C   . VAL B  2  64  ? 34.694  -23.247 -1.592  1.00 4.05  ? 176  VAL C C   1 
ATOM   1322  O  O   . VAL B  2  64  ? 34.444  -24.435 -1.620  1.00 4.16  ? 176  VAL C O   1 
ATOM   1323  C  CB  . VAL B  2  64  ? 35.681  -21.923 -3.492  1.00 4.38  ? 176  VAL C CB  1 
ATOM   1324  C  CG1 . VAL B  2  64  ? 36.475  -23.165 -3.896  1.00 5.53  ? 176  VAL C CG1 1 
ATOM   1325  C  CG2 . VAL B  2  64  ? 35.406  -21.041 -4.696  1.00 5.76  ? 176  VAL C CG2 1 
ATOM   1326  N  N   . TYR B  2  65  ? 35.256  -22.635 -0.530  1.00 5.85  ? 177  TYR C N   1 
ATOM   1327  C  CA  . TYR B  2  65  ? 35.835  -23.344 0.621   1.00 4.39  ? 177  TYR C CA  1 
ATOM   1328  C  C   . TYR B  2  65  ? 34.903  -23.522 1.826   1.00 4.27  ? 177  TYR C C   1 
ATOM   1329  O  O   . TYR B  2  65  ? 35.116  -24.424 2.642   1.00 3.52  ? 177  TYR C O   1 
ATOM   1330  C  CB  . TYR B  2  65  ? 37.117  -22.585 1.019   1.00 5.14  ? 177  TYR C CB  1 
ATOM   1331  C  CG  . TYR B  2  65  ? 38.119  -22.544 -0.120  1.00 3.08  ? 177  TYR C CG  1 
ATOM   1332  C  CD1 . TYR B  2  65  ? 38.813  -23.713 -0.489  1.00 3.49  ? 177  TYR C CD1 1 
ATOM   1333  C  CD2 . TYR B  2  65  ? 38.321  -21.391 -0.877  1.00 3.72  ? 177  TYR C CD2 1 
ATOM   1334  C  CE1 . TYR B  2  65  ? 39.662  -23.731 -1.570  1.00 2.00  ? 177  TYR C CE1 1 
ATOM   1335  C  CE2 . TYR B  2  65  ? 39.182  -21.398 -1.981  1.00 3.58  ? 177  TYR C CE2 1 
ATOM   1336  C  CZ  . TYR B  2  65  ? 39.850  -22.580 -2.319  1.00 2.58  ? 177  TYR C CZ  1 
ATOM   1337  O  OH  . TYR B  2  65  ? 40.721  -22.615 -3.381  1.00 4.87  ? 177  TYR C OH  1 
ATOM   1338  N  N   . GLY B  2  66  ? 33.860  -22.667 1.909   1.00 4.35  ? 178  GLY C N   1 
ATOM   1339  C  CA  . GLY B  2  66  ? 32.928  -22.639 3.037   1.00 5.43  ? 178  GLY C CA  1 
ATOM   1340  C  C   . GLY B  2  66  ? 33.315  -21.605 4.087   1.00 5.74  ? 178  GLY C C   1 
ATOM   1341  O  O   . GLY B  2  66  ? 34.457  -21.177 4.132   1.00 6.16  ? 178  GLY C O   1 
ATOM   1342  N  N   . SER B  2  67  ? 32.365  -21.230 4.955   1.00 5.54  ? 179  SER C N   1 
ATOM   1343  C  CA  . SER B  2  67  ? 32.605  -20.263 6.040   1.00 4.55  ? 179  SER C CA  1 
ATOM   1344  C  C   . SER B  2  67  ? 32.423  -20.877 7.450   1.00 4.44  ? 179  SER C C   1 
ATOM   1345  O  O   . SER B  2  67  ? 32.425  -20.170 8.435   1.00 5.93  ? 179  SER C O   1 
ATOM   1346  C  CB  . SER B  2  67  ? 31.655  -19.080 5.884   1.00 2.00  ? 179  SER C CB  1 
ATOM   1347  O  OG  . SER B  2  67  ? 31.762  -18.515 4.602   1.00 5.86  ? 179  SER C OG  1 
ATOM   1348  N  N   . GLU B  2  68  ? 32.226  -22.191 7.522   1.00 8.07  ? 180  GLU C N   1 
ATOM   1349  C  CA  . GLU B  2  68  ? 32.036  -22.934 8.771   1.00 12.17 ? 180  GLU C CA  1 
ATOM   1350  C  C   . GLU B  2  68  ? 32.882  -24.202 8.681   1.00 13.16 ? 180  GLU C C   1 
ATOM   1351  O  O   . GLU B  2  68  ? 32.986  -24.776 7.606   1.00 11.72 ? 180  GLU C O   1 
ATOM   1352  C  CB  . GLU B  2  68  ? 30.556  -23.315 8.959   1.00 14.47 ? 180  GLU C CB  1 
ATOM   1353  C  CG  . GLU B  2  68  ? 29.592  -22.154 8.968   1.00 21.36 ? 180  GLU C CG  1 
ATOM   1354  C  CD  . GLU B  2  68  ? 28.140  -22.581 9.187   1.00 25.62 ? 180  GLU C CD  1 
ATOM   1355  O  OE1 . GLU B  2  68  ? 27.237  -21.965 8.575   1.00 27.24 ? 180  GLU C OE1 1 
ATOM   1356  O  OE2 . GLU B  2  68  ? 27.900  -23.525 9.981   1.00 29.01 ? 180  GLU C OE2 1 
ATOM   1357  N  N   . GLU B  2  69  ? 33.456  -24.650 9.818   1.00 18.97 ? 181  GLU C N   1 
ATOM   1358  C  CA  . GLU B  2  69  ? 34.499  -25.710 9.807   1.00 21.47 ? 181  GLU C CA  1 
ATOM   1359  C  C   . GLU B  2  69  ? 34.074  -27.097 9.404   1.00 21.32 ? 181  GLU C C   1 
ATOM   1360  O  O   . GLU B  2  69  ? 34.856  -27.781 8.694   1.00 19.97 ? 181  GLU C O   1 
ATOM   1361  C  CB  . GLU B  2  69  ? 35.283  -25.779 11.113  1.00 23.46 ? 181  GLU C CB  1 
ATOM   1362  C  CG  . GLU B  2  69  ? 36.605  -25.012 11.082  1.00 27.57 ? 181  GLU C CG  1 
ATOM   1363  C  CD  . GLU B  2  69  ? 37.584  -25.440 9.973   1.00 31.26 ? 181  GLU C CD  1 
ATOM   1364  O  OE1 . GLU B  2  69  ? 38.725  -24.899 9.979   1.00 31.31 ? 181  GLU C OE1 1 
ATOM   1365  O  OE2 . GLU B  2  69  ? 37.228  -26.300 9.097   1.00 27.03 ? 181  GLU C OE2 1 
ATOM   1366  N  N   . PRO B  2  70  ? 32.893  -27.579 9.861   1.00 19.93 ? 182  PRO C N   1 
ATOM   1367  C  CA  . PRO B  2  70  ? 32.418  -28.912 9.474   1.00 16.46 ? 182  PRO C CA  1 
ATOM   1368  C  C   . PRO B  2  70  ? 32.379  -28.965 7.945   1.00 11.96 ? 182  PRO C C   1 
ATOM   1369  O  O   . PRO B  2  70  ? 33.046  -29.785 7.340   1.00 12.16 ? 182  PRO C O   1 
ATOM   1370  C  CB  . PRO B  2  70  ? 31.027  -28.980 10.099  1.00 17.92 ? 182  PRO C CB  1 
ATOM   1371  C  CG  . PRO B  2  70  ? 31.166  -28.093 11.284  1.00 18.35 ? 182  PRO C CG  1 
ATOM   1372  C  CD  . PRO B  2  70  ? 31.939  -26.918 10.775  1.00 17.48 ? 182  PRO C CD  1 
ATOM   1373  N  N   . LEU B  2  71  ? 31.642  -28.014 7.345   1.00 9.23  ? 183  LEU C N   1 
ATOM   1374  C  CA  . LEU B  2  71  ? 31.511  -27.883 5.892   1.00 7.33  ? 183  LEU C CA  1 
ATOM   1375  C  C   . LEU B  2  71  ? 32.879  -27.812 5.165   1.00 6.47  ? 183  LEU C C   1 
ATOM   1376  O  O   . LEU B  2  71  ? 33.107  -28.506 4.157   1.00 5.20  ? 183  LEU C O   1 
ATOM   1377  C  CB  . LEU B  2  71  ? 30.683  -26.627 5.531   1.00 6.79  ? 183  LEU C CB  1 
ATOM   1378  C  CG  . LEU B  2  71  ? 30.548  -26.284 4.021   1.00 6.94  ? 183  LEU C CG  1 
ATOM   1379  C  CD1 . LEU B  2  71  ? 29.850  -27.402 3.274   1.00 7.86  ? 183  LEU C CD1 1 
ATOM   1380  C  CD2 . LEU B  2  71  ? 29.792  -24.974 3.841   1.00 5.29  ? 183  LEU C CD2 1 
ATOM   1381  N  N   . ALA B  2  72  ? 33.766  -26.947 5.662   1.00 9.30  ? 184  ALA C N   1 
ATOM   1382  C  CA  . ALA B  2  72  ? 35.070  -26.753 5.033   1.00 9.52  ? 184  ALA C CA  1 
ATOM   1383  C  C   . ALA B  2  72  ? 35.812  -28.095 4.930   1.00 10.12 ? 184  ALA C C   1 
ATOM   1384  O  O   . ALA B  2  72  ? 36.333  -28.445 3.873   1.00 9.66  ? 184  ALA C O   1 
ATOM   1385  C  CB  . ALA B  2  72  ? 35.889  -25.725 5.814   1.00 5.97  ? 184  ALA C CB  1 
ATOM   1386  N  N   . ARG B  2  73  ? 35.802  -28.860 6.014   1.00 11.51 ? 185  ARG C N   1 
ATOM   1387  C  CA  . ARG B  2  73  ? 36.464  -30.150 6.013   1.00 13.62 ? 185  ARG C CA  1 
ATOM   1388  C  C   . ARG B  2  73  ? 35.731  -31.125 5.085   1.00 12.24 ? 185  ARG C C   1 
ATOM   1389  O  O   . ARG B  2  73  ? 36.364  -31.891 4.368   1.00 11.38 ? 185  ARG C O   1 
ATOM   1390  C  CB  . ARG B  2  73  ? 36.534  -30.673 7.448   1.00 17.27 ? 185  ARG C CB  1 
ATOM   1391  C  CG  . ARG B  2  73  ? 37.799  -31.455 7.789   1.00 22.97 ? 185  ARG C CG  1 
ATOM   1392  C  CD  . ARG B  2  73  ? 38.179  -31.280 9.262   1.00 26.76 ? 185  ARG C CD  1 
ATOM   1393  N  NE  . ARG B  2  73  ? 36.997  -31.198 10.111  1.00 28.81 ? 185  ARG C NE  1 
ATOM   1394  C  CZ  . ARG B  2  73  ? 36.767  -30.227 10.986  1.00 29.99 ? 185  ARG C CZ  1 
ATOM   1395  N  NH1 . ARG B  2  73  ? 37.683  -29.278 11.176  1.00 31.44 ? 185  ARG C NH1 1 
ATOM   1396  N  NH2 . ARG B  2  73  ? 35.628  -30.213 11.685  1.00 31.89 ? 185  ARG C NH2 1 
ATOM   1397  N  N   . ASN B  2  74  ? 34.396  -31.062 5.055   1.00 13.35 ? 186  ASN C N   1 
ATOM   1398  C  CA  . ASN B  2  74  ? 33.596  -31.939 4.161   1.00 14.61 ? 186  ASN C CA  1 
ATOM   1399  C  C   . ASN B  2  74  ? 33.772  -31.609 2.681   1.00 13.69 ? 186  ASN C C   1 
ATOM   1400  O  O   . ASN B  2  74  ? 33.504  -32.464 1.828   1.00 13.25 ? 186  ASN C O   1 
ATOM   1401  C  CB  . ASN B  2  74  ? 32.094  -31.913 4.519   1.00 13.86 ? 186  ASN C CB  1 
ATOM   1402  C  CG  . ASN B  2  74  ? 31.821  -32.594 5.858   1.00 17.97 ? 186  ASN C CG  1 
ATOM   1403  O  OD1 . ASN B  2  74  ? 32.705  -33.281 6.415   1.00 18.76 ? 186  ASN C OD1 1 
ATOM   1404  N  ND2 . ASN B  2  74  ? 30.608  -32.401 6.393   1.00 16.05 ? 186  ASN C ND2 1 
ATOM   1405  N  N   . LEU B  2  75  ? 34.231  -30.389 2.374   1.00 11.64 ? 187  LEU C N   1 
ATOM   1406  C  CA  . LEU B  2  75  ? 34.455  -30.003 0.983   1.00 10.58 ? 187  LEU C CA  1 
ATOM   1407  C  C   . LEU B  2  75  ? 35.797  -30.482 0.456   1.00 9.96  ? 187  LEU C C   1 
ATOM   1408  O  O   . LEU B  2  75  ? 36.002  -30.556 -0.739  1.00 9.90  ? 187  LEU C O   1 
ATOM   1409  C  CB  . LEU B  2  75  ? 34.333  -28.479 0.836   1.00 12.49 ? 187  LEU C CB  1 
ATOM   1410  C  CG  . LEU B  2  75  ? 32.898  -27.908 0.963   1.00 9.37  ? 187  LEU C CG  1 
ATOM   1411  C  CD1 . LEU B  2  75  ? 32.928  -26.428 1.300   1.00 9.26  ? 187  LEU C CD1 1 
ATOM   1412  C  CD2 . LEU B  2  75  ? 32.112  -28.156 -0.320  1.00 11.85 ? 187  LEU C CD2 1 
ATOM   1413  N  N   . ARG B  2  76  ? 36.685  -30.848 1.357   1.00 10.29 ? 188  ARG C N   1 
ATOM   1414  C  CA  . ARG B  2  76  ? 38.067  -31.250 1.011   1.00 11.38 ? 188  ARG C CA  1 
ATOM   1415  C  C   . ARG B  2  76  ? 38.262  -32.765 0.785   1.00 11.68 ? 188  ARG C C   1 
ATOM   1416  O  O   . ARG B  2  76  ? 37.665  -33.607 1.459   1.00 10.39 ? 188  ARG C O   1 
ATOM   1417  C  CB  . ARG B  2  76  ? 38.996  -30.788 2.134   1.00 8.76  ? 188  ARG C CB  1 
ATOM   1418  C  CG  . ARG B  2  76  ? 39.064  -29.283 2.320   1.00 5.22  ? 188  ARG C CG  1 
ATOM   1419  C  CD  . ARG B  2  76  ? 39.962  -28.920 3.487   1.00 5.23  ? 188  ARG C CD  1 
ATOM   1420  N  NE  . ARG B  2  76  ? 41.308  -29.527 3.383   1.00 6.38  ? 188  ARG C NE  1 
ATOM   1421  C  CZ  . ARG B  2  76  ? 42.374  -29.253 4.207   1.00 11.23 ? 188  ARG C CZ  1 
ATOM   1422  N  NH1 . ARG B  2  76  ? 42.267  -28.362 5.194   1.00 6.51  ? 188  ARG C NH1 1 
ATOM   1423  N  NH2 . ARG B  2  76  ? 43.550  -29.872 4.021   1.00 9.55  ? 188  ARG C NH2 1 
ATOM   1424  N  N   . ASN B  2  77  ? 39.101  -33.112 -0.173  1.00 13.34 ? 189  ASN C N   1 
ATOM   1425  C  CA  . ASN B  2  77  ? 39.421  -34.522 -0.390  1.00 16.01 ? 189  ASN C CA  1 
ATOM   1426  C  C   . ASN B  2  77  ? 40.460  -34.973 0.642   1.00 18.89 ? 189  ASN C C   1 
ATOM   1427  O  O   . ASN B  2  77  ? 41.658  -34.694 0.508   1.00 17.59 ? 189  ASN C O   1 
ATOM   1428  C  CB  . ASN B  2  77  ? 39.966  -34.720 -1.779  1.00 13.38 ? 189  ASN C CB  1 
ATOM   1429  C  CG  . ASN B  2  77  ? 40.241  -36.171 -2.123  1.00 14.53 ? 189  ASN C CG  1 
ATOM   1430  O  OD1 . ASN B  2  77  ? 40.378  -37.044 -1.256  1.00 13.57 ? 189  ASN C OD1 1 
ATOM   1431  N  ND2 . ASN B  2  77  ? 40.313  -36.405 -3.413  1.00 15.37 ? 189  ASN C ND2 1 
ATOM   1432  N  N   . MET B  2  78  ? 39.987  -35.670 1.657   1.00 22.48 ? 190  MET C N   1 
ATOM   1433  C  CA  . MET B  2  78  ? 40.856  -36.083 2.758   1.00 25.61 ? 190  MET C CA  1 
ATOM   1434  C  C   . MET B  2  78  ? 41.367  -37.530 2.602   1.00 24.15 ? 190  MET C C   1 
ATOM   1435  O  O   . MET B  2  78  ? 41.858  -38.128 3.567   1.00 24.22 ? 190  MET C O   1 
ATOM   1436  C  CB  . MET B  2  78  ? 40.099  -35.887 4.093   1.00 27.28 ? 190  MET C CB  1 
ATOM   1437  C  CG  . MET B  2  78  ? 39.636  -34.438 4.354   1.00 30.44 ? 190  MET C CG  1 
ATOM   1438  S  SD  . MET B  2  78  ? 40.991  -33.233 4.578   1.00 31.02 ? 190  MET C SD  1 
ATOM   1439  C  CE  . MET B  2  78  ? 40.313  -32.174 5.847   1.00 26.49 ? 190  MET C CE  1 
ATOM   1440  N  N   . SER B  2  79  ? 41.291  -38.062 1.385   1.00 20.84 ? 191  SER C N   1 
ATOM   1441  C  CA  . SER B  2  79  ? 41.689  -39.439 1.123   1.00 21.15 ? 191  SER C CA  1 
ATOM   1442  C  C   . SER B  2  79  ? 43.186  -39.586 0.838   1.00 20.45 ? 191  SER C C   1 
ATOM   1443  O  O   . SER B  2  79  ? 43.684  -40.708 0.705   1.00 19.19 ? 191  SER C O   1 
ATOM   1444  C  CB  . SER B  2  79  ? 40.883  -39.993 -0.044  1.00 22.73 ? 191  SER C CB  1 
ATOM   1445  O  OG  . SER B  2  79  ? 39.500  -40.078 0.275   1.00 24.71 ? 191  SER C OG  1 
ATOM   1446  N  N   . ASN B  2  80  ? 43.886  -38.450 0.766   1.00 19.94 ? 192  ASN C N   1 
ATOM   1447  C  CA  . ASN B  2  80  ? 45.330  -38.396 0.487   1.00 17.69 ? 192  ASN C CA  1 
ATOM   1448  C  C   . ASN B  2  80  ? 45.892  -37.076 0.953   1.00 17.45 ? 192  ASN C C   1 
ATOM   1449  O  O   . ASN B  2  80  ? 45.164  -36.255 1.502   1.00 18.87 ? 192  ASN C O   1 
ATOM   1450  C  CB  . ASN B  2  80  ? 45.580  -38.547 -1.011  1.00 17.60 ? 192  ASN C CB  1 
ATOM   1451  C  CG  . ASN B  2  80  ? 44.815  -37.531 -1.837  1.00 17.66 ? 192  ASN C CG  1 
ATOM   1452  O  OD1 . ASN B  2  80  ? 44.866  -36.336 -1.574  1.00 18.41 ? 192  ASN C OD1 1 
ATOM   1453  N  ND2 . ASN B  2  80  ? 44.101  -38.005 -2.834  1.00 19.38 ? 192  ASN C ND2 1 
ATOM   1454  N  N   . GLN B  2  81  ? 47.181  -36.865 0.723   1.00 19.01 ? 193  GLN C N   1 
ATOM   1455  C  CA  . GLN B  2  81  ? 47.855  -35.610 1.095   1.00 18.42 ? 193  GLN C CA  1 
ATOM   1456  C  C   . GLN B  2  81  ? 48.092  -34.700 -0.133  1.00 17.21 ? 193  GLN C C   1 
ATOM   1457  O  O   . GLN B  2  81  ? 49.133  -34.040 -0.244  1.00 16.34 ? 193  GLN C O   1 
ATOM   1458  C  CB  . GLN B  2  81  ? 49.177  -35.925 1.803   1.00 18.32 ? 193  GLN C CB  1 
ATOM   1459  C  CG  . GLN B  2  81  ? 48.994  -36.554 3.176   1.00 20.14 ? 193  GLN C CG  1 
ATOM   1460  C  CD  . GLN B  2  81  ? 49.027  -35.550 4.320   1.00 19.73 ? 193  GLN C CD  1 
ATOM   1461  O  OE1 . GLN B  2  81  ? 49.312  -34.380 4.132   1.00 21.04 ? 193  GLN C OE1 1 
ATOM   1462  N  NE2 . GLN B  2  81  ? 48.755  -36.019 5.531   1.00 22.87 ? 193  GLN C NE2 1 
ATOM   1463  N  N   . LEU B  2  82  ? 47.095  -34.653 -1.053  1.00 15.66 ? 194  LEU C N   1 
ATOM   1464  C  CA  . LEU B  2  82  ? 47.190  -33.845 -2.265  1.00 12.90 ? 194  LEU C CA  1 
ATOM   1465  C  C   . LEU B  2  82  ? 46.569  -32.460 -2.108  1.00 11.97 ? 194  LEU C C   1 
ATOM   1466  O  O   . LEU B  2  82  ? 46.733  -31.588 -2.985  1.00 9.56  ? 194  LEU C O   1 
ATOM   1467  C  CB  . LEU B  2  82  ? 46.587  -34.594 -3.461  1.00 11.46 ? 194  LEU C CB  1 
ATOM   1468  C  CG  . LEU B  2  82  ? 47.336  -35.873 -3.863  1.00 10.60 ? 194  LEU C CG  1 
ATOM   1469  C  CD1 . LEU B  2  82  ? 46.769  -36.421 -5.153  1.00 9.33  ? 194  LEU C CD1 1 
ATOM   1470  C  CD2 . LEU B  2  82  ? 48.839  -35.585 -4.021  1.00 10.12 ? 194  LEU C CD2 1 
ATOM   1471  N  N   . GLY B  2  83  ? 45.881  -32.265 -0.973  1.00 11.04 ? 195  GLY C N   1 
ATOM   1472  C  CA  . GLY B  2  83  ? 45.254  -30.984 -0.660  1.00 12.09 ? 195  GLY C CA  1 
ATOM   1473  C  C   . GLY B  2  83  ? 44.149  -30.570 -1.631  1.00 10.45 ? 195  GLY C C   1 
ATOM   1474  O  O   . GLY B  2  83  ? 43.974  -29.377 -1.918  1.00 12.53 ? 195  GLY C O   1 
ATOM   1475  N  N   . LEU B  2  84  ? 43.382  -31.531 -2.109  1.00 7.89  ? 196  LEU C N   1 
ATOM   1476  C  CA  . LEU B  2  84  ? 42.384  -31.223 -3.105  1.00 5.82  ? 196  LEU C CA  1 
ATOM   1477  C  C   . LEU B  2  84  ? 41.013  -31.013 -2.507  1.00 6.10  ? 196  LEU C C   1 
ATOM   1478  O  O   . LEU B  2  84  ? 40.767  -31.331 -1.327  1.00 4.55  ? 196  LEU C O   1 
ATOM   1479  C  CB  . LEU B  2  84  ? 42.317  -32.362 -4.110  1.00 6.54  ? 196  LEU C CB  1 
ATOM   1480  C  CG  . LEU B  2  84  ? 43.620  -32.792 -4.765  1.00 7.57  ? 196  LEU C CG  1 
ATOM   1481  C  CD1 . LEU B  2  84  ? 43.406  -34.097 -5.526  1.00 8.46  ? 196  LEU C CD1 1 
ATOM   1482  C  CD2 . LEU B  2  84  ? 44.138  -31.693 -5.676  1.00 4.15  ? 196  LEU C CD2 1 
ATOM   1483  N  N   . LEU B  2  85  ? 40.124  -30.432 -3.333  1.00 6.19  ? 197  LEU C N   1 
ATOM   1484  C  CA  . LEU B  2  85  ? 38.713  -30.354 -2.990  1.00 5.83  ? 197  LEU C CA  1 
ATOM   1485  C  C   . LEU B  2  85  ? 38.066  -31.643 -3.486  1.00 5.03  ? 197  LEU C C   1 
ATOM   1486  O  O   . LEU B  2  85  ? 38.493  -32.168 -4.508  1.00 6.96  ? 197  LEU C O   1 
ATOM   1487  C  CB  . LEU B  2  85  ? 38.057  -29.138 -3.664  1.00 4.34  ? 197  LEU C CB  1 
ATOM   1488  C  CG  . LEU B  2  85  ? 38.521  -27.755 -3.148  1.00 4.31  ? 197  LEU C CG  1 
ATOM   1489  C  CD1 . LEU B  2  85  ? 37.938  -26.650 -4.014  1.00 4.46  ? 197  LEU C CD1 1 
ATOM   1490  C  CD2 . LEU B  2  85  ? 38.133  -27.577 -1.682  1.00 3.61  ? 197  LEU C CD2 1 
ATOM   1491  N  N   . ALA B  2  86  ? 37.106  -32.173 -2.727  1.00 6.88  ? 198  ALA C N   1 
ATOM   1492  C  CA  . ALA B  2  86  ? 36.339  -33.364 -3.128  1.00 6.41  ? 198  ALA C CA  1 
ATOM   1493  C  C   . ALA B  2  86  ? 35.590  -33.101 -4.453  1.00 9.09  ? 198  ALA C C   1 
ATOM   1494  O  O   . ALA B  2  86  ? 35.089  -31.986 -4.699  1.00 7.10  ? 198  ALA C O   1 
ATOM   1495  C  CB  . ALA B  2  86  ? 35.339  -33.703 -2.035  1.00 2.00  ? 198  ALA C CB  1 
ATOM   1496  N  N   . VAL B  2  87  ? 35.539  -34.103 -5.323  1.00 9.13  ? 199  VAL C N   1 
ATOM   1497  C  CA  . VAL B  2  87  ? 34.818  -33.966 -6.593  1.00 9.21  ? 199  VAL C CA  1 
ATOM   1498  C  C   . VAL B  2  87  ? 33.701  -35.039 -6.725  1.00 11.01 ? 199  VAL C C   1 
ATOM   1499  O  O   . VAL B  2  87  ? 33.727  -36.093 -6.056  1.00 12.30 ? 199  VAL C O   1 
ATOM   1500  C  CB  . VAL B  2  87  ? 35.787  -34.045 -7.808  1.00 10.56 ? 199  VAL C CB  1 
ATOM   1501  C  CG1 . VAL B  2  87  ? 36.837  -32.931 -7.723  1.00 6.90  ? 199  VAL C CG1 1 
ATOM   1502  C  CG2 . VAL B  2  87  ? 36.456  -35.415 -7.868  1.00 10.31 ? 199  VAL C CG2 1 
ATOM   1503  N  N   . ASN B  2  88  ? 32.709  -34.770 -7.561  1.00 10.08 ? 200  ASN C N   1 
ATOM   1504  C  CA  . ASN B  2  88  ? 31.604  -35.709 -7.767  1.00 10.57 ? 200  ASN C CA  1 
ATOM   1505  C  C   . ASN B  2  88  ? 32.154  -37.108 -8.071  1.00 12.07 ? 200  ASN C C   1 
ATOM   1506  O  O   . ASN B  2  88  ? 33.012  -37.269 -8.942  1.00 12.25 ? 200  ASN C O   1 
ATOM   1507  C  CB  . ASN B  2  88  ? 30.726  -35.245 -8.928  1.00 8.61  ? 200  ASN C CB  1 
ATOM   1508  C  CG  . ASN B  2  88  ? 29.344  -35.849 -8.885  1.00 9.88  ? 200  ASN C CG  1 
ATOM   1509  O  OD1 . ASN B  2  88  ? 28.392  -35.210 -8.409  1.00 13.81 ? 200  ASN C OD1 1 
ATOM   1510  N  ND2 . ASN B  2  88  ? 29.217  -37.079 -9.365  1.00 6.84  ? 200  ASN C ND2 1 
ATOM   1511  N  N   . GLN B  2  89  ? 31.693  -38.092 -7.344  1.00 12.30 ? 201  GLN C N   1 
ATOM   1512  C  CA  . GLN B  2  89  ? 32.137  -39.462 -7.540  1.00 15.95 ? 201  GLN C CA  1 
ATOM   1513  C  C   . GLN B  2  89  ? 31.202  -40.235 -8.499  1.00 17.97 ? 201  GLN C C   1 
ATOM   1514  O  O   . GLN B  2  89  ? 31.415  -41.436 -8.746  1.00 19.24 ? 201  GLN C O   1 
ATOM   1515  C  CB  . GLN B  2  89  ? 32.207  -40.184 -6.180  1.00 15.89 ? 201  GLN C CB  1 
ATOM   1516  C  CG  . GLN B  2  89  ? 33.094  -39.508 -5.148  1.00 16.79 ? 201  GLN C CG  1 
ATOM   1517  C  CD  . GLN B  2  89  ? 34.540  -39.440 -5.584  1.00 18.67 ? 201  GLN C CD  1 
ATOM   1518  O  OE1 . GLN B  2  89  ? 35.151  -40.443 -5.918  1.00 22.91 ? 201  GLN C OE1 1 
ATOM   1519  N  NE2 . GLN B  2  89  ? 35.100  -38.255 -5.584  1.00 18.56 ? 201  GLN C NE2 1 
ATOM   1520  N  N   . ARG B  2  90  ? 30.170  -39.558 -9.035  1.00 18.45 ? 202  ARG C N   1 
ATOM   1521  C  CA  . ARG B  2  90  ? 29.210  -40.209 -9.941  1.00 19.48 ? 202  ARG C CA  1 
ATOM   1522  C  C   . ARG B  2  90  ? 29.294  -39.746 -11.422 1.00 18.31 ? 202  ARG C C   1 
ATOM   1523  O  O   . ARG B  2  90  ? 28.986  -40.536 -12.348 1.00 19.36 ? 202  ARG C O   1 
ATOM   1524  C  CB  . ARG B  2  90  ? 27.769  -40.030 -9.429  1.00 20.33 ? 202  ARG C CB  1 
ATOM   1525  C  CG  . ARG B  2  90  ? 27.365  -41.004 -8.348  1.00 24.40 ? 202  ARG C CG  1 
ATOM   1526  C  CD  . ARG B  2  90  ? 25.865  -41.327 -8.414  1.00 30.91 ? 202  ARG C CD  1 
ATOM   1527  N  NE  . ARG B  2  90  ? 24.998  -40.328 -7.761  1.00 32.92 ? 202  ARG C NE  1 
ATOM   1528  C  CZ  . ARG B  2  90  ? 23.728  -40.048 -8.116  1.00 33.61 ? 202  ARG C CZ  1 
ATOM   1529  N  NH1 . ARG B  2  90  ? 23.153  -40.654 -9.158  1.00 33.98 ? 202  ARG C NH1 1 
ATOM   1530  N  NH2 . ARG B  2  90  ? 23.040  -39.145 -7.436  1.00 33.94 ? 202  ARG C NH2 1 
ATOM   1531  N  N   . PHE B  2  91  ? 29.691  -38.480 -11.661 1.00 13.32 ? 203  PHE C N   1 
ATOM   1532  C  CA  . PHE B  2  91  ? 29.733  -37.954 -13.036 1.00 11.12 ? 203  PHE C CA  1 
ATOM   1533  C  C   . PHE B  2  91  ? 30.938  -37.079 -13.258 1.00 12.12 ? 203  PHE C C   1 
ATOM   1534  O  O   . PHE B  2  91  ? 31.425  -36.414 -12.333 1.00 10.94 ? 203  PHE C O   1 
ATOM   1535  C  CB  . PHE B  2  91  ? 28.504  -37.077 -13.344 1.00 9.76  ? 203  PHE C CB  1 
ATOM   1536  C  CG  . PHE B  2  91  ? 27.186  -37.733 -13.113 1.00 9.03  ? 203  PHE C CG  1 
ATOM   1537  C  CD1 . PHE B  2  91  ? 26.602  -38.511 -14.104 1.00 10.07 ? 203  PHE C CD1 1 
ATOM   1538  C  CD2 . PHE B  2  91  ? 26.516  -37.567 -11.908 1.00 8.83  ? 203  PHE C CD2 1 
ATOM   1539  C  CE1 . PHE B  2  91  ? 25.363  -39.113 -13.886 1.00 10.43 ? 203  PHE C CE1 1 
ATOM   1540  C  CE2 . PHE B  2  91  ? 25.277  -38.165 -11.684 1.00 9.71  ? 203  PHE C CE2 1 
ATOM   1541  C  CZ  . PHE B  2  91  ? 24.703  -38.938 -12.673 1.00 9.45  ? 203  PHE C CZ  1 
ATOM   1542  N  N   . GLN B  2  92  ? 31.391  -37.086 -14.494 1.00 13.42 ? 204  GLN C N   1 
ATOM   1543  C  CA  . GLN B  2  92  ? 32.441  -36.198 -14.964 1.00 16.34 ? 204  GLN C CA  1 
ATOM   1544  C  C   . GLN B  2  92  ? 31.938  -35.450 -16.188 1.00 14.36 ? 204  GLN C C   1 
ATOM   1545  O  O   . GLN B  2  92  ? 30.971  -35.869 -16.819 1.00 12.37 ? 204  GLN C O   1 
ATOM   1546  C  CB  . GLN B  2  92  ? 33.731  -36.955 -15.315 1.00 16.87 ? 204  GLN C CB  1 
ATOM   1547  C  CG  . GLN B  2  92  ? 34.712  -37.055 -14.164 1.00 21.38 ? 204  GLN C CG  1 
ATOM   1548  C  CD  . GLN B  2  92  ? 35.797  -38.093 -14.417 1.00 26.21 ? 204  GLN C CD  1 
ATOM   1549  O  OE1 . GLN B  2  92  ? 35.741  -38.838 -15.394 1.00 29.77 ? 204  GLN C OE1 1 
ATOM   1550  N  NE2 . GLN B  2  92  ? 36.786  -38.160 -13.528 1.00 28.86 ? 204  GLN C NE2 1 
ATOM   1551  N  N   . ASP B  2  93  ? 32.598  -34.344 -16.479 1.00 13.52 ? 205  ASP C N   1 
ATOM   1552  C  CA  . ASP B  2  93  ? 32.289  -33.447 -17.580 1.00 13.04 ? 205  ASP C CA  1 
ATOM   1553  C  C   . ASP B  2  93  ? 33.408  -33.521 -18.617 1.00 11.49 ? 205  ASP C C   1 
ATOM   1554  O  O   . ASP B  2  93  ? 34.370  -32.768 -18.562 1.00 10.34 ? 205  ASP C O   1 
ATOM   1555  C  CB  . ASP B  2  93  ? 32.131  -32.022 -17.000 1.00 10.33 ? 205  ASP C CB  1 
ATOM   1556  C  CG  . ASP B  2  93  ? 31.890  -30.922 -18.018 1.00 10.51 ? 205  ASP C CG  1 
ATOM   1557  O  OD1 . ASP B  2  93  ? 31.957  -29.745 -17.610 1.00 7.99  ? 205  ASP C OD1 1 
ATOM   1558  O  OD2 . ASP B  2  93  ? 31.646  -31.221 -19.228 1.00 9.59  ? 205  ASP C OD2 1 
ATOM   1559  N  N   . ASN B  2  94  ? 33.239  -34.441 -19.572 1.00 13.35 ? 206  ASN C N   1 
ATOM   1560  C  CA  . ASN B  2  94  ? 34.232  -34.748 -20.608 1.00 15.15 ? 206  ASN C CA  1 
ATOM   1561  C  C   . ASN B  2  94  ? 35.599  -34.981 -19.970 1.00 15.28 ? 206  ASN C C   1 
ATOM   1562  O  O   . ASN B  2  94  ? 36.600  -34.462 -20.451 1.00 15.64 ? 206  ASN C O   1 
ATOM   1563  C  CB  . ASN B  2  94  ? 34.323  -33.641 -21.674 1.00 15.03 ? 206  ASN C CB  1 
ATOM   1564  C  CG  . ASN B  2  94  ? 33.027  -33.455 -22.461 1.00 21.02 ? 206  ASN C CG  1 
ATOM   1565  O  OD1 . ASN B  2  94  ? 32.369  -34.425 -22.872 1.00 21.48 ? 206  ASN C OD1 1 
ATOM   1566  N  ND2 . ASN B  2  94  ? 32.637  -32.196 -22.676 1.00 22.46 ? 206  ASN C ND2 1 
ATOM   1567  N  N   . GLY B  2  95  ? 35.613  -35.739 -18.851 1.00 14.02 ? 207  GLY C N   1 
ATOM   1568  C  CA  . GLY B  2  95  ? 36.863  -36.071 -18.169 1.00 13.06 ? 207  GLY C CA  1 
ATOM   1569  C  C   . GLY B  2  95  ? 37.274  -35.088 -17.081 1.00 14.83 ? 207  GLY C C   1 
ATOM   1570  O  O   . GLY B  2  95  ? 38.258  -35.320 -16.387 1.00 15.28 ? 207  GLY C O   1 
ATOM   1571  N  N   . ARG B  2  96  ? 36.526  -33.989 -16.917 1.00 14.38 ? 208  ARG C N   1 
ATOM   1572  C  CA  . ARG B  2  96  ? 36.855  -32.970 -15.922 1.00 12.34 ? 208  ARG C CA  1 
ATOM   1573  C  C   . ARG B  2  96  ? 35.919  -32.995 -14.719 1.00 12.83 ? 208  ARG C C   1 
ATOM   1574  O  O   . ARG B  2  96  ? 34.804  -33.544 -14.772 1.00 10.20 ? 208  ARG C O   1 
ATOM   1575  C  CB  . ARG B  2  96  ? 36.866  -31.611 -16.577 1.00 10.97 ? 208  ARG C CB  1 
ATOM   1576  C  CG  . ARG B  2  96  ? 37.784  -31.568 -17.780 1.00 12.95 ? 208  ARG C CG  1 
ATOM   1577  C  CD  . ARG B  2  96  ? 38.041  -30.140 -18.178 1.00 14.63 ? 208  ARG C CD  1 
ATOM   1578  N  NE  . ARG B  2  96  ? 39.306  -29.976 -18.871 1.00 19.87 ? 208  ARG C NE  1 
ATOM   1579  C  CZ  . ARG B  2  96  ? 39.496  -30.235 -20.160 1.00 22.76 ? 208  ARG C CZ  1 
ATOM   1580  N  NH1 . ARG B  2  96  ? 38.503  -30.717 -20.915 1.00 22.80 ? 208  ARG C NH1 1 
ATOM   1581  N  NH2 . ARG B  2  96  ? 40.689  -30.013 -20.696 1.00 22.35 ? 208  ARG C NH2 1 
ATOM   1582  N  N   . ALA B  2  97  ? 36.368  -32.397 -13.623 1.00 11.83 ? 209  ALA C N   1 
ATOM   1583  C  CA  . ALA B  2  97  ? 35.627  -32.480 -12.362 1.00 12.18 ? 209  ALA C CA  1 
ATOM   1584  C  C   . ALA B  2  97  ? 34.285  -31.713 -12.311 1.00 10.99 ? 209  ALA C C   1 
ATOM   1585  O  O   . ALA B  2  97  ? 34.134  -30.601 -12.840 1.00 12.27 ? 209  ALA C O   1 
ATOM   1586  C  CB  . ALA B  2  97  ? 36.520  -32.033 -11.208 1.00 8.56  ? 209  ALA C CB  1 
ATOM   1587  N  N   . LEU B  2  98  ? 33.317  -32.318 -11.659 1.00 9.74  ? 210  LEU C N   1 
ATOM   1588  C  CA  . LEU B  2  98  ? 32.096  -31.615 -11.339 1.00 8.58  ? 210  LEU C CA  1 
ATOM   1589  C  C   . LEU B  2  98  ? 32.006  -31.541 -9.845  1.00 8.10  ? 210  LEU C C   1 
ATOM   1590  O  O   . LEU B  2  98  ? 32.720  -32.277 -9.143  1.00 8.55  ? 210  LEU C O   1 
ATOM   1591  C  CB  . LEU B  2  98  ? 30.863  -32.325 -11.901 1.00 9.06  ? 210  LEU C CB  1 
ATOM   1592  C  CG  . LEU B  2  98  ? 30.665  -32.255 -13.409 1.00 8.66  ? 210  LEU C CG  1 
ATOM   1593  C  CD1 . LEU B  2  98  ? 29.561  -33.205 -13.815 1.00 9.03  ? 210  LEU C CD1 1 
ATOM   1594  C  CD2 . LEU B  2  98  ? 30.351  -30.823 -13.851 1.00 6.11  ? 210  LEU C CD2 1 
ATOM   1595  N  N   . LEU B  2  99  ? 31.167  -30.647 -9.350  1.00 7.43  ? 211  LEU C N   1 
ATOM   1596  C  CA  . LEU B  2  99  ? 30.987  -30.525 -7.930  1.00 6.33  ? 211  LEU C CA  1 
ATOM   1597  C  C   . LEU B  2  99  ? 30.360  -31.775 -7.379  1.00 7.11  ? 211  LEU C C   1 
ATOM   1598  O  O   . LEU B  2  99  ? 29.648  -32.451 -8.101  1.00 7.63  ? 211  LEU C O   1 
ATOM   1599  C  CB  . LEU B  2  99  ? 30.085  -29.312 -7.615  1.00 7.94  ? 211  LEU C CB  1 
ATOM   1600  C  CG  . LEU B  2  99  ? 30.645  -27.920 -7.960  1.00 7.37  ? 211  LEU C CG  1 
ATOM   1601  C  CD1 . LEU B  2  99  ? 29.511  -26.914 -8.026  1.00 9.09  ? 211  LEU C CD1 1 
ATOM   1602  C  CD2 . LEU B  2  99  ? 31.698  -27.499 -6.941  1.00 5.73  ? 211  LEU C CD2 1 
ATOM   1603  N  N   . PRO B  2  100 ? 30.692  -32.175 -6.123  1.00 9.09  ? 212  PRO C N   1 
ATOM   1604  C  CA  . PRO B  2  100 ? 30.071  -33.343 -5.502  1.00 9.39  ? 212  PRO C CA  1 
ATOM   1605  C  C   . PRO B  2  100 ? 28.597  -33.010 -5.224  1.00 12.95 ? 212  PRO C C   1 
ATOM   1606  O  O   . PRO B  2  100 ? 28.237  -31.832 -5.076  1.00 11.83 ? 212  PRO C O   1 
ATOM   1607  C  CB  . PRO B  2  100 ? 30.854  -33.536 -4.213  1.00 9.50  ? 212  PRO C CB  1 
ATOM   1608  C  CG  . PRO B  2  100 ? 31.360  -32.165 -3.928  1.00 11.69 ? 212  PRO C CG  1 
ATOM   1609  C  CD  . PRO B  2  100 ? 31.761  -31.625 -5.260  1.00 8.62  ? 212  PRO C CD  1 
ATOM   1610  N  N   . PHE B  2  101 ? 27.750  -34.032 -5.207  1.00 12.09 ? 213  PHE C N   1 
ATOM   1611  C  CA  . PHE B  2  101 ? 26.352  -33.853 -4.895  1.00 11.37 ? 213  PHE C CA  1 
ATOM   1612  C  C   . PHE B  2  101 ? 26.166  -33.548 -3.427  1.00 12.38 ? 213  PHE C C   1 
ATOM   1613  O  O   . PHE B  2  101 ? 26.953  -33.994 -2.585  1.00 11.75 ? 213  PHE C O   1 
ATOM   1614  C  CB  . PHE B  2  101 ? 25.585  -35.107 -5.263  1.00 8.61  ? 213  PHE C CB  1 
ATOM   1615  C  CG  . PHE B  2  101 ? 25.401  -35.263 -6.744  1.00 10.98 ? 213  PHE C CG  1 
ATOM   1616  C  CD1 . PHE B  2  101 ? 25.548  -36.504 -7.352  1.00 9.66  ? 213  PHE C CD1 1 
ATOM   1617  C  CD2 . PHE B  2  101 ? 24.988  -34.177 -7.530  1.00 10.64 ? 213  PHE C CD2 1 
ATOM   1618  C  CE1 . PHE B  2  101 ? 25.276  -36.661 -8.710  1.00 11.97 ? 213  PHE C CE1 1 
ATOM   1619  C  CE2 . PHE B  2  101 ? 24.716  -34.333 -8.888  1.00 12.43 ? 213  PHE C CE2 1 
ATOM   1620  C  CZ  . PHE B  2  101 ? 24.858  -35.575 -9.481  1.00 10.82 ? 213  PHE C CZ  1 
ATOM   1621  N  N   . ASP B  2  102 ? 25.159  -32.733 -3.133  1.00 14.58 ? 214  ASP C N   1 
ATOM   1622  C  CA  . ASP B  2  102 ? 24.787  -32.397 -1.758  1.00 17.22 ? 214  ASP C CA  1 
ATOM   1623  C  C   . ASP B  2  102 ? 23.761  -33.431 -1.266  1.00 19.52 ? 214  ASP C C   1 
ATOM   1624  O  O   . ASP B  2  102 ? 23.290  -34.268 -2.043  1.00 17.35 ? 214  ASP C O   1 
ATOM   1625  C  CB  . ASP B  2  102 ? 24.187  -30.985 -1.710  1.00 18.77 ? 214  ASP C CB  1 
ATOM   1626  C  CG  . ASP B  2  102 ? 24.407  -30.234 -0.401  1.00 24.88 ? 214  ASP C CG  1 
ATOM   1627  O  OD1 . ASP B  2  102 ? 24.597  -28.987 -0.445  1.00 26.78 ? 214  ASP C OD1 1 
ATOM   1628  O  OD2 . ASP B  2  102 ? 24.385  -30.868 0.679   1.00 27.25 ? 214  ASP C OD2 1 
ATOM   1629  N  N   . ASN B  2  103 ? 23.435  -33.375 0.013   1.00 21.08 ? 215  ASN C N   1 
ATOM   1630  C  CA  . ASN B  2  103 ? 22.467  -34.282 0.623   1.00 26.40 ? 215  ASN C CA  1 
ATOM   1631  C  C   . ASN B  2  103 ? 21.440  -33.470 1.430   1.00 26.15 ? 215  ASN C C   1 
ATOM   1632  O  O   . ASN B  2  103 ? 21.515  -33.346 2.656   1.00 28.28 ? 215  ASN C O   1 
ATOM   1633  C  CB  . ASN B  2  103 ? 23.211  -35.291 1.513   1.00 27.94 ? 215  ASN C CB  1 
ATOM   1634  C  CG  . ASN B  2  103 ? 22.341  -36.451 1.942   1.00 31.63 ? 215  ASN C CG  1 
ATOM   1635  O  OD1 . ASN B  2  103 ? 21.373  -36.802 1.260   1.00 35.24 ? 215  ASN C OD1 1 
ATOM   1636  N  ND2 . ASN B  2  103 ? 22.677  -37.058 3.075   1.00 32.03 ? 215  ASN C ND2 1 
ATOM   1637  N  N   . LEU B  2  104 ? 20.499  -32.893 0.731   1.00 27.25 ? 216  LEU C N   1 
ATOM   1638  C  CA  . LEU B  2  104 ? 19.501  -32.054 1.367   1.00 30.29 ? 216  LEU C CA  1 
ATOM   1639  C  C   . LEU B  2  104 ? 18.275  -32.879 1.765   1.00 33.11 ? 216  LEU C C   1 
ATOM   1640  O  O   . LEU B  2  104 ? 18.199  -34.084 1.457   1.00 33.11 ? 216  LEU C O   1 
ATOM   1641  C  CB  . LEU B  2  104 ? 19.129  -30.899 0.418   1.00 28.18 ? 216  LEU C CB  1 
ATOM   1642  C  CG  . LEU B  2  104 ? 20.333  -30.081 -0.127  1.00 28.24 ? 216  LEU C CG  1 
ATOM   1643  C  CD1 . LEU B  2  104 ? 19.875  -29.106 -1.203  1.00 24.80 ? 216  LEU C CD1 1 
ATOM   1644  C  CD2 . LEU B  2  104 ? 21.050  -29.349 1.008   1.00 22.83 ? 216  LEU C CD2 1 
ATOM   1645  N  N   . HIS B  2  105 ? 17.343  -32.237 2.487   1.00 35.85 ? 217  HIS C N   1 
ATOM   1646  C  CA  . HIS B  2  105 ? 16.120  -32.907 2.928   1.00 37.42 ? 217  HIS C CA  1 
ATOM   1647  C  C   . HIS B  2  105 ? 15.157  -33.058 1.760   1.00 36.37 ? 217  HIS C C   1 
ATOM   1648  O  O   . HIS B  2  105 ? 15.036  -34.146 1.194   1.00 38.18 ? 217  HIS C O   1 
ATOM   1649  C  CB  . HIS B  2  105 ? 15.474  -32.139 4.096   1.00 40.22 ? 217  HIS C CB  1 
ATOM   1650  C  CG  . HIS B  2  105 ? 15.357  -32.965 5.362   1.00 45.01 ? 217  HIS C CG  1 
ATOM   1651  N  ND1 . HIS B  2  105 ? 16.232  -34.002 5.674   1.00 45.11 ? 217  HIS C ND1 1 
ATOM   1652  C  CD2 . HIS B  2  105 ? 14.444  -32.927 6.375   1.00 44.63 ? 217  HIS C CD2 1 
ATOM   1653  C  CE1 . HIS B  2  105 ? 15.860  -34.557 6.816   1.00 45.23 ? 217  HIS C CE1 1 
ATOM   1654  N  NE2 . HIS B  2  105 ? 14.780  -33.925 7.260   1.00 45.15 ? 217  HIS C NE2 1 
ATOM   1655  N  N   . ASP B  2  106 ? 14.469  -31.985 1.393   1.00 34.26 ? 218  ASP C N   1 
ATOM   1656  C  CA  . ASP B  2  106 ? 13.616  -32.008 0.196   1.00 32.36 ? 218  ASP C CA  1 
ATOM   1657  C  C   . ASP B  2  106 ? 14.328  -31.203 -0.890  1.00 28.83 ? 218  ASP C C   1 
ATOM   1658  O  O   . ASP B  2  106 ? 14.007  -30.036 -1.151  1.00 27.79 ? 218  ASP C O   1 
ATOM   1659  C  CB  . ASP B  2  106 ? 12.216  -31.410 0.458   1.00 34.42 ? 218  ASP C CB  1 
ATOM   1660  C  CG  . ASP B  2  106 ? 11.449  -32.034 1.622   1.00 36.52 ? 218  ASP C CG  1 
ATOM   1661  O  OD1 . ASP B  2  106 ? 11.896  -33.075 2.188   1.00 39.06 ? 218  ASP C OD1 1 
ATOM   1662  O  OD2 . ASP B  2  106 ? 10.393  -31.471 1.978   1.00 38.22 ? 218  ASP C OD2 1 
ATOM   1663  N  N   . ASP B  2  107 ? 15.341  -31.838 -1.469  1.00 25.29 ? 219  ASP C N   1 
ATOM   1664  C  CA  . ASP B  2  107 ? 16.195  -31.255 -2.487  1.00 20.65 ? 219  ASP C CA  1 
ATOM   1665  C  C   . ASP B  2  107 ? 15.350  -30.614 -3.615  1.00 18.38 ? 219  ASP C C   1 
ATOM   1666  O  O   . ASP B  2  107 ? 14.582  -31.282 -4.330  1.00 12.30 ? 219  ASP C O   1 
ATOM   1667  C  CB  . ASP B  2  107 ? 17.114  -32.367 -3.009  1.00 19.01 ? 219  ASP C CB  1 
ATOM   1668  C  CG  . ASP B  2  107 ? 18.172  -31.897 -3.959  1.00 21.02 ? 219  ASP C CG  1 
ATOM   1669  O  OD1 . ASP B  2  107 ? 19.353  -31.885 -3.577  1.00 23.54 ? 219  ASP C OD1 1 
ATOM   1670  O  OD2 . ASP B  2  107 ? 17.833  -31.555 -5.100  1.00 23.25 ? 219  ASP C OD2 1 
ATOM   1671  N  N   . PRO B  2  108 ? 15.474  -29.283 -3.763  1.00 17.33 ? 220  PRO C N   1 
ATOM   1672  C  CA  . PRO B  2  108 ? 14.737  -28.528 -4.783  1.00 14.98 ? 220  PRO C CA  1 
ATOM   1673  C  C   . PRO B  2  108 ? 15.166  -28.888 -6.206  1.00 13.11 ? 220  PRO C C   1 
ATOM   1674  O  O   . PRO B  2  108 ? 14.365  -28.823 -7.143  1.00 13.02 ? 220  PRO C O   1 
ATOM   1675  C  CB  . PRO B  2  108 ? 15.038  -27.067 -4.415  1.00 16.69 ? 220  PRO C CB  1 
ATOM   1676  C  CG  . PRO B  2  108 ? 16.400  -27.161 -3.802  1.00 16.61 ? 220  PRO C CG  1 
ATOM   1677  C  CD  . PRO B  2  108 ? 16.343  -28.391 -2.945  1.00 14.90 ? 220  PRO C CD  1 
ATOM   1678  N  N   . CYS B  2  109 ? 16.429  -29.294 -6.366  1.00 10.60 ? 221  CYS C N   1 
ATOM   1679  C  CA  . CYS B  2  109 ? 16.931  -29.648 -7.681  1.00 9.20  ? 221  CYS C CA  1 
ATOM   1680  C  C   . CYS B  2  109 ? 16.236  -30.902 -8.257  1.00 9.59  ? 221  CYS C C   1 
ATOM   1681  O  O   . CYS B  2  109 ? 15.977  -30.979 -9.467  1.00 9.89  ? 221  CYS C O   1 
ATOM   1682  C  CB  . CYS B  2  109 ? 18.458  -29.825 -7.634  1.00 8.52  ? 221  CYS C CB  1 
ATOM   1683  S  SG  . CYS B  2  109 ? 19.376  -28.324 -7.084  1.00 8.72  ? 221  CYS C SG  1 
ATOM   1684  N  N   . LEU B  2  110 ? 15.921  -31.862 -7.399  1.00 9.61  ? 222  LEU C N   1 
ATOM   1685  C  CA  . LEU B  2  110 ? 15.214  -33.077 -7.819  1.00 12.41 ? 222  LEU C CA  1 
ATOM   1686  C  C   . LEU B  2  110 ? 13.928  -32.737 -8.543  1.00 14.25 ? 222  LEU C C   1 
ATOM   1687  O  O   . LEU B  2  110 ? 13.596  -33.354 -9.557  1.00 16.01 ? 222  LEU C O   1 
ATOM   1688  C  CB  . LEU B  2  110 ? 14.895  -33.969 -6.607  1.00 10.94 ? 222  LEU C CB  1 
ATOM   1689  C  CG  . LEU B  2  110 ? 16.098  -34.692 -5.973  1.00 10.14 ? 222  LEU C CG  1 
ATOM   1690  C  CD1 . LEU B  2  110 ? 15.622  -35.645 -4.880  1.00 9.42  ? 222  LEU C CD1 1 
ATOM   1691  C  CD2 . LEU B  2  110 ? 16.869  -35.440 -7.051  1.00 5.81  ? 222  LEU C CD2 1 
ATOM   1692  N  N   . LEU B  2  111 ? 13.259  -31.704 -8.045  1.00 15.81 ? 223  LEU C N   1 
ATOM   1693  C  CA  . LEU B  2  111 ? 11.965  -31.250 -8.570  1.00 16.40 ? 223  LEU C CA  1 
ATOM   1694  C  C   . LEU B  2  111 ? 12.024  -30.616 -9.971  1.00 16.02 ? 223  LEU C C   1 
ATOM   1695  O  O   . LEU B  2  111 ? 10.999  -30.594 -10.688 1.00 17.72 ? 223  LEU C O   1 
ATOM   1696  C  CB  . LEU B  2  111 ? 11.329  -30.279 -7.563  1.00 13.83 ? 223  LEU C CB  1 
ATOM   1697  C  CG  . LEU B  2  111 ? 11.291  -30.780 -6.118  1.00 15.66 ? 223  LEU C CG  1 
ATOM   1698  C  CD1 . LEU B  2  111 ? 10.705  -29.713 -5.203  1.00 16.90 ? 223  LEU C CD1 1 
ATOM   1699  C  CD2 . LEU B  2  111 ? 10.503  -32.081 -6.036  1.00 14.59 ? 223  LEU C CD2 1 
ATOM   1700  N  N   . THR B  2  112 ? 13.189  -30.120 -10.394 1.00 12.77 ? 224  THR C N   1 
ATOM   1701  C  CA  . THR B  2  112 ? 13.276  -29.446 -11.698 1.00 13.80 ? 224  THR C CA  1 
ATOM   1702  C  C   . THR B  2  112 ? 13.137  -30.412 -12.879 1.00 14.06 ? 224  THR C C   1 
ATOM   1703  O  O   . THR B  2  112 ? 12.679  -30.023 -13.947 1.00 14.35 ? 224  THR C O   1 
ATOM   1704  C  CB  . THR B  2  112 ? 14.575  -28.606 -11.837 1.00 11.75 ? 224  THR C CB  1 
ATOM   1705  O  OG1 . THR B  2  112 ? 15.711  -29.426 -11.622 1.00 12.57 ? 224  THR C OG1 1 
ATOM   1706  C  CG2 . THR B  2  112 ? 14.587  -27.485 -10.823 1.00 9.21  ? 224  THR C CG2 1 
ATOM   1707  N  N   . ASN B  2  113 ? 13.566  -31.659 -12.677 1.00 16.06 ? 225  ASN C N   1 
ATOM   1708  C  CA  . ASN B  2  113 ? 13.397  -32.748 -13.641 1.00 14.81 ? 225  ASN C CA  1 
ATOM   1709  C  C   . ASN B  2  113 ? 13.274  -34.034 -12.848 1.00 14.40 ? 225  ASN C C   1 
ATOM   1710  O  O   . ASN B  2  113 ? 14.273  -34.659 -12.487 1.00 12.74 ? 225  ASN C O   1 
ATOM   1711  C  CB  . ASN B  2  113 ? 14.565  -32.839 -14.651 1.00 16.03 ? 225  ASN C CB  1 
ATOM   1712  C  CG  . ASN B  2  113 ? 14.318  -33.899 -15.733 1.00 17.88 ? 225  ASN C CG  1 
ATOM   1713  O  OD1 . ASN B  2  113 ? 13.739  -34.981 -15.465 1.00 16.77 ? 225  ASN C OD1 1 
ATOM   1714  N  ND2 . ASN B  2  113 ? 14.746  -33.604 -16.958 1.00 18.30 ? 225  ASN C ND2 1 
ATOM   1715  N  N   . ARG B  2  114 ? 12.031  -34.422 -12.585 1.00 13.78 ? 226  ARG C N   1 
ATOM   1716  C  CA  . ARG B  2  114 ? 11.750  -35.552 -11.737 1.00 16.01 ? 226  ARG C CA  1 
ATOM   1717  C  C   . ARG B  2  114 ? 12.395  -36.857 -12.199 1.00 16.41 ? 226  ARG C C   1 
ATOM   1718  O  O   . ARG B  2  114 ? 12.962  -37.584 -11.375 1.00 14.49 ? 226  ARG C O   1 
ATOM   1719  C  CB  . ARG B  2  114 ? 10.242  -35.681 -11.531 1.00 17.38 ? 226  ARG C CB  1 
ATOM   1720  C  CG  . ARG B  2  114 ? 9.725   -34.579 -10.619 1.00 20.33 ? 226  ARG C CG  1 
ATOM   1721  C  CD  . ARG B  2  114 ? 8.251   -34.709 -10.323 1.00 24.16 ? 226  ARG C CD  1 
ATOM   1722  N  NE  . ARG B  2  114 ? 7.884   -34.035 -9.068  1.00 27.08 ? 226  ARG C NE  1 
ATOM   1723  C  CZ  . ARG B  2  114 ? 7.535   -32.749 -8.958  1.00 26.19 ? 226  ARG C CZ  1 
ATOM   1724  N  NH1 . ARG B  2  114 ? 7.494   -31.974 -10.032 1.00 28.26 ? 226  ARG C NH1 1 
ATOM   1725  N  NH2 . ARG B  2  114 ? 7.228   -32.244 -7.770  1.00 23.60 ? 226  ARG C NH2 1 
ATOM   1726  N  N   . SER B  2  115 ? 12.383  -37.122 -13.502 1.00 17.27 ? 227  SER C N   1 
ATOM   1727  C  CA  . SER B  2  115 ? 12.981  -38.361 -14.018 1.00 17.41 ? 227  SER C CA  1 
ATOM   1728  C  C   . SER B  2  115 ? 14.511  -38.382 -13.934 1.00 17.37 ? 227  SER C C   1 
ATOM   1729  O  O   . SER B  2  115 ? 15.063  -39.447 -13.675 1.00 16.95 ? 227  SER C O   1 
ATOM   1730  C  CB  . SER B  2  115 ? 12.560  -38.613 -15.465 1.00 16.37 ? 227  SER C CB  1 
ATOM   1731  O  OG  . SER B  2  115 ? 13.087  -37.622 -16.325 1.00 19.56 ? 227  SER C OG  1 
ATOM   1732  N  N   . ALA B  2  116 ? 15.184  -37.225 -14.152 1.00 15.08 ? 228  ALA C N   1 
ATOM   1733  C  CA  . ALA B  2  116 ? 16.653  -37.162 -14.157 1.00 14.41 ? 228  ALA C CA  1 
ATOM   1734  C  C   . ALA B  2  116 ? 17.290  -37.554 -12.802 1.00 15.45 ? 228  ALA C C   1 
ATOM   1735  O  O   . ALA B  2  116 ? 18.430  -38.049 -12.752 1.00 18.39 ? 228  ALA C O   1 
ATOM   1736  C  CB  . ALA B  2  116 ? 17.123  -35.776 -14.590 1.00 12.58 ? 228  ALA C CB  1 
ATOM   1737  N  N   . ARG B  2  117 ? 16.572  -37.331 -11.711 1.00 13.83 ? 229  ARG C N   1 
ATOM   1738  C  CA  . ARG B  2  117 ? 17.057  -37.659 -10.377 1.00 12.89 ? 229  ARG C CA  1 
ATOM   1739  C  C   . ARG B  2  117 ? 18.472  -37.110 -10.067 1.00 13.11 ? 229  ARG C C   1 
ATOM   1740  O  O   . ARG B  2  117 ? 19.301  -37.810 -9.478  1.00 12.96 ? 229  ARG C O   1 
ATOM   1741  C  CB  . ARG B  2  117 ? 17.044  -39.167 -10.168 1.00 14.15 ? 229  ARG C CB  1 
ATOM   1742  C  CG  . ARG B  2  117 ? 15.680  -39.847 -10.244 1.00 13.26 ? 229  ARG C CG  1 
ATOM   1743  C  CD  . ARG B  2  117 ? 15.833  -41.286 -9.789  1.00 14.03 ? 229  ARG C CD  1 
ATOM   1744  N  NE  . ARG B  2  117 ? 14.726  -42.159 -10.169 1.00 15.37 ? 229  ARG C NE  1 
ATOM   1745  C  CZ  . ARG B  2  117 ? 13.627  -42.364 -9.448  1.00 13.11 ? 229  ARG C CZ  1 
ATOM   1746  N  NH1 . ARG B  2  117 ? 13.428  -41.712 -8.310  1.00 12.00 ? 229  ARG C NH1 1 
ATOM   1747  N  NH2 . ARG B  2  117 ? 12.717  -43.215 -9.880  1.00 13.61 ? 229  ARG C NH2 1 
ATOM   1748  N  N   . ILE B  2  118 ? 18.752  -35.870 -10.454 1.00 12.08 ? 230  ILE C N   1 
ATOM   1749  C  CA  . ILE B  2  118 ? 20.054  -35.259 -10.126 1.00 11.30 ? 230  ILE C CA  1 
ATOM   1750  C  C   . ILE B  2  118 ? 19.887  -34.260 -8.984  1.00 10.40 ? 230  ILE C C   1 
ATOM   1751  O  O   . ILE B  2  118 ? 19.217  -33.242 -9.152  1.00 10.32 ? 230  ILE C O   1 
ATOM   1752  C  CB  . ILE B  2  118 ? 20.654  -34.529 -11.336 1.00 10.46 ? 230  ILE C CB  1 
ATOM   1753  C  CG1 . ILE B  2  118 ? 20.714  -35.457 -12.560 1.00 12.89 ? 230  ILE C CG1 1 
ATOM   1754  C  CG2 . ILE B  2  118 ? 22.035  -34.018 -10.984 1.00 9.63  ? 230  ILE C CG2 1 
ATOM   1755  C  CD1 . ILE B  2  118 ? 21.588  -36.697 -12.390 1.00 15.71 ? 230  ILE C CD1 1 
ATOM   1756  N  N   . PRO B  2  119 ? 20.479  -34.529 -7.788  1.00 10.34 ? 231  PRO C N   1 
ATOM   1757  C  CA  . PRO B  2  119 ? 20.363  -33.628 -6.625  1.00 10.89 ? 231  PRO C CA  1 
ATOM   1758  C  C   . PRO B  2  119 ? 21.152  -32.297 -6.790  1.00 9.59  ? 231  PRO C C   1 
ATOM   1759  O  O   . PRO B  2  119 ? 21.858  -32.076 -7.778  1.00 7.86  ? 231  PRO C O   1 
ATOM   1760  C  CB  . PRO B  2  119 ? 20.883  -34.496 -5.465  1.00 11.08 ? 231  PRO C CB  1 
ATOM   1761  C  CG  . PRO B  2  119 ? 21.903  -35.344 -6.123  1.00 11.07 ? 231  PRO C CG  1 
ATOM   1762  C  CD  . PRO B  2  119 ? 21.293  -35.726 -7.448  1.00 8.83  ? 231  PRO C CD  1 
ATOM   1763  N  N   . CYS B  2  120 ? 20.992  -31.403 -5.838  1.00 9.67  ? 232  CYS C N   1 
ATOM   1764  C  CA  . CYS B  2  120 ? 21.739  -30.157 -5.867  1.00 9.08  ? 232  CYS C CA  1 
ATOM   1765  C  C   . CYS B  2  120 ? 23.219  -30.426 -5.631  1.00 9.47  ? 232  CYS C C   1 
ATOM   1766  O  O   . CYS B  2  120 ? 23.581  -31.496 -5.159  1.00 8.88  ? 232  CYS C O   1 
ATOM   1767  C  CB  . CYS B  2  120 ? 21.216  -29.200 -4.809  1.00 8.61  ? 232  CYS C CB  1 
ATOM   1768  S  SG  . CYS B  2  120 ? 19.521  -28.604 -5.110  1.00 8.74  ? 232  CYS C SG  1 
ATOM   1769  N  N   . PHE B  2  121 ? 24.059  -29.464 -5.982  1.00 8.52  ? 233  PHE C N   1 
ATOM   1770  C  CA  . PHE B  2  121 ? 25.498  -29.618 -5.784  1.00 9.16  ? 233  PHE C CA  1 
ATOM   1771  C  C   . PHE B  2  121 ? 25.915  -29.154 -4.393  1.00 8.29  ? 233  PHE C C   1 
ATOM   1772  O  O   . PHE B  2  121 ? 25.208  -28.383 -3.747  1.00 5.57  ? 233  PHE C O   1 
ATOM   1773  C  CB  . PHE B  2  121 ? 26.263  -28.841 -6.876  1.00 9.75  ? 233  PHE C CB  1 
ATOM   1774  C  CG  . PHE B  2  121 ? 26.252  -29.500 -8.247  1.00 12.39 ? 233  PHE C CG  1 
ATOM   1775  C  CD1 . PHE B  2  121 ? 26.924  -30.713 -8.467  1.00 10.81 ? 233  PHE C CD1 1 
ATOM   1776  C  CD2 . PHE B  2  121 ? 25.555  -28.915 -9.327  1.00 13.02 ? 233  PHE C CD2 1 
ATOM   1777  C  CE1 . PHE B  2  121 ? 26.897  -31.318 -9.720  1.00 9.77  ? 233  PHE C CE1 1 
ATOM   1778  C  CE2 . PHE B  2  121 ? 25.531  -29.522 -10.583 1.00 11.58 ? 233  PHE C CE2 1 
ATOM   1779  C  CZ  . PHE B  2  121 ? 26.204  -30.724 -10.772 1.00 10.34 ? 233  PHE C CZ  1 
ATOM   1780  N  N   . LEU B  2  122 ? 27.049  -29.682 -3.903  1.00 9.72  ? 234  LEU C N   1 
ATOM   1781  C  CA  . LEU B  2  122 ? 27.639  -29.250 -2.618  1.00 10.68 ? 234  LEU C CA  1 
ATOM   1782  C  C   . LEU B  2  122 ? 28.839  -28.322 -2.882  1.00 8.14  ? 234  LEU C C   1 
ATOM   1783  O  O   . LEU B  2  122 ? 29.758  -28.657 -3.644  1.00 5.11  ? 234  LEU C O   1 
ATOM   1784  C  CB  . LEU B  2  122 ? 28.086  -30.463 -1.757  1.00 11.31 ? 234  LEU C CB  1 
ATOM   1785  C  CG  . LEU B  2  122 ? 28.839  -30.169 -0.425  1.00 10.69 ? 234  LEU C CG  1 
ATOM   1786  C  CD1 . LEU B  2  122 ? 27.903  -29.564 0.616   1.00 10.44 ? 234  LEU C CD1 1 
ATOM   1787  C  CD2 . LEU B  2  122 ? 29.447  -31.457 0.110   1.00 9.33  ? 234  LEU C CD2 1 
ATOM   1788  N  N   . ALA B  2  123 ? 28.770  -27.133 -2.294  1.00 6.32  ? 235  ALA C N   1 
ATOM   1789  C  CA  . ALA B  2  123 ? 29.817  -26.168 -2.469  1.00 6.13  ? 235  ALA C CA  1 
ATOM   1790  C  C   . ALA B  2  123 ? 30.065  -25.407 -1.171  1.00 6.40  ? 235  ALA C C   1 
ATOM   1791  O  O   . ALA B  2  123 ? 29.460  -25.719 -0.139  1.00 6.56  ? 235  ALA C O   1 
ATOM   1792  C  CB  . ALA B  2  123 ? 29.436  -25.238 -3.600  1.00 4.20  ? 235  ALA C CB  1 
ATOM   1793  N  N   . GLY B  2  124 ? 31.001  -24.440 -1.211  1.00 8.49  ? 236  GLY C N   1 
ATOM   1794  C  CA  . GLY B  2  124 ? 31.265  -23.570 -0.067  1.00 4.42  ? 236  GLY C CA  1 
ATOM   1795  C  C   . GLY B  2  124 ? 30.034  -22.736 0.310   1.00 6.34  ? 236  GLY C C   1 
ATOM   1796  O  O   . GLY B  2  124 ? 29.835  -22.415 1.482   1.00 6.04  ? 236  GLY C O   1 
ATOM   1797  N  N   . ASP B  2  125 ? 29.206  -22.379 -0.690  1.00 3.80  ? 237  ASP C N   1 
ATOM   1798  C  CA  . ASP B  2  125 ? 27.958  -21.655 -0.447  1.00 6.34  ? 237  ASP C CA  1 
ATOM   1799  C  C   . ASP B  2  125 ? 26.768  -22.558 -0.858  1.00 4.44  ? 237  ASP C C   1 
ATOM   1800  O  O   . ASP B  2  125 ? 26.840  -23.221 -1.869  1.00 4.26  ? 237  ASP C O   1 
ATOM   1801  C  CB  . ASP B  2  125 ? 27.951  -20.344 -1.266  1.00 5.06  ? 237  ASP C CB  1 
ATOM   1802  C  CG  . ASP B  2  125 ? 26.640  -19.548 -1.155  1.00 6.89  ? 237  ASP C CG  1 
ATOM   1803  O  OD1 . ASP B  2  125 ? 26.463  -18.842 -0.128  1.00 6.43  ? 237  ASP C OD1 1 
ATOM   1804  O  OD2 . ASP B  2  125 ? 25.783  -19.640 -2.083  1.00 5.23  ? 237  ASP C OD2 1 
ATOM   1805  N  N   . THR B  2  126 ? 25.700  -22.554 -0.067  1.00 6.14  ? 238  THR C N   1 
ATOM   1806  C  CA  . THR B  2  126 ? 24.472  -23.352 -0.314  1.00 7.13  ? 238  THR C CA  1 
ATOM   1807  C  C   . THR B  2  126 ? 23.687  -23.026 -1.627  1.00 5.77  ? 238  THR C C   1 
ATOM   1808  O  O   . THR B  2  126 ? 22.782  -23.763 -1.984  1.00 6.31  ? 238  THR C O   1 
ATOM   1809  C  CB  . THR B  2  126 ? 23.475  -23.194 0.881   1.00 7.96  ? 238  THR C CB  1 
ATOM   1810  O  OG1 . THR B  2  126 ? 22.994  -21.817 0.968   1.00 7.16  ? 238  THR C OG1 1 
ATOM   1811  C  CG2 . THR B  2  126 ? 24.143  -23.583 2.189   1.00 5.42  ? 238  THR C CG2 1 
ATOM   1812  N  N   . ARG B  2  127 ? 24.023  -21.948 -2.359  1.00 7.54  ? 239  ARG C N   1 
ATOM   1813  C  CA  . ARG B  2  127 ? 23.183  -21.559 -3.528  1.00 8.25  ? 239  ARG C CA  1 
ATOM   1814  C  C   . ARG B  2  127 ? 23.781  -21.923 -4.894  1.00 6.58  ? 239  ARG C C   1 
ATOM   1815  O  O   . ARG B  2  127 ? 23.229  -21.524 -5.935  1.00 7.35  ? 239  ARG C O   1 
ATOM   1816  C  CB  . ARG B  2  127 ? 22.868  -20.036 -3.471  1.00 6.06  ? 239  ARG C CB  1 
ATOM   1817  C  CG  . ARG B  2  127 ? 22.054  -19.593 -2.242  1.00 7.37  ? 239  ARG C CG  1 
ATOM   1818  C  CD  . ARG B  2  127 ? 22.219  -18.108 -1.960  1.00 7.64  ? 239  ARG C CD  1 
ATOM   1819  N  NE  . ARG B  2  127 ? 23.591  -17.792 -1.480  1.00 9.43  ? 239  ARG C NE  1 
ATOM   1820  C  CZ  . ARG B  2  127 ? 24.042  -16.564 -1.194  1.00 10.33 ? 239  ARG C CZ  1 
ATOM   1821  N  NH1 . ARG B  2  127 ? 23.235  -15.488 -1.361  1.00 9.40  ? 239  ARG C NH1 1 
ATOM   1822  N  NH2 . ARG B  2  127 ? 25.302  -16.399 -0.748  1.00 5.45  ? 239  ARG C NH2 1 
ATOM   1823  N  N   . SER B  2  128 ? 24.865  -22.706 -4.900  1.00 4.97  ? 240  SER C N   1 
ATOM   1824  C  CA  . SER B  2  128 ? 25.610  -23.022 -6.126  1.00 4.88  ? 240  SER C CA  1 
ATOM   1825  C  C   . SER B  2  128 ? 24.768  -23.556 -7.267  1.00 6.39  ? 240  SER C C   1 
ATOM   1826  O  O   . SER B  2  128 ? 25.153  -23.431 -8.440  1.00 2.10  ? 240  SER C O   1 
ATOM   1827  C  CB  . SER B  2  128 ? 26.747  -24.024 -5.836  1.00 6.97  ? 240  SER C CB  1 
ATOM   1828  O  OG  . SER B  2  128 ? 26.271  -25.335 -5.560  1.00 8.35  ? 240  SER C OG  1 
ATOM   1829  N  N   . SER B  2  129 ? 23.624  -24.166 -6.928  1.00 8.36  ? 241  SER C N   1 
ATOM   1830  C  CA  . SER B  2  129 ? 22.757  -24.757 -7.944  1.00 8.90  ? 241  SER C CA  1 
ATOM   1831  C  C   . SER B  2  129 ? 21.619  -23.826 -8.392  1.00 9.47  ? 241  SER C C   1 
ATOM   1832  O  O   . SER B  2  129 ? 20.901  -24.201 -9.304  1.00 10.09 ? 241  SER C O   1 
ATOM   1833  C  CB  . SER B  2  129 ? 22.146  -26.066 -7.406  1.00 8.83  ? 241  SER C CB  1 
ATOM   1834  O  OG  . SER B  2  129 ? 23.135  -26.896 -6.838  1.00 10.90 ? 241  SER C OG  1 
ATOM   1835  N  N   . GLU B  2  130 ? 21.465  -22.629 -7.770  1.00 7.65  ? 242  GLU C N   1 
ATOM   1836  C  CA  . GLU B  2  130 ? 20.318  -21.711 -8.085  1.00 10.73 ? 242  GLU C CA  1 
ATOM   1837  C  C   . GLU B  2  130 ? 20.083  -21.503 -9.633  1.00 8.78  ? 242  GLU C C   1 
ATOM   1838  O  O   . GLU B  2  130 ? 18.933  -21.444 -10.090 1.00 7.70  ? 242  GLU C O   1 
ATOM   1839  C  CB  . GLU B  2  130 ? 20.478  -20.364 -7.312  1.00 8.00  ? 242  GLU C CB  1 
ATOM   1840  C  CG  . GLU B  2  130 ? 19.266  -19.424 -7.320  1.00 7.08  ? 242  GLU C CG  1 
ATOM   1841  C  CD  . GLU B  2  130 ? 19.295  -18.399 -8.462  1.00 9.30  ? 242  GLU C CD  1 
ATOM   1842  O  OE1 . GLU B  2  130 ? 20.345  -18.260 -9.113  1.00 7.66  ? 242  GLU C OE1 1 
ATOM   1843  O  OE2 . GLU B  2  130 ? 18.258  -17.718 -8.719  1.00 9.43  ? 242  GLU C OE2 1 
ATOM   1844  N  N   . MET B  2  131 ? 21.168  -21.394 -10.415 1.00 8.41  ? 243  MET C N   1 
ATOM   1845  C  CA  . MET B  2  131 ? 21.090  -21.365 -11.872 1.00 9.65  ? 243  MET C CA  1 
ATOM   1846  C  C   . MET B  2  131 ? 22.385  -22.023 -12.415 1.00 10.07 ? 243  MET C C   1 
ATOM   1847  O  O   . MET B  2  131 ? 23.462  -21.797 -11.845 1.00 8.33  ? 243  MET C O   1 
ATOM   1848  C  CB  . MET B  2  131 ? 20.834  -19.905 -12.401 1.00 10.28 ? 243  MET C CB  1 
ATOM   1849  C  CG  . MET B  2  131 ? 22.036  -18.933 -12.440 1.00 13.68 ? 243  MET C CG  1 
ATOM   1850  S  SD  . MET B  2  131 ? 21.613  -17.175 -12.768 1.00 11.47 ? 243  MET C SD  1 
ATOM   1851  C  CE  . MET B  2  131 ? 20.917  -17.203 -14.405 1.00 10.47 ? 243  MET C CE  1 
ATOM   1852  N  N   . PRO B  2  132 ? 22.305  -22.878 -13.497 1.00 9.76  ? 244  PRO C N   1 
ATOM   1853  C  CA  . PRO B  2  132 ? 23.479  -23.595 -14.082 1.00 9.04  ? 244  PRO C CA  1 
ATOM   1854  C  C   . PRO B  2  132 ? 24.719  -22.739 -14.368 1.00 6.62  ? 244  PRO C C   1 
ATOM   1855  O  O   . PRO B  2  132 ? 25.842  -23.226 -14.243 1.00 5.14  ? 244  PRO C O   1 
ATOM   1856  C  CB  . PRO B  2  132 ? 22.907  -24.252 -15.346 1.00 6.89  ? 244  PRO C CB  1 
ATOM   1857  C  CG  . PRO B  2  132 ? 21.497  -24.488 -14.954 1.00 7.44  ? 244  PRO C CG  1 
ATOM   1858  C  CD  . PRO B  2  132 ? 21.089  -23.206 -14.276 1.00 9.22  ? 244  PRO C CD  1 
ATOM   1859  N  N   . GLU B  2  133 ? 24.510  -21.479 -14.710 1.00 7.07  ? 245  GLU C N   1 
ATOM   1860  C  CA  . GLU B  2  133 ? 25.620  -20.558 -15.000 1.00 9.31  ? 245  GLU C CA  1 
ATOM   1861  C  C   . GLU B  2  133 ? 26.458  -20.246 -13.719 1.00 8.02  ? 245  GLU C C   1 
ATOM   1862  O  O   . GLU B  2  133 ? 27.703  -20.118 -13.764 1.00 4.80  ? 245  GLU C O   1 
ATOM   1863  C  CB  . GLU B  2  133 ? 25.074  -19.276 -15.636 1.00 7.29  ? 245  GLU C CB  1 
ATOM   1864  C  CG  . GLU B  2  133 ? 24.093  -19.544 -16.783 1.00 7.90  ? 245  GLU C CG  1 
ATOM   1865  C  CD  . GLU B  2  133 ? 22.651  -19.572 -16.315 1.00 7.46  ? 245  GLU C CD  1 
ATOM   1866  O  OE1 . GLU B  2  133 ? 21.795  -18.951 -16.968 1.00 8.91  ? 245  GLU C OE1 1 
ATOM   1867  O  OE2 . GLU B  2  133 ? 22.374  -20.199 -15.297 1.00 7.64  ? 245  GLU C OE2 1 
ATOM   1868  N  N   . LEU B  2  134 ? 25.752  -20.132 -12.597 1.00 5.46  ? 246  LEU C N   1 
ATOM   1869  C  CA  . LEU B  2  134 ? 26.397  -19.948 -11.314 1.00 5.97  ? 246  LEU C CA  1 
ATOM   1870  C  C   . LEU B  2  134 ? 27.096  -21.247 -10.943 1.00 8.70  ? 246  LEU C C   1 
ATOM   1871  O  O   . LEU B  2  134 ? 28.174  -21.237 -10.365 1.00 7.18  ? 246  LEU C O   1 
ATOM   1872  C  CB  . LEU B  2  134 ? 25.356  -19.568 -10.254 1.00 4.33  ? 246  LEU C CB  1 
ATOM   1873  C  CG  . LEU B  2  134 ? 25.814  -19.511 -8.781  1.00 5.03  ? 246  LEU C CG  1 
ATOM   1874  C  CD1 . LEU B  2  134 ? 26.861  -18.406 -8.549  1.00 2.00  ? 246  LEU C CD1 1 
ATOM   1875  C  CD2 . LEU B  2  134 ? 24.586  -19.323 -7.894  1.00 2.02  ? 246  LEU C CD2 1 
ATOM   1876  N  N   . THR B  2  135 ? 26.464  -22.372 -11.304 1.00 7.66  ? 247  THR C N   1 
ATOM   1877  C  CA  . THR B  2  135 ? 27.021  -23.691 -11.049 1.00 9.20  ? 247  THR C CA  1 
ATOM   1878  C  C   . THR B  2  135 ? 28.319  -23.864 -11.818 1.00 7.15  ? 247  THR C C   1 
ATOM   1879  O  O   . THR B  2  135 ? 29.314  -24.340 -11.272 1.00 9.23  ? 247  THR C O   1 
ATOM   1880  C  CB  . THR B  2  135 ? 26.043  -24.818 -11.461 1.00 5.93  ? 247  THR C CB  1 
ATOM   1881  O  OG1 . THR B  2  135 ? 24.826  -24.727 -10.677 1.00 6.35  ? 247  THR C OG1 1 
ATOM   1882  C  CG2 . THR B  2  135 ? 26.707  -26.180 -11.239 1.00 6.18  ? 247  THR C CG2 1 
ATOM   1883  N  N   . SER B  2  136 ? 28.311  -23.438 -13.070 1.00 5.18  ? 248  SER C N   1 
ATOM   1884  C  CA  . SER B  2  136 ? 29.481  -23.531 -13.893 1.00 7.20  ? 248  SER C CA  1 
ATOM   1885  C  C   . SER B  2  136 ? 30.650  -22.683 -13.348 1.00 9.70  ? 248  SER C C   1 
ATOM   1886  O  O   . SER B  2  136 ? 31.795  -23.128 -13.436 1.00 10.14 ? 248  SER C O   1 
ATOM   1887  C  CB  . SER B  2  136 ? 29.117  -23.144 -15.321 1.00 8.00  ? 248  SER C CB  1 
ATOM   1888  O  OG  . SER B  2  136 ? 28.147  -24.062 -15.826 1.00 6.79  ? 248  SER C OG  1 
ATOM   1889  N  N   . MET B  2  137 ? 30.365  -21.482 -12.777 1.00 8.20  ? 249  MET C N   1 
ATOM   1890  C  CA  . MET B  2  137 ? 31.414  -20.641 -12.172 1.00 6.21  ? 249  MET C CA  1 
ATOM   1891  C  C   . MET B  2  137 ? 31.991  -21.304 -10.943 1.00 5.89  ? 249  MET C C   1 
ATOM   1892  O  O   . MET B  2  137 ? 33.210  -21.234 -10.713 1.00 5.00  ? 249  MET C O   1 
ATOM   1893  C  CB  . MET B  2  137 ? 30.881  -19.238 -11.812 1.00 5.33  ? 249  MET C CB  1 
ATOM   1894  C  CG  . MET B  2  137 ? 30.577  -18.340 -13.018 1.00 4.45  ? 249  MET C CG  1 
ATOM   1895  S  SD  . MET B  2  137 ? 31.912  -18.300 -14.261 1.00 9.59  ? 249  MET C SD  1 
ATOM   1896  C  CE  . MET B  2  137 ? 32.981  -17.025 -13.595 1.00 3.20  ? 249  MET C CE  1 
ATOM   1897  N  N   . HIS B  2  138 ? 31.118  -21.974 -10.167 1.00 6.29  ? 250  HIS C N   1 
ATOM   1898  C  CA  . HIS B  2  138 ? 31.525  -22.711 -8.970  1.00 6.91  ? 250  HIS C CA  1 
ATOM   1899  C  C   . HIS B  2  138 ? 32.418  -23.884 -9.329  1.00 8.24  ? 250  HIS C C   1 
ATOM   1900  O  O   . HIS B  2  138 ? 33.411  -24.155 -8.630  1.00 10.55 ? 250  HIS C O   1 
ATOM   1901  C  CB  . HIS B  2  138 ? 30.328  -23.235 -8.175  1.00 5.48  ? 250  HIS C CB  1 
ATOM   1902  C  CG  . HIS B  2  138 ? 29.808  -22.304 -7.113  1.00 7.79  ? 250  HIS C CG  1 
ATOM   1903  N  ND1 . HIS B  2  138 ? 30.385  -22.191 -5.859  1.00 6.66  ? 250  HIS C ND1 1 
ATOM   1904  C  CD2 . HIS B  2  138 ? 28.702  -21.502 -7.086  1.00 9.16  ? 250  HIS C CD2 1 
ATOM   1905  C  CE1 . HIS B  2  138 ? 29.662  -21.371 -5.107  1.00 7.92  ? 250  HIS C CE1 1 
ATOM   1906  N  NE2 . HIS B  2  138 ? 28.632  -20.936 -5.828  1.00 9.13  ? 250  HIS C NE2 1 
ATOM   1907  N  N   . THR B  2  139 ? 32.083  -24.570 -10.422 1.00 6.90  ? 251  THR C N   1 
ATOM   1908  C  CA  . THR B  2  139 ? 32.859  -25.715 -10.865 1.00 7.90  ? 251  THR C CA  1 
ATOM   1909  C  C   . THR B  2  139 ? 34.220  -25.266 -11.378 1.00 9.37  ? 251  THR C C   1 
ATOM   1910  O  O   . THR B  2  139 ? 35.244  -25.913 -11.091 1.00 8.38  ? 251  THR C O   1 
ATOM   1911  C  CB  . THR B  2  139 ? 32.136  -26.480 -11.972 1.00 7.39  ? 251  THR C CB  1 
ATOM   1912  O  OG1 . THR B  2  139 ? 30.801  -26.747 -11.520 1.00 13.01 ? 251  THR C OG1 1 
ATOM   1913  C  CG2 . THR B  2  139 ? 32.833  -27.807 -12.267 1.00 7.97  ? 251  THR C CG2 1 
ATOM   1914  N  N   . LEU B  2  140 ? 34.209  -24.148 -12.128 1.00 9.16  ? 252  LEU C N   1 
ATOM   1915  C  CA  . LEU B  2  140 ? 35.419  -23.541 -12.662 1.00 10.04 ? 252  LEU C CA  1 
ATOM   1916  C  C   . LEU B  2  140 ? 36.467  -23.304 -11.548 1.00 9.85  ? 252  LEU C C   1 
ATOM   1917  O  O   . LEU B  2  140 ? 37.632  -23.682 -11.712 1.00 9.70  ? 252  LEU C O   1 
ATOM   1918  C  CB  . LEU B  2  140 ? 35.087  -22.205 -13.354 1.00 9.35  ? 252  LEU C CB  1 
ATOM   1919  C  CG  . LEU B  2  140 ? 36.291  -21.391 -13.866 1.00 9.15  ? 252  LEU C CG  1 
ATOM   1920  C  CD1 . LEU B  2  140 ? 36.995  -22.169 -14.976 1.00 8.99  ? 252  LEU C CD1 1 
ATOM   1921  C  CD2 . LEU B  2  140 ? 35.849  -20.023 -14.367 1.00 6.89  ? 252  LEU C CD2 1 
ATOM   1922  N  N   . LEU B  2  141 ? 36.050  -22.699 -10.429 1.00 7.23  ? 253  LEU C N   1 
ATOM   1923  C  CA  . LEU B  2  141 ? 36.998  -22.388 -9.357  1.00 9.46  ? 253  LEU C CA  1 
ATOM   1924  C  C   . LEU B  2  141 ? 37.434  -23.635 -8.575  1.00 11.52 ? 253  LEU C C   1 
ATOM   1925  O  O   . LEU B  2  141 ? 38.557  -23.679 -8.043  1.00 9.68  ? 253  LEU C O   1 
ATOM   1926  C  CB  . LEU B  2  141 ? 36.434  -21.311 -8.430  1.00 6.99  ? 253  LEU C CB  1 
ATOM   1927  C  CG  . LEU B  2  141 ? 36.156  -19.943 -9.077  1.00 4.58  ? 253  LEU C CG  1 
ATOM   1928  C  CD1 . LEU B  2  141 ? 35.577  -18.993 -8.054  1.00 6.90  ? 253  LEU C CD1 1 
ATOM   1929  C  CD2 . LEU B  2  141 ? 37.418  -19.365 -9.672  1.00 5.71  ? 253  LEU C CD2 1 
ATOM   1930  N  N   . LEU B  2  142 ? 36.550  -24.647 -8.518  1.00 10.89 ? 254  LEU C N   1 
ATOM   1931  C  CA  . LEU B  2  142 ? 36.881  -25.939 -7.906  1.00 11.14 ? 254  LEU C CA  1 
ATOM   1932  C  C   . LEU B  2  142 ? 37.984  -26.613 -8.705  1.00 9.61  ? 254  LEU C C   1 
ATOM   1933  O  O   . LEU B  2  142 ? 38.866  -27.221 -8.125  1.00 9.87  ? 254  LEU C O   1 
ATOM   1934  C  CB  . LEU B  2  142 ? 35.656  -26.879 -7.861  1.00 13.21 ? 254  LEU C CB  1 
ATOM   1935  C  CG  . LEU B  2  142 ? 35.932  -28.381 -7.669  1.00 12.36 ? 254  LEU C CG  1 
ATOM   1936  C  CD1 . LEU B  2  142 ? 35.608  -28.804 -6.250  1.00 12.89 ? 254  LEU C CD1 1 
ATOM   1937  C  CD2 . LEU B  2  142 ? 35.084  -29.185 -8.646  1.00 16.29 ? 254  LEU C CD2 1 
ATOM   1938  N  N   . ARG B  2  143 ? 37.913  -26.522 -10.034 1.00 7.68  ? 255  ARG C N   1 
ATOM   1939  C  CA  . ARG B  2  143 ? 38.958  -27.107 -10.890 1.00 9.13  ? 255  ARG C CA  1 
ATOM   1940  C  C   . ARG B  2  143 ? 40.275  -26.351 -10.735 1.00 6.96  ? 255  ARG C C   1 
ATOM   1941  O  O   . ARG B  2  143 ? 41.328  -26.973 -10.642 1.00 5.69  ? 255  ARG C O   1 
ATOM   1942  C  CB  . ARG B  2  143 ? 38.531  -27.119 -12.370 1.00 9.67  ? 255  ARG C CB  1 
ATOM   1943  C  CG  . ARG B  2  143 ? 37.427  -28.117 -12.655 1.00 9.26  ? 255  ARG C CG  1 
ATOM   1944  C  CD  . ARG B  2  143 ? 36.913  -28.013 -14.068 1.00 7.01  ? 255  ARG C CD  1 
ATOM   1945  N  NE  . ARG B  2  143 ? 35.674  -28.769 -14.220 1.00 4.92  ? 255  ARG C NE  1 
ATOM   1946  C  CZ  . ARG B  2  143 ? 35.009  -28.859 -15.352 1.00 3.94  ? 255  ARG C CZ  1 
ATOM   1947  N  NH1 . ARG B  2  143 ? 35.488  -28.284 -16.430 1.00 7.02  ? 255  ARG C NH1 1 
ATOM   1948  N  NH2 . ARG B  2  143 ? 33.875  -29.544 -15.413 1.00 5.16  ? 255  ARG C NH2 1 
ATOM   1949  N  N   . GLU B  2  144 ? 40.184  -25.019 -10.685 1.00 5.86  ? 256  GLU C N   1 
ATOM   1950  C  CA  . GLU B  2  144 ? 41.350  -24.164 -10.541 1.00 5.28  ? 256  GLU C CA  1 
ATOM   1951  C  C   . GLU B  2  144 ? 42.086  -24.463 -9.241  1.00 5.12  ? 256  GLU C C   1 
ATOM   1952  O  O   . GLU B  2  144 ? 43.310  -24.424 -9.215  1.00 3.45  ? 256  GLU C O   1 
ATOM   1953  C  CB  . GLU B  2  144 ? 40.964  -22.671 -10.600 1.00 5.64  ? 256  GLU C CB  1 
ATOM   1954  C  CG  . GLU B  2  144 ? 42.154  -21.707 -10.437 1.00 8.83  ? 256  GLU C CG  1 
ATOM   1955  C  CD  . GLU B  2  144 ? 43.243  -21.836 -11.516 1.00 12.23 ? 256  GLU C CD  1 
ATOM   1956  O  OE1 . GLU B  2  144 ? 44.341  -21.285 -11.305 1.00 11.60 ? 256  GLU C OE1 1 
ATOM   1957  O  OE2 . GLU B  2  144 ? 43.002  -22.484 -12.575 1.00 12.22 ? 256  GLU C OE2 1 
ATOM   1958  N  N   . HIS B  2  145 ? 41.327  -24.756 -8.175  1.00 5.10  ? 257  HIS C N   1 
ATOM   1959  C  CA  . HIS B  2  145 ? 41.908  -25.136 -6.896  1.00 8.18  ? 257  HIS C CA  1 
ATOM   1960  C  C   . HIS B  2  145 ? 42.724  -26.421 -7.015  1.00 7.84  ? 257  HIS C C   1 
ATOM   1961  O  O   . HIS B  2  145 ? 43.869  -26.483 -6.552  1.00 6.44  ? 257  HIS C O   1 
ATOM   1962  C  CB  . HIS B  2  145 ? 40.851  -25.341 -5.811  1.00 3.59  ? 257  HIS C CB  1 
ATOM   1963  C  CG  . HIS B  2  145 ? 41.456  -25.946 -4.576  1.00 6.44  ? 257  HIS C CG  1 
ATOM   1964  N  ND1 . HIS B  2  145 ? 41.954  -25.189 -3.538  1.00 7.33  ? 257  HIS C ND1 1 
ATOM   1965  C  CD2 . HIS B  2  145 ? 41.760  -27.233 -4.266  1.00 5.81  ? 257  HIS C CD2 1 
ATOM   1966  C  CE1 . HIS B  2  145 ? 42.538  -25.982 -2.654  1.00 6.22  ? 257  HIS C CE1 1 
ATOM   1967  N  NE2 . HIS B  2  145 ? 42.431  -27.226 -3.079  1.00 5.04  ? 257  HIS C NE2 1 
ATOM   1968  N  N   . ASN B  2  146 ? 42.123  -27.451 -7.613  1.00 7.11  ? 258  ASN C N   1 
ATOM   1969  C  CA  . ASN B  2  146 ? 42.791  -28.739 -7.737  1.00 8.58  ? 258  ASN C CA  1 
ATOM   1970  C  C   . ASN B  2  146 ? 44.000  -28.662 -8.692  1.00 7.10  ? 258  ASN C C   1 
ATOM   1971  O  O   . ASN B  2  146 ? 45.066  -29.289 -8.456  1.00 6.22  ? 258  ASN C O   1 
ATOM   1972  C  CB  . ASN B  2  146 ? 41.764  -29.831 -8.141  1.00 8.54  ? 258  ASN C CB  1 
ATOM   1973  C  CG  . ASN B  2  146 ? 40.862  -30.296 -6.973  1.00 9.71  ? 258  ASN C CG  1 
ATOM   1974  O  OD1 . ASN B  2  146 ? 40.959  -29.822 -5.835  1.00 9.55  ? 258  ASN C OD1 1 
ATOM   1975  N  ND2 . ASN B  2  146 ? 39.979  -31.242 -7.238  1.00 10.50 ? 258  ASN C ND2 1 
ATOM   1976  N  N   . ARG B  2  147 ? 43.861  -27.853 -9.738  1.00 6.82  ? 259  ARG C N   1 
ATOM   1977  C  CA  . ARG B  2  147 ? 44.962  -27.611 -10.676 1.00 8.67  ? 259  ARG C CA  1 
ATOM   1978  C  C   . ARG B  2  147 ? 46.171  -27.004 -9.925  1.00 8.29  ? 259  ARG C C   1 
ATOM   1979  O  O   . ARG B  2  147 ? 47.286  -27.501 -10.008 1.00 7.15  ? 259  ARG C O   1 
ATOM   1980  C  CB  . ARG B  2  147 ? 44.501  -26.645 -11.790 1.00 5.23  ? 259  ARG C CB  1 
ATOM   1981  C  CG  . ARG B  2  147 ? 45.588  -26.249 -12.777 1.00 7.16  ? 259  ARG C CG  1 
ATOM   1982  C  CD  . ARG B  2  147 ? 45.078  -25.351 -13.890 1.00 7.27  ? 259  ARG C CD  1 
ATOM   1983  N  NE  . ARG B  2  147 ? 46.179  -24.955 -14.771 1.00 13.49 ? 259  ARG C NE  1 
ATOM   1984  C  CZ  . ARG B  2  147 ? 46.591  -25.652 -15.845 1.00 15.25 ? 259  ARG C CZ  1 
ATOM   1985  N  NH1 . ARG B  2  147 ? 45.961  -26.760 -16.207 1.00 16.82 ? 259  ARG C NH1 1 
ATOM   1986  N  NH2 . ARG B  2  147 ? 47.617  -25.223 -16.569 1.00 12.47 ? 259  ARG C NH2 1 
ATOM   1987  N  N   . LEU B  2  148 ? 45.904  -25.910 -9.214  1.00 8.51  ? 260  LEU C N   1 
ATOM   1988  C  CA  . LEU B  2  148 ? 46.893  -25.203 -8.426  1.00 8.42  ? 260  LEU C CA  1 
ATOM   1989  C  C   . LEU B  2  148 ? 47.568  -26.109 -7.403  1.00 9.60  ? 260  LEU C C   1 
ATOM   1990  O  O   . LEU B  2  148 ? 48.782  -26.074 -7.254  1.00 8.78  ? 260  LEU C O   1 
ATOM   1991  C  CB  . LEU B  2  148 ? 46.238  -24.008 -7.714  1.00 7.53  ? 260  LEU C CB  1 
ATOM   1992  C  CG  . LEU B  2  148 ? 45.815  -22.811 -8.597  1.00 12.25 ? 260  LEU C CG  1 
ATOM   1993  C  CD1 . LEU B  2  148 ? 45.145  -21.749 -7.741  1.00 10.28 ? 260  LEU C CD1 1 
ATOM   1994  C  CD2 . LEU B  2  148 ? 47.026  -22.208 -9.333  1.00 8.26  ? 260  LEU C CD2 1 
ATOM   1995  N  N   . ALA B  2  149 ? 46.777  -26.900 -6.680  1.00 9.09  ? 261  ALA C N   1 
ATOM   1996  C  CA  . ALA B  2  149 ? 47.324  -27.816 -5.677  1.00 10.18 ? 261  ALA C CA  1 
ATOM   1997  C  C   . ALA B  2  149 ? 48.272  -28.862 -6.327  1.00 10.60 ? 261  ALA C C   1 
ATOM   1998  O  O   . ALA B  2  149 ? 49.323  -29.202 -5.753  1.00 8.89  ? 261  ALA C O   1 
ATOM   1999  C  CB  . ALA B  2  149 ? 46.174  -28.512 -4.919  1.00 7.73  ? 261  ALA C CB  1 
ATOM   2000  N  N   . THR B  2  150 ? 47.890  -29.359 -7.533  1.00 10.27 ? 262  THR C N   1 
ATOM   2001  C  CA  . THR B  2  150 ? 48.674  -30.373 -8.269  1.00 10.41 ? 262  THR C CA  1 
ATOM   2002  C  C   . THR B  2  150 ? 50.000  -29.796 -8.701  1.00 11.24 ? 262  THR C C   1 
ATOM   2003  O  O   . THR B  2  150 ? 51.046  -30.423 -8.508  1.00 7.91  ? 262  THR C O   1 
ATOM   2004  C  CB  . THR B  2  150 ? 47.950  -30.885 -9.537  1.00 9.73  ? 262  THR C CB  1 
ATOM   2005  O  OG1 . THR B  2  150 ? 46.667  -31.421 -9.190  1.00 11.44 ? 262  THR C OG1 1 
ATOM   2006  C  CG2 . THR B  2  150 ? 48.780  -31.966 -10.198 1.00 6.14  ? 262  THR C CG2 1 
ATOM   2007  N  N   . GLU B  2  151 ? 49.942  -28.584 -9.278  1.00 10.38 ? 263  GLU C N   1 
ATOM   2008  C  CA  . GLU B  2  151 ? 51.134  -27.848 -9.709  1.00 10.09 ? 263  GLU C CA  1 
ATOM   2009  C  C   . GLU B  2  151 ? 52.065  -27.534 -8.532  1.00 10.46 ? 263  GLU C C   1 
ATOM   2010  O  O   . GLU B  2  151 ? 53.270  -27.787 -8.614  1.00 11.85 ? 263  GLU C O   1 
ATOM   2011  C  CB  . GLU B  2  151 ? 50.714  -26.558 -10.426 1.00 8.91  ? 263  GLU C CB  1 
ATOM   2012  C  CG  . GLU B  2  151 ? 50.089  -26.815 -11.803 1.00 8.74  ? 263  GLU C CG  1 
ATOM   2013  C  CD  . GLU B  2  151 ? 49.341  -25.627 -12.367 1.00 8.36  ? 263  GLU C CD  1 
ATOM   2014  O  OE1 . GLU B  2  151 ? 48.893  -24.786 -11.571 1.00 7.21  ? 263  GLU C OE1 1 
ATOM   2015  O  OE2 . GLU B  2  151 ? 49.180  -25.552 -13.612 1.00 7.20  ? 263  GLU C OE2 1 
ATOM   2016  N  N   . LEU B  2  152 ? 51.508  -27.009 -7.442  1.00 8.68  ? 264  LEU C N   1 
ATOM   2017  C  CA  . LEU B  2  152 ? 52.293  -26.677 -6.245  1.00 11.22 ? 264  LEU C CA  1 
ATOM   2018  C  C   . LEU B  2  152 ? 52.999  -27.927 -5.650  1.00 13.13 ? 264  LEU C C   1 
ATOM   2019  O  O   . LEU B  2  152 ? 54.084  -27.830 -5.040  1.00 7.95  ? 264  LEU C O   1 
ATOM   2020  C  CB  . LEU B  2  152 ? 51.387  -26.004 -5.189  1.00 10.88 ? 264  LEU C CB  1 
ATOM   2021  C  CG  . LEU B  2  152 ? 50.879  -24.574 -5.519  1.00 10.69 ? 264  LEU C CG  1 
ATOM   2022  C  CD1 . LEU B  2  152 ? 49.766  -24.184 -4.577  1.00 11.15 ? 264  LEU C CD1 1 
ATOM   2023  C  CD2 . LEU B  2  152 ? 52.010  -23.569 -5.419  1.00 11.55 ? 264  LEU C CD2 1 
ATOM   2024  N  N   . LYS B  2  153 ? 52.365  -29.099 -5.848  1.00 12.55 ? 265  LYS C N   1 
ATOM   2025  C  CA  . LYS B  2  153 ? 52.882  -30.358 -5.356  1.00 13.63 ? 265  LYS C CA  1 
ATOM   2026  C  C   . LYS B  2  153 ? 54.090  -30.798 -6.206  1.00 12.82 ? 265  LYS C C   1 
ATOM   2027  O  O   . LYS B  2  153 ? 55.044  -31.373 -5.669  1.00 10.73 ? 265  LYS C O   1 
ATOM   2028  C  CB  . LYS B  2  153 ? 51.745  -31.419 -5.335  1.00 13.09 ? 265  LYS C CB  1 
ATOM   2029  C  CG  . LYS B  2  153 ? 52.158  -32.864 -5.035  1.00 13.76 ? 265  LYS C CG  1 
ATOM   2030  C  CD  . LYS B  2  153 ? 52.861  -33.017 -3.706  1.00 15.41 ? 265  LYS C CD  1 
ATOM   2031  C  CE  . LYS B  2  153 ? 53.260  -34.465 -3.474  1.00 17.00 ? 265  LYS C CE  1 
ATOM   2032  N  NZ  . LYS B  2  153 ? 53.817  -34.669 -2.114  1.00 16.00 ? 265  LYS C NZ  1 
ATOM   2033  N  N   . SER B  2  154 ? 54.057  -30.524 -7.521  1.00 10.74 ? 266  SER C N   1 
ATOM   2034  C  CA  . SER B  2  154 ? 55.210  -30.828 -8.363  1.00 12.71 ? 266  SER C CA  1 
ATOM   2035  C  C   . SER B  2  154 ? 56.335  -29.848 -8.016  1.00 15.42 ? 266  SER C C   1 
ATOM   2036  O  O   . SER B  2  154 ? 57.523  -30.212 -7.963  1.00 12.07 ? 266  SER C O   1 
ATOM   2037  C  CB  . SER B  2  154 ? 54.861  -30.691 -9.836  1.00 11.97 ? 266  SER C CB  1 
ATOM   2038  O  OG  . SER B  2  154 ? 53.896  -31.647 -10.217 1.00 18.42 ? 266  SER C OG  1 
ATOM   2039  N  N   . LEU B  2  155 ? 55.910  -28.603 -7.747  1.00 15.25 ? 267  LEU C N   1 
ATOM   2040  C  CA  . LEU B  2  155 ? 56.758  -27.480 -7.381  1.00 15.56 ? 267  LEU C CA  1 
ATOM   2041  C  C   . LEU B  2  155 ? 57.523  -27.765 -6.082  1.00 14.22 ? 267  LEU C C   1 
ATOM   2042  O  O   . LEU B  2  155 ? 58.761  -27.666 -6.046  1.00 13.36 ? 267  LEU C O   1 
ATOM   2043  C  CB  . LEU B  2  155 ? 55.856  -26.264 -7.184  1.00 17.83 ? 267  LEU C CB  1 
ATOM   2044  C  CG  . LEU B  2  155 ? 56.393  -24.869 -7.489  1.00 20.30 ? 267  LEU C CG  1 
ATOM   2045  C  CD1 . LEU B  2  155 ? 57.809  -24.948 -8.002  1.00 20.28 ? 267  LEU C CD1 1 
ATOM   2046  C  CD2 . LEU B  2  155 ? 55.490  -24.196 -8.520  1.00 22.53 ? 267  LEU C CD2 1 
ATOM   2047  N  N   . ASN B  2  156 ? 56.748  -28.103 -5.026  1.00 13.16 ? 268  ASN C N   1 
ATOM   2048  C  CA  . ASN B  2  156 ? 57.229  -28.357 -3.654  1.00 12.87 ? 268  ASN C CA  1 
ATOM   2049  C  C   . ASN B  2  156 ? 56.813  -29.758 -3.141  1.00 10.61 ? 268  ASN C C   1 
ATOM   2050  O  O   . ASN B  2  156 ? 55.842  -29.899 -2.413  1.00 11.04 ? 268  ASN C O   1 
ATOM   2051  C  CB  . ASN B  2  156 ? 56.666  -27.272 -2.709  1.00 14.19 ? 268  ASN C CB  1 
ATOM   2052  C  CG  . ASN B  2  156 ? 57.062  -25.851 -3.100  1.00 14.84 ? 268  ASN C CG  1 
ATOM   2053  O  OD1 . ASN B  2  156 ? 58.229  -25.470 -3.015  1.00 14.85 ? 268  ASN C OD1 1 
ATOM   2054  N  ND2 . ASN B  2  156 ? 56.088  -25.057 -3.531  1.00 13.77 ? 268  ASN C ND2 1 
ATOM   2055  N  N   . PRO B  2  157 ? 57.561  -30.817 -3.513  1.00 10.79 ? 269  PRO C N   1 
ATOM   2056  C  CA  . PRO B  2  157 ? 57.273  -32.208 -3.111  1.00 9.52  ? 269  PRO C CA  1 
ATOM   2057  C  C   . PRO B  2  157 ? 57.127  -32.442 -1.621  1.00 9.73  ? 269  PRO C C   1 
ATOM   2058  O  O   . PRO B  2  157 ? 56.298  -33.243 -1.232  1.00 13.27 ? 269  PRO C O   1 
ATOM   2059  C  CB  . PRO B  2  157 ? 58.429  -32.985 -3.715  1.00 10.96 ? 269  PRO C CB  1 
ATOM   2060  C  CG  . PRO B  2  157 ? 58.717  -32.191 -4.932  1.00 11.09 ? 269  PRO C CG  1 
ATOM   2061  C  CD  . PRO B  2  157 ? 58.719  -30.781 -4.426  1.00 9.96  ? 269  PRO C CD  1 
ATOM   2062  N  N   . ARG B  2  158 ? 57.893  -31.742 -0.788  1.00 11.44 ? 270  ARG C N   1 
ATOM   2063  C  CA  . ARG B  2  158 ? 57.813  -31.932 0.682   1.00 13.35 ? 270  ARG C CA  1 
ATOM   2064  C  C   . ARG B  2  158 ? 56.500  -31.402 1.284   1.00 11.99 ? 270  ARG C C   1 
ATOM   2065  O  O   . ARG B  2  158 ? 56.169  -31.727 2.422   1.00 12.13 ? 270  ARG C O   1 
ATOM   2066  C  CB  . ARG B  2  158 ? 58.962  -31.229 1.425   1.00 14.67 ? 270  ARG C CB  1 
ATOM   2067  C  CG  . ARG B  2  158 ? 60.367  -31.750 1.198   1.00 15.44 ? 270  ARG C CG  1 
ATOM   2068  C  CD  . ARG B  2  158 ? 60.569  -33.139 1.727   1.00 17.79 ? 270  ARG C CD  1 
ATOM   2069  N  NE  . ARG B  2  158 ? 60.210  -33.305 3.135   1.00 22.25 ? 270  ARG C NE  1 
ATOM   2070  C  CZ  . ARG B  2  158 ? 61.082  -33.628 4.093   1.00 26.36 ? 270  ARG C CZ  1 
ATOM   2071  N  NH1 . ARG B  2  158 ? 62.373  -33.694 3.814   1.00 28.71 ? 270  ARG C NH1 1 
ATOM   2072  N  NH2 . ARG B  2  158 ? 60.670  -33.851 5.339   1.00 28.72 ? 270  ARG C NH2 1 
ATOM   2073  N  N   . TRP B  2  159 ? 55.785  -30.566 0.543   1.00 12.04 ? 271  TRP C N   1 
ATOM   2074  C  CA  . TRP B  2  159 ? 54.534  -29.985 1.037   1.00 12.29 ? 271  TRP C CA  1 
ATOM   2075  C  C   . TRP B  2  159 ? 53.434  -31.030 1.232   1.00 11.27 ? 271  TRP C C   1 
ATOM   2076  O  O   . TRP B  2  159 ? 53.130  -31.823 0.312   1.00 11.03 ? 271  TRP C O   1 
ATOM   2077  C  CB  . TRP B  2  159 ? 54.042  -28.879 0.088   1.00 14.12 ? 271  TRP C CB  1 
ATOM   2078  C  CG  . TRP B  2  159 ? 54.768  -27.584 0.265   1.00 12.38 ? 271  TRP C CG  1 
ATOM   2079  C  CD1 . TRP B  2  159 ? 55.863  -27.351 1.048   1.00 11.28 ? 271  TRP C CD1 1 
ATOM   2080  C  CD2 . TRP B  2  159 ? 54.411  -26.330 -0.320  1.00 13.53 ? 271  TRP C CD2 1 
ATOM   2081  N  NE1 . TRP B  2  159 ? 56.201  -26.030 0.992   1.00 10.87 ? 271  TRP C NE1 1 
ATOM   2082  C  CE2 . TRP B  2  159 ? 55.332  -25.375 0.168   1.00 11.59 ? 271  TRP C CE2 1 
ATOM   2083  C  CE3 . TRP B  2  159 ? 53.394  -25.926 -1.217  1.00 12.88 ? 271  TRP C CE3 1 
ATOM   2084  C  CZ2 . TRP B  2  159 ? 55.277  -24.029 -0.205  1.00 13.41 ? 271  TRP C CZ2 1 
ATOM   2085  C  CZ3 . TRP B  2  159 ? 53.335  -24.589 -1.600  1.00 13.09 ? 271  TRP C CZ3 1 
ATOM   2086  C  CH2 . TRP B  2  159 ? 54.268  -23.655 -1.093  1.00 15.47 ? 271  TRP C CH2 1 
ATOM   2087  N  N   . ASP B  2  160 ? 52.860  -31.018 2.450   1.00 10.60 ? 272  ASP C N   1 
ATOM   2088  C  CA  . ASP B  2  160 ? 51.763  -31.915 2.828   1.00 10.59 ? 272  ASP C CA  1 
ATOM   2089  C  C   . ASP B  2  160 ? 50.415  -31.356 2.351   1.00 8.44  ? 272  ASP C C   1 
ATOM   2090  O  O   . ASP B  2  160 ? 50.373  -30.235 1.793   1.00 5.41  ? 272  ASP C O   1 
ATOM   2091  C  CB  . ASP B  2  160 ? 51.755  -32.182 4.363   1.00 9.19  ? 272  ASP C CB  1 
ATOM   2092  C  CG  . ASP B  2  160 ? 51.423  -30.997 5.295   1.00 11.40 ? 272  ASP C CG  1 
ATOM   2093  O  OD1 . ASP B  2  160 ? 51.573  -31.166 6.515   1.00 12.77 ? 272  ASP C OD1 1 
ATOM   2094  O  OD2 . ASP B  2  160 ? 51.016  -29.914 4.834   1.00 10.85 ? 272  ASP C OD2 1 
ATOM   2095  N  N   . GLY B  2  161 ? 49.341  -32.140 2.598   1.00 8.89  ? 273  GLY C N   1 
ATOM   2096  C  CA  . GLY B  2  161 ? 47.957  -31.812 2.171   1.00 9.19  ? 273  GLY C CA  1 
ATOM   2097  C  C   . GLY B  2  161 ? 47.469  -30.455 2.644   1.00 10.52 ? 273  GLY C C   1 
ATOM   2098  O  O   . GLY B  2  161 ? 47.023  -29.642 1.829   1.00 8.91  ? 273  GLY C O   1 
ATOM   2099  N  N   . GLU B  2  162 ? 47.581  -30.211 3.963   1.00 8.83  ? 274  GLU C N   1 
ATOM   2100  C  CA  . GLU B  2  162 ? 47.183  -28.955 4.591   1.00 9.34  ? 274  GLU C CA  1 
ATOM   2101  C  C   . GLU B  2  162 ? 47.891  -27.761 3.953   1.00 10.37 ? 274  GLU C C   1 
ATOM   2102  O  O   . GLU B  2  162 ? 47.261  -26.748 3.638   1.00 8.76  ? 274  GLU C O   1 
ATOM   2103  C  CB  . GLU B  2  162 ? 47.469  -29.019 6.089   1.00 7.20  ? 274  GLU C CB  1 
ATOM   2104  C  CG  . GLU B  2  162 ? 46.967  -27.830 6.899   1.00 9.94  ? 274  GLU C CG  1 
ATOM   2105  C  CD  . GLU B  2  162 ? 45.468  -27.546 6.754   1.00 8.11  ? 274  GLU C CD  1 
ATOM   2106  O  OE1 . GLU B  2  162 ? 45.077  -26.412 7.001   1.00 8.15  ? 274  GLU C OE1 1 
ATOM   2107  O  OE2 . GLU B  2  162 ? 44.697  -28.444 6.385   1.00 9.70  ? 274  GLU C OE2 1 
ATOM   2108  N  N   . ARG B  2  163 ? 49.201  -27.892 3.741   1.00 11.91 ? 275  ARG C N   1 
ATOM   2109  C  CA  . ARG B  2  163 ? 49.978  -26.838 3.106   1.00 12.39 ? 275  ARG C CA  1 
ATOM   2110  C  C   . ARG B  2  163 ? 49.513  -26.582 1.675   1.00 10.99 ? 275  ARG C C   1 
ATOM   2111  O  O   . ARG B  2  163 ? 49.334  -25.431 1.286   1.00 8.77  ? 275  ARG C O   1 
ATOM   2112  C  CB  . ARG B  2  163 ? 51.468  -27.197 3.087   1.00 15.19 ? 275  ARG C CB  1 
ATOM   2113  C  CG  . ARG B  2  163 ? 52.382  -26.062 2.633   1.00 17.19 ? 275  ARG C CG  1 
ATOM   2114  C  CD  . ARG B  2  163 ? 52.434  -24.948 3.665   1.00 20.46 ? 275  ARG C CD  1 
ATOM   2115  N  NE  . ARG B  2  163 ? 53.624  -24.125 3.495   1.00 22.70 ? 275  ARG C NE  1 
ATOM   2116  C  CZ  . ARG B  2  163 ? 54.790  -24.379 4.067   1.00 19.99 ? 275  ARG C CZ  1 
ATOM   2117  N  NH1 . ARG B  2  163 ? 54.921  -25.413 4.883   1.00 18.89 ? 275  ARG C NH1 1 
ATOM   2118  N  NH2 . ARG B  2  163 ? 55.813  -23.590 3.830   1.00 21.09 ? 275  ARG C NH2 1 
ATOM   2119  N  N   . LEU B  2  164 ? 49.344  -27.663 0.896   1.00 7.01  ? 276  LEU C N   1 
ATOM   2120  C  CA  . LEU B  2  164 ? 48.904  -27.546 -0.487  1.00 8.08  ? 276  LEU C CA  1 
ATOM   2121  C  C   . LEU B  2  164 ? 47.501  -26.928 -0.589  1.00 7.26  ? 276  LEU C C   1 
ATOM   2122  O  O   . LEU B  2  164 ? 47.260  -26.031 -1.418  1.00 5.35  ? 276  LEU C O   1 
ATOM   2123  C  CB  . LEU B  2  164 ? 48.947  -28.906 -1.166  1.00 6.04  ? 276  LEU C CB  1 
ATOM   2124  C  CG  . LEU B  2  164 ? 50.353  -29.469 -1.419  1.00 8.18  ? 276  LEU C CG  1 
ATOM   2125  C  CD1 . LEU B  2  164 ? 50.259  -30.977 -1.656  1.00 9.46  ? 276  LEU C CD1 1 
ATOM   2126  C  CD2 . LEU B  2  164 ? 51.028  -28.748 -2.596  1.00 2.00  ? 276  LEU C CD2 1 
ATOM   2127  N  N   . TYR B  2  165 ? 46.588  -27.404 0.245   1.00 7.33  ? 277  TYR C N   1 
ATOM   2128  C  CA  . TYR B  2  165 ? 45.235  -26.850 0.288   1.00 8.39  ? 277  TYR C CA  1 
ATOM   2129  C  C   . TYR B  2  165 ? 45.294  -25.358 0.602   1.00 8.66  ? 277  TYR C C   1 
ATOM   2130  O  O   . TYR B  2  165 ? 44.686  -24.539 -0.125  1.00 4.56  ? 277  TYR C O   1 
ATOM   2131  C  CB  . TYR B  2  165 ? 44.371  -27.571 1.360   1.00 6.65  ? 277  TYR C CB  1 
ATOM   2132  C  CG  . TYR B  2  165 ? 43.070  -26.862 1.730   1.00 5.90  ? 277  TYR C CG  1 
ATOM   2133  C  CD1 . TYR B  2  165 ? 43.005  -26.018 2.849   1.00 7.07  ? 277  TYR C CD1 1 
ATOM   2134  C  CD2 . TYR B  2  165 ? 41.889  -27.047 0.975   1.00 6.13  ? 277  TYR C CD2 1 
ATOM   2135  C  CE1 . TYR B  2  165 ? 41.805  -25.384 3.209   1.00 7.70  ? 277  TYR C CE1 1 
ATOM   2136  C  CE2 . TYR B  2  165 ? 40.688  -26.409 1.329   1.00 3.58  ? 277  TYR C CE2 1 
ATOM   2137  C  CZ  . TYR B  2  165 ? 40.653  -25.587 2.443   1.00 4.89  ? 277  TYR C CZ  1 
ATOM   2138  O  OH  . TYR B  2  165 ? 39.486  -24.967 2.795   1.00 6.50  ? 277  TYR C OH  1 
ATOM   2139  N  N   . GLN B  2  166 ? 46.016  -24.996 1.684   1.00 7.27  ? 278  GLN C N   1 
ATOM   2140  C  CA  . GLN B  2  166 ? 46.057  -23.605 2.077   1.00 6.97  ? 278  GLN C CA  1 
ATOM   2141  C  C   . GLN B  2  166 ? 46.678  -22.709 1.035   1.00 5.81  ? 278  GLN C C   1 
ATOM   2142  O  O   . GLN B  2  166 ? 46.166  -21.602 0.822   1.00 7.88  ? 278  GLN C O   1 
ATOM   2143  C  CB  . GLN B  2  166 ? 46.738  -23.413 3.430   1.00 5.47  ? 278  GLN C CB  1 
ATOM   2144  C  CG  . GLN B  2  166 ? 46.004  -24.071 4.586   1.00 8.56  ? 278  GLN C CG  1 
ATOM   2145  C  CD  . GLN B  2  166 ? 44.643  -23.469 4.940   1.00 9.26  ? 278  GLN C CD  1 
ATOM   2146  O  OE1 . GLN B  2  166 ? 44.135  -22.573 4.264   1.00 10.37 ? 278  GLN C OE1 1 
ATOM   2147  N  NE2 . GLN B  2  166 ? 44.045  -23.981 6.020   1.00 9.26  ? 278  GLN C NE2 1 
ATOM   2148  N  N   . GLU B  2  167 ? 47.753  -23.187 0.356   1.00 6.20  ? 279  GLU C N   1 
ATOM   2149  C  CA  . GLU B  2  167 ? 48.460  -22.397 -0.654  1.00 5.18  ? 279  GLU C CA  1 
ATOM   2150  C  C   . GLU B  2  167 ? 47.626  -22.176 -1.910  1.00 5.93  ? 279  GLU C C   1 
ATOM   2151  O  O   . GLU B  2  167 ? 47.638  -21.086 -2.478  1.00 3.59  ? 279  GLU C O   1 
ATOM   2152  C  CB  . GLU B  2  167 ? 49.799  -23.041 -1.019  1.00 6.59  ? 279  GLU C CB  1 
ATOM   2153  C  CG  . GLU B  2  167 ? 50.833  -22.955 0.097   1.00 9.95  ? 279  GLU C CG  1 
ATOM   2154  C  CD  . GLU B  2  167 ? 51.405  -21.555 0.291   1.00 10.68 ? 279  GLU C CD  1 
ATOM   2155  O  OE1 . GLU B  2  167 ? 51.572  -20.831 -0.708  1.00 11.34 ? 279  GLU C OE1 1 
ATOM   2156  O  OE2 . GLU B  2  167 ? 51.701  -21.185 1.446   1.00 11.20 ? 279  GLU C OE2 1 
ATOM   2157  N  N   . ALA B  2  168 ? 46.899  -23.213 -2.330  1.00 6.65  ? 280  ALA C N   1 
ATOM   2158  C  CA  . ALA B  2  168 ? 46.016  -23.111 -3.496  1.00 5.03  ? 280  ALA C CA  1 
ATOM   2159  C  C   . ALA B  2  168 ? 44.805  -22.237 -3.149  1.00 4.27  ? 280  ALA C C   1 
ATOM   2160  O  O   . ALA B  2  168 ? 44.450  -21.343 -3.909  1.00 5.79  ? 280  ALA C O   1 
ATOM   2161  C  CB  . ALA B  2  168 ? 45.584  -24.499 -3.929  1.00 3.86  ? 280  ALA C CB  1 
ATOM   2162  N  N   . ARG B  2  169 ? 44.219  -22.471 -1.968  1.00 5.56  ? 281  ARG C N   1 
ATOM   2163  C  CA  . ARG B  2  169 ? 43.110  -21.649 -1.442  1.00 9.71  ? 281  ARG C CA  1 
ATOM   2164  C  C   . ARG B  2  169 ? 43.484  -20.149 -1.459  1.00 10.45 ? 281  ARG C C   1 
ATOM   2165  O  O   . ARG B  2  169 ? 42.658  -19.286 -1.821  1.00 8.25  ? 281  ARG C O   1 
ATOM   2166  C  CB  . ARG B  2  169 ? 42.760  -22.075 0.004   1.00 7.02  ? 281  ARG C CB  1 
ATOM   2167  C  CG  . ARG B  2  169 ? 41.694  -21.229 0.675   1.00 6.83  ? 281  ARG C CG  1 
ATOM   2168  C  CD  . ARG B  2  169 ? 41.331  -21.739 2.072   1.00 6.55  ? 281  ARG C CD  1 
ATOM   2169  N  NE  . ARG B  2  169 ? 40.389  -20.841 2.783   1.00 5.93  ? 281  ARG C NE  1 
ATOM   2170  C  CZ  . ARG B  2  169 ? 40.605  -20.288 3.989   1.00 5.40  ? 281  ARG C CZ  1 
ATOM   2171  N  NH1 . ARG B  2  169 ? 41.733  -20.561 4.672   1.00 5.87  ? 281  ARG C NH1 1 
ATOM   2172  N  NH2 . ARG B  2  169 ? 39.699  -19.482 4.524   1.00 4.05  ? 281  ARG C NH2 1 
ATOM   2173  N  N   . LYS B  2  170 ? 44.748  -19.839 -1.066  1.00 8.47  ? 282  LYS C N   1 
ATOM   2174  C  CA  . LYS B  2  170 ? 45.217  -18.447 -1.014  1.00 6.91  ? 282  LYS C CA  1 
ATOM   2175  C  C   . LYS B  2  170 ? 45.320  -17.840 -2.408  1.00 3.73  ? 282  LYS C C   1 
ATOM   2176  O  O   . LYS B  2  170 ? 44.988  -16.666 -2.616  1.00 2.00  ? 282  LYS C O   1 
ATOM   2177  C  CB  . LYS B  2  170 ? 46.566  -18.393 -0.290  1.00 8.29  ? 282  LYS C CB  1 
ATOM   2178  C  CG  . LYS B  2  170 ? 47.130  -17.016 -0.024  1.00 9.18  ? 282  LYS C CG  1 
ATOM   2179  C  CD  . LYS B  2  170 ? 48.425  -17.173 0.744   1.00 9.80  ? 282  LYS C CD  1 
ATOM   2180  C  CE  . LYS B  2  170 ? 49.160  -15.870 0.879   1.00 13.23 ? 282  LYS C CE  1 
ATOM   2181  N  NZ  . LYS B  2  170 ? 50.206  -15.978 1.936   1.00 13.84 ? 282  LYS C NZ  1 
ATOM   2182  N  N   . ILE B  2  171 ? 45.755  -18.633 -3.360  1.00 4.24  ? 283  ILE C N   1 
ATOM   2183  C  CA  . ILE B  2  171 ? 45.845  -18.139 -4.728  1.00 7.20  ? 283  ILE C CA  1 
ATOM   2184  C  C   . ILE B  2  171 ? 44.435  -17.909 -5.346  1.00 7.23  ? 283  ILE C C   1 
ATOM   2185  O  O   . ILE B  2  171 ? 44.221  -16.906 -6.047  1.00 6.71  ? 283  ILE C O   1 
ATOM   2186  C  CB  . ILE B  2  171 ? 46.660  -19.086 -5.643  1.00 7.64  ? 283  ILE C CB  1 
ATOM   2187  C  CG1 . ILE B  2  171 ? 48.137  -19.085 -5.202  1.00 6.20  ? 283  ILE C CG1 1 
ATOM   2188  C  CG2 . ILE B  2  171 ? 46.506  -18.654 -7.109  1.00 2.51  ? 283  ILE C CG2 1 
ATOM   2189  C  CD1 . ILE B  2  171 ? 48.982  -20.148 -5.881  1.00 9.28  ? 283  ILE C CD1 1 
ATOM   2190  N  N   . VAL B  2  172 ? 43.501  -18.838 -5.074  1.00 5.62  ? 284  VAL C N   1 
ATOM   2191  C  CA  . VAL B  2  172 ? 42.119  -18.711 -5.574  1.00 7.06  ? 284  VAL C CA  1 
ATOM   2192  C  C   . VAL B  2  172 ? 41.463  -17.446 -4.997  1.00 5.60  ? 284  VAL C C   1 
ATOM   2193  O  O   . VAL B  2  172 ? 40.803  -16.707 -5.707  1.00 3.97  ? 284  VAL C O   1 
ATOM   2194  C  CB  . VAL B  2  172 ? 41.275  -19.963 -5.194  1.00 8.19  ? 284  VAL C CB  1 
ATOM   2195  C  CG1 . VAL B  2  172 ? 39.800  -19.712 -5.452  1.00 6.09  ? 284  VAL C CG1 1 
ATOM   2196  C  CG2 . VAL B  2  172 ? 41.763  -21.179 -5.990  1.00 8.64  ? 284  VAL C CG2 1 
ATOM   2197  N  N   . GLY B  2  173 ? 41.698  -17.209 -3.704  1.00 4.74  ? 285  GLY C N   1 
ATOM   2198  C  CA  . GLY B  2  173 ? 41.194  -16.025 -3.028  1.00 6.32  ? 285  GLY C CA  1 
ATOM   2199  C  C   . GLY B  2  173 ? 41.754  -14.749 -3.621  1.00 6.16  ? 285  GLY C C   1 
ATOM   2200  O  O   . GLY B  2  173 ? 41.027  -13.740 -3.793  1.00 3.43  ? 285  GLY C O   1 
ATOM   2201  N  N   . ALA B  2  174 ? 43.053  -14.803 -3.969  1.00 6.52  ? 286  ALA C N   1 
ATOM   2202  C  CA  . ALA B  2  174 ? 43.715  -13.697 -4.640  1.00 6.39  ? 286  ALA C CA  1 
ATOM   2203  C  C   . ALA B  2  174 ? 43.106  -13.484 -6.037  1.00 4.89  ? 286  ALA C C   1 
ATOM   2204  O  O   . ALA B  2  174 ? 42.890  -12.336 -6.461  1.00 4.94  ? 286  ALA C O   1 
ATOM   2205  C  CB  . ALA B  2  174 ? 45.209  -13.972 -4.756  1.00 5.85  ? 286  ALA C CB  1 
ATOM   2206  N  N   . MET B  2  175 ? 42.825  -14.581 -6.746  1.00 3.50  ? 287  MET C N   1 
ATOM   2207  C  CA  . MET B  2  175 ? 42.232  -14.476 -8.071  1.00 4.57  ? 287  MET C CA  1 
ATOM   2208  C  C   . MET B  2  175 ? 40.853  -13.789 -8.029  1.00 4.25  ? 287  MET C C   1 
ATOM   2209  O  O   . MET B  2  175 ? 40.545  -12.952 -8.895  1.00 4.21  ? 287  MET C O   1 
ATOM   2210  C  CB  . MET B  2  175 ? 42.130  -15.857 -8.719  1.00 4.22  ? 287  MET C CB  1 
ATOM   2211  C  CG  . MET B  2  175 ? 43.488  -16.425 -9.096  1.00 8.48  ? 287  MET C CG  1 
ATOM   2212  S  SD  . MET B  2  175 ? 43.447  -18.133 -9.684  1.00 7.86  ? 287  MET C SD  1 
ATOM   2213  C  CE  . MET B  2  175 ? 44.963  -18.137 -10.644 1.00 7.66  ? 287  MET C CE  1 
ATOM   2214  N  N   . VAL B  2  176 ? 40.036  -14.125 -7.034  1.00 4.50  ? 288  VAL C N   1 
ATOM   2215  C  CA  . VAL B  2  176 ? 38.719  -13.508 -6.932  1.00 5.29  ? 288  VAL C CA  1 
ATOM   2216  C  C   . VAL B  2  176 ? 38.817  -12.001 -6.648  1.00 6.35  ? 288  VAL C C   1 
ATOM   2217  O  O   . VAL B  2  176 ? 38.100  -11.194 -7.267  1.00 3.78  ? 288  VAL C O   1 
ATOM   2218  C  CB  . VAL B  2  176 ? 37.878  -14.194 -5.873  1.00 5.94  ? 288  VAL C CB  1 
ATOM   2219  C  CG1 . VAL B  2  176 ? 36.569  -13.436 -5.654  1.00 3.05  ? 288  VAL C CG1 1 
ATOM   2220  C  CG2 . VAL B  2  176 ? 37.575  -15.610 -6.337  1.00 6.87  ? 288  VAL C CG2 1 
ATOM   2221  N  N   . GLN B  2  177 ? 39.735  -11.619 -5.734  1.00 5.69  ? 289  GLN C N   1 
ATOM   2222  C  CA  . GLN B  2  177 ? 39.974  -10.207 -5.411  1.00 5.84  ? 289  GLN C CA  1 
ATOM   2223  C  C   . GLN B  2  177 ? 40.431  -9.418  -6.634  1.00 6.50  ? 289  GLN C C   1 
ATOM   2224  O  O   . GLN B  2  177 ? 39.881  -8.339  -6.918  1.00 8.06  ? 289  GLN C O   1 
ATOM   2225  C  CB  . GLN B  2  177 ? 41.031  -10.061 -4.311  1.00 5.26  ? 289  GLN C CB  1 
ATOM   2226  C  CG  . GLN B  2  177 ? 40.660  -10.693 -2.986  1.00 6.84  ? 289  GLN C CG  1 
ATOM   2227  C  CD  . GLN B  2  177 ? 41.636  -10.323 -1.864  1.00 8.54  ? 289  GLN C CD  1 
ATOM   2228  O  OE1 . GLN B  2  177 ? 42.772  -9.911  -2.124  1.00 8.93  ? 289  GLN C OE1 1 
ATOM   2229  N  NE2 . GLN B  2  177 ? 41.185  -10.447 -0.614  1.00 5.89  ? 289  GLN C NE2 1 
ATOM   2230  N  N   . ILE B  2  178 ? 41.426  -9.949  -7.376  1.00 4.59  ? 290  ILE C N   1 
ATOM   2231  C  CA  . ILE B  2  178 ? 41.929  -9.268  -8.569  1.00 4.59  ? 290  ILE C CA  1 
ATOM   2232  C  C   . ILE B  2  178 ? 40.844  -9.128  -9.686  1.00 5.42  ? 290  ILE C C   1 
ATOM   2233  O  O   . ILE B  2  178 ? 40.595  -8.031  -10.176 1.00 3.48  ? 290  ILE C O   1 
ATOM   2234  C  CB  . ILE B  2  178 ? 43.205  -9.965  -9.112  1.00 5.89  ? 290  ILE C CB  1 
ATOM   2235  C  CG1 . ILE B  2  178 ? 44.323  -9.790  -8.060  1.00 8.32  ? 290  ILE C CG1 1 
ATOM   2236  C  CG2 . ILE B  2  178 ? 43.643  -9.361  -10.447 1.00 2.00  ? 290  ILE C CG2 1 
ATOM   2237  C  CD1 . ILE B  2  178 ? 45.577  -10.602 -8.355  1.00 7.87  ? 290  ILE C CD1 1 
ATOM   2238  N  N   . ILE B  2  179 ? 40.201  -10.221 -10.077 1.00 4.64  ? 291  ILE C N   1 
ATOM   2239  C  CA  . ILE B  2  179 ? 39.175  -10.117 -11.095 1.00 6.88  ? 291  ILE C CA  1 
ATOM   2240  C  C   . ILE B  2  179 ? 38.100  -9.097  -10.679 1.00 6.96  ? 291  ILE C C   1 
ATOM   2241  O  O   . ILE B  2  179 ? 37.623  -8.316  -11.514 1.00 5.91  ? 291  ILE C O   1 
ATOM   2242  C  CB  . ILE B  2  179 ? 38.520  -11.507 -11.379 1.00 7.55  ? 291  ILE C CB  1 
ATOM   2243  C  CG1 . ILE B  2  179 ? 39.546  -12.431 -12.050 1.00 7.06  ? 291  ILE C CG1 1 
ATOM   2244  C  CG2 . ILE B  2  179 ? 37.286  -11.350 -12.277 1.00 4.25  ? 291  ILE C CG2 1 
ATOM   2245  C  CD1 . ILE B  2  179 ? 39.250  -13.906 -11.909 1.00 6.09  ? 291  ILE C CD1 1 
ATOM   2246  N  N   . THR B  2  180 ? 37.768  -9.089  -9.373  1.00 6.07  ? 292  THR C N   1 
ATOM   2247  C  CA  . THR B  2  180 ? 36.707  -8.230  -8.816  1.00 7.18  ? 292  THR C CA  1 
ATOM   2248  C  C   . THR B  2  180 ? 37.048  -6.714  -8.825  1.00 8.14  ? 292  THR C C   1 
ATOM   2249  O  O   . THR B  2  180 ? 36.296  -5.887  -9.388  1.00 3.29  ? 292  THR C O   1 
ATOM   2250  C  CB  . THR B  2  180 ? 36.351  -8.686  -7.369  1.00 7.38  ? 292  THR C CB  1 
ATOM   2251  O  OG1 . THR B  2  180 ? 35.736  -9.981  -7.415  1.00 7.70  ? 292  THR C OG1 1 
ATOM   2252  C  CG2 . THR B  2  180 ? 35.389  -7.711  -6.686  1.00 7.25  ? 292  THR C CG2 1 
ATOM   2253  N  N   . TYR B  2  181 ? 38.181  -6.358  -8.215  1.00 4.79  ? 293  TYR C N   1 
ATOM   2254  C  CA  . TYR B  2  181 ? 38.570  -4.958  -8.095  1.00 6.28  ? 293  TYR C CA  1 
ATOM   2255  C  C   . TYR B  2  181 ? 39.233  -4.385  -9.365  1.00 6.34  ? 293  TYR C C   1 
ATOM   2256  O  O   . TYR B  2  181 ? 39.115  -3.173  -9.647  1.00 8.03  ? 293  TYR C O   1 
ATOM   2257  C  CB  . TYR B  2  181 ? 39.494  -4.786  -6.882  1.00 4.33  ? 293  TYR C CB  1 
ATOM   2258  C  CG  . TYR B  2  181 ? 38.776  -4.846  -5.569  1.00 3.97  ? 293  TYR C CG  1 
ATOM   2259  C  CD1 . TYR B  2  181 ? 38.555  -3.696  -4.817  1.00 2.01  ? 293  TYR C CD1 1 
ATOM   2260  C  CD2 . TYR B  2  181 ? 38.296  -6.051  -5.082  1.00 3.97  ? 293  TYR C CD2 1 
ATOM   2261  C  CE1 . TYR B  2  181 ? 37.870  -3.755  -3.619  1.00 2.02  ? 293  TYR C CE1 1 
ATOM   2262  C  CE2 . TYR B  2  181 ? 37.606  -6.124  -3.884  1.00 4.34  ? 293  TYR C CE2 1 
ATOM   2263  C  CZ  . TYR B  2  181 ? 37.398  -4.976  -3.157  1.00 2.56  ? 293  TYR C CZ  1 
ATOM   2264  O  OH  . TYR B  2  181 ? 36.764  -5.058  -1.953  1.00 3.20  ? 293  TYR C OH  1 
ATOM   2265  N  N   . ARG B  2  182 ? 39.939  -5.241  -10.119 1.00 5.88  ? 294  ARG C N   1 
ATOM   2266  C  CA  . ARG B  2  182 ? 40.590  -4.814  -11.334 1.00 5.10  ? 294  ARG C CA  1 
ATOM   2267  C  C   . ARG B  2  182 ? 39.653  -4.800  -12.518 1.00 5.40  ? 294  ARG C C   1 
ATOM   2268  O  O   . ARG B  2  182 ? 39.691  -3.865  -13.295 1.00 3.12  ? 294  ARG C O   1 
ATOM   2269  C  CB  . ARG B  2  182 ? 41.744  -5.716  -11.694 1.00 5.80  ? 294  ARG C CB  1 
ATOM   2270  C  CG  . ARG B  2  182 ? 42.574  -5.185  -12.863 1.00 9.34  ? 294  ARG C CG  1 
ATOM   2271  C  CD  . ARG B  2  182 ? 43.604  -6.189  -13.328 1.00 6.07  ? 294  ARG C CD  1 
ATOM   2272  N  NE  . ARG B  2  182 ? 42.968  -7.323  -13.947 1.00 7.80  ? 294  ARG C NE  1 
ATOM   2273  C  CZ  . ARG B  2  182 ? 43.521  -8.504  -14.081 1.00 9.12  ? 294  ARG C CZ  1 
ATOM   2274  N  NH1 . ARG B  2  182 ? 44.778  -8.711  -13.651 1.00 7.55  ? 294  ARG C NH1 1 
ATOM   2275  N  NH2 . ARG B  2  182 ? 42.828  -9.481  -14.660 1.00 7.07  ? 294  ARG C NH2 1 
ATOM   2276  N  N   . ASP B  2  183 ? 38.822  -5.820  -12.650 1.00 3.73  ? 295  ASP C N   1 
ATOM   2277  C  CA  . ASP B  2  183 ? 38.036  -5.960  -13.865 1.00 5.86  ? 295  ASP C CA  1 
ATOM   2278  C  C   . ASP B  2  183 ? 36.550  -5.690  -13.722 1.00 5.85  ? 295  ASP C C   1 
ATOM   2279  O  O   . ASP B  2  183 ? 35.932  -5.130  -14.643 1.00 6.84  ? 295  ASP C O   1 
ATOM   2280  C  CB  . ASP B  2  183 ? 38.206  -7.355  -14.433 1.00 5.21  ? 295  ASP C CB  1 
ATOM   2281  C  CG  . ASP B  2  183 ? 39.636  -7.733  -14.705 1.00 8.47  ? 295  ASP C CG  1 
ATOM   2282  O  OD1 . ASP B  2  183 ? 39.990  -8.890  -14.400 1.00 9.62  ? 295  ASP C OD1 1 
ATOM   2283  O  OD2 . ASP B  2  183 ? 40.403  -6.889  -15.234 1.00 5.90  ? 295  ASP C OD2 1 
ATOM   2284  N  N   . TYR B  2  184 ? 35.980  -6.112  -12.590 1.00 8.54  ? 296  TYR C N   1 
ATOM   2285  C  CA  . TYR B  2  184 ? 34.522  -6.039  -12.394 1.00 8.09  ? 296  TYR C CA  1 
ATOM   2286  C  C   . TYR B  2  184 ? 34.015  -4.712  -11.828 1.00 7.94  ? 296  TYR C C   1 
ATOM   2287  O  O   . TYR B  2  184 ? 33.202  -4.043  -12.480 1.00 6.87  ? 296  TYR C O   1 
ATOM   2288  C  CB  . TYR B  2  184 ? 34.069  -7.212  -11.516 1.00 7.65  ? 296  TYR C CB  1 
ATOM   2289  C  CG  . TYR B  2  184 ? 32.612  -7.182  -11.133 1.00 6.80  ? 296  TYR C CG  1 
ATOM   2290  C  CD1 . TYR B  2  184 ? 31.618  -7.654  -12.003 1.00 7.45  ? 296  TYR C CD1 1 
ATOM   2291  C  CD2 . TYR B  2  184 ? 32.224  -6.690  -9.880  1.00 5.55  ? 296  TYR C CD2 1 
ATOM   2292  C  CE1 . TYR B  2  184 ? 30.276  -7.627  -11.611 1.00 4.56  ? 296  TYR C CE1 1 
ATOM   2293  C  CE2 . TYR B  2  184 ? 30.889  -6.664  -9.482  1.00 4.44  ? 296  TYR C CE2 1 
ATOM   2294  C  CZ  . TYR B  2  184 ? 29.919  -7.131  -10.344 1.00 4.59  ? 296  TYR C CZ  1 
ATOM   2295  O  OH  . TYR B  2  184 ? 28.598  -7.107  -9.945  1.00 4.99  ? 296  TYR C OH  1 
ATOM   2296  N  N   . LEU B  2  185 ? 34.495  -4.330  -10.620 1.00 7.59  ? 297  LEU C N   1 
ATOM   2297  C  CA  . LEU B  2  185 ? 34.008  -3.106  -9.948  1.00 6.64  ? 297  LEU C CA  1 
ATOM   2298  C  C   . LEU B  2  185 ? 34.120  -1.825  -10.777 1.00 6.74  ? 297  LEU C C   1 
ATOM   2299  O  O   . LEU B  2  185 ? 33.239  -0.973  -10.670 1.00 6.18  ? 297  LEU C O   1 
ATOM   2300  C  CB  . LEU B  2  185 ? 34.655  -2.912  -8.562  1.00 5.05  ? 297  LEU C CB  1 
ATOM   2301  C  CG  . LEU B  2  185 ? 34.211  -3.894  -7.474  1.00 3.06  ? 297  LEU C CG  1 
ATOM   2302  C  CD1 . LEU B  2  185 ? 34.976  -3.634  -6.207  1.00 2.67  ? 297  LEU C CD1 1 
ATOM   2303  C  CD2 . LEU B  2  185 ? 32.727  -3.762  -7.214  1.00 2.61  ? 297  LEU C CD2 1 
ATOM   2304  N  N   . PRO B  2  186 ? 35.186  -1.621  -11.591 1.00 6.04  ? 298  PRO C N   1 
ATOM   2305  C  CA  . PRO B  2  186 ? 35.289  -0.412  -12.406 1.00 5.90  ? 298  PRO C CA  1 
ATOM   2306  C  C   . PRO B  2  186 ? 34.144  -0.347  -13.446 1.00 5.77  ? 298  PRO C C   1 
ATOM   2307  O  O   . PRO B  2  186 ? 33.685  0.736   -13.807 1.00 4.66  ? 298  PRO C O   1 
ATOM   2308  C  CB  . PRO B  2  186 ? 36.663  -0.539  -13.066 1.00 5.87  ? 298  PRO C CB  1 
ATOM   2309  C  CG  . PRO B  2  186 ? 37.415  -1.389  -12.106 1.00 4.99  ? 298  PRO C CG  1 
ATOM   2310  C  CD  . PRO B  2  186 ? 36.417  -2.447  -11.726 1.00 4.64  ? 298  PRO C CD  1 
ATOM   2311  N  N   . LEU B  2  187 ? 33.682  -1.502  -13.901 1.00 5.09  ? 299  LEU C N   1 
ATOM   2312  C  CA  . LEU B  2  187 ? 32.608  -1.529  -14.873 1.00 6.52  ? 299  LEU C CA  1 
ATOM   2313  C  C   . LEU B  2  187 ? 31.231  -1.424  -14.198 1.00 6.04  ? 299  LEU C C   1 
ATOM   2314  O  O   . LEU B  2  187 ? 30.238  -1.106  -14.860 1.00 6.65  ? 299  LEU C O   1 
ATOM   2315  C  CB  . LEU B  2  187 ? 32.726  -2.764  -15.795 1.00 5.58  ? 299  LEU C CB  1 
ATOM   2316  C  CG  . LEU B  2  187 ? 33.553  -2.552  -17.091 1.00 7.89  ? 299  LEU C CG  1 
ATOM   2317  C  CD1 . LEU B  2  187 ? 34.951  -2.027  -16.770 1.00 8.02  ? 299  LEU C CD1 1 
ATOM   2318  C  CD2 . LEU B  2  187 ? 33.651  -3.842  -17.880 1.00 6.07  ? 299  LEU C CD2 1 
ATOM   2319  N  N   . VAL B  2  188 ? 31.180  -1.642  -12.889 1.00 4.66  ? 300  VAL C N   1 
ATOM   2320  C  CA  . VAL B  2  188 ? 29.942  -1.466  -12.146 1.00 6.87  ? 300  VAL C CA  1 
ATOM   2321  C  C   . VAL B  2  188 ? 29.743  0.012   -11.828 1.00 7.75  ? 300  VAL C C   1 
ATOM   2322  O  O   . VAL B  2  188 ? 28.700  0.594   -12.146 1.00 7.90  ? 300  VAL C O   1 
ATOM   2323  C  CB  . VAL B  2  188 ? 29.928  -2.252  -10.791 1.00 7.72  ? 300  VAL C CB  1 
ATOM   2324  C  CG1 . VAL B  2  188 ? 28.620  -1.990  -10.010 1.00 7.36  ? 300  VAL C CG1 1 
ATOM   2325  C  CG2 . VAL B  2  188 ? 30.068  -3.738  -11.052 1.00 6.43  ? 300  VAL C CG2 1 
ATOM   2326  N  N   . LEU B  2  189 ? 30.774  0.602   -11.223 1.00 8.90  ? 301  LEU C N   1 
ATOM   2327  C  CA  . LEU B  2  189 ? 30.754  1.955   -10.681 1.00 5.81  ? 301  LEU C CA  1 
ATOM   2328  C  C   . LEU B  2  189 ? 30.931  3.062   -11.685 1.00 6.13  ? 301  LEU C C   1 
ATOM   2329  O  O   . LEU B  2  189 ? 30.338  4.121   -11.516 1.00 9.02  ? 301  LEU C O   1 
ATOM   2330  C  CB  . LEU B  2  189 ? 31.847  2.104   -9.620  1.00 6.41  ? 301  LEU C CB  1 
ATOM   2331  C  CG  . LEU B  2  189 ? 31.776  1.172   -8.405  1.00 8.17  ? 301  LEU C CG  1 
ATOM   2332  C  CD1 . LEU B  2  189 ? 33.001  1.402   -7.522  1.00 7.91  ? 301  LEU C CD1 1 
ATOM   2333  C  CD2 . LEU B  2  189 ? 30.492  1.416   -7.623  1.00 7.42  ? 301  LEU C CD2 1 
ATOM   2334  N  N   . GLY B  2  190 ? 31.708  2.824   -12.728 1.00 5.76  ? 302  GLY C N   1 
ATOM   2335  C  CA  . GLY B  2  190 ? 32.090  3.898   -13.627 1.00 5.96  ? 302  GLY C CA  1 
ATOM   2336  C  C   . GLY B  2  190 ? 33.369  4.529   -13.087 1.00 6.69  ? 302  GLY C C   1 
ATOM   2337  O  O   . GLY B  2  190 ? 33.573  4.470   -11.885 1.00 6.70  ? 302  GLY C O   1 
ATOM   2338  N  N   . PRO B  2  191 ? 34.229  5.146   -13.927 1.00 8.05  ? 303  PRO C N   1 
ATOM   2339  C  CA  . PRO B  2  191 ? 35.516  5.758   -13.490 1.00 9.28  ? 303  PRO C CA  1 
ATOM   2340  C  C   . PRO B  2  191 ? 35.416  6.815   -12.384 1.00 11.52 ? 303  PRO C C   1 
ATOM   2341  O  O   . PRO B  2  191 ? 36.285  6.883   -11.491 1.00 10.21 ? 303  PRO C O   1 
ATOM   2342  C  CB  . PRO B  2  191 ? 36.115  6.318   -14.783 1.00 10.16 ? 303  PRO C CB  1 
ATOM   2343  C  CG  . PRO B  2  191 ? 34.920  6.493   -15.670 1.00 11.89 ? 303  PRO C CG  1 
ATOM   2344  C  CD  . PRO B  2  191 ? 34.057  5.293   -15.386 1.00 8.97  ? 303  PRO C CD  1 
ATOM   2345  N  N   . THR B  2  192 ? 34.366  7.629   -12.421 1.00 10.98 ? 304  THR C N   1 
ATOM   2346  C  CA  . THR B  2  192 ? 34.222  8.668   -11.418 1.00 10.69 ? 304  THR C CA  1 
ATOM   2347  C  C   . THR B  2  192 ? 33.920  8.090   -10.034 1.00 10.13 ? 304  THR C C   1 
ATOM   2348  O  O   . THR B  2  192 ? 34.598  8.453   -9.058  1.00 8.73  ? 304  THR C O   1 
ATOM   2349  C  CB  . THR B  2  192 ? 33.155  9.694   -11.831 1.00 10.03 ? 304  THR C CB  1 
ATOM   2350  O  OG1 . THR B  2  192 ? 33.530  10.235  -13.101 1.00 11.05 ? 304  THR C OG1 1 
ATOM   2351  C  CG2 . THR B  2  192 ? 33.074  10.819  -10.820 1.00 10.62 ? 304  THR C CG2 1 
ATOM   2352  N  N   . ALA B  2  193 ? 32.936  7.183   -9.932  1.00 6.74  ? 305  ALA C N   1 
ATOM   2353  C  CA  . ALA B  2  193 ? 32.659  6.558   -8.630  1.00 7.89  ? 305  ALA C CA  1 
ATOM   2354  C  C   . ALA B  2  193 ? 33.842  5.679   -8.184  1.00 7.54  ? 305  ALA C C   1 
ATOM   2355  O  O   . ALA B  2  193 ? 34.132  5.602   -6.991  1.00 6.24  ? 305  ALA C O   1 
ATOM   2356  C  CB  . ALA B  2  193 ? 31.375  5.722   -8.661  1.00 3.17  ? 305  ALA C CB  1 
ATOM   2357  N  N   . MET B  2  194 ? 34.503  5.011   -9.148  1.00 6.74  ? 306  MET C N   1 
ATOM   2358  C  CA  . MET B  2  194 ? 35.696  4.203   -8.848  1.00 9.36  ? 306  MET C CA  1 
ATOM   2359  C  C   . MET B  2  194 ? 36.766  5.064   -8.128  1.00 10.24 ? 306  MET C C   1 
ATOM   2360  O  O   . MET B  2  194 ? 37.230  4.719   -7.022  1.00 12.42 ? 306  MET C O   1 
ATOM   2361  C  CB  . MET B  2  194 ? 36.279  3.627   -10.142 1.00 8.00  ? 306  MET C CB  1 
ATOM   2362  C  CG  . MET B  2  194 ? 37.528  2.780   -9.960  1.00 14.28 ? 306  MET C CG  1 
ATOM   2363  S  SD  . MET B  2  194 ? 37.173  1.228   -9.143  1.00 22.14 ? 306  MET C SD  1 
ATOM   2364  C  CE  . MET B  2  194 ? 38.811  0.785   -8.605  1.00 24.03 ? 306  MET C CE  1 
ATOM   2365  N  N   . ARG B  2  195 ? 37.130  6.200   -8.734  1.00 10.66 ? 307  ARG C N   1 
ATOM   2366  C  CA  . ARG B  2  195 ? 38.097  7.107   -8.130  1.00 11.04 ? 307  ARG C CA  1 
ATOM   2367  C  C   . ARG B  2  195 ? 37.641  7.629   -6.750  1.00 10.64 ? 307  ARG C C   1 
ATOM   2368  O  O   . ARG B  2  195 ? 38.443  7.695   -5.822  1.00 10.92 ? 307  ARG C O   1 
ATOM   2369  C  CB  . ARG B  2  195 ? 38.407  8.275   -9.085  1.00 14.18 ? 307  ARG C CB  1 
ATOM   2370  C  CG  . ARG B  2  195 ? 39.501  7.980   -10.120 1.00 16.01 ? 307  ARG C CG  1 
ATOM   2371  C  CD  . ARG B  2  195 ? 39.768  9.185   -11.024 1.00 17.21 ? 307  ARG C CD  1 
ATOM   2372  N  NE  . ARG B  2  195 ? 38.597  9.533   -11.840 1.00 20.39 ? 307  ARG C NE  1 
ATOM   2373  C  CZ  . ARG B  2  195 ? 38.411  9.174   -13.129 1.00 21.23 ? 307  ARG C CZ  1 
ATOM   2374  N  NH1 . ARG B  2  195 ? 39.337  8.480   -13.779 1.00 22.94 ? 307  ARG C NH1 1 
ATOM   2375  N  NH2 . ARG B  2  195 ? 37.302  9.527   -13.770 1.00 21.58 ? 307  ARG C NH2 1 
ATOM   2376  N  N   . LYS B  2  196 ? 36.363  7.946   -6.590  1.00 9.86  ? 308  LYS C N   1 
ATOM   2377  C  CA  . LYS B  2  196 ? 35.857  8.472   -5.307  1.00 11.59 ? 308  LYS C CA  1 
ATOM   2378  C  C   . LYS B  2  196 ? 35.865  7.449   -4.171  1.00 9.67  ? 308  LYS C C   1 
ATOM   2379  O  O   . LYS B  2  196 ? 36.365  7.734   -3.089  1.00 9.40  ? 308  LYS C O   1 
ATOM   2380  C  CB  . LYS B  2  196 ? 34.421  9.029   -5.442  1.00 11.76 ? 308  LYS C CB  1 
ATOM   2381  C  CG  . LYS B  2  196 ? 33.847  9.667   -4.172  1.00 11.48 ? 308  LYS C CG  1 
ATOM   2382  C  CD  . LYS B  2  196 ? 32.467  10.229  -4.438  1.00 10.85 ? 308  LYS C CD  1 
ATOM   2383  C  CE  . LYS B  2  196 ? 31.922  11.012  -3.255  1.00 14.59 ? 308  LYS C CE  1 
ATOM   2384  N  NZ  . LYS B  2  196 ? 32.578  12.353  -3.130  1.00 15.88 ? 308  LYS C NZ  1 
ATOM   2385  N  N   . TYR B  2  197 ? 35.288  6.274   -4.415  1.00 9.05  ? 309  TYR C N   1 
ATOM   2386  C  CA  . TYR B  2  197 ? 35.123  5.276   -3.364  1.00 8.82  ? 309  TYR C CA  1 
ATOM   2387  C  C   . TYR B  2  197 ? 36.263  4.284   -3.303  1.00 6.77  ? 309  TYR C C   1 
ATOM   2388  O  O   . TYR B  2  197 ? 36.450  3.646   -2.280  1.00 7.06  ? 309  TYR C O   1 
ATOM   2389  C  CB  . TYR B  2  197 ? 33.778  4.527   -3.519  1.00 8.68  ? 309  TYR C CB  1 
ATOM   2390  C  CG  . TYR B  2  197 ? 32.585  5.457   -3.496  1.00 7.13  ? 309  TYR C CG  1 
ATOM   2391  C  CD1 . TYR B  2  197 ? 32.196  6.070   -2.309  1.00 10.17 ? 309  TYR C CD1 1 
ATOM   2392  C  CD2 . TYR B  2  197 ? 31.899  5.794   -4.661  1.00 4.95  ? 309  TYR C CD2 1 
ATOM   2393  C  CE1 . TYR B  2  197 ? 31.172  7.003   -2.277  1.00 10.99 ? 309  TYR C CE1 1 
ATOM   2394  C  CE2 . TYR B  2  197 ? 30.862  6.728   -4.642  1.00 8.96  ? 309  TYR C CE2 1 
ATOM   2395  C  CZ  . TYR B  2  197 ? 30.509  7.333   -3.441  1.00 10.73 ? 309  TYR C CZ  1 
ATOM   2396  O  OH  . TYR B  2  197 ? 29.527  8.296   -3.405  1.00 9.95  ? 309  TYR C OH  1 
ATOM   2397  N  N   . LEU B  2  198 ? 37.017  4.141   -4.376  1.00 6.91  ? 310  LEU C N   1 
ATOM   2398  C  CA  . LEU B  2  198 ? 38.130  3.192   -4.339  1.00 9.50  ? 310  LEU C CA  1 
ATOM   2399  C  C   . LEU B  2  198 ? 39.479  3.791   -4.718  1.00 8.01  ? 310  LEU C C   1 
ATOM   2400  O  O   . LEU B  2  198 ? 40.068  3.428   -5.724  1.00 7.08  ? 310  LEU C O   1 
ATOM   2401  C  CB  . LEU B  2  198 ? 37.796  1.953   -5.183  1.00 7.20  ? 310  LEU C CB  1 
ATOM   2402  C  CG  . LEU B  2  198 ? 36.885  0.970   -4.463  1.00 6.72  ? 310  LEU C CG  1 
ATOM   2403  C  CD1 . LEU B  2  198 ? 36.223  0.031   -5.452  1.00 7.53  ? 310  LEU C CD1 1 
ATOM   2404  C  CD2 . LEU B  2  198 ? 37.694  0.220   -3.406  1.00 5.19  ? 310  LEU C CD2 1 
ATOM   2405  N  N   . PRO B  2  199 ? 39.989  4.739   -3.911  1.00 9.44  ? 311  PRO C N   1 
ATOM   2406  C  CA  . PRO B  2  199 ? 41.305  5.361   -4.157  1.00 10.44 ? 311  PRO C CA  1 
ATOM   2407  C  C   . PRO B  2  199 ? 42.372  4.288   -4.080  1.00 9.79  ? 311  PRO C C   1 
ATOM   2408  O  O   . PRO B  2  199 ? 42.119  3.222   -3.521  1.00 9.83  ? 311  PRO C O   1 
ATOM   2409  C  CB  . PRO B  2  199 ? 41.458  6.352   -3.005  1.00 11.28 ? 311  PRO C CB  1 
ATOM   2410  C  CG  . PRO B  2  199 ? 40.638  5.718   -1.936  1.00 11.45 ? 311  PRO C CG  1 
ATOM   2411  C  CD  . PRO B  2  199 ? 39.390  5.270   -2.674  1.00 10.43 ? 311  PRO C CD  1 
ATOM   2412  N  N   . THR B  2  200 ? 43.548  4.569   -4.646  1.00 10.69 ? 312  THR C N   1 
ATOM   2413  C  CA  . THR B  2  200 ? 44.669  3.630   -4.640  1.00 10.83 ? 312  THR C CA  1 
ATOM   2414  C  C   . THR B  2  200 ? 44.856  2.997   -3.280  1.00 8.40  ? 312  THR C C   1 
ATOM   2415  O  O   . THR B  2  200 ? 44.898  3.694   -2.269  1.00 8.51  ? 312  THR C O   1 
ATOM   2416  C  CB  . THR B  2  200 ? 45.985  4.345   -4.990  1.00 13.68 ? 312  THR C CB  1 
ATOM   2417  O  OG1 . THR B  2  200 ? 45.771  5.128   -6.163  1.00 15.49 ? 312  THR C OG1 1 
ATOM   2418  C  CG2 . THR B  2  200 ? 47.113  3.336   -5.233  1.00 11.29 ? 312  THR C CG2 1 
ATOM   2419  N  N   . TYR B  2  201 ? 44.970  1.674   -3.270  1.00 8.51  ? 313  TYR C N   1 
ATOM   2420  C  CA  . TYR B  2  201 ? 45.229  0.923   -2.049  1.00 10.41 ? 313  TYR C CA  1 
ATOM   2421  C  C   . TYR B  2  201 ? 46.550  1.378   -1.400  1.00 11.43 ? 313  TYR C C   1 
ATOM   2422  O  O   . TYR B  2  201 ? 47.554  1.571   -2.089  1.00 12.30 ? 313  TYR C O   1 
ATOM   2423  C  CB  . TYR B  2  201 ? 45.317  -0.559  -2.384  1.00 6.47  ? 313  TYR C CB  1 
ATOM   2424  C  CG  . TYR B  2  201 ? 45.600  -1.426  -1.189  1.00 8.08  ? 313  TYR C CG  1 
ATOM   2425  C  CD1 . TYR B  2  201 ? 44.655  -1.578  -0.186  1.00 6.12  ? 313  TYR C CD1 1 
ATOM   2426  C  CD2 . TYR B  2  201 ? 46.804  -2.147  -1.080  1.00 9.98  ? 313  TYR C CD2 1 
ATOM   2427  C  CE1 . TYR B  2  201 ? 44.871  -2.422  0.902   1.00 7.51  ? 313  TYR C CE1 1 
ATOM   2428  C  CE2 . TYR B  2  201 ? 47.038  -3.000  0.007   1.00 10.24 ? 313  TYR C CE2 1 
ATOM   2429  C  CZ  . TYR B  2  201 ? 46.064  -3.132  0.999   1.00 7.12  ? 313  TYR C CZ  1 
ATOM   2430  O  OH  . TYR B  2  201 ? 46.298  -3.922  2.101   1.00 4.63  ? 313  TYR C OH  1 
ATOM   2431  N  N   . ARG B  2  202 ? 46.550  1.571   -0.097  1.00 12.90 ? 314  ARG C N   1 
ATOM   2432  C  CA  . ARG B  2  202 ? 47.798  1.948   0.578   1.00 16.23 ? 314  ARG C CA  1 
ATOM   2433  C  C   . ARG B  2  202 ? 48.298  0.813   1.442   1.00 17.15 ? 314  ARG C C   1 
ATOM   2434  O  O   . ARG B  2  202 ? 49.428  0.387   1.297   1.00 21.63 ? 314  ARG C O   1 
ATOM   2435  C  CB  . ARG B  2  202 ? 47.617  3.215   1.412   1.00 15.61 ? 314  ARG C CB  1 
ATOM   2436  C  CG  . ARG B  2  202 ? 47.319  4.437   0.569   1.00 16.52 ? 314  ARG C CG  1 
ATOM   2437  C  CD  . ARG B  2  202 ? 48.415  4.655   -0.453  1.00 19.85 ? 314  ARG C CD  1 
ATOM   2438  N  NE  . ARG B  2  202 ? 48.060  5.689   -1.412  1.00 23.16 ? 314  ARG C NE  1 
ATOM   2439  C  CZ  . ARG B  2  202 ? 48.736  5.957   -2.527  1.00 25.83 ? 314  ARG C CZ  1 
ATOM   2440  N  NH1 . ARG B  2  202 ? 49.839  5.267   -2.819  1.00 27.67 ? 314  ARG C NH1 1 
ATOM   2441  N  NH2 . ARG B  2  202 ? 48.311  6.920   -3.352  1.00 27.19 ? 314  ARG C NH2 1 
ATOM   2442  N  N   . SER B  2  203 ? 47.457  0.309   2.318   1.00 13.38 ? 315  SER C N   1 
ATOM   2443  C  CA  . SER B  2  203 ? 47.831  -0.795  3.173   1.00 12.82 ? 315  SER C CA  1 
ATOM   2444  C  C   . SER B  2  203 ? 46.658  -1.188  4.014   1.00 7.35  ? 315  SER C C   1 
ATOM   2445  O  O   . SER B  2  203 ? 45.677  -0.456  4.080   1.00 6.95  ? 315  SER C O   1 
ATOM   2446  C  CB  . SER B  2  203 ? 49.003  -0.396  4.116   1.00 17.85 ? 315  SER C CB  1 
ATOM   2447  O  OG  . SER B  2  203 ? 48.643  0.668   5.021   1.00 20.75 ? 315  SER C OG  1 
ATOM   2448  N  N   . TYR B  2  204 ? 46.764  -2.328  4.652   1.00 6.18  ? 316  TYR C N   1 
ATOM   2449  C  CA  . TYR B  2  204 ? 45.742  -2.768  5.583   1.00 8.58  ? 316  TYR C CA  1 
ATOM   2450  C  C   . TYR B  2  204 ? 45.632  -1.775  6.745   1.00 10.45 ? 316  TYR C C   1 
ATOM   2451  O  O   . TYR B  2  204 ? 46.645  -1.276  7.263   1.00 10.79 ? 316  TYR C O   1 
ATOM   2452  C  CB  . TYR B  2  204 ? 46.071  -4.176  6.092   1.00 6.92  ? 316  TYR C CB  1 
ATOM   2453  C  CG  . TYR B  2  204 ? 45.240  -4.670  7.274   1.00 10.52 ? 316  TYR C CG  1 
ATOM   2454  C  CD1 . TYR B  2  204 ? 43.825  -4.771  7.201   1.00 7.15  ? 316  TYR C CD1 1 
ATOM   2455  C  CD2 . TYR B  2  204 ? 45.869  -5.028  8.480   1.00 7.84  ? 316  TYR C CD2 1 
ATOM   2456  C  CE1 . TYR B  2  204 ? 43.081  -5.207  8.301   1.00 7.78  ? 316  TYR C CE1 1 
ATOM   2457  C  CE2 . TYR B  2  204 ? 45.130  -5.467  9.581   1.00 9.77  ? 316  TYR C CE2 1 
ATOM   2458  C  CZ  . TYR B  2  204 ? 43.736  -5.554  9.490   1.00 5.67  ? 316  TYR C CZ  1 
ATOM   2459  O  OH  . TYR B  2  204 ? 43.009  -5.964  10.591  1.00 7.85  ? 316  TYR C OH  1 
ATOM   2460  N  N   . ASN B  2  205 ? 44.392  -1.493  7.132   1.00 8.40  ? 317  ASN C N   1 
ATOM   2461  C  CA  . ASN B  2  205 ? 44.068  -0.597  8.235   1.00 8.33  ? 317  ASN C CA  1 
ATOM   2462  C  C   . ASN B  2  205 ? 43.135  -1.341  9.153   1.00 8.27  ? 317  ASN C C   1 
ATOM   2463  O  O   . ASN B  2  205 ? 41.970  -1.547  8.817   1.00 8.35  ? 317  ASN C O   1 
ATOM   2464  C  CB  . ASN B  2  205 ? 43.403  0.678   7.670   1.00 9.32  ? 317  ASN C CB  1 
ATOM   2465  C  CG  . ASN B  2  205 ? 43.033  1.728   8.712   1.00 8.83  ? 317  ASN C CG  1 
ATOM   2466  O  OD1 . ASN B  2  205 ? 42.904  1.426   9.882   1.00 8.35  ? 317  ASN C OD1 1 
ATOM   2467  N  ND2 . ASN B  2  205 ? 42.834  2.977   8.270   1.00 12.64 ? 317  ASN C ND2 1 
ATOM   2468  N  N   . ASP B  2  206 ? 43.646  -1.769  10.294  1.00 6.43  ? 318  ASP C N   1 
ATOM   2469  C  CA  . ASP B  2  206 ? 42.846  -2.549  11.225  1.00 6.80  ? 318  ASP C CA  1 
ATOM   2470  C  C   . ASP B  2  206 ? 41.732  -1.743  11.897  1.00 7.43  ? 318  ASP C C   1 
ATOM   2471  O  O   . ASP B  2  206 ? 41.002  -2.265  12.743  1.00 9.90  ? 318  ASP C O   1 
ATOM   2472  C  CB  . ASP B  2  206 ? 43.741  -3.266  12.277  1.00 11.74 ? 318  ASP C CB  1 
ATOM   2473  C  CG  . ASP B  2  206 ? 44.431  -2.414  13.377  1.00 14.20 ? 318  ASP C CG  1 
ATOM   2474  O  OD1 . ASP B  2  206 ? 44.189  -1.198  13.505  1.00 13.50 ? 318  ASP C OD1 1 
ATOM   2475  O  OD2 . ASP B  2  206 ? 45.230  -2.999  14.130  1.00 18.88 ? 318  ASP C OD2 1 
ATOM   2476  N  N   . SER B  2  207 ? 41.590  -0.487  11.544  1.00 4.36  ? 319  SER C N   1 
ATOM   2477  C  CA  . SER B  2  207 ? 40.514  0.278   12.121  1.00 6.74  ? 319  SER C CA  1 
ATOM   2478  C  C   . SER B  2  207 ? 39.342  0.419   11.133  1.00 7.88  ? 319  SER C C   1 
ATOM   2479  O  O   . SER B  2  207 ? 38.317  1.069   11.450  1.00 8.43  ? 319  SER C O   1 
ATOM   2480  C  CB  . SER B  2  207 ? 41.024  1.642   12.582  1.00 4.83  ? 319  SER C CB  1 
ATOM   2481  O  OG  . SER B  2  207 ? 41.890  1.483   13.694  1.00 4.87  ? 319  SER C OG  1 
ATOM   2482  N  N   . VAL B  2  208 ? 39.509  -0.149  9.920   1.00 6.04  ? 320  VAL C N   1 
ATOM   2483  C  CA  . VAL B  2  208 ? 38.426  -0.164  8.929   1.00 5.90  ? 320  VAL C CA  1 
ATOM   2484  C  C   . VAL B  2  208 ? 37.452  -1.342  9.239   1.00 8.17  ? 320  VAL C C   1 
ATOM   2485  O  O   . VAL B  2  208 ? 37.886  -2.500  9.352   1.00 9.98  ? 320  VAL C O   1 
ATOM   2486  C  CB  . VAL B  2  208 ? 38.988  -0.303  7.487   1.00 3.49  ? 320  VAL C CB  1 
ATOM   2487  C  CG1 . VAL B  2  208 ? 37.859  -0.561  6.500   1.00 3.51  ? 320  VAL C CG1 1 
ATOM   2488  C  CG2 . VAL B  2  208 ? 39.725  0.963   7.090   1.00 2.00  ? 320  VAL C CG2 1 
ATOM   2489  N  N   . ASP B  2  209 ? 36.154  -1.026  9.463   1.00 4.72  ? 321  ASP C N   1 
ATOM   2490  C  CA  . ASP B  2  209 ? 35.144  -2.083  9.698   1.00 7.34  ? 321  ASP C CA  1 
ATOM   2491  C  C   . ASP B  2  209 ? 34.898  -2.861  8.376   1.00 4.31  ? 321  ASP C C   1 
ATOM   2492  O  O   . ASP B  2  209 ? 34.450  -2.284  7.390   1.00 2.00  ? 321  ASP C O   1 
ATOM   2493  C  CB  . ASP B  2  209 ? 33.805  -1.486  10.253  1.00 5.31  ? 321  ASP C CB  1 
ATOM   2494  C  CG  . ASP B  2  209 ? 32.813  -2.543  10.793  1.00 3.37  ? 321  ASP C CG  1 
ATOM   2495  O  OD1 . ASP B  2  209 ? 31.937  -2.179  11.596  1.00 7.68  ? 321  ASP C OD1 1 
ATOM   2496  O  OD2 . ASP B  2  209 ? 32.921  -3.739  10.443  1.00 3.48  ? 321  ASP C OD2 1 
ATOM   2497  N  N   . PRO B  2  210 ? 35.253  -4.177  8.348   1.00 2.35  ? 322  PRO C N   1 
ATOM   2498  C  CA  . PRO B  2  210 ? 35.083  -5.025  7.180   1.00 5.24  ? 322  PRO C CA  1 
ATOM   2499  C  C   . PRO B  2  210 ? 33.721  -5.749  7.110   1.00 5.05  ? 322  PRO C C   1 
ATOM   2500  O  O   . PRO B  2  210 ? 33.490  -6.465  6.152   1.00 9.31  ? 322  PRO C O   1 
ATOM   2501  C  CB  . PRO B  2  210 ? 36.203  -6.025  7.364   1.00 4.99  ? 322  PRO C CB  1 
ATOM   2502  C  CG  . PRO B  2  210 ? 36.093  -6.300  8.813   1.00 6.16  ? 322  PRO C CG  1 
ATOM   2503  C  CD  . PRO B  2  210 ? 35.901  -4.936  9.437   1.00 2.45  ? 322  PRO C CD  1 
ATOM   2504  N  N   . ARG B  2  211 ? 32.862  -5.631  8.114   1.00 5.27  ? 323  ARG C N   1 
ATOM   2505  C  CA  . ARG B  2  211 ? 31.558  -6.334  8.066   1.00 5.38  ? 323  ARG C CA  1 
ATOM   2506  C  C   . ARG B  2  211 ? 30.663  -5.865  6.898   1.00 6.27  ? 323  ARG C C   1 
ATOM   2507  O  O   . ARG B  2  211 ? 30.695  -4.700  6.498   1.00 6.02  ? 323  ARG C O   1 
ATOM   2508  C  CB  . ARG B  2  211 ? 30.793  -6.106  9.349   1.00 4.33  ? 323  ARG C CB  1 
ATOM   2509  C  CG  . ARG B  2  211 ? 31.375  -6.769  10.572  1.00 2.45  ? 323  ARG C CG  1 
ATOM   2510  C  CD  . ARG B  2  211 ? 30.546  -6.423  11.801  1.00 4.88  ? 323  ARG C CD  1 
ATOM   2511  N  NE  . ARG B  2  211 ? 30.774  -5.052  12.251  1.00 5.89  ? 323  ARG C NE  1 
ATOM   2512  C  CZ  . ARG B  2  211 ? 30.318  -4.550  13.393  1.00 10.43 ? 323  ARG C CZ  1 
ATOM   2513  N  NH1 . ARG B  2  211 ? 29.532  -5.290  14.178  1.00 7.97  ? 323  ARG C NH1 1 
ATOM   2514  N  NH2 . ARG B  2  211 ? 30.642  -3.304  13.752  1.00 6.00  ? 323  ARG C NH2 1 
ATOM   2515  N  N   . ILE B  2  212 ? 29.858  -6.766  6.360   1.00 5.70  ? 324  ILE C N   1 
ATOM   2516  C  CA  . ILE B  2  212 ? 28.873  -6.381  5.364   1.00 4.14  ? 324  ILE C CA  1 
ATOM   2517  C  C   . ILE B  2  212 ? 27.790  -5.526  6.045   1.00 2.86  ? 324  ILE C C   1 
ATOM   2518  O  O   . ILE B  2  212 ? 27.293  -5.893  7.112   1.00 2.24  ? 324  ILE C O   1 
ATOM   2519  C  CB  . ILE B  2  212 ? 28.201  -7.636  4.719   1.00 4.93  ? 324  ILE C CB  1 
ATOM   2520  C  CG1 . ILE B  2  212 ? 29.215  -8.468  3.950   1.00 6.97  ? 324  ILE C CG1 1 
ATOM   2521  C  CG2 . ILE B  2  212 ? 27.086  -7.215  3.768   1.00 9.80  ? 324  ILE C CG2 1 
ATOM   2522  C  CD1 . ILE B  2  212 ? 29.798  -7.757  2.744   1.00 10.21 ? 324  ILE C CD1 1 
ATOM   2523  N  N   . ALA B  2  213 ? 27.452  -4.372  5.446   1.00 3.55  ? 325  ALA C N   1 
ATOM   2524  C  CA  . ALA B  2  213 ? 26.346  -3.537  5.960   1.00 5.54  ? 325  ALA C CA  1 
ATOM   2525  C  C   . ALA B  2  213 ? 24.964  -4.117  5.516   1.00 3.19  ? 325  ALA C C   1 
ATOM   2526  O  O   . ALA B  2  213 ? 24.829  -4.641  4.410   1.00 2.00  ? 325  ALA C O   1 
ATOM   2527  C  CB  . ALA B  2  213 ? 26.503  -2.089  5.478   1.00 2.67  ? 325  ALA C CB  1 
ATOM   2528  N  N   . ASN B  2  214 ? 23.967  -4.021  6.384   1.00 3.71  ? 326  ASN C N   1 
ATOM   2529  C  CA  . ASN B  2  214 ? 22.634  -4.565  6.085   1.00 3.76  ? 326  ASN C CA  1 
ATOM   2530  C  C   . ASN B  2  214 ? 22.111  -4.100  4.726   1.00 3.17  ? 326  ASN C C   1 
ATOM   2531  O  O   . ASN B  2  214 ? 21.763  -4.916  3.880   1.00 2.38  ? 326  ASN C O   1 
ATOM   2532  C  CB  . ASN B  2  214 ? 21.626  -4.234  7.208   1.00 4.28  ? 326  ASN C CB  1 
ATOM   2533  C  CG  . ASN B  2  214 ? 20.468  -5.249  7.261   1.00 4.83  ? 326  ASN C CG  1 
ATOM   2534  O  OD1 . ASN B  2  214 ? 19.843  -5.526  6.235   1.00 3.35  ? 326  ASN C OD1 1 
ATOM   2535  N  ND2 . ASN B  2  214 ? 20.193  -5.813  8.455   1.00 2.34  ? 326  ASN C ND2 1 
ATOM   2536  N  N   . VAL B  2  215 ? 22.125  -2.804  4.483   1.00 4.65  ? 327  VAL C N   1 
ATOM   2537  C  CA  . VAL B  2  215 ? 21.664  -2.237  3.188   1.00 5.01  ? 327  VAL C CA  1 
ATOM   2538  C  C   . VAL B  2  215 ? 22.362  -2.863  1.962   1.00 3.62  ? 327  VAL C C   1 
ATOM   2539  O  O   . VAL B  2  215 ? 21.726  -3.050  0.929   1.00 4.29  ? 327  VAL C O   1 
ATOM   2540  C  CB  . VAL B  2  215 ? 21.832  -0.668  3.154   1.00 3.89  ? 327  VAL C CB  1 
ATOM   2541  C  CG1 . VAL B  2  215 ? 23.314  -0.286  3.147   1.00 3.95  ? 327  VAL C CG1 1 
ATOM   2542  C  CG2 . VAL B  2  215 ? 21.110  -0.061  1.952   1.00 2.00  ? 327  VAL C CG2 1 
ATOM   2543  N  N   . PHE B  2  216 ? 23.682  -3.194  2.076   1.00 5.53  ? 328  PHE C N   1 
ATOM   2544  C  CA  . PHE B  2  216 ? 24.437  -3.814  0.963   1.00 4.17  ? 328  PHE C CA  1 
ATOM   2545  C  C   . PHE B  2  216 ? 23.740  -5.093  0.408   1.00 2.00  ? 328  PHE C C   1 
ATOM   2546  O  O   . PHE B  2  216 ? 23.673  -5.271  -0.832  1.00 2.00  ? 328  PHE C O   1 
ATOM   2547  C  CB  . PHE B  2  216 ? 25.906  -4.157  1.394   1.00 2.73  ? 328  PHE C CB  1 
ATOM   2548  C  CG  . PHE B  2  216 ? 26.750  -4.731  0.271   1.00 3.49  ? 328  PHE C CG  1 
ATOM   2549  C  CD1 . PHE B  2  216 ? 27.300  -3.900  -0.716  1.00 3.48  ? 328  PHE C CD1 1 
ATOM   2550  C  CD2 . PHE B  2  216 ? 26.959  -6.109  0.163   1.00 2.55  ? 328  PHE C CD2 1 
ATOM   2551  C  CE1 . PHE B  2  216 ? 28.037  -4.423  -1.784  1.00 4.57  ? 328  PHE C CE1 1 
ATOM   2552  C  CE2 . PHE B  2  216 ? 27.689  -6.633  -0.900  1.00 3.78  ? 328  PHE C CE2 1 
ATOM   2553  C  CZ  . PHE B  2  216 ? 28.231  -5.792  -1.876  1.00 2.76  ? 328  PHE C CZ  1 
ATOM   2554  N  N   . THR B  2  217 ? 23.242  -5.967  1.325   1.00 2.20  ? 329  THR C N   1 
ATOM   2555  C  CA  . THR B  2  217 ? 22.520  -7.217  0.964   1.00 2.16  ? 329  THR C CA  1 
ATOM   2556  C  C   . THR B  2  217 ? 21.325  -6.964  0.047   1.00 3.91  ? 329  THR C C   1 
ATOM   2557  O  O   . THR B  2  217 ? 20.910  -7.862  -0.708  1.00 3.35  ? 329  THR C O   1 
ATOM   2558  C  CB  . THR B  2  217 ? 21.987  -7.962  2.173   1.00 2.00  ? 329  THR C CB  1 
ATOM   2559  O  OG1 . THR B  2  217 ? 20.941  -7.215  2.819   1.00 2.00  ? 329  THR C OG1 1 
ATOM   2560  C  CG2 . THR B  2  217 ? 23.118  -8.208  3.150   1.00 5.11  ? 329  THR C CG2 1 
ATOM   2561  N  N   . ASN B  2  218 ? 20.785  -5.751  0.109   1.00 2.07  ? 330  ASN C N   1 
ATOM   2562  C  CA  . ASN B  2  218 ? 19.665  -5.386  -0.743  1.00 3.74  ? 330  ASN C CA  1 
ATOM   2563  C  C   . ASN B  2  218 ? 20.144  -4.567  -1.943  1.00 2.72  ? 330  ASN C C   1 
ATOM   2564  O  O   . ASN B  2  218 ? 19.696  -4.810  -3.073  1.00 3.76  ? 330  ASN C O   1 
ATOM   2565  C  CB  . ASN B  2  218 ? 18.633  -4.602  0.073   1.00 4.21  ? 330  ASN C CB  1 
ATOM   2566  C  CG  . ASN B  2  218 ? 17.219  -4.730  -0.486  1.00 7.06  ? 330  ASN C CG  1 
ATOM   2567  O  OD1 . ASN B  2  218 ? 16.742  -3.846  -1.198  1.00 6.14  ? 330  ASN C OD1 1 
ATOM   2568  N  ND2 . ASN B  2  218 ? 16.555  -5.849  -0.180  1.00 5.42  ? 330  ASN C ND2 1 
ATOM   2569  N  N   . ALA B  2  219 ? 21.085  -3.606  -1.698  1.00 2.00  ? 331  ALA C N   1 
ATOM   2570  C  CA  . ALA B  2  219 ? 21.605  -2.715  -2.754  1.00 3.89  ? 331  ALA C CA  1 
ATOM   2571  C  C   . ALA B  2  219 ? 22.396  -3.444  -3.850  1.00 3.66  ? 331  ALA C C   1 
ATOM   2572  O  O   . ALA B  2  219 ? 22.299  -3.077  -5.040  1.00 3.30  ? 331  ALA C O   1 
ATOM   2573  C  CB  . ALA B  2  219 ? 22.445  -1.601  -2.140  1.00 3.55  ? 331  ALA C CB  1 
ATOM   2574  N  N   . PHE B  2  220 ? 23.157  -4.500  -3.471  1.00 4.94  ? 332  PHE C N   1 
ATOM   2575  C  CA  . PHE B  2  220 ? 23.946  -5.273  -4.463  1.00 4.31  ? 332  PHE C CA  1 
ATOM   2576  C  C   . PHE B  2  220 ? 23.041  -6.106  -5.374  1.00 4.96  ? 332  PHE C C   1 
ATOM   2577  O  O   . PHE B  2  220 ? 23.495  -6.614  -6.410  1.00 3.11  ? 332  PHE C O   1 
ATOM   2578  C  CB  . PHE B  2  220 ? 25.006  -6.183  -3.804  1.00 4.96  ? 332  PHE C CB  1 
ATOM   2579  C  CG  . PHE B  2  220 ? 26.152  -6.498  -4.734  1.00 4.03  ? 332  PHE C CG  1 
ATOM   2580  C  CD1 . PHE B  2  220 ? 26.886  -5.466  -5.324  1.00 4.19  ? 332  PHE C CD1 1 
ATOM   2581  C  CD2 . PHE B  2  220 ? 26.508  -7.835  -5.019  1.00 2.45  ? 332  PHE C CD2 1 
ATOM   2582  C  CE1 . PHE B  2  220 ? 27.957  -5.762  -6.179  1.00 7.08  ? 332  PHE C CE1 1 
ATOM   2583  C  CE2 . PHE B  2  220 ? 27.568  -8.137  -5.869  1.00 3.88  ? 332  PHE C CE2 1 
ATOM   2584  C  CZ  . PHE B  2  220 ? 28.300  -7.100  -6.450  1.00 4.65  ? 332  PHE C CZ  1 
ATOM   2585  N  N   . ARG B  2  221 ? 21.754  -6.225  -4.991  1.00 4.98  ? 333  ARG C N   1 
ATOM   2586  C  CA  . ARG B  2  221 ? 20.764  -6.900  -5.833  1.00 6.54  ? 333  ARG C CA  1 
ATOM   2587  C  C   . ARG B  2  221 ? 20.460  -6.097  -7.082  1.00 5.44  ? 333  ARG C C   1 
ATOM   2588  O  O   . ARG B  2  221 ? 19.560  -6.464  -7.837  1.00 3.29  ? 333  ARG C O   1 
ATOM   2589  C  CB  . ARG B  2  221 ? 19.462  -7.138  -5.072  1.00 5.31  ? 333  ARG C CB  1 
ATOM   2590  C  CG  . ARG B  2  221 ? 19.645  -7.962  -3.837  1.00 2.88  ? 333  ARG C CG  1 
ATOM   2591  C  CD  . ARG B  2  221 ? 18.347  -8.120  -3.117  1.00 5.64  ? 333  ARG C CD  1 
ATOM   2592  N  NE  . ARG B  2  221 ? 18.547  -8.844  -1.861  1.00 8.18  ? 333  ARG C NE  1 
ATOM   2593  C  CZ  . ARG B  2  221 ? 17.630  -9.641  -1.295  1.00 9.35  ? 333  ARG C CZ  1 
ATOM   2594  N  NH1 . ARG B  2  221 ? 16.451  -9.830  -1.879  1.00 3.83  ? 333  ARG C NH1 1 
ATOM   2595  N  NH2 . ARG B  2  221 ? 17.900  -10.247 -0.149  1.00 4.67  ? 333  ARG C NH2 1 
ATOM   2596  N  N   . TYR B  2  222 ? 21.218  -4.981  -7.301  1.00 6.24  ? 334  TYR C N   1 
ATOM   2597  C  CA  . TYR B  2  222 ? 21.101  -4.200  -8.545  1.00 5.96  ? 334  TYR C CA  1 
ATOM   2598  C  C   . TYR B  2  222 ? 21.317  -5.145  -9.740  1.00 6.83  ? 334  TYR C C   1 
ATOM   2599  O  O   . TYR B  2  222 ? 20.808  -4.893  -10.843 1.00 5.00  ? 334  TYR C O   1 
ATOM   2600  C  CB  . TYR B  2  222 ? 22.152  -3.047  -8.619  1.00 6.43  ? 334  TYR C CB  1 
ATOM   2601  C  CG  . TYR B  2  222 ? 23.477  -3.444  -9.267  1.00 4.84  ? 334  TYR C CG  1 
ATOM   2602  C  CD1 . TYR B  2  222 ? 24.503  -4.028  -8.504  1.00 4.87  ? 334  TYR C CD1 1 
ATOM   2603  C  CD2 . TYR B  2  222 ? 23.651  -3.374  -10.664 1.00 3.91  ? 334  TYR C CD2 1 
ATOM   2604  C  CE1 . TYR B  2  222 ? 25.656  -4.544  -9.106  1.00 4.10  ? 334  TYR C CE1 1 
ATOM   2605  C  CE2 . TYR B  2  222 ? 24.805  -3.894  -11.276 1.00 5.28  ? 334  TYR C CE2 1 
ATOM   2606  C  CZ  . TYR B  2  222 ? 25.799  -4.483  -10.485 1.00 4.61  ? 334  TYR C CZ  1 
ATOM   2607  O  OH  . TYR B  2  222 ? 26.906  -5.020  -11.083 1.00 2.93  ? 334  TYR C OH  1 
ATOM   2608  N  N   . GLY B  2  223 ? 22.089  -6.218  -9.490  1.00 3.08  ? 335  GLY C N   1 
ATOM   2609  C  CA  . GLY B  2  223 ? 22.416  -7.167  -10.510 1.00 3.11  ? 335  GLY C CA  1 
ATOM   2610  C  C   . GLY B  2  223 ? 21.209  -7.859  -11.105 1.00 3.48  ? 335  GLY C C   1 
ATOM   2611  O  O   . GLY B  2  223 ? 21.257  -8.279  -12.238 1.00 4.25  ? 335  GLY C O   1 
ATOM   2612  N  N   . HIS B  2  224 ? 20.129  -7.983  -10.351 1.00 4.55  ? 336  HIS C N   1 
ATOM   2613  C  CA  . HIS B  2  224 ? 18.916  -8.637  -10.880 1.00 5.39  ? 336  HIS C CA  1 
ATOM   2614  C  C   . HIS B  2  224 ? 18.438  -7.954  -12.155 1.00 5.58  ? 336  HIS C C   1 
ATOM   2615  O  O   . HIS B  2  224 ? 17.781  -8.588  -12.988 1.00 6.00  ? 336  HIS C O   1 
ATOM   2616  C  CB  . HIS B  2  224 ? 17.786  -8.636  -9.840  1.00 6.63  ? 336  HIS C CB  1 
ATOM   2617  C  CG  . HIS B  2  224 ? 18.077  -9.478  -8.600  1.00 5.41  ? 336  HIS C CG  1 
ATOM   2618  N  ND1 . HIS B  2  224 ? 17.376  -9.290  -7.413  1.00 5.72  ? 336  HIS C ND1 1 
ATOM   2619  C  CD2 . HIS B  2  224 ? 19.046  -10.444 -8.491  1.00 3.34  ? 336  HIS C CD2 1 
ATOM   2620  C  CE1 . HIS B  2  224 ? 17.945  -10.158 -6.561  1.00 3.37  ? 336  HIS C CE1 1 
ATOM   2621  N  NE2 . HIS B  2  224 ? 18.894  -10.823 -7.144  1.00 4.57  ? 336  HIS C NE2 1 
ATOM   2622  N  N   . THR B  2  225 ? 18.789  -6.662  -12.312 1.00 5.46  ? 337  THR C N   1 
ATOM   2623  C  CA  . THR B  2  225 ? 18.398  -5.920  -13.501 1.00 6.05  ? 337  THR C CA  1 
ATOM   2624  C  C   . THR B  2  225 ? 19.260  -6.322  -14.734 1.00 5.24  ? 337  THR C C   1 
ATOM   2625  O  O   . THR B  2  225 ? 18.937  -5.984  -15.888 1.00 5.10  ? 337  THR C O   1 
ATOM   2626  C  CB  . THR B  2  225 ? 18.488  -4.382  -13.278 1.00 4.58  ? 337  THR C CB  1 
ATOM   2627  O  OG1 . THR B  2  225 ? 19.854  -4.012  -13.088 1.00 8.14  ? 337  THR C OG1 1 
ATOM   2628  C  CG2 . THR B  2  225 ? 17.677  -3.925  -12.074 1.00 3.70  ? 337  THR C CG2 1 
ATOM   2629  N  N   . LEU B  2  226 ? 20.355  -7.052  -14.490 1.00 5.79  ? 338  LEU C N   1 
ATOM   2630  C  CA  . LEU B  2  226 ? 21.251  -7.470  -15.577 1.00 7.50  ? 338  LEU C CA  1 
ATOM   2631  C  C   . LEU B  2  226 ? 20.857  -8.824  -16.219 1.00 8.15  ? 338  LEU C C   1 
ATOM   2632  O  O   . LEU B  2  226 ? 21.356  -9.170  -17.303 1.00 11.47 ? 338  LEU C O   1 
ATOM   2633  C  CB  . LEU B  2  226 ? 22.666  -7.607  -15.039 1.00 5.46  ? 338  LEU C CB  1 
ATOM   2634  C  CG  . LEU B  2  226 ? 23.253  -6.374  -14.391 1.00 9.13  ? 338  LEU C CG  1 
ATOM   2635  C  CD1 . LEU B  2  226 ? 24.541  -6.746  -13.660 1.00 10.94 ? 338  LEU C CD1 1 
ATOM   2636  C  CD2 . LEU B  2  226 ? 23.516  -5.322  -15.445 1.00 7.66  ? 338  LEU C CD2 1 
ATOM   2637  N  N   . ILE B  2  227 ? 19.972  -9.571  -15.551 1.00 6.75  ? 339  ILE C N   1 
ATOM   2638  C  CA  . ILE B  2  227 ? 19.591  -10.928 -15.934 1.00 5.46  ? 339  ILE C CA  1 
ATOM   2639  C  C   . ILE B  2  227 ? 18.804  -11.014 -17.219 1.00 6.59  ? 339  ILE C C   1 
ATOM   2640  O  O   . ILE B  2  227 ? 17.834  -10.283 -17.422 1.00 7.44  ? 339  ILE C O   1 
ATOM   2641  C  CB  . ILE B  2  227 ? 18.793  -11.554 -14.797 1.00 5.34  ? 339  ILE C CB  1 
ATOM   2642  C  CG1 . ILE B  2  227 ? 19.703  -11.648 -13.564 1.00 5.39  ? 339  ILE C CG1 1 
ATOM   2643  C  CG2 . ILE B  2  227 ? 18.255  -12.927 -15.196 1.00 5.05  ? 339  ILE C CG2 1 
ATOM   2644  C  CD1 . ILE B  2  227 ? 18.976  -11.989 -12.270 1.00 5.40  ? 339  ILE C CD1 1 
ATOM   2645  N  N   . GLN B  2  228 ? 19.248  -11.890 -18.105 1.00 6.84  ? 340  GLN C N   1 
ATOM   2646  C  CA  . GLN B  2  228 ? 18.532  -12.179 -19.341 1.00 5.62  ? 340  GLN C CA  1 
ATOM   2647  C  C   . GLN B  2  228 ? 17.500  -13.265 -19.070 1.00 5.28  ? 340  GLN C C   1 
ATOM   2648  O  O   . GLN B  2  228 ? 17.694  -14.092 -18.197 1.00 3.86  ? 340  GLN C O   1 
ATOM   2649  C  CB  . GLN B  2  228 ? 19.513  -12.636 -20.417 1.00 7.43  ? 340  GLN C CB  1 
ATOM   2650  C  CG  . GLN B  2  228 ? 20.299  -11.518 -21.082 1.00 10.76 ? 340  GLN C CG  1 
ATOM   2651  C  CD  . GLN B  2  228 ? 19.716  -11.167 -22.443 1.00 13.63 ? 340  GLN C CD  1 
ATOM   2652  O  OE1 . GLN B  2  228 ? 18.655  -11.649 -22.805 1.00 10.12 ? 340  GLN C OE1 1 
ATOM   2653  N  NE2 . GLN B  2  228 ? 20.425  -10.331 -23.209 1.00 15.39 ? 340  GLN C NE2 1 
ATOM   2654  N  N   . PRO B  2  229 ? 16.398  -13.299 -19.825 1.00 9.03  ? 341  PRO C N   1 
ATOM   2655  C  CA  . PRO B  2  229 ? 15.324  -14.297 -19.634 1.00 9.29  ? 341  PRO C CA  1 
ATOM   2656  C  C   . PRO B  2  229 ? 15.665  -15.708 -20.141 1.00 8.18  ? 341  PRO C C   1 
ATOM   2657  O  O   . PRO B  2  229 ? 14.822  -16.593 -20.090 1.00 10.57 ? 341  PRO C O   1 
ATOM   2658  C  CB  . PRO B  2  229 ? 14.144  -13.649 -20.392 1.00 11.43 ? 341  PRO C CB  1 
ATOM   2659  C  CG  . PRO B  2  229 ? 14.829  -12.997 -21.557 1.00 10.45 ? 341  PRO C CG  1 
ATOM   2660  C  CD  . PRO B  2  229 ? 16.079  -12.380 -20.957 1.00 11.13 ? 341  PRO C CD  1 
ATOM   2661  N  N   . PHE B  2  230 ? 16.891  -15.911 -20.644 1.00 9.18  ? 342  PHE C N   1 
ATOM   2662  C  CA  . PHE B  2  230 ? 17.347  -17.227 -21.128 1.00 7.02  ? 342  PHE C CA  1 
ATOM   2663  C  C   . PHE B  2  230 ? 18.715  -17.596 -20.599 1.00 6.46  ? 342  PHE C C   1 
ATOM   2664  O  O   . PHE B  2  230 ? 19.489  -16.737 -20.224 1.00 4.04  ? 342  PHE C O   1 
ATOM   2665  C  CB  . PHE B  2  230 ? 17.464  -17.246 -22.640 1.00 7.52  ? 342  PHE C CB  1 
ATOM   2666  C  CG  . PHE B  2  230 ? 16.197  -16.942 -23.360 1.00 10.17 ? 342  PHE C CG  1 
ATOM   2667  C  CD1 . PHE B  2  230 ? 15.964  -15.676 -23.873 1.00 10.76 ? 342  PHE C CD1 1 
ATOM   2668  C  CD2 . PHE B  2  230 ? 15.251  -17.941 -23.553 1.00 12.61 ? 342  PHE C CD2 1 
ATOM   2669  C  CE1 . PHE B  2  230 ? 14.792  -15.401 -24.586 1.00 13.96 ? 342  PHE C CE1 1 
ATOM   2670  C  CE2 . PHE B  2  230 ? 14.073  -17.680 -24.266 1.00 17.34 ? 342  PHE C CE2 1 
ATOM   2671  C  CZ  . PHE B  2  230 ? 13.843  -16.406 -24.785 1.00 14.81 ? 342  PHE C CZ  1 
ATOM   2672  N  N   . MET B  2  231 ? 18.966  -18.907 -20.525 1.00 8.28  ? 343  MET C N   1 
ATOM   2673  C  CA  . MET B  2  231 ? 20.331  -19.446 -20.340 1.00 10.39 ? 343  MET C CA  1 
ATOM   2674  C  C   . MET B  2  231 ? 20.815  -19.822 -21.748 1.00 11.77 ? 343  MET C C   1 
ATOM   2675  O  O   . MET B  2  231 ? 20.198  -20.687 -22.436 1.00 14.45 ? 343  MET C O   1 
ATOM   2676  C  CB  . MET B  2  231 ? 20.368  -20.690 -19.439 1.00 8.82  ? 343  MET C CB  1 
ATOM   2677  C  CG  . MET B  2  231 ? 21.752  -21.353 -19.391 1.00 5.59  ? 343  MET C CG  1 
ATOM   2678  S  SD  . MET B  2  231 ? 21.827  -22.797 -18.311 1.00 9.53  ? 343  MET C SD  1 
ATOM   2679  C  CE  . MET B  2  231 ? 21.188  -24.068 -19.390 1.00 11.53 ? 343  MET C CE  1 
ATOM   2680  N  N   . PHE B  2  232 ? 21.852  -19.138 -22.215 1.00 8.38  ? 344  PHE C N   1 
ATOM   2681  C  CA  . PHE B  2  232 ? 22.346  -19.331 -23.574 1.00 8.97  ? 344  PHE C CA  1 
ATOM   2682  C  C   . PHE B  2  232 ? 23.443  -20.355 -23.588 1.00 11.23 ? 344  PHE C C   1 
ATOM   2683  O  O   . PHE B  2  232 ? 24.335  -20.273 -22.737 1.00 11.36 ? 344  PHE C O   1 
ATOM   2684  C  CB  . PHE B  2  232 ? 22.903  -18.022 -24.131 1.00 8.20  ? 344  PHE C CB  1 
ATOM   2685  C  CG  . PHE B  2  232 ? 21.888  -16.918 -24.292 1.00 8.60  ? 344  PHE C CG  1 
ATOM   2686  C  CD1 . PHE B  2  232 ? 21.492  -16.170 -23.202 1.00 7.60  ? 344  PHE C CD1 1 
ATOM   2687  C  CD2 . PHE B  2  232 ? 21.340  -16.642 -25.535 1.00 8.26  ? 344  PHE C CD2 1 
ATOM   2688  C  CE1 . PHE B  2  232 ? 20.560  -15.158 -23.335 1.00 8.64  ? 344  PHE C CE1 1 
ATOM   2689  C  CE2 . PHE B  2  232 ? 20.413  -15.639 -25.681 1.00 9.37  ? 344  PHE C CE2 1 
ATOM   2690  C  CZ  . PHE B  2  232 ? 20.021  -14.897 -24.582 1.00 10.16 ? 344  PHE C CZ  1 
ATOM   2691  N  N   . ARG B  2  233 ? 23.388  -21.307 -24.544 1.00 9.74  ? 345  ARG C N   1 
ATOM   2692  C  CA  . ARG B  2  233 ? 24.437  -22.353 -24.661 1.00 11.46 ? 345  ARG C CA  1 
ATOM   2693  C  C   . ARG B  2  233 ? 25.007  -22.391 -26.066 1.00 14.53 ? 345  ARG C C   1 
ATOM   2694  O  O   . ARG B  2  233 ? 24.245  -22.379 -27.064 1.00 14.46 ? 345  ARG C O   1 
ATOM   2695  C  CB  . ARG B  2  233 ? 23.907  -23.745 -24.265 1.00 10.05 ? 345  ARG C CB  1 
ATOM   2696  C  CG  . ARG B  2  233 ? 23.576  -23.856 -22.790 1.00 13.96 ? 345  ARG C CG  1 
ATOM   2697  C  CD  . ARG B  2  233 ? 23.051  -25.219 -22.426 1.00 16.17 ? 345  ARG C CD  1 
ATOM   2698  N  NE  . ARG B  2  233 ? 21.825  -25.547 -23.130 1.00 17.89 ? 345  ARG C NE  1 
ATOM   2699  C  CZ  . ARG B  2  233 ? 20.946  -26.420 -22.661 1.00 20.69 ? 345  ARG C CZ  1 
ATOM   2700  N  NH1 . ARG B  2  233 ? 21.171  -27.018 -21.487 1.00 20.10 ? 345  ARG C NH1 1 
ATOM   2701  N  NH2 . ARG B  2  233 ? 19.839  -26.693 -23.352 1.00 19.53 ? 345  ARG C NH2 1 
ATOM   2702  N  N   . LEU B  2  234 ? 26.347  -22.419 -26.149 1.00 13.44 ? 346  LEU C N   1 
ATOM   2703  C  CA  . LEU B  2  234 ? 27.028  -22.438 -27.436 1.00 15.20 ? 346  LEU C CA  1 
ATOM   2704  C  C   . LEU B  2  234 ? 28.024  -23.608 -27.564 1.00 16.93 ? 346  LEU C C   1 
ATOM   2705  O  O   . LEU B  2  234 ? 28.715  -23.970 -26.612 1.00 14.16 ? 346  LEU C O   1 
ATOM   2706  C  CB  . LEU B  2  234 ? 27.738  -21.104 -27.648 1.00 14.34 ? 346  LEU C CB  1 
ATOM   2707  C  CG  . LEU B  2  234 ? 26.852  -19.856 -27.621 1.00 16.08 ? 346  LEU C CG  1 
ATOM   2708  C  CD1 . LEU B  2  234 ? 27.730  -18.606 -27.624 1.00 12.53 ? 346  LEU C CD1 1 
ATOM   2709  C  CD2 . LEU B  2  234 ? 25.875  -19.861 -28.801 1.00 9.19  ? 346  LEU C CD2 1 
ATOM   2710  N  N   . ASP B  2  235 ? 28.095  -24.202 -28.757 1.00 19.66 ? 347  ASP C N   1 
ATOM   2711  C  CA  . ASP B  2  235 ? 29.005  -25.318 -28.993 1.00 20.57 ? 347  ASP C CA  1 
ATOM   2712  C  C   . ASP B  2  235 ? 30.431  -24.837 -29.097 1.00 19.61 ? 347  ASP C C   1 
ATOM   2713  O  O   . ASP B  2  235 ? 30.705  -23.655 -28.914 1.00 15.65 ? 347  ASP C O   1 
ATOM   2714  C  CB  . ASP B  2  235 ? 28.608  -26.081 -30.270 1.00 25.38 ? 347  ASP C CB  1 
ATOM   2715  C  CG  . ASP B  2  235 ? 28.726  -25.294 -31.581 1.00 28.70 ? 347  ASP C CG  1 
ATOM   2716  O  OD1 . ASP B  2  235 ? 29.430  -24.265 -31.633 1.00 30.95 ? 347  ASP C OD1 1 
ATOM   2717  O  OD2 . ASP B  2  235 ? 28.105  -25.718 -32.575 1.00 32.32 ? 347  ASP C OD2 1 
ATOM   2718  N  N   . ASN B  2  236 ? 31.325  -25.736 -29.461 1.00 23.23 ? 348  ASN C N   1 
ATOM   2719  C  CA  . ASN B  2  236 ? 32.751  -25.410 -29.540 1.00 27.48 ? 348  ASN C CA  1 
ATOM   2720  C  C   . ASN B  2  236 ? 33.108  -24.304 -30.533 1.00 27.51 ? 348  ASN C C   1 
ATOM   2721  O  O   . ASN B  2  236 ? 34.111  -23.630 -30.335 1.00 30.91 ? 348  ASN C O   1 
ATOM   2722  C  CB  . ASN B  2  236 ? 33.585  -26.666 -29.806 1.00 30.41 ? 348  ASN C CB  1 
ATOM   2723  C  CG  . ASN B  2  236 ? 32.969  -27.538 -30.872 1.00 35.19 ? 348  ASN C CG  1 
ATOM   2724  O  OD1 . ASN B  2  236 ? 33.286  -27.402 -32.057 1.00 38.10 ? 348  ASN C OD1 1 
ATOM   2725  N  ND2 . ASN B  2  236 ? 32.060  -28.421 -30.456 1.00 36.60 ? 348  ASN C ND2 1 
ATOM   2726  N  N   . ARG B  2  237 ? 32.314  -24.090 -31.582 1.00 25.95 ? 349  ARG C N   1 
ATOM   2727  C  CA  . ARG B  2  237 ? 32.633  -22.998 -32.508 1.00 25.30 ? 349  ARG C CA  1 
ATOM   2728  C  C   . ARG B  2  237 ? 31.844  -21.708 -32.203 1.00 23.85 ? 349  ARG C C   1 
ATOM   2729  O  O   . ARG B  2  237 ? 31.826  -20.763 -33.012 1.00 20.78 ? 349  ARG C O   1 
ATOM   2730  C  CB  . ARG B  2  237 ? 32.397  -23.438 -33.942 1.00 29.09 ? 349  ARG C CB  1 
ATOM   2731  C  CG  . ARG B  2  237 ? 30.964  -23.802 -34.270 1.00 34.67 ? 349  ARG C CG  1 
ATOM   2732  C  CD  . ARG B  2  237 ? 30.816  -24.007 -35.768 1.00 39.75 ? 349  ARG C CD  1 
ATOM   2733  N  NE  . ARG B  2  237 ? 29.468  -24.399 -36.176 1.00 42.30 ? 349  ARG C NE  1 
ATOM   2734  C  CZ  . ARG B  2  237 ? 28.902  -25.576 -35.930 1.00 43.17 ? 349  ARG C CZ  1 
ATOM   2735  N  NH1 . ARG B  2  237 ? 29.536  -26.499 -35.208 1.00 42.86 ? 349  ARG C NH1 1 
ATOM   2736  N  NH2 . ARG B  2  237 ? 27.688  -25.821 -36.394 1.00 43.20 ? 349  ARG C NH2 1 
ATOM   2737  N  N   . TYR B  2  238 ? 31.229  -21.679 -30.998 1.00 23.19 ? 350  TYR C N   1 
ATOM   2738  C  CA  . TYR B  2  238 ? 30.411  -20.567 -30.470 1.00 22.20 ? 350  TYR C CA  1 
ATOM   2739  C  C   . TYR B  2  238 ? 29.109  -20.390 -31.232 1.00 22.42 ? 350  TYR C C   1 
ATOM   2740  O  O   . TYR B  2  238 ? 28.603  -19.279 -31.401 1.00 20.58 ? 350  TYR C O   1 
ATOM   2741  C  CB  . TYR B  2  238 ? 31.192  -19.251 -30.436 1.00 18.97 ? 350  TYR C CB  1 
ATOM   2742  C  CG  . TYR B  2  238 ? 31.956  -19.080 -29.156 1.00 19.03 ? 350  TYR C CG  1 
ATOM   2743  C  CD1 . TYR B  2  238 ? 33.217  -19.659 -28.977 1.00 17.81 ? 350  TYR C CD1 1 
ATOM   2744  C  CD2 . TYR B  2  238 ? 31.417  -18.335 -28.111 1.00 18.69 ? 350  TYR C CD2 1 
ATOM   2745  C  CE1 . TYR B  2  238 ? 33.911  -19.482 -27.775 1.00 19.27 ? 350  TYR C CE1 1 
ATOM   2746  C  CE2 . TYR B  2  238 ? 32.102  -18.157 -26.915 1.00 18.29 ? 350  TYR C CE2 1 
ATOM   2747  C  CZ  . TYR B  2  238 ? 33.346  -18.726 -26.751 1.00 17.55 ? 350  TYR C CZ  1 
ATOM   2748  O  OH  . TYR B  2  238 ? 34.023  -18.528 -25.577 1.00 17.26 ? 350  TYR C OH  1 
ATOM   2749  N  N   . GLN B  2  239 ? 28.602  -21.487 -31.719 1.00 22.32 ? 351  GLN C N   1 
ATOM   2750  C  CA  . GLN B  2  239 ? 27.332  -21.471 -32.396 1.00 25.40 ? 351  GLN C CA  1 
ATOM   2751  C  C   . GLN B  2  239 ? 26.261  -22.045 -31.462 1.00 24.14 ? 351  GLN C C   1 
ATOM   2752  O  O   . GLN B  2  239 ? 26.581  -22.753 -30.494 1.00 21.48 ? 351  GLN C O   1 
ATOM   2753  C  CB  . GLN B  2  239 ? 27.434  -22.269 -33.708 1.00 29.39 ? 351  GLN C CB  1 
ATOM   2754  C  CG  . GLN B  2  239 ? 28.316  -21.607 -34.760 1.00 31.19 ? 351  GLN C CG  1 
ATOM   2755  C  CD  . GLN B  2  239 ? 27.849  -20.207 -35.121 1.00 33.36 ? 351  GLN C CD  1 
ATOM   2756  O  OE1 . GLN B  2  239 ? 26.723  -20.025 -35.613 1.00 35.12 ? 351  GLN C OE1 1 
ATOM   2757  N  NE2 . GLN B  2  239 ? 28.714  -19.210 -34.879 1.00 32.75 ? 351  GLN C NE2 1 
ATOM   2758  N  N   . PRO B  2  240 ? 24.980  -21.722 -31.695 1.00 23.37 ? 352  PRO C N   1 
ATOM   2759  C  CA  . PRO B  2  240 ? 23.904  -22.216 -30.861 1.00 23.98 ? 352  PRO C CA  1 
ATOM   2760  C  C   . PRO B  2  240 ? 23.990  -23.724 -30.673 1.00 25.24 ? 352  PRO C C   1 
ATOM   2761  O  O   . PRO B  2  240 ? 24.067  -24.481 -31.658 1.00 24.07 ? 352  PRO C O   1 
ATOM   2762  C  CB  . PRO B  2  240 ? 22.658  -21.790 -31.633 1.00 24.09 ? 352  PRO C CB  1 
ATOM   2763  C  CG  . PRO B  2  240 ? 23.109  -20.513 -32.229 1.00 24.63 ? 352  PRO C CG  1 
ATOM   2764  C  CD  . PRO B  2  240 ? 24.466  -20.841 -32.758 1.00 23.16 ? 352  PRO C CD  1 
ATOM   2765  N  N   . MET B  2  241 ? 24.044  -24.146 -29.401 1.00 25.13 ? 353  MET C N   1 
ATOM   2766  C  CA  . MET B  2  241 ? 24.030  -25.550 -29.071 1.00 26.14 ? 353  MET C CA  1 
ATOM   2767  C  C   . MET B  2  241 ? 22.602  -26.091 -29.239 1.00 27.03 ? 353  MET C C   1 
ATOM   2768  O  O   . MET B  2  241 ? 21.709  -25.806 -28.442 1.00 26.65 ? 353  MET C O   1 
ATOM   2769  C  CB  . MET B  2  241 ? 24.510  -25.762 -27.649 1.00 26.05 ? 353  MET C CB  1 
ATOM   2770  C  CG  . MET B  2  241 ? 24.644  -27.219 -27.261 1.00 29.02 ? 353  MET C CG  1 
ATOM   2771  S  SD  . MET B  2  241 ? 24.967  -27.432 -25.509 1.00 32.93 ? 353  MET C SD  1 
ATOM   2772  C  CE  . MET B  2  241 ? 23.345  -27.882 -24.896 1.00 29.58 ? 353  MET C CE  1 
ATOM   2773  N  N   . GLU B  2  242 ? 22.385  -26.843 -30.305 1.00 27.52 ? 354  GLU C N   1 
ATOM   2774  C  CA  . GLU B  2  242 ? 21.078  -27.413 -30.589 1.00 28.90 ? 354  GLU C CA  1 
ATOM   2775  C  C   . GLU B  2  242 ? 20.833  -28.716 -29.788 1.00 30.08 ? 354  GLU C C   1 
ATOM   2776  O  O   . GLU B  2  242 ? 21.787  -29.361 -29.338 1.00 31.08 ? 354  GLU C O   1 
ATOM   2777  C  CB  . GLU B  2  242 ? 20.934  -27.640 -32.103 1.00 26.60 ? 354  GLU C CB  1 
ATOM   2778  C  CG  . GLU B  2  242 ? 21.107  -26.368 -32.947 1.00 26.04 ? 354  GLU C CG  1 
ATOM   2779  C  CD  . GLU B  2  242 ? 20.122  -25.235 -32.630 1.00 25.29 ? 354  GLU C CD  1 
ATOM   2780  O  OE1 . GLU B  2  242 ? 19.149  -25.449 -31.880 1.00 25.32 ? 354  GLU C OE1 1 
ATOM   2781  O  OE2 . GLU B  2  242 ? 20.329  -24.118 -33.147 1.00 26.53 ? 354  GLU C OE2 1 
ATOM   2782  N  N   . PRO B  2  243 ? 19.546  -29.136 -29.613 1.00 30.91 ? 355  PRO C N   1 
ATOM   2783  C  CA  . PRO B  2  243 ? 18.350  -28.438 -30.148 1.00 30.82 ? 355  PRO C CA  1 
ATOM   2784  C  C   . PRO B  2  243 ? 17.824  -27.290 -29.265 1.00 31.18 ? 355  PRO C C   1 
ATOM   2785  O  O   . PRO B  2  243 ? 16.846  -26.631 -29.638 1.00 30.25 ? 355  PRO C O   1 
ATOM   2786  C  CB  . PRO B  2  243 ? 17.351  -29.571 -30.234 1.00 30.81 ? 355  PRO C CB  1 
ATOM   2787  C  CG  . PRO B  2  243 ? 17.625  -30.296 -28.960 1.00 29.79 ? 355  PRO C CG  1 
ATOM   2788  C  CD  . PRO B  2  243 ? 19.132  -30.361 -28.882 1.00 30.76 ? 355  PRO C CD  1 
ATOM   2789  N  N   . ASN B  2  244 ? 18.469  -27.048 -28.100 1.00 29.33 ? 356  ASN C N   1 
ATOM   2790  C  CA  . ASN B  2  244 ? 17.988  -26.016 -27.181 1.00 27.28 ? 356  ASN C CA  1 
ATOM   2791  C  C   . ASN B  2  244 ? 19.092  -25.046 -26.737 1.00 25.34 ? 356  ASN C C   1 
ATOM   2792  O  O   . ASN B  2  244 ? 19.637  -25.214 -25.652 1.00 24.73 ? 356  ASN C O   1 
ATOM   2793  C  CB  . ASN B  2  244 ? 17.367  -26.671 -25.927 1.00 26.80 ? 356  ASN C CB  1 
ATOM   2794  C  CG  . ASN B  2  244 ? 16.362  -27.783 -26.223 1.00 29.38 ? 356  ASN C CG  1 
ATOM   2795  O  OD1 . ASN B  2  244 ? 15.637  -27.743 -27.210 1.00 30.42 ? 356  ASN C OD1 1 
ATOM   2796  N  ND2 . ASN B  2  244 ? 16.326  -28.788 -25.359 1.00 30.13 ? 356  ASN C ND2 1 
ATOM   2797  N  N   . PRO B  2  245 ? 19.450  -24.027 -27.570 1.00 24.71 ? 357  PRO C N   1 
ATOM   2798  C  CA  . PRO B  2  245 ? 20.488  -23.018 -27.243 1.00 23.20 ? 357  PRO C CA  1 
ATOM   2799  C  C   . PRO B  2  245 ? 19.975  -21.876 -26.348 1.00 21.30 ? 357  PRO C C   1 
ATOM   2800  O  O   . PRO B  2  245 ? 20.781  -21.151 -25.773 1.00 20.60 ? 357  PRO C O   1 
ATOM   2801  C  CB  . PRO B  2  245 ? 20.899  -22.499 -28.602 1.00 22.33 ? 357  PRO C CB  1 
ATOM   2802  C  CG  . PRO B  2  245 ? 19.590  -22.485 -29.314 1.00 25.17 ? 357  PRO C CG  1 
ATOM   2803  C  CD  . PRO B  2  245 ? 18.957  -23.812 -28.953 1.00 25.42 ? 357  PRO C CD  1 
ATOM   2804  N  N   . ARG B  2  246 ? 18.638  -21.716 -26.250 1.00 19.43 ? 358  ARG C N   1 
ATOM   2805  C  CA  . ARG B  2  246 ? 18.029  -20.666 -25.410 1.00 19.55 ? 358  ARG C CA  1 
ATOM   2806  C  C   . ARG B  2  246 ? 16.988  -21.235 -24.466 1.00 16.99 ? 358  ARG C C   1 
ATOM   2807  O  O   . ARG B  2  246 ? 15.840  -21.382 -24.835 1.00 18.63 ? 358  ARG C O   1 
ATOM   2808  C  CB  . ARG B  2  246 ? 17.358  -19.584 -26.266 1.00 22.05 ? 358  ARG C CB  1 
ATOM   2809  C  CG  . ARG B  2  246 ? 18.290  -18.501 -26.752 1.00 27.18 ? 358  ARG C CG  1 
ATOM   2810  C  CD  . ARG B  2  246 ? 18.123  -18.235 -28.239 1.00 33.15 ? 358  ARG C CD  1 
ATOM   2811  N  NE  . ARG B  2  246 ? 16.807  -17.714 -28.570 1.00 36.46 ? 358  ARG C NE  1 
ATOM   2812  C  CZ  . ARG B  2  246 ? 16.291  -16.599 -28.057 1.00 39.89 ? 358  ARG C CZ  1 
ATOM   2813  N  NH1 . ARG B  2  246 ? 16.978  -15.886 -27.167 1.00 42.04 ? 358  ARG C NH1 1 
ATOM   2814  N  NH2 . ARG B  2  246 ? 15.085  -16.198 -28.426 1.00 40.47 ? 358  ARG C NH2 1 
ATOM   2815  N  N   . VAL B  2  247 ? 17.386  -21.545 -23.241 1.00 14.62 ? 359  VAL C N   1 
ATOM   2816  C  CA  . VAL B  2  247 ? 16.449  -22.094 -22.274 1.00 12.15 ? 359  VAL C CA  1 
ATOM   2817  C  C   . VAL B  2  247 ? 15.866  -20.993 -21.396 1.00 12.02 ? 359  VAL C C   1 
ATOM   2818  O  O   . VAL B  2  247 ? 16.616  -20.270 -20.744 1.00 10.49 ? 359  VAL C O   1 
ATOM   2819  C  CB  . VAL B  2  247 ? 17.111  -23.150 -21.328 1.00 11.88 ? 359  VAL C CB  1 
ATOM   2820  C  CG1 . VAL B  2  247 ? 16.034  -23.870 -20.502 1.00 6.65  ? 359  VAL C CG1 1 
ATOM   2821  C  CG2 . VAL B  2  247 ? 17.935  -24.152 -22.116 1.00 10.33 ? 359  VAL C CG2 1 
ATOM   2822  N  N   . PRO B  2  248 ? 14.509  -20.841 -21.368 1.00 11.15 ? 360  PRO C N   1 
ATOM   2823  C  CA  . PRO B  2  248 ? 13.840  -19.835 -20.521 1.00 10.11 ? 360  PRO C CA  1 
ATOM   2824  C  C   . PRO B  2  248 ? 14.368  -19.983 -19.095 1.00 8.62  ? 360  PRO C C   1 
ATOM   2825  O  O   . PRO B  2  248 ? 14.545  -21.102 -18.627 1.00 9.44  ? 360  PRO C O   1 
ATOM   2826  C  CB  . PRO B  2  248 ? 12.373  -20.232 -20.636 1.00 10.64 ? 360  PRO C CB  1 
ATOM   2827  C  CG  . PRO B  2  248 ? 12.304  -20.726 -22.042 1.00 11.23 ? 360  PRO C CG  1 
ATOM   2828  C  CD  . PRO B  2  248 ? 13.524  -21.596 -22.165 1.00 10.31 ? 360  PRO C CD  1 
ATOM   2829  N  N   . LEU B  2  249 ? 14.621  -18.878 -18.404 1.00 8.76  ? 361  LEU C N   1 
ATOM   2830  C  CA  . LEU B  2  249 ? 15.238  -18.955 -17.076 1.00 10.00 ? 361  LEU C CA  1 
ATOM   2831  C  C   . LEU B  2  249 ? 14.423  -19.724 -16.039 1.00 11.58 ? 361  LEU C C   1 
ATOM   2832  O  O   . LEU B  2  249 ? 15.012  -20.424 -15.173 1.00 9.72  ? 361  LEU C O   1 
ATOM   2833  C  CB  . LEU B  2  249 ? 15.601  -17.569 -16.537 1.00 7.76  ? 361  LEU C CB  1 
ATOM   2834  C  CG  . LEU B  2  249 ? 16.974  -17.487 -15.839 1.00 5.07  ? 361  LEU C CG  1 
ATOM   2835  C  CD1 . LEU B  2  249 ? 18.084  -17.842 -16.807 1.00 2.00  ? 361  LEU C CD1 1 
ATOM   2836  C  CD2 . LEU B  2  249 ? 17.196  -16.106 -15.275 1.00 6.18  ? 361  LEU C CD2 1 
ATOM   2837  N  N   . SER B  2  250 ? 13.069  -19.624 -16.141 1.00 9.18  ? 362  SER C N   1 
ATOM   2838  C  CA  . SER B  2  250 ? 12.127  -20.315 -15.228 1.00 9.09  ? 362  SER C CA  1 
ATOM   2839  C  C   . SER B  2  250 ? 12.251  -21.853 -15.269 1.00 8.20  ? 362  SER C C   1 
ATOM   2840  O  O   . SER B  2  250 ? 11.658  -22.554 -14.442 1.00 9.48  ? 362  SER C O   1 
ATOM   2841  C  CB  . SER B  2  250 ? 10.678  -19.908 -15.557 1.00 9.23  ? 362  SER C CB  1 
ATOM   2842  O  OG  . SER B  2  250 ? 10.377  -20.129 -16.922 1.00 7.18  ? 362  SER C OG  1 
ATOM   2843  N  N   . ARG B  2  251 ? 12.991  -22.377 -16.232 1.00 8.60  ? 363  ARG C N   1 
ATOM   2844  C  CA  . ARG B  2  251 ? 13.220  -23.811 -16.295 1.00 13.29 ? 363  ARG C CA  1 
ATOM   2845  C  C   . ARG B  2  251 ? 14.706  -24.201 -16.059 1.00 11.97 ? 363  ARG C C   1 
ATOM   2846  O  O   . ARG B  2  251 ? 15.104  -25.351 -16.334 1.00 8.80  ? 363  ARG C O   1 
ATOM   2847  C  CB  . ARG B  2  251 ? 12.690  -24.379 -17.623 1.00 15.45 ? 363  ARG C CB  1 
ATOM   2848  C  CG  . ARG B  2  251 ? 11.172  -24.577 -17.619 1.00 18.51 ? 363  ARG C CG  1 
ATOM   2849  C  CD  . ARG B  2  251 ? 10.558  -24.171 -18.931 1.00 22.59 ? 363  ARG C CD  1 
ATOM   2850  N  NE  . ARG B  2  251 ? 11.214  -24.813 -20.060 1.00 24.01 ? 363  ARG C NE  1 
ATOM   2851  C  CZ  . ARG B  2  251 ? 11.021  -24.453 -21.324 1.00 26.25 ? 363  ARG C CZ  1 
ATOM   2852  N  NH1 . ARG B  2  251 ? 10.171  -23.465 -21.620 1.00 24.93 ? 363  ARG C NH1 1 
ATOM   2853  N  NH2 . ARG B  2  251 ? 11.666  -25.087 -22.294 1.00 27.12 ? 363  ARG C NH2 1 
ATOM   2854  N  N   . VAL B  2  252 ? 15.530  -23.252 -15.560 1.00 9.59  ? 364  VAL C N   1 
ATOM   2855  C  CA  . VAL B  2  252 ? 16.906  -23.633 -15.230 1.00 9.16  ? 364  VAL C CA  1 
ATOM   2856  C  C   . VAL B  2  252 ? 17.207  -23.430 -13.744 1.00 10.18 ? 364  VAL C C   1 
ATOM   2857  O  O   . VAL B  2  252 ? 18.241  -23.920 -13.255 1.00 8.41  ? 364  VAL C O   1 
ATOM   2858  C  CB  . VAL B  2  252 ? 18.003  -22.928 -16.099 1.00 7.09  ? 364  VAL C CB  1 
ATOM   2859  C  CG1 . VAL B  2  252 ? 17.667  -23.073 -17.563 1.00 7.22  ? 364  VAL C CG1 1 
ATOM   2860  C  CG2 . VAL B  2  252 ? 18.174  -21.459 -15.722 1.00 6.67  ? 364  VAL C CG2 1 
ATOM   2861  N  N   . PHE B  2  253 ? 16.305  -22.723 -13.006 1.00 9.12  ? 365  PHE C N   1 
ATOM   2862  C  CA  . PHE B  2  253 ? 16.528  -22.530 -11.564 1.00 8.02  ? 365  PHE C CA  1 
ATOM   2863  C  C   . PHE B  2  253 ? 16.638  -23.895 -10.836 1.00 9.17  ? 365  PHE C C   1 
ATOM   2864  O  O   . PHE B  2  253 ? 15.746  -24.761 -10.927 1.00 9.97  ? 365  PHE C O   1 
ATOM   2865  C  CB  . PHE B  2  253 ? 15.420  -21.680 -10.942 1.00 7.80  ? 365  PHE C CB  1 
ATOM   2866  C  CG  . PHE B  2  253 ? 15.215  -20.327 -11.596 1.00 9.26  ? 365  PHE C CG  1 
ATOM   2867  C  CD1 . PHE B  2  253 ? 13.944  -19.936 -12.054 1.00 6.70  ? 365  PHE C CD1 1 
ATOM   2868  C  CD2 . PHE B  2  253 ? 16.271  -19.425 -11.731 1.00 8.06  ? 365  PHE C CD2 1 
ATOM   2869  C  CE1 . PHE B  2  253 ? 13.722  -18.694 -12.628 1.00 2.82  ? 365  PHE C CE1 1 
ATOM   2870  C  CE2 . PHE B  2  253 ? 16.049  -18.172 -12.308 1.00 7.80  ? 365  PHE C CE2 1 
ATOM   2871  C  CZ  . PHE B  2  253 ? 14.771  -17.807 -12.759 1.00 6.24  ? 365  PHE C CZ  1 
ATOM   2872  N  N   . PHE B  2  254 ? 17.756  -24.097 -10.135 1.00 7.60  ? 366  PHE C N   1 
ATOM   2873  C  CA  . PHE B  2  254 ? 18.039  -25.343 -9.430  1.00 7.35  ? 366  PHE C CA  1 
ATOM   2874  C  C   . PHE B  2  254 ? 18.098  -26.541 -10.386 1.00 6.39  ? 366  PHE C C   1 
ATOM   2875  O  O   . PHE B  2  254 ? 17.962  -27.681 -9.966  1.00 7.81  ? 366  PHE C O   1 
ATOM   2876  C  CB  . PHE B  2  254 ? 16.995  -25.590 -8.301  1.00 9.50  ? 366  PHE C CB  1 
ATOM   2877  C  CG  . PHE B  2  254 ? 16.932  -24.489 -7.264  1.00 11.95 ? 366  PHE C CG  1 
ATOM   2878  C  CD1 . PHE B  2  254 ? 17.922  -24.366 -6.287  1.00 10.32 ? 366  PHE C CD1 1 
ATOM   2879  C  CD2 . PHE B  2  254 ? 15.923  -23.509 -7.321  1.00 13.68 ? 366  PHE C CD2 1 
ATOM   2880  C  CE1 . PHE B  2  254 ? 17.915  -23.291 -5.398  1.00 13.06 ? 366  PHE C CE1 1 
ATOM   2881  C  CE2 . PHE B  2  254 ? 15.911  -22.429 -6.431  1.00 11.74 ? 366  PHE C CE2 1 
ATOM   2882  C  CZ  . PHE B  2  254 ? 16.903  -22.315 -5.475  1.00 12.62 ? 366  PHE C CZ  1 
ATOM   2883  N  N   . ALA B  2  255 ? 18.338  -26.289 -11.685 1.00 9.07  ? 367  ALA C N   1 
ATOM   2884  C  CA  . ALA B  2  255 ? 18.352  -27.375 -12.674 1.00 8.82  ? 367  ALA C CA  1 
ATOM   2885  C  C   . ALA B  2  255 ? 19.746  -28.003 -12.848 1.00 8.06  ? 367  ALA C C   1 
ATOM   2886  O  O   . ALA B  2  255 ? 20.349  -27.940 -13.925 1.00 8.97  ? 367  ALA C O   1 
ATOM   2887  C  CB  . ALA B  2  255 ? 17.823  -26.853 -14.011 1.00 8.71  ? 367  ALA C CB  1 
ATOM   2888  N  N   . SER B  2  256 ? 20.242  -28.631 -11.781 1.00 9.88  ? 368  SER C N   1 
ATOM   2889  C  CA  . SER B  2  256 ? 21.580  -29.257 -11.779 1.00 9.91  ? 368  SER C CA  1 
ATOM   2890  C  C   . SER B  2  256 ? 21.716  -30.354 -12.819 1.00 8.17  ? 368  SER C C   1 
ATOM   2891  O  O   . SER B  2  256 ? 22.798  -30.550 -13.357 1.00 9.40  ? 368  SER C O   1 
ATOM   2892  C  CB  . SER B  2  256 ? 21.933  -29.779 -10.365 1.00 9.39  ? 368  SER C CB  1 
ATOM   2893  O  OG  . SER B  2  256 ? 20.869  -30.526 -9.786  1.00 11.24 ? 368  SER C OG  1 
ATOM   2894  N  N   . TRP B  2  257 ? 20.606  -31.038 -13.115 1.00 7.03  ? 369  TRP C N   1 
ATOM   2895  C  CA  . TRP B  2  257 ? 20.566  -32.092 -14.122 1.00 7.99  ? 369  TRP C CA  1 
ATOM   2896  C  C   . TRP B  2  257 ? 21.011  -31.602 -15.497 1.00 9.61  ? 369  TRP C C   1 
ATOM   2897  O  O   . TRP B  2  257 ? 21.492  -32.383 -16.320 1.00 9.75  ? 369  TRP C O   1 
ATOM   2898  C  CB  . TRP B  2  257 ? 19.155  -32.643 -14.237 1.00 11.99 ? 369  TRP C CB  1 
ATOM   2899  C  CG  . TRP B  2  257 ? 18.179  -31.677 -14.868 1.00 11.08 ? 369  TRP C CG  1 
ATOM   2900  C  CD1 . TRP B  2  257 ? 17.416  -30.725 -14.238 1.00 11.38 ? 369  TRP C CD1 1 
ATOM   2901  C  CD2 . TRP B  2  257 ? 17.796  -31.658 -16.229 1.00 10.69 ? 369  TRP C CD2 1 
ATOM   2902  N  NE1 . TRP B  2  257 ? 16.568  -30.118 -15.135 1.00 10.25 ? 369  TRP C NE1 1 
ATOM   2903  C  CE2 . TRP B  2  257 ? 16.776  -30.672 -16.364 1.00 12.44 ? 369  TRP C CE2 1 
ATOM   2904  C  CE3 . TRP B  2  257 ? 18.205  -32.387 -17.353 1.00 10.13 ? 369  TRP C CE3 1 
ATOM   2905  C  CZ2 . TRP B  2  257 ? 16.160  -30.402 -17.595 1.00 13.96 ? 369  TRP C CZ2 1 
ATOM   2906  C  CZ3 . TRP B  2  257 ? 17.597  -32.123 -18.578 1.00 13.09 ? 369  TRP C CZ3 1 
ATOM   2907  C  CH2 . TRP B  2  257 ? 16.579  -31.136 -18.690 1.00 13.15 ? 369  TRP C CH2 1 
ATOM   2908  N  N   . ARG B  2  258 ? 20.827  -30.311 -15.772 1.00 10.19 ? 370  ARG C N   1 
ATOM   2909  C  CA  . ARG B  2  258 ? 21.292  -29.764 -17.052 1.00 9.15  ? 370  ARG C CA  1 
ATOM   2910  C  C   . ARG B  2  258 ? 22.839  -29.699 -17.145 1.00 7.80  ? 370  ARG C C   1 
ATOM   2911  O  O   . ARG B  2  258 ? 23.397  -29.823 -18.235 1.00 8.65  ? 370  ARG C O   1 
ATOM   2912  C  CB  . ARG B  2  258 ? 20.686  -28.394 -17.314 1.00 7.30  ? 370  ARG C CB  1 
ATOM   2913  C  CG  . ARG B  2  258 ? 19.168  -28.400 -17.344 1.00 6.48  ? 370  ARG C CG  1 
ATOM   2914  C  CD  . ARG B  2  258 ? 18.674  -27.043 -17.752 1.00 8.60  ? 370  ARG C CD  1 
ATOM   2915  N  NE  . ARG B  2  258 ? 17.220  -26.944 -17.785 1.00 10.06 ? 370  ARG C NE  1 
ATOM   2916  C  CZ  . ARG B  2  258 ? 16.479  -27.196 -18.854 1.00 7.39  ? 370  ARG C CZ  1 
ATOM   2917  N  NH1 . ARG B  2  258 ? 17.057  -27.617 -19.991 1.00 5.29  ? 370  ARG C NH1 1 
ATOM   2918  N  NH2 . ARG B  2  258 ? 15.168  -27.035 -18.779 1.00 5.26  ? 370  ARG C NH2 1 
ATOM   2919  N  N   . VAL B  2  259 ? 23.531  -29.526 -16.021 1.00 7.08  ? 371  VAL C N   1 
ATOM   2920  C  CA  . VAL B  2  259 ? 24.995  -29.505 -16.099 1.00 8.40  ? 371  VAL C CA  1 
ATOM   2921  C  C   . VAL B  2  259 ? 25.521  -30.942 -16.285 1.00 8.20  ? 371  VAL C C   1 
ATOM   2922  O  O   . VAL B  2  259 ? 26.372  -31.210 -17.142 1.00 9.22  ? 371  VAL C O   1 
ATOM   2923  C  CB  . VAL B  2  259 ? 25.600  -28.852 -14.846 1.00 6.91  ? 371  VAL C CB  1 
ATOM   2924  C  CG1 . VAL B  2  259 ? 27.126  -28.935 -14.881 1.00 8.72  ? 371  VAL C CG1 1 
ATOM   2925  C  CG2 . VAL B  2  259 ? 25.158  -27.389 -14.775 1.00 6.84  ? 371  VAL C CG2 1 
ATOM   2926  N  N   . VAL B  2  260 ? 24.947  -31.858 -15.527 1.00 8.15  ? 372  VAL C N   1 
ATOM   2927  C  CA  . VAL B  2  260 ? 25.306  -33.269 -15.557 1.00 10.37 ? 372  VAL C CA  1 
ATOM   2928  C  C   . VAL B  2  260 ? 24.909  -33.935 -16.880 1.00 11.83 ? 372  VAL C C   1 
ATOM   2929  O  O   . VAL B  2  260 ? 25.756  -34.565 -17.535 1.00 11.79 ? 372  VAL C O   1 
ATOM   2930  C  CB  . VAL B  2  260 ? 24.624  -34.025 -14.385 1.00 8.37  ? 372  VAL C CB  1 
ATOM   2931  C  CG1 . VAL B  2  260 ? 24.752  -35.519 -14.575 1.00 10.70 ? 372  VAL C CG1 1 
ATOM   2932  C  CG2 . VAL B  2  260 ? 25.248  -33.608 -13.054 1.00 9.74  ? 372  VAL C CG2 1 
ATOM   2933  N  N   . LEU B  2  261 ? 23.639  -33.757 -17.300 1.00 10.84 ? 373  LEU C N   1 
ATOM   2934  C  CA  . LEU B  2  261 ? 23.131  -34.480 -18.470 1.00 10.55 ? 373  LEU C CA  1 
ATOM   2935  C  C   . LEU B  2  261 ? 23.083  -33.684 -19.770 1.00 10.16 ? 373  LEU C C   1 
ATOM   2936  O  O   . LEU B  2  261 ? 22.942  -34.294 -20.825 1.00 11.41 ? 373  LEU C O   1 
ATOM   2937  C  CB  . LEU B  2  261 ? 21.748  -35.080 -18.167 1.00 9.98  ? 373  LEU C CB  1 
ATOM   2938  C  CG  . LEU B  2  261 ? 21.630  -35.949 -16.892 1.00 13.24 ? 373  LEU C CG  1 
ATOM   2939  C  CD1 . LEU B  2  261 ? 20.181  -36.345 -16.639 1.00 11.86 ? 373  LEU C CD1 1 
ATOM   2940  C  CD2 . LEU B  2  261 ? 22.500  -37.187 -17.013 1.00 13.42 ? 373  LEU C CD2 1 
ATOM   2941  N  N   . GLU B  2  262 ? 23.211  -32.345 -19.734 1.00 9.88  ? 374  GLU C N   1 
ATOM   2942  C  CA  . GLU B  2  262 ? 23.139  -31.576 -20.985 1.00 9.28  ? 374  GLU C CA  1 
ATOM   2943  C  C   . GLU B  2  262 ? 24.430  -30.918 -21.457 1.00 8.53  ? 374  GLU C C   1 
ATOM   2944  O  O   . GLU B  2  262 ? 24.401  -29.810 -21.967 1.00 9.86  ? 374  GLU C O   1 
ATOM   2945  C  CB  . GLU B  2  262 ? 21.988  -30.563 -20.962 1.00 9.10  ? 374  GLU C CB  1 
ATOM   2946  C  CG  . GLU B  2  262 ? 20.626  -31.251 -20.965 1.00 12.88 ? 374  GLU C CG  1 
ATOM   2947  C  CD  . GLU B  2  262 ? 19.434  -30.317 -21.109 1.00 15.65 ? 374  GLU C CD  1 
ATOM   2948  O  OE1 . GLU B  2  262 ? 18.471  -30.700 -21.809 1.00 20.10 ? 374  GLU C OE1 1 
ATOM   2949  O  OE2 . GLU B  2  262 ? 19.443  -29.215 -20.515 1.00 16.62 ? 374  GLU C OE2 1 
ATOM   2950  N  N   . GLY B  2  263 ? 25.556  -31.605 -21.319 1.00 7.60  ? 375  GLY C N   1 
ATOM   2951  C  CA  . GLY B  2  263 ? 26.785  -31.090 -21.908 1.00 7.82  ? 375  GLY C CA  1 
ATOM   2952  C  C   . GLY B  2  263 ? 27.807  -30.422 -20.975 1.00 5.30  ? 375  GLY C C   1 
ATOM   2953  O  O   . GLY B  2  263 ? 28.777  -29.859 -21.456 1.00 6.13  ? 375  GLY C O   1 
ATOM   2954  N  N   . GLY B  2  264 ? 27.596  -30.452 -19.676 1.00 6.97  ? 376  GLY C N   1 
ATOM   2955  C  CA  . GLY B  2  264 ? 28.608  -29.895 -18.779 1.00 6.57  ? 376  GLY C CA  1 
ATOM   2956  C  C   . GLY B  2  264 ? 28.671  -28.391 -18.754 1.00 7.71  ? 376  GLY C C   1 
ATOM   2957  O  O   . GLY B  2  264 ? 27.721  -27.716 -19.124 1.00 7.04  ? 376  GLY C O   1 
ATOM   2958  N  N   . ILE B  2  265 ? 29.814  -27.849 -18.341 1.00 8.16  ? 377  ILE C N   1 
ATOM   2959  C  CA  . ILE B  2  265 ? 29.903  -26.403 -18.126 1.00 8.47  ? 377  ILE C CA  1 
ATOM   2960  C  C   . ILE B  2  265 ? 30.391  -25.585 -19.323 1.00 8.27  ? 377  ILE C C   1 
ATOM   2961  O  O   . ILE B  2  265 ? 30.157  -24.368 -19.347 1.00 6.35  ? 377  ILE C O   1 
ATOM   2962  C  CB  . ILE B  2  265 ? 30.784  -26.053 -16.886 1.00 6.26  ? 377  ILE C CB  1 
ATOM   2963  C  CG1 . ILE B  2  265 ? 32.272  -26.402 -17.120 1.00 5.93  ? 377  ILE C CG1 1 
ATOM   2964  C  CG2 . ILE B  2  265 ? 30.242  -26.766 -15.667 1.00 3.07  ? 377  ILE C CG2 1 
ATOM   2965  C  CD1 . ILE B  2  265 ? 33.191  -25.882 -16.028 1.00 4.90  ? 377  ILE C CD1 1 
ATOM   2966  N  N   . ASP B  2  266 ? 31.054  -26.229 -20.302 1.00 6.54  ? 378  ASP C N   1 
ATOM   2967  C  CA  . ASP B  2  266 ? 31.613  -25.488 -21.457 1.00 8.36  ? 378  ASP C CA  1 
ATOM   2968  C  C   . ASP B  2  266 ? 30.574  -24.694 -22.274 1.00 7.62  ? 378  ASP C C   1 
ATOM   2969  O  O   . ASP B  2  266 ? 30.779  -23.510 -22.539 1.00 6.05  ? 378  ASP C O   1 
ATOM   2970  C  CB  . ASP B  2  266 ? 32.372  -26.411 -22.400 1.00 7.96  ? 378  ASP C CB  1 
ATOM   2971  C  CG  . ASP B  2  266 ? 33.687  -26.864 -21.833 1.00 12.68 ? 378  ASP C CG  1 
ATOM   2972  O  OD1 . ASP B  2  266 ? 33.991  -26.533 -20.668 1.00 14.23 ? 378  ASP C OD1 1 
ATOM   2973  O  OD2 . ASP B  2  266 ? 34.416  -27.561 -22.553 1.00 12.33 ? 378  ASP C OD2 1 
ATOM   2974  N  N   . PRO B  2  267 ? 29.456  -25.319 -22.715 1.00 7.59  ? 379  PRO C N   1 
ATOM   2975  C  CA  . PRO B  2  267 ? 28.435  -24.598 -23.497 1.00 7.08  ? 379  PRO C CA  1 
ATOM   2976  C  C   . PRO B  2  267 ? 27.884  -23.398 -22.710 1.00 6.75  ? 379  PRO C C   1 
ATOM   2977  O  O   . PRO B  2  267 ? 27.621  -22.337 -23.278 1.00 7.35  ? 379  PRO C O   1 
ATOM   2978  C  CB  . PRO B  2  267 ? 27.371  -25.661 -23.751 1.00 6.93  ? 379  PRO C CB  1 
ATOM   2979  C  CG  . PRO B  2  267 ? 28.139  -26.936 -23.681 1.00 6.53  ? 379  PRO C CG  1 
ATOM   2980  C  CD  . PRO B  2  267 ? 29.077  -26.733 -22.516 1.00 4.98  ? 379  PRO C CD  1 
ATOM   2981  N  N   . ILE B  2  268 ? 27.744  -23.585 -21.395 1.00 6.98  ? 380  ILE C N   1 
ATOM   2982  C  CA  . ILE B  2  268 ? 27.263  -22.542 -20.487 1.00 7.90  ? 380  ILE C CA  1 
ATOM   2983  C  C   . ILE B  2  268 ? 28.284  -21.383 -20.353 1.00 7.21  ? 380  ILE C C   1 
ATOM   2984  O  O   . ILE B  2  268 ? 27.923  -20.190 -20.423 1.00 2.56  ? 380  ILE C O   1 
ATOM   2985  C  CB  . ILE B  2  268 ? 26.935  -23.168 -19.099 1.00 8.65  ? 380  ILE C CB  1 
ATOM   2986  C  CG1 . ILE B  2  268 ? 25.723  -24.128 -19.246 1.00 7.46  ? 380  ILE C CG1 1 
ATOM   2987  C  CG2 . ILE B  2  268 ? 26.640  -22.090 -18.068 1.00 7.44  ? 380  ILE C CG2 1 
ATOM   2988  C  CD1 . ILE B  2  268 ? 25.530  -25.076 -18.066 1.00 2.68  ? 380  ILE C CD1 1 
ATOM   2989  N  N   . LEU B  2  269 ? 29.557  -21.721 -20.178 1.00 7.55  ? 381  LEU C N   1 
ATOM   2990  C  CA  . LEU B  2  269 ? 30.591  -20.693 -20.093 1.00 10.11 ? 381  LEU C CA  1 
ATOM   2991  C  C   . LEU B  2  269 ? 30.745  -19.894 -21.399 1.00 8.70  ? 381  LEU C C   1 
ATOM   2992  O  O   . LEU B  2  269 ? 30.998  -18.689 -21.362 1.00 9.59  ? 381  LEU C O   1 
ATOM   2993  C  CB  . LEU B  2  269 ? 31.913  -21.312 -19.637 1.00 8.79  ? 381  LEU C CB  1 
ATOM   2994  C  CG  . LEU B  2  269 ? 31.959  -21.674 -18.132 1.00 10.42 ? 381  LEU C CG  1 
ATOM   2995  C  CD1 . LEU B  2  269 ? 33.165  -22.569 -17.830 1.00 11.03 ? 381  LEU C CD1 1 
ATOM   2996  C  CD2 . LEU B  2  269 ? 31.985  -20.410 -17.281 1.00 6.64  ? 381  LEU C CD2 1 
ATOM   2997  N  N   . ARG B  2  270 ? 30.556  -20.544 -22.555 1.00 9.76  ? 382  ARG C N   1 
ATOM   2998  C  CA  . ARG B  2  270 ? 30.618  -19.820 -23.826 1.00 8.35  ? 382  ARG C CA  1 
ATOM   2999  C  C   . ARG B  2  270 ? 29.426  -18.890 -23.954 1.00 7.31  ? 382  ARG C C   1 
ATOM   3000  O  O   . ARG B  2  270 ? 29.559  -17.770 -24.435 1.00 7.28  ? 382  ARG C O   1 
ATOM   3001  C  CB  . ARG B  2  270 ? 30.693  -20.774 -25.020 1.00 10.26 ? 382  ARG C CB  1 
ATOM   3002  C  CG  . ARG B  2  270 ? 32.115  -21.293 -25.269 1.00 15.83 ? 382  ARG C CG  1 
ATOM   3003  C  CD  . ARG B  2  270 ? 32.229  -22.239 -26.470 1.00 15.89 ? 382  ARG C CD  1 
ATOM   3004  N  NE  . ARG B  2  270 ? 31.579  -23.503 -26.187 1.00 19.88 ? 382  ARG C NE  1 
ATOM   3005  C  CZ  . ARG B  2  270 ? 32.168  -24.684 -26.137 1.00 18.12 ? 382  ARG C CZ  1 
ATOM   3006  N  NH1 . ARG B  2  270 ? 33.459  -24.822 -26.431 1.00 18.76 ? 382  ARG C NH1 1 
ATOM   3007  N  NH2 . ARG B  2  270 ? 31.448  -25.743 -25.826 1.00 17.80 ? 382  ARG C NH2 1 
ATOM   3008  N  N   . GLY B  2  271 ? 28.264  -19.352 -23.482 1.00 9.75  ? 383  GLY C N   1 
ATOM   3009  C  CA  . GLY B  2  271 ? 27.062  -18.514 -23.489 1.00 9.21  ? 383  GLY C CA  1 
ATOM   3010  C  C   . GLY B  2  271 ? 27.239  -17.254 -22.660 1.00 9.57  ? 383  GLY C C   1 
ATOM   3011  O  O   . GLY B  2  271 ? 26.834  -16.167 -23.070 1.00 9.97  ? 383  GLY C O   1 
ATOM   3012  N  N   . LEU B  2  272 ? 27.850  -17.387 -21.485 1.00 7.87  ? 384  LEU C N   1 
ATOM   3013  C  CA  . LEU B  2  272 ? 28.102  -16.228 -20.655 1.00 6.93  ? 384  LEU C CA  1 
ATOM   3014  C  C   . LEU B  2  272 ? 29.047  -15.228 -21.328 1.00 7.45  ? 384  LEU C C   1 
ATOM   3015  O  O   . LEU B  2  272 ? 28.846  -14.015 -21.210 1.00 6.52  ? 384  LEU C O   1 
ATOM   3016  C  CB  . LEU B  2  272 ? 28.672  -16.656 -19.305 1.00 8.21  ? 384  LEU C CB  1 
ATOM   3017  C  CG  . LEU B  2  272 ? 27.717  -17.369 -18.374 1.00 5.44  ? 384  LEU C CG  1 
ATOM   3018  C  CD1 . LEU B  2  272 ? 28.477  -17.873 -17.165 1.00 9.90  ? 384  LEU C CD1 1 
ATOM   3019  C  CD2 . LEU B  2  272 ? 26.609  -16.417 -17.960 1.00 5.12  ? 384  LEU C CD2 1 
ATOM   3020  N  N   . MET B  2  273 ? 30.063  -15.733 -22.064 1.00 6.69  ? 385  MET C N   1 
ATOM   3021  C  CA  . MET B  2  273 ? 31.048  -14.864 -22.708 1.00 7.84  ? 385  MET C CA  1 
ATOM   3022  C  C   . MET B  2  273 ? 30.563  -14.224 -23.965 1.00 8.17  ? 385  MET C C   1 
ATOM   3023  O  O   . MET B  2  273 ? 30.919  -13.087 -24.235 1.00 7.87  ? 385  MET C O   1 
ATOM   3024  C  CB  . MET B  2  273 ? 32.368  -15.619 -23.034 1.00 7.37  ? 385  MET C CB  1 
ATOM   3025  C  CG  . MET B  2  273 ? 33.240  -15.878 -21.807 1.00 8.73  ? 385  MET C CG  1 
ATOM   3026  S  SD  . MET B  2  273 ? 34.770  -16.750 -22.204 1.00 8.75  ? 385  MET C SD  1 
ATOM   3027  C  CE  . MET B  2  273 ? 34.230  -18.469 -22.226 1.00 5.94  ? 385  MET C CE  1 
ATOM   3028  N  N   . ALA B  2  274 ? 29.731  -14.950 -24.716 1.00 8.42  ? 386  ALA C N   1 
ATOM   3029  C  CA  . ALA B  2  274 ? 29.373  -14.519 -26.062 1.00 8.05  ? 386  ALA C CA  1 
ATOM   3030  C  C   . ALA B  2  274 ? 27.988  -13.926 -26.178 1.00 8.66  ? 386  ALA C C   1 
ATOM   3031  O  O   . ALA B  2  274 ? 27.512  -13.727 -27.294 1.00 9.85  ? 386  ALA C O   1 
ATOM   3032  C  CB  . ALA B  2  274 ? 29.515  -15.687 -27.021 1.00 6.40  ? 386  ALA C CB  1 
ATOM   3033  N  N   . THR B  2  275 ? 27.368  -13.635 -25.056 1.00 8.49  ? 387  THR C N   1 
ATOM   3034  C  CA  . THR B  2  275 ? 26.037  -13.021 -25.027 1.00 9.45  ? 387  THR C CA  1 
ATOM   3035  C  C   . THR B  2  275 ? 26.071  -11.761 -24.158 1.00 10.41 ? 387  THR C C   1 
ATOM   3036  O  O   . THR B  2  275 ? 26.757  -11.728 -23.125 1.00 11.04 ? 387  THR C O   1 
ATOM   3037  C  CB  . THR B  2  275 ? 24.993  -13.990 -24.427 1.00 7.77  ? 387  THR C CB  1 
ATOM   3038  O  OG1 . THR B  2  275 ? 25.145  -15.280 -25.037 1.00 9.84  ? 387  THR C OG1 1 
ATOM   3039  C  CG2 . THR B  2  275 ? 23.574  -13.497 -24.679 1.00 8.53  ? 387  THR C CG2 1 
ATOM   3040  N  N   . PRO B  2  276 ? 25.396  -10.674 -24.584 1.00 10.20 ? 388  PRO C N   1 
ATOM   3041  C  CA  . PRO B  2  276 ? 25.338  -9.446  -23.801 1.00 8.63  ? 388  PRO C CA  1 
ATOM   3042  C  C   . PRO B  2  276 ? 24.463  -9.653  -22.558 1.00 9.04  ? 388  PRO C C   1 
ATOM   3043  O  O   . PRO B  2  276 ? 23.530  -10.495 -22.533 1.00 6.06  ? 388  PRO C O   1 
ATOM   3044  C  CB  . PRO B  2  276 ? 24.674  -8.442  -24.736 1.00 7.41  ? 388  PRO C CB  1 
ATOM   3045  C  CG  . PRO B  2  276 ? 24.890  -9.026  -26.090 1.00 10.20 ? 388  PRO C CG  1 
ATOM   3046  C  CD  . PRO B  2  276 ? 24.713  -10.499 -25.885 1.00 10.78 ? 388  PRO C CD  1 
ATOM   3047  N  N   . ALA B  2  277 ? 24.807  -8.936  -21.500 1.00 10.09 ? 389  ALA C N   1 
ATOM   3048  C  CA  . ALA B  2  277 ? 23.913  -8.842  -20.341 1.00 8.40  ? 389  ALA C CA  1 
ATOM   3049  C  C   . ALA B  2  277 ? 22.700  -7.987  -20.758 1.00 6.26  ? 389  ALA C C   1 
ATOM   3050  O  O   . ALA B  2  277 ? 22.723  -7.304  -21.800 1.00 2.75  ? 389  ALA C O   1 
ATOM   3051  C  CB  . ALA B  2  277 ? 24.626  -8.139  -19.189 1.00 7.40  ? 389  ALA C CB  1 
ATOM   3052  N  N   . LYS B  2  278 ? 21.649  -8.055  -19.975 1.00 6.00  ? 390  LYS C N   1 
ATOM   3053  C  CA  . LYS B  2  278 ? 20.544  -7.158  -20.178 1.00 5.83  ? 390  LYS C CA  1 
ATOM   3054  C  C   . LYS B  2  278 ? 20.941  -5.787  -19.609 1.00 6.27  ? 390  LYS C C   1 
ATOM   3055  O  O   . LYS B  2  278 ? 21.511  -5.689  -18.526 1.00 7.58  ? 390  LYS C O   1 
ATOM   3056  C  CB  . LYS B  2  278 ? 19.284  -7.675  -19.465 1.00 6.30  ? 390  LYS C CB  1 
ATOM   3057  C  CG  . LYS B  2  278 ? 18.147  -6.658  -19.425 1.00 6.11  ? 390  LYS C CG  1 
ATOM   3058  C  CD  . LYS B  2  278 ? 17.038  -7.091  -18.476 1.00 7.99  ? 390  LYS C CD  1 
ATOM   3059  C  CE  . LYS B  2  278 ? 16.056  -5.952  -18.169 1.00 7.44  ? 390  LYS C CE  1 
ATOM   3060  N  NZ  . LYS B  2  278 ? 16.673  -4.867  -17.321 1.00 8.23  ? 390  LYS C NZ  1 
ATOM   3061  N  N   . LEU B  2  279 ? 20.689  -4.733  -20.354 1.00 7.40  ? 391  LEU C N   1 
ATOM   3062  C  CA  . LEU B  2  279 ? 20.966  -3.397  -19.862 1.00 8.32  ? 391  LEU C CA  1 
ATOM   3063  C  C   . LEU B  2  279 ? 19.778  -2.900  -19.048 1.00 10.00 ? 391  LEU C C   1 
ATOM   3064  O  O   . LEU B  2  279 ? 18.616  -3.082  -19.456 1.00 9.72  ? 391  LEU C O   1 
ATOM   3065  C  CB  . LEU B  2  279 ? 21.218  -2.446  -21.022 1.00 10.84 ? 391  LEU C CB  1 
ATOM   3066  C  CG  . LEU B  2  279 ? 21.399  -0.950  -20.673 1.00 12.92 ? 391  LEU C CG  1 
ATOM   3067  C  CD1 . LEU B  2  279 ? 22.751  -0.711  -19.995 1.00 13.69 ? 391  LEU C CD1 1 
ATOM   3068  C  CD2 . LEU B  2  279 ? 21.280  -0.107  -21.942 1.00 13.35 ? 391  LEU C CD2 1 
ATOM   3069  N  N   . ASN B  2  280 ? 20.067  -2.308  -17.895 1.00 8.35  ? 392  ASN C N   1 
ATOM   3070  C  CA  . ASN B  2  280 ? 19.035  -1.722  -17.075 1.00 8.46  ? 392  ASN C CA  1 
ATOM   3071  C  C   . ASN B  2  280 ? 18.652  -0.343  -17.646 1.00 10.60 ? 392  ASN C C   1 
ATOM   3072  O  O   . ASN B  2  280 ? 19.503  0.537   -17.846 1.00 6.68  ? 392  ASN C O   1 
ATOM   3073  C  CB  . ASN B  2  280 ? 19.515  -1.605  -15.611 1.00 5.25  ? 392  ASN C CB  1 
ATOM   3074  C  CG  . ASN B  2  280 ? 18.520  -0.905  -14.691 1.00 6.38  ? 392  ASN C CG  1 
ATOM   3075  O  OD1 . ASN B  2  280 ? 17.307  -0.898  -14.927 1.00 6.05  ? 392  ASN C OD1 1 
ATOM   3076  N  ND2 . ASN B  2  280 ? 19.025  -0.313  -13.627 1.00 5.34  ? 392  ASN C ND2 1 
ATOM   3077  N  N   . ARG B  2  281 ? 17.359  -0.193  -17.977 1.00 9.37  ? 393  ARG C N   1 
ATOM   3078  C  CA  . ARG B  2  281 ? 16.817  1.088   -18.443 1.00 9.98  ? 393  ARG C CA  1 
ATOM   3079  C  C   . ARG B  2  281 ? 15.579  1.403   -17.629 1.00 7.30  ? 393  ARG C C   1 
ATOM   3080  O  O   . ARG B  2  281 ? 14.943  0.501   -17.096 1.00 5.45  ? 393  ARG C O   1 
ATOM   3081  C  CB  . ARG B  2  281 ? 16.522  1.055   -19.955 1.00 12.59 ? 393  ARG C CB  1 
ATOM   3082  C  CG  . ARG B  2  281 ? 17.782  0.717   -20.761 1.00 13.93 ? 393  ARG C CG  1 
ATOM   3083  C  CD  . ARG B  2  281 ? 17.546  0.722   -22.253 1.00 17.99 ? 393  ARG C CD  1 
ATOM   3084  N  NE  . ARG B  2  281 ? 17.110  2.027   -22.708 1.00 22.82 ? 393  ARG C NE  1 
ATOM   3085  C  CZ  . ARG B  2  281 ? 16.608  2.276   -23.904 1.00 23.31 ? 393  ARG C CZ  1 
ATOM   3086  N  NH1 . ARG B  2  281 ? 16.516  1.302   -24.800 1.00 20.83 ? 393  ARG C NH1 1 
ATOM   3087  N  NH2 . ARG B  2  281 ? 16.208  3.511   -24.204 1.00 25.22 ? 393  ARG C NH2 1 
ATOM   3088  N  N   . GLN B  2  282 ? 15.241  2.673   -17.537 1.00 7.91  ? 394  GLN C N   1 
ATOM   3089  C  CA  . GLN B  2  282 ? 14.190  3.114   -16.623 1.00 9.81  ? 394  GLN C CA  1 
ATOM   3090  C  C   . GLN B  2  282 ? 12.804  2.534   -16.877 1.00 7.71  ? 394  GLN C C   1 
ATOM   3091  O  O   . GLN B  2  282 ? 12.032  2.415   -15.928 1.00 7.32  ? 394  GLN C O   1 
ATOM   3092  C  CB  . GLN B  2  282 ? 14.193  4.650   -16.523 1.00 9.34  ? 394  GLN C CB  1 
ATOM   3093  C  CG  . GLN B  2  282 ? 15.426  5.143   -15.753 1.00 9.14  ? 394  GLN C CG  1 
ATOM   3094  C  CD  . GLN B  2  282 ? 15.584  6.642   -15.742 1.00 9.14  ? 394  GLN C CD  1 
ATOM   3095  O  OE1 . GLN B  2  282 ? 15.304  7.330   -16.724 1.00 11.58 ? 394  GLN C OE1 1 
ATOM   3096  N  NE2 . GLN B  2  282 ? 16.028  7.165   -14.615 1.00 11.02 ? 394  GLN C NE2 1 
ATOM   3097  N  N   . ASN B  2  283 ? 12.506  2.154   -18.121 1.00 8.23  ? 395  ASN C N   1 
ATOM   3098  C  CA  . ASN B  2  283 ? 11.224  1.487   -18.412 1.00 8.93  ? 395  ASN C CA  1 
ATOM   3099  C  C   . ASN B  2  283 ? 11.471  0.028   -18.869 1.00 9.33  ? 395  ASN C C   1 
ATOM   3100  O  O   . ASN B  2  283 ? 10.638  -0.602  -19.534 1.00 6.49  ? 395  ASN C O   1 
ATOM   3101  C  CB  . ASN B  2  283 ? 10.397  2.278   -19.453 1.00 8.22  ? 395  ASN C CB  1 
ATOM   3102  C  CG  . ASN B  2  283 ? 11.000  2.305   -20.848 1.00 11.86 ? 395  ASN C CG  1 
ATOM   3103  O  OD1 . ASN B  2  283 ? 12.148  1.914   -21.054 1.00 17.16 ? 395  ASN C OD1 1 
ATOM   3104  N  ND2 . ASN B  2  283 ? 10.222  2.758   -21.823 1.00 11.10 ? 395  ASN C ND2 1 
ATOM   3105  N  N   . GLN B  2  284 ? 12.636  -0.496  -18.490 1.00 7.30  ? 396  GLN C N   1 
ATOM   3106  C  CA  . GLN B  2  284 ? 13.026  -1.880  -18.777 1.00 8.48  ? 396  GLN C CA  1 
ATOM   3107  C  C   . GLN B  2  284 ? 13.886  -2.377  -17.605 1.00 8.83  ? 396  GLN C C   1 
ATOM   3108  O  O   . GLN B  2  284 ? 15.067  -2.726  -17.802 1.00 7.42  ? 396  GLN C O   1 
ATOM   3109  C  CB  . GLN B  2  284 ? 13.859  -1.955  -20.069 1.00 8.98  ? 396  GLN C CB  1 
ATOM   3110  C  CG  . GLN B  2  284 ? 13.182  -1.441  -21.337 1.00 10.54 ? 396  GLN C CG  1 
ATOM   3111  C  CD  . GLN B  2  284 ? 14.148  -1.340  -22.526 1.00 13.45 ? 396  GLN C CD  1 
ATOM   3112  O  OE1 . GLN B  2  284 ? 15.199  -1.988  -22.581 1.00 11.28 ? 396  GLN C OE1 1 
ATOM   3113  N  NE2 . GLN B  2  284 ? 13.790  -0.527  -23.490 1.00 16.88 ? 396  GLN C NE2 1 
ATOM   3114  N  N   . ILE B  2  285 ? 13.294  -2.387  -16.398 1.00 5.88  ? 397  ILE C N   1 
ATOM   3115  C  CA  . ILE B  2  285 ? 14.061  -2.677  -15.171 1.00 6.98  ? 397  ILE C CA  1 
ATOM   3116  C  C   . ILE B  2  285 ? 14.419  -4.154  -14.947 1.00 6.27  ? 397  ILE C C   1 
ATOM   3117  O  O   . ILE B  2  285 ? 15.599  -4.492  -14.799 1.00 3.38  ? 397  ILE C O   1 
ATOM   3118  C  CB  . ILE B  2  285 ? 13.368  -2.033  -13.930 1.00 7.14  ? 397  ILE C CB  1 
ATOM   3119  C  CG1 . ILE B  2  285 ? 13.426  -0.495  -14.115 1.00 9.84  ? 397  ILE C CG1 1 
ATOM   3120  C  CG2 . ILE B  2  285 ? 14.068  -2.435  -12.610 1.00 6.66  ? 397  ILE C CG2 1 
ATOM   3121  C  CD1 . ILE B  2  285 ? 12.748  0.324   -13.034 1.00 9.18  ? 397  ILE C CD1 1 
ATOM   3122  N  N   . ALA B  2  286 ? 13.422  -5.025  -14.912 1.00 3.50  ? 398  ALA C N   1 
ATOM   3123  C  CA  . ALA B  2  286 ? 13.672  -6.453  -14.712 1.00 5.94  ? 398  ALA C CA  1 
ATOM   3124  C  C   . ALA B  2  286 ? 12.611  -7.328  -15.430 1.00 7.71  ? 398  ALA C C   1 
ATOM   3125  O  O   . ALA B  2  286 ? 11.417  -7.005  -15.434 1.00 7.87  ? 398  ALA C O   1 
ATOM   3126  C  CB  . ALA B  2  286 ? 13.731  -6.763  -13.223 1.00 3.98  ? 398  ALA C CB  1 
ATOM   3127  N  N   . VAL B  2  287 ? 13.076  -8.432  -16.038 1.00 6.12  ? 399  VAL C N   1 
ATOM   3128  C  CA  . VAL B  2  287 ? 12.267  -9.345  -16.860 1.00 5.83  ? 399  VAL C CA  1 
ATOM   3129  C  C   . VAL B  2  287 ? 11.285  -10.225 -16.059 1.00 5.33  ? 399  VAL C C   1 
ATOM   3130  O  O   . VAL B  2  287 ? 11.482  -10.539 -14.892 1.00 4.60  ? 399  VAL C O   1 
ATOM   3131  C  CB  . VAL B  2  287 ? 13.180  -10.265 -17.735 1.00 7.60  ? 399  VAL C CB  1 
ATOM   3132  C  CG1 . VAL B  2  287 ? 14.164  -9.413  -18.542 1.00 7.27  ? 399  VAL C CG1 1 
ATOM   3133  C  CG2 . VAL B  2  287 ? 13.940  -11.276 -16.867 1.00 5.26  ? 399  VAL C CG2 1 
ATOM   3134  N  N   . ASP B  2  288 ? 10.233  -10.629 -16.751 1.00 5.14  ? 400  ASP C N   1 
ATOM   3135  C  CA  . ASP B  2  288 ? 9.188   -11.450 -16.188 1.00 6.93  ? 400  ASP C CA  1 
ATOM   3136  C  C   . ASP B  2  288 ? 9.650   -12.885 -15.866 1.00 6.28  ? 400  ASP C C   1 
ATOM   3137  O  O   . ASP B  2  288 ? 9.014   -13.573 -15.086 1.00 7.97  ? 400  ASP C O   1 
ATOM   3138  C  CB  . ASP B  2  288 ? 7.974   -11.414 -17.142 1.00 6.83  ? 400  ASP C CB  1 
ATOM   3139  C  CG  . ASP B  2  288 ? 6.938   -10.356 -16.751 1.00 11.47 ? 400  ASP C CG  1 
ATOM   3140  O  OD1 . ASP B  2  288 ? 7.086   -9.742  -15.672 1.00 11.52 ? 400  ASP C OD1 1 
ATOM   3141  O  OD2 . ASP B  2  288 ? 5.947   -10.156 -17.504 1.00 11.66 ? 400  ASP C OD2 1 
ATOM   3142  N  N   . GLU B  2  289 ? 10.773  -13.336 -16.444 1.00 8.06  ? 401  GLU C N   1 
ATOM   3143  C  CA  . GLU B  2  289 ? 11.309  -14.657 -16.059 1.00 8.38  ? 401  GLU C CA  1 
ATOM   3144  C  C   . GLU B  2  289 ? 11.684  -14.668 -14.579 1.00 6.96  ? 401  GLU C C   1 
ATOM   3145  O  O   . GLU B  2  289 ? 11.654  -15.713 -13.929 1.00 5.92  ? 401  GLU C O   1 
ATOM   3146  C  CB  . GLU B  2  289 ? 12.521  -15.061 -16.897 1.00 8.47  ? 401  GLU C CB  1 
ATOM   3147  C  CG  . GLU B  2  289 ? 12.189  -15.509 -18.306 1.00 12.22 ? 401  GLU C CG  1 
ATOM   3148  C  CD  . GLU B  2  289 ? 11.201  -16.681 -18.395 1.00 13.39 ? 401  GLU C CD  1 
ATOM   3149  O  OE1 . GLU B  2  289 ? 10.190  -16.541 -19.097 1.00 12.64 ? 401  GLU C OE1 1 
ATOM   3150  O  OE2 . GLU B  2  289 ? 11.450  -17.742 -17.780 1.00 13.64 ? 401  GLU C OE2 1 
ATOM   3151  N  N   . ILE B  2  290 ? 12.027  -13.504 -14.035 1.00 6.38  ? 402  ILE C N   1 
ATOM   3152  C  CA  . ILE B  2  290 ? 12.274  -13.445 -12.622 1.00 6.55  ? 402  ILE C CA  1 
ATOM   3153  C  C   . ILE B  2  290 ? 11.179  -12.682 -11.886 1.00 7.67  ? 402  ILE C C   1 
ATOM   3154  O  O   . ILE B  2  290 ? 11.072  -12.820 -10.676 1.00 9.66  ? 402  ILE C O   1 
ATOM   3155  C  CB  . ILE B  2  290 ? 13.674  -12.853 -12.274 1.00 5.74  ? 402  ILE C CB  1 
ATOM   3156  C  CG1 . ILE B  2  290 ? 13.833  -11.453 -12.853 1.00 5.73  ? 402  ILE C CG1 1 
ATOM   3157  C  CG2 . ILE B  2  290 ? 14.762  -13.785 -12.806 1.00 4.93  ? 402  ILE C CG2 1 
ATOM   3158  C  CD1 . ILE B  2  290 ? 15.084  -10.734 -12.374 1.00 5.93  ? 402  ILE C CD1 1 
ATOM   3159  N  N   . ARG B  2  291 ? 10.342  -11.918 -12.619 1.00 7.26  ? 403  ARG C N   1 
ATOM   3160  C  CA  . ARG B  2  291 ? 9.273   -11.072 -11.996 1.00 8.74  ? 403  ARG C CA  1 
ATOM   3161  C  C   . ARG B  2  291 ? 7.918   -11.793 -11.851 1.00 7.19  ? 403  ARG C C   1 
ATOM   3162  O  O   . ARG B  2  291 ? 7.085   -11.430 -10.980 1.00 4.95  ? 403  ARG C O   1 
ATOM   3163  C  CB  . ARG B  2  291 ? 9.053   -9.774  -12.819 1.00 8.84  ? 403  ARG C CB  1 
ATOM   3164  C  CG  . ARG B  2  291 ? 8.443   -8.634  -12.011 1.00 6.82  ? 403  ARG C CG  1 
ATOM   3165  C  CD  . ARG B  2  291 ? 7.886   -7.538  -12.897 1.00 5.59  ? 403  ARG C CD  1 
ATOM   3166  N  NE  . ARG B  2  291 ? 6.559   -7.871  -13.405 1.00 10.31 ? 403  ARG C NE  1 
ATOM   3167  C  CZ  . ARG B  2  291 ? 5.427   -7.883  -12.691 1.00 10.29 ? 403  ARG C CZ  1 
ATOM   3168  N  NH1 . ARG B  2  291 ? 5.424   -7.578  -11.400 1.00 7.47  ? 403  ARG C NH1 1 
ATOM   3169  N  NH2 . ARG B  2  291 ? 4.281   -8.208  -13.291 1.00 12.28 ? 403  ARG C NH2 1 
ATOM   3170  N  N   . GLU B  2  292 ? 7.698   -12.786 -12.732 1.00 6.98  ? 404  GLU C N   1 
ATOM   3171  C  CA  . GLU B  2  292 ? 6.470   -13.595 -12.756 1.00 8.33  ? 404  GLU C CA  1 
ATOM   3172  C  C   . GLU B  2  292 ? 6.763   -15.073 -12.536 1.00 8.74  ? 404  GLU C C   1 
ATOM   3173  O  O   . GLU B  2  292 ? 5.981   -15.780 -11.912 1.00 8.99  ? 404  GLU C O   1 
ATOM   3174  C  CB  . GLU B  2  292 ? 5.761   -13.457 -14.111 1.00 6.44  ? 404  GLU C CB  1 
ATOM   3175  C  CG  . GLU B  2  292 ? 5.199   -12.076 -14.425 1.00 6.60  ? 404  GLU C CG  1 
ATOM   3176  C  CD  . GLU B  2  292 ? 3.931   -11.729 -13.672 1.00 3.33  ? 404  GLU C CD  1 
ATOM   3177  O  OE1 . GLU B  2  292 ? 3.050   -11.077 -14.260 1.00 8.07  ? 404  GLU C OE1 1 
ATOM   3178  O  OE2 . GLU B  2  292 ? 3.819   -12.091 -12.503 1.00 5.54  ? 404  GLU C OE2 1 
ATOM   3179  N  N   . ARG B  2  293 ? 7.923   -15.523 -13.020 1.00 10.23 ? 405  ARG C N   1 
ATOM   3180  C  CA  . ARG B  2  293 ? 8.217   -16.937 -13.044 1.00 10.59 ? 405  ARG C CA  1 
ATOM   3181  C  C   . ARG B  2  293 ? 9.405   -17.378 -12.201 1.00 8.94  ? 405  ARG C C   1 
ATOM   3182  O  O   . ARG B  2  293 ? 9.938   -18.465 -12.453 1.00 8.88  ? 405  ARG C O   1 
ATOM   3183  C  CB  . ARG B  2  293 ? 8.415   -17.364 -14.504 1.00 11.20 ? 405  ARG C CB  1 
ATOM   3184  C  CG  . ARG B  2  293 ? 7.159   -17.153 -15.351 1.00 15.56 ? 405  ARG C CG  1 
ATOM   3185  C  CD  . ARG B  2  293 ? 7.352   -17.531 -16.815 1.00 16.46 ? 405  ARG C CD  1 
ATOM   3186  N  NE  . ARG B  2  293 ? 8.145   -16.538 -17.561 1.00 21.69 ? 405  ARG C NE  1 
ATOM   3187  C  CZ  . ARG B  2  293 ? 7.706   -15.323 -18.011 1.00 24.15 ? 405  ARG C CZ  1 
ATOM   3188  N  NH1 . ARG B  2  293 ? 6.454   -14.890 -17.745 1.00 21.39 ? 405  ARG C NH1 1 
ATOM   3189  N  NH2 . ARG B  2  293 ? 8.534   -14.533 -18.713 1.00 19.79 ? 405  ARG C NH2 1 
ATOM   3190  N  N   . LEU B  2  294 ? 9.818   -16.578 -11.200 1.00 8.15  ? 406  LEU C N   1 
ATOM   3191  C  CA  . LEU B  2  294 ? 10.940  -17.011 -10.376 1.00 7.28  ? 406  LEU C CA  1 
ATOM   3192  C  C   . LEU B  2  294 ? 10.616  -18.333 -9.617  1.00 6.29  ? 406  LEU C C   1 
ATOM   3193  O  O   . LEU B  2  294 ? 9.610   -18.428 -8.909  1.00 6.68  ? 406  LEU C O   1 
ATOM   3194  C  CB  . LEU B  2  294 ? 11.372  -15.931 -9.359  1.00 6.39  ? 406  LEU C CB  1 
ATOM   3195  C  CG  . LEU B  2  294 ? 12.655  -16.268 -8.528  1.00 9.60  ? 406  LEU C CG  1 
ATOM   3196  C  CD1 . LEU B  2  294 ? 13.938  -16.027 -9.354  1.00 9.01  ? 406  LEU C CD1 1 
ATOM   3197  C  CD2 . LEU B  2  294 ? 12.693  -15.451 -7.240  1.00 10.39 ? 406  LEU C CD2 1 
ATOM   3198  N  N   . PHE B  2  295 ? 11.503  -19.342 -9.805  1.00 5.72  ? 407  PHE C N   1 
ATOM   3199  C  CA  . PHE B  2  295 ? 11.455  -20.653 -9.124  1.00 7.19  ? 407  PHE C CA  1 
ATOM   3200  C  C   . PHE B  2  295 ? 10.154  -21.419 -9.396  1.00 7.55  ? 407  PHE C C   1 
ATOM   3201  O  O   . PHE B  2  295 ? 9.698   -22.225 -8.574  1.00 5.82  ? 407  PHE C O   1 
ATOM   3202  C  CB  . PHE B  2  295 ? 11.681  -20.462 -7.615  1.00 6.84  ? 407  PHE C CB  1 
ATOM   3203  C  CG  . PHE B  2  295 ? 13.019  -19.874 -7.286  1.00 4.69  ? 407  PHE C CG  1 
ATOM   3204  C  CD1 . PHE B  2  295 ? 13.308  -19.473 -5.985  1.00 9.27  ? 407  PHE C CD1 1 
ATOM   3205  C  CD2 . PHE B  2  295 ? 14.000  -19.762 -8.259  1.00 3.28  ? 407  PHE C CD2 1 
ATOM   3206  C  CE1 . PHE B  2  295 ? 14.568  -18.973 -5.654  1.00 10.15 ? 407  PHE C CE1 1 
ATOM   3207  C  CE2 . PHE B  2  295 ? 15.248  -19.268 -7.949  1.00 8.82  ? 407  PHE C CE2 1 
ATOM   3208  C  CZ  . PHE B  2  295 ? 15.541  -18.872 -6.638  1.00 12.09 ? 407  PHE C CZ  1 
ATOM   3209  N  N   . GLU B  2  296 ? 9.604   -21.136 -10.575 1.00 10.01 ? 408  GLU C N   1 
ATOM   3210  C  CA  . GLU B  2  296 ? 8.366   -21.687 -11.109 1.00 12.31 ? 408  GLU C CA  1 
ATOM   3211  C  C   . GLU B  2  296 ? 8.267   -23.204 -10.878 1.00 12.83 ? 408  GLU C C   1 
ATOM   3212  O  O   . GLU B  2  296 ? 7.227   -23.703 -10.449 1.00 12.34 ? 408  GLU C O   1 
ATOM   3213  C  CB  . GLU B  2  296 ? 8.313   -21.359 -12.619 1.00 16.96 ? 408  GLU C CB  1 
ATOM   3214  C  CG  . GLU B  2  296 ? 6.973   -21.549 -13.314 1.00 23.10 ? 408  GLU C CG  1 
ATOM   3215  C  CD  . GLU B  2  296 ? 5.957   -20.480 -12.973 1.00 26.54 ? 408  GLU C CD  1 
ATOM   3216  O  OE1 . GLU B  2  296 ? 6.360   -19.388 -12.510 1.00 28.52 ? 408  GLU C OE1 1 
ATOM   3217  O  OE2 . GLU B  2  296 ? 4.746   -20.735 -13.167 1.00 29.35 ? 408  GLU C OE2 1 
ATOM   3218  N  N   . GLN B  2  297 ? 9.353   -23.919 -11.123 1.00 9.93  ? 409  GLN C N   1 
ATOM   3219  C  CA  . GLN B  2  297 ? 9.332   -25.378 -11.001 1.00 11.17 ? 409  GLN C CA  1 
ATOM   3220  C  C   . GLN B  2  297 ? 9.456   -25.907 -9.572  1.00 11.41 ? 409  GLN C C   1 
ATOM   3221  O  O   . GLN B  2  297 ? 9.114   -27.070 -9.335  1.00 13.29 ? 409  GLN C O   1 
ATOM   3222  C  CB  . GLN B  2  297 ? 10.438  -26.009 -11.867 1.00 11.50 ? 409  GLN C CB  1 
ATOM   3223  C  CG  . GLN B  2  297 ? 10.336  -25.724 -13.363 1.00 15.69 ? 409  GLN C CG  1 
ATOM   3224  C  CD  . GLN B  2  297 ? 11.296  -26.582 -14.196 1.00 19.83 ? 409  GLN C CD  1 
ATOM   3225  O  OE1 . GLN B  2  297 ? 12.479  -26.735 -13.856 1.00 15.95 ? 409  GLN C OE1 1 
ATOM   3226  N  NE2 . GLN B  2  297 ? 10.780  -27.155 -15.305 1.00 22.48 ? 409  GLN C NE2 1 
ATOM   3227  N  N   . VAL B  2  298 ? 9.932   -25.089 -8.609  1.00 11.29 ? 410  VAL C N   1 
ATOM   3228  C  CA  . VAL B  2  298 ? 10.158  -25.613 -7.249  1.00 12.72 ? 410  VAL C CA  1 
ATOM   3229  C  C   . VAL B  2  298 ? 9.303   -24.932 -6.174  1.00 14.01 ? 410  VAL C C   1 
ATOM   3230  O  O   . VAL B  2  298 ? 9.562   -25.079 -4.972  1.00 13.49 ? 410  VAL C O   1 
ATOM   3231  C  CB  . VAL B  2  298 ? 11.656  -25.520 -6.820  1.00 13.03 ? 410  VAL C CB  1 
ATOM   3232  C  CG1 . VAL B  2  298 ? 12.567  -26.245 -7.808  1.00 12.35 ? 410  VAL C CG1 1 
ATOM   3233  C  CG2 . VAL B  2  298 ? 12.071  -24.071 -6.678  1.00 17.63 ? 410  VAL C CG2 1 
ATOM   3234  N  N   . MET B  2  299 ? 8.278   -24.185 -6.609  1.00 15.40 ? 411  MET C N   1 
ATOM   3235  C  CA  . MET B  2  299 ? 7.374   -23.483 -5.677  1.00 13.34 ? 411  MET C CA  1 
ATOM   3236  C  C   . MET B  2  299 ? 5.901   -23.697 -6.084  1.00 11.98 ? 411  MET C C   1 
ATOM   3237  O  O   . MET B  2  299 ? 5.626   -24.107 -7.201  1.00 8.53  ? 411  MET C O   1 
ATOM   3238  C  CB  . MET B  2  299 ? 7.709   -21.971 -5.645  1.00 12.55 ? 411  MET C CB  1 
ATOM   3239  C  CG  . MET B  2  299 ? 9.165   -21.636 -5.299  1.00 14.13 ? 411  MET C CG  1 
ATOM   3240  S  SD  . MET B  2  299 ? 9.575   -21.918 -3.562  1.00 20.53 ? 411  MET C SD  1 
ATOM   3241  C  CE  . MET B  2  299 ? 8.845   -20.468 -2.842  1.00 10.17 ? 411  MET C CE  1 
ATOM   3242  N  N   . ARG B  2  300 ? 4.973   -23.416 -5.158  1.00 9.73  ? 412  ARG C N   1 
ATOM   3243  C  CA  . ARG B  2  300 ? 3.546   -23.580 -5.435  1.00 12.06 ? 412  ARG C CA  1 
ATOM   3244  C  C   . ARG B  2  300 ? 3.070   -22.633 -6.552  1.00 12.01 ? 412  ARG C C   1 
ATOM   3245  O  O   . ARG B  2  300 ? 2.138   -22.959 -7.307  1.00 12.20 ? 412  ARG C O   1 
ATOM   3246  C  CB  . ARG B  2  300 ? 2.705   -23.407 -4.141  1.00 10.33 ? 412  ARG C CB  1 
ATOM   3247  C  CG  . ARG B  2  300 ? 2.736   -22.040 -3.482  1.00 9.64  ? 412  ARG C CG  1 
ATOM   3248  C  CD  . ARG B  2  300 ? 1.816   -22.015 -2.253  1.00 7.46  ? 412  ARG C CD  1 
ATOM   3249  N  NE  . ARG B  2  300 ? 1.742   -20.691 -1.614  1.00 5.27  ? 412  ARG C NE  1 
ATOM   3250  C  CZ  . ARG B  2  300 ? 1.119   -19.602 -2.109  1.00 7.53  ? 412  ARG C CZ  1 
ATOM   3251  N  NH1 . ARG B  2  300 ? 0.426   -19.665 -3.238  1.00 6.56  ? 412  ARG C NH1 1 
ATOM   3252  N  NH2 . ARG B  2  300 ? 1.165   -18.461 -1.451  1.00 7.02  ? 412  ARG C NH2 1 
ATOM   3253  N  N   . ILE B  2  301 ? 3.705   -21.463 -6.647  1.00 11.36 ? 413  ILE C N   1 
ATOM   3254  C  CA  . ILE B  2  301 ? 3.496   -20.508 -7.748  1.00 10.61 ? 413  ILE C CA  1 
ATOM   3255  C  C   . ILE B  2  301 ? 4.822   -19.785 -8.031  1.00 11.41 ? 413  ILE C C   1 
ATOM   3256  O  O   . ILE B  2  301 ? 5.754   -19.840 -7.195  1.00 10.85 ? 413  ILE C O   1 
ATOM   3257  C  CB  . ILE B  2  301 ? 2.370   -19.430 -7.479  1.00 8.37  ? 413  ILE C CB  1 
ATOM   3258  C  CG1 . ILE B  2  301 ? 2.697   -18.551 -6.277  1.00 10.33 ? 413  ILE C CG1 1 
ATOM   3259  C  CG2 . ILE B  2  301 ? 1.027   -20.090 -7.268  1.00 9.40  ? 413  ILE C CG2 1 
ATOM   3260  C  CD1 . ILE B  2  301 ? 1.709   -17.423 -6.077  1.00 10.74 ? 413  ILE C CD1 1 
ATOM   3261  N  N   . GLY B  2  302 ? 4.920   -19.123 -9.200  1.00 10.99 ? 414  GLY C N   1 
ATOM   3262  C  CA  . GLY B  2  302 ? 6.124   -18.353 -9.529  1.00 11.05 ? 414  GLY C CA  1 
ATOM   3263  C  C   . GLY B  2  302 ? 6.302   -17.179 -8.572  1.00 10.76 ? 414  GLY C C   1 
ATOM   3264  O  O   . GLY B  2  302 ? 5.319   -16.543 -8.192  1.00 9.73  ? 414  GLY C O   1 
ATOM   3265  N  N   . LEU B  2  303 ? 7.541   -16.907 -8.135  1.00 10.85 ? 415  LEU C N   1 
ATOM   3266  C  CA  . LEU B  2  303 ? 7.777   -15.752 -7.240  1.00 8.76  ? 415  LEU C CA  1 
ATOM   3267  C  C   . LEU B  2  303 ? 8.090   -14.481 -8.055  1.00 6.70  ? 415  LEU C C   1 
ATOM   3268  O  O   . LEU B  2  303 ? 8.208   -14.522 -9.271  1.00 8.67  ? 415  LEU C O   1 
ATOM   3269  C  CB  . LEU B  2  303 ? 8.927   -16.023 -6.232  1.00 9.99  ? 415  LEU C CB  1 
ATOM   3270  C  CG  . LEU B  2  303 ? 8.880   -17.323 -5.389  1.00 14.70 ? 415  LEU C CG  1 
ATOM   3271  C  CD1 . LEU B  2  303 ? 9.928   -17.270 -4.273  1.00 11.26 ? 415  LEU C CD1 1 
ATOM   3272  C  CD2 . LEU B  2  303 ? 7.482   -17.541 -4.811  1.00 11.32 ? 415  LEU C CD2 1 
ATOM   3273  N  N   . ASP B  2  304 ? 8.203   -13.350 -7.374  1.00 4.74  ? 416  ASP C N   1 
ATOM   3274  C  CA  . ASP B  2  304 ? 8.552   -12.075 -8.000  1.00 4.90  ? 416  ASP C CA  1 
ATOM   3275  C  C   . ASP B  2  304 ? 9.809   -11.572 -7.326  1.00 2.30  ? 416  ASP C C   1 
ATOM   3276  O  O   . ASP B  2  304 ? 9.734   -11.094 -6.208  1.00 2.00  ? 416  ASP C O   1 
ATOM   3277  C  CB  . ASP B  2  304 ? 7.401   -11.066 -7.791  1.00 6.30  ? 416  ASP C CB  1 
ATOM   3278  C  CG  . ASP B  2  304 ? 7.588   -9.661  -8.419  1.00 7.59  ? 416  ASP C CG  1 
ATOM   3279  O  OD1 . ASP B  2  304 ? 6.551   -9.017  -8.707  1.00 8.37  ? 416  ASP C OD1 1 
ATOM   3280  O  OD2 . ASP B  2  304 ? 8.743   -9.193  -8.615  1.00 6.54  ? 416  ASP C OD2 1 
ATOM   3281  N  N   . LEU B  2  305 ? 10.952  -11.695 -8.007  1.00 2.79  ? 417  LEU C N   1 
ATOM   3282  C  CA  . LEU B  2  305 ? 12.228  -11.316 -7.401  1.00 5.76  ? 417  LEU C CA  1 
ATOM   3283  C  C   . LEU B  2  305 ? 12.280  -9.804  -7.024  1.00 4.64  ? 417  LEU C C   1 
ATOM   3284  O  O   . LEU B  2  305 ? 12.648  -9.478  -5.897  1.00 2.00  ? 417  LEU C O   1 
ATOM   3285  C  CB  . LEU B  2  305 ? 13.405  -11.759 -8.283  1.00 2.91  ? 417  LEU C CB  1 
ATOM   3286  C  CG  . LEU B  2  305 ? 14.792  -11.702 -7.623  1.00 6.57  ? 417  LEU C CG  1 
ATOM   3287  C  CD1 . LEU B  2  305 ? 14.745  -12.308 -6.225  1.00 7.71  ? 417  LEU C CD1 1 
ATOM   3288  C  CD2 . LEU B  2  305 ? 15.807  -12.433 -8.481  1.00 7.80  ? 417  LEU C CD2 1 
ATOM   3289  N  N   . PRO B  2  306 ? 11.913  -8.840  -7.953  1.00 6.69  ? 418  PRO C N   1 
ATOM   3290  C  CA  . PRO B  2  306 ? 11.894  -7.396  -7.623  1.00 6.59  ? 418  PRO C CA  1 
ATOM   3291  C  C   . PRO B  2  306 ? 11.035  -7.139  -6.398  1.00 4.25  ? 418  PRO C C   1 
ATOM   3292  O  O   . PRO B  2  306 ? 11.443  -6.409  -5.493  1.00 4.64  ? 418  PRO C O   1 
ATOM   3293  C  CB  . PRO B  2  306 ? 11.307  -6.736  -8.880  1.00 4.00  ? 418  PRO C CB  1 
ATOM   3294  C  CG  . PRO B  2  306 ? 11.818  -7.625  -9.960  1.00 2.00  ? 418  PRO C CG  1 
ATOM   3295  C  CD  . PRO B  2  306 ? 11.629  -9.023  -9.421  1.00 5.69  ? 418  PRO C CD  1 
ATOM   3296  N  N   . ALA B  2  307 ? 9.848   -7.759  -6.360  1.00 4.16  ? 419  ALA C N   1 
ATOM   3297  C  CA  . ALA B  2  307 ? 8.947   -7.575  -5.220  1.00 5.76  ? 419  ALA C CA  1 
ATOM   3298  C  C   . ALA B  2  307 ? 9.552   -8.185  -3.942  1.00 3.26  ? 419  ALA C C   1 
ATOM   3299  O  O   . ALA B  2  307 ? 9.467   -7.581  -2.882  1.00 2.74  ? 419  ALA C O   1 
ATOM   3300  C  CB  . ALA B  2  307 ? 7.555   -8.156  -5.511  1.00 4.07  ? 419  ALA C CB  1 
ATOM   3301  N  N   . LEU B  2  308 ? 10.168  -9.365  -4.070  1.00 2.64  ? 420  LEU C N   1 
ATOM   3302  C  CA  . LEU B  2  308 ? 10.853  -10.005 -2.940  1.00 4.03  ? 420  LEU C CA  1 
ATOM   3303  C  C   . LEU B  2  308 ? 11.961  -9.095  -2.379  1.00 2.00  ? 420  LEU C C   1 
ATOM   3304  O  O   . LEU B  2  308 ? 12.096  -8.978  -1.154  1.00 3.25  ? 420  LEU C O   1 
ATOM   3305  C  CB  . LEU B  2  308 ? 11.447  -11.365 -3.343  1.00 3.63  ? 420  LEU C CB  1 
ATOM   3306  C  CG  . LEU B  2  308 ? 10.454  -12.538 -3.506  1.00 3.07  ? 420  LEU C CG  1 
ATOM   3307  C  CD1 . LEU B  2  308 ? 11.128  -13.681 -4.259  1.00 4.48  ? 420  LEU C CD1 1 
ATOM   3308  C  CD2 . LEU B  2  308 ? 9.942   -13.001 -2.149  1.00 2.00  ? 420  LEU C CD2 1 
ATOM   3309  N  N   . ASN B  2  309 ? 12.714  -8.450  -3.280  1.00 4.66  ? 421  ASN C N   1 
ATOM   3310  C  CA  . ASN B  2  309 ? 13.795  -7.472  -2.902  1.00 6.15  ? 421  ASN C CA  1 
ATOM   3311  C  C   . ASN B  2  309 ? 13.230  -6.364  -2.000  1.00 5.33  ? 421  ASN C C   1 
ATOM   3312  O  O   . ASN B  2  309 ? 13.801  -6.052  -0.960  1.00 2.45  ? 421  ASN C O   1 
ATOM   3313  C  CB  . ASN B  2  309 ? 14.453  -6.840  -4.159  1.00 6.51  ? 421  ASN C CB  1 
ATOM   3314  C  CG  . ASN B  2  309 ? 15.225  -7.834  -5.040  1.00 3.83  ? 421  ASN C CG  1 
ATOM   3315  O  OD1 . ASN B  2  309 ? 15.579  -7.532  -6.189  1.00 5.48  ? 421  ASN C OD1 1 
ATOM   3316  N  ND2 . ASN B  2  309 ? 15.493  -9.027  -4.504  1.00 2.61  ? 421  ASN C ND2 1 
ATOM   3317  N  N   . MET B  2  310 ? 12.065  -5.803  -2.395  1.00 6.17  ? 422  MET C N   1 
ATOM   3318  C  CA  . MET B  2  310 ? 11.362  -4.759  -1.616  1.00 3.81  ? 422  MET C CA  1 
ATOM   3319  C  C   . MET B  2  310 ? 10.802  -5.256  -0.284  1.00 2.29  ? 422  MET C C   1 
ATOM   3320  O  O   . MET B  2  310 ? 10.916  -4.583  0.723   1.00 3.19  ? 422  MET C O   1 
ATOM   3321  C  CB  . MET B  2  310 ? 10.269  -4.138  -2.481  1.00 2.24  ? 422  MET C CB  1 
ATOM   3322  C  CG  . MET B  2  310 ? 10.882  -3.387  -3.651  1.00 4.43  ? 422  MET C CG  1 
ATOM   3323  S  SD  . MET B  2  310 ? 9.686   -2.554  -4.716  1.00 5.94  ? 422  MET C SD  1 
ATOM   3324  C  CE  . MET B  2  310 ? 9.611   -3.701  -6.090  1.00 3.71  ? 422  MET C CE  1 
ATOM   3325  N  N   . GLN B  2  311 ? 10.206  -6.436  -0.261  1.00 2.67  ? 423  GLN C N   1 
ATOM   3326  C  CA  . GLN B  2  311 ? 9.700   -6.979  0.980   1.00 2.00  ? 423  GLN C CA  1 
ATOM   3327  C  C   . GLN B  2  311 ? 10.864  -7.286  1.925   1.00 3.60  ? 423  GLN C C   1 
ATOM   3328  O  O   . GLN B  2  311 ? 10.730  -7.166  3.126   1.00 2.00  ? 423  GLN C O   1 
ATOM   3329  C  CB  . GLN B  2  311 ? 8.886   -8.259  0.706   1.00 3.11  ? 423  GLN C CB  1 
ATOM   3330  C  CG  . GLN B  2  311 ? 8.130   -8.808  1.916   1.00 3.25  ? 423  GLN C CG  1 
ATOM   3331  C  CD  . GLN B  2  311 ? 6.777   -8.132  2.133   1.00 7.43  ? 423  GLN C CD  1 
ATOM   3332  O  OE1 . GLN B  2  311 ? 6.630   -6.902  1.975   1.00 6.04  ? 423  GLN C OE1 1 
ATOM   3333  N  NE2 . GLN B  2  311 ? 5.786   -8.935  2.504   1.00 5.20  ? 423  GLN C NE2 1 
ATOM   3334  N  N   . ARG B  2  312 ? 12.008  -7.701  1.357   1.00 3.61  ? 424  ARG C N   1 
ATOM   3335  C  CA  . ARG B  2  312 ? 13.188  -8.028  2.176   1.00 2.99  ? 424  ARG C CA  1 
ATOM   3336  C  C   . ARG B  2  312 ? 13.748  -6.788  2.843   1.00 2.00  ? 424  ARG C C   1 
ATOM   3337  O  O   . ARG B  2  312 ? 14.128  -6.813  4.021   1.00 2.00  ? 424  ARG C O   1 
ATOM   3338  C  CB  . ARG B  2  312 ? 14.299  -8.719  1.341   1.00 3.06  ? 424  ARG C CB  1 
ATOM   3339  C  CG  . ARG B  2  312 ? 15.486  -9.244  2.179   1.00 2.00  ? 424  ARG C CG  1 
ATOM   3340  C  CD  . ARG B  2  312 ? 15.085  -10.382 3.082   1.00 2.00  ? 424  ARG C CD  1 
ATOM   3341  N  NE  . ARG B  2  312 ? 14.449  -11.466 2.314   1.00 4.05  ? 424  ARG C NE  1 
ATOM   3342  C  CZ  . ARG B  2  312 ? 13.770  -12.480 2.838   1.00 2.00  ? 424  ARG C CZ  1 
ATOM   3343  N  NH1 . ARG B  2  312 ? 13.619  -12.594 4.162   1.00 5.86  ? 424  ARG C NH1 1 
ATOM   3344  N  NH2 . ARG B  2  312 ? 13.232  -13.387 2.035   1.00 2.00  ? 424  ARG C NH2 1 
ATOM   3345  N  N   . SER B  2  313 ? 13.780  -5.693  2.111   1.00 2.81  ? 425  SER C N   1 
ATOM   3346  C  CA  . SER B  2  313 ? 14.280  -4.474  2.703   1.00 3.24  ? 425  SER C CA  1 
ATOM   3347  C  C   . SER B  2  313 ? 13.422  -4.041  3.897   1.00 3.84  ? 425  SER C C   1 
ATOM   3348  O  O   . SER B  2  313 ? 13.961  -3.549  4.895   1.00 3.03  ? 425  SER C O   1 
ATOM   3349  C  CB  . SER B  2  313 ? 14.430  -3.360  1.650   1.00 2.00  ? 425  SER C CB  1 
ATOM   3350  O  OG  . SER B  2  313 ? 13.219  -3.047  1.003   1.00 3.96  ? 425  SER C OG  1 
ATOM   3351  N  N   . ARG B  2  314 ? 12.099  -4.270  3.815   1.00 2.00  ? 426  ARG C N   1 
ATOM   3352  C  CA  . ARG B  2  314 ? 11.178  -3.956  4.919   1.00 2.57  ? 426  ARG C CA  1 
ATOM   3353  C  C   . ARG B  2  314 ? 11.388  -4.912  6.091   1.00 2.40  ? 426  ARG C C   1 
ATOM   3354  O  O   . ARG B  2  314 ? 11.405  -4.502  7.249   1.00 4.22  ? 426  ARG C O   1 
ATOM   3355  C  CB  . ARG B  2  314 ? 9.720   -4.006  4.422   1.00 2.00  ? 426  ARG C CB  1 
ATOM   3356  C  CG  . ARG B  2  314 ? 9.477   -3.005  3.314   1.00 7.52  ? 426  ARG C CG  1 
ATOM   3357  C  CD  . ARG B  2  314 ? 8.204   -3.274  2.544   1.00 4.97  ? 426  ARG C CD  1 
ATOM   3358  N  NE  . ARG B  2  314 ? 8.119   -2.399  1.377   1.00 5.05  ? 426  ARG C NE  1 
ATOM   3359  C  CZ  . ARG B  2  314 ? 7.057   -2.315  0.560   1.00 8.91  ? 426  ARG C CZ  1 
ATOM   3360  N  NH1 . ARG B  2  314 ? 5.967   -3.057  0.793   1.00 5.62  ? 426  ARG C NH1 1 
ATOM   3361  N  NH2 . ARG B  2  314 ? 7.080   -1.482  -0.483  1.00 4.82  ? 426  ARG C NH2 1 
ATOM   3362  N  N   . ASP B  2  315 ? 11.518  -6.199  5.772   1.00 2.57  ? 427  ASP C N   1 
ATOM   3363  C  CA  . ASP B  2  315 ? 11.840  -7.232  6.739   1.00 4.17  ? 427  ASP C CA  1 
ATOM   3364  C  C   . ASP B  2  315 ? 13.089  -6.778  7.517   1.00 4.31  ? 427  ASP C C   1 
ATOM   3365  O  O   . ASP B  2  315 ? 13.157  -6.900  8.751   1.00 3.71  ? 427  ASP C O   1 
ATOM   3366  C  CB  . ASP B  2  315 ? 12.110  -8.561  5.974   1.00 2.57  ? 427  ASP C CB  1 
ATOM   3367  C  CG  . ASP B  2  315 ? 12.636  -9.748  6.815   1.00 2.00  ? 427  ASP C CG  1 
ATOM   3368  O  OD1 . ASP B  2  315 ? 12.320  -9.849  8.003   1.00 3.16  ? 427  ASP C OD1 1 
ATOM   3369  O  OD2 . ASP B  2  315 ? 13.350  -10.598 6.266   1.00 2.93  ? 427  ASP C OD2 1 
ATOM   3370  N  N   . HIS B  2  316 ? 14.029  -6.180  6.796   1.00 4.08  ? 428  HIS C N   1 
ATOM   3371  C  CA  . HIS B  2  316 ? 15.290  -5.773  7.393   1.00 5.47  ? 428  HIS C CA  1 
ATOM   3372  C  C   . HIS B  2  316 ? 15.261  -4.404  8.047   1.00 6.97  ? 428  HIS C C   1 
ATOM   3373  O  O   . HIS B  2  316 ? 16.305  -3.942  8.540   1.00 7.15  ? 428  HIS C O   1 
ATOM   3374  C  CB  . HIS B  2  316 ? 16.417  -5.860  6.357   1.00 4.67  ? 428  HIS C CB  1 
ATOM   3375  C  CG  . HIS B  2  316 ? 16.863  -7.255  6.080   1.00 5.14  ? 428  HIS C CG  1 
ATOM   3376  N  ND1 . HIS B  2  316 ? 18.184  -7.565  5.770   1.00 3.66  ? 428  HIS C ND1 1 
ATOM   3377  C  CD2 . HIS B  2  316 ? 16.170  -8.424  6.018   1.00 2.86  ? 428  HIS C CD2 1 
ATOM   3378  C  CE1 . HIS B  2  316 ? 18.280  -8.868  5.522   1.00 6.50  ? 428  HIS C CE1 1 
ATOM   3379  N  NE2 . HIS B  2  316 ? 17.074  -9.411  5.667   1.00 6.76  ? 428  HIS C NE2 1 
ATOM   3380  N  N   . GLY B  2  317 ? 14.090  -3.749  8.071   1.00 6.46  ? 429  GLY C N   1 
ATOM   3381  C  CA  . GLY B  2  317 ? 13.984  -2.441  8.718   1.00 3.29  ? 429  GLY C CA  1 
ATOM   3382  C  C   . GLY B  2  317 ? 14.854  -1.385  8.076   1.00 3.17  ? 429  GLY C C   1 
ATOM   3383  O  O   . GLY B  2  317 ? 15.287  -0.452  8.733   1.00 5.87  ? 429  GLY C O   1 
ATOM   3384  N  N   . LEU B  2  318 ? 15.104  -1.511  6.776   1.00 3.86  ? 430  LEU C N   1 
ATOM   3385  C  CA  . LEU B  2  318 ? 15.935  -0.543  6.095   1.00 4.35  ? 430  LEU C CA  1 
ATOM   3386  C  C   . LEU B  2  318 ? 15.239  0.810   5.777   1.00 7.04  ? 430  LEU C C   1 
ATOM   3387  O  O   . LEU B  2  318 ? 14.087  0.863   5.313   1.00 6.35  ? 430  LEU C O   1 
ATOM   3388  C  CB  . LEU B  2  318 ? 16.449  -1.148  4.805   1.00 2.36  ? 430  LEU C CB  1 
ATOM   3389  C  CG  . LEU B  2  318 ? 17.403  -2.324  4.957   1.00 5.49  ? 430  LEU C CG  1 
ATOM   3390  C  CD1 . LEU B  2  318 ? 17.665  -2.915  3.592   1.00 6.09  ? 430  LEU C CD1 1 
ATOM   3391  C  CD2 . LEU B  2  318 ? 18.707  -1.890  5.620   1.00 3.16  ? 430  LEU C CD2 1 
ATOM   3392  N  N   . PRO B  2  319 ? 15.945  1.935   6.041   1.00 6.77  ? 431  PRO C N   1 
ATOM   3393  C  CA  . PRO B  2  319 ? 15.455  3.277   5.743   1.00 5.99  ? 431  PRO C CA  1 
ATOM   3394  C  C   . PRO B  2  319 ? 15.173  3.415   4.256   1.00 7.28  ? 431  PRO C C   1 
ATOM   3395  O  O   . PRO B  2  319 ? 15.713  2.650   3.433   1.00 5.01  ? 431  PRO C O   1 
ATOM   3396  C  CB  . PRO B  2  319 ? 16.608  4.183   6.147   1.00 5.99  ? 431  PRO C CB  1 
ATOM   3397  C  CG  . PRO B  2  319 ? 17.217  3.403   7.260   1.00 7.37  ? 431  PRO C CG  1 
ATOM   3398  C  CD  . PRO B  2  319 ? 17.235  1.998   6.751   1.00 6.32  ? 431  PRO C CD  1 
ATOM   3399  N  N   . GLY B  2  320 ? 14.351  4.402   3.930   1.00 6.95  ? 432  GLY C N   1 
ATOM   3400  C  CA  . GLY B  2  320 ? 13.967  4.654   2.562   1.00 5.62  ? 432  GLY C CA  1 
ATOM   3401  C  C   . GLY B  2  320 ? 15.026  5.361   1.742   1.00 6.36  ? 432  GLY C C   1 
ATOM   3402  O  O   . GLY B  2  320 ? 16.142  5.663   2.227   1.00 4.55  ? 432  GLY C O   1 
ATOM   3403  N  N   . TYR B  2  321 ? 14.627  5.646   0.499   1.00 5.64  ? 433  TYR C N   1 
ATOM   3404  C  CA  . TYR B  2  321 ? 15.454  6.244   -0.545  1.00 6.94  ? 433  TYR C CA  1 
ATOM   3405  C  C   . TYR B  2  321 ? 16.240  7.490   -0.115  1.00 6.93  ? 433  TYR C C   1 
ATOM   3406  O  O   . TYR B  2  321 ? 17.480  7.513   -0.240  1.00 7.77  ? 433  TYR C O   1 
ATOM   3407  C  CB  . TYR B  2  321 ? 14.570  6.559   -1.761  1.00 5.40  ? 433  TYR C CB  1 
ATOM   3408  C  CG  . TYR B  2  321 ? 15.299  7.233   -2.905  1.00 7.35  ? 433  TYR C CG  1 
ATOM   3409  C  CD1 . TYR B  2  321 ? 16.238  6.534   -3.687  1.00 4.79  ? 433  TYR C CD1 1 
ATOM   3410  C  CD2 . TYR B  2  321 ? 15.014  8.554   -3.243  1.00 2.94  ? 433  TYR C CD2 1 
ATOM   3411  C  CE1 . TYR B  2  321 ? 16.854  7.141   -4.767  1.00 3.77  ? 433  TYR C CE1 1 
ATOM   3412  C  CE2 . TYR B  2  321 ? 15.635  9.157   -4.319  1.00 4.91  ? 433  TYR C CE2 1 
ATOM   3413  C  CZ  . TYR B  2  321 ? 16.552  8.452   -5.073  1.00 2.57  ? 433  TYR C CZ  1 
ATOM   3414  O  OH  . TYR B  2  321 ? 17.209  9.082   -6.090  1.00 3.81  ? 433  TYR C OH  1 
ATOM   3415  N  N   . ASN B  2  322 ? 15.517  8.514   0.371   1.00 6.42  ? 434  ASN C N   1 
ATOM   3416  C  CA  . ASN B  2  322 ? 16.098  9.779   0.787   1.00 5.14  ? 434  ASN C CA  1 
ATOM   3417  C  C   . ASN B  2  322 ? 17.034  9.661   1.978   1.00 5.76  ? 434  ASN C C   1 
ATOM   3418  O  O   . ASN B  2  322 ? 18.009  10.416  2.069   1.00 4.71  ? 434  ASN C O   1 
ATOM   3419  C  CB  . ASN B  2  322 ? 14.993  10.793  1.090   1.00 6.00  ? 434  ASN C CB  1 
ATOM   3420  C  CG  . ASN B  2  322 ? 14.475  11.487  -0.165  1.00 6.11  ? 434  ASN C CG  1 
ATOM   3421  O  OD1 . ASN B  2  322 ? 15.054  11.357  -1.235  1.00 9.01  ? 434  ASN C OD1 1 
ATOM   3422  N  ND2 . ASN B  2  322 ? 13.399  12.237  -0.030  1.00 5.01  ? 434  ASN C ND2 1 
ATOM   3423  N  N   . ALA B  2  323 ? 16.748  8.753   2.904   1.00 4.31  ? 435  ALA C N   1 
ATOM   3424  C  CA  . ALA B  2  323 ? 17.641  8.593   4.038   1.00 4.39  ? 435  ALA C CA  1 
ATOM   3425  C  C   . ALA B  2  323 ? 18.997  8.062   3.549   1.00 5.37  ? 435  ALA C C   1 
ATOM   3426  O  O   . ALA B  2  323 ? 20.054  8.462   4.045   1.00 5.30  ? 435  ALA C O   1 
ATOM   3427  C  CB  . ALA B  2  323 ? 17.026  7.679   5.098   1.00 4.45  ? 435  ALA C CB  1 
ATOM   3428  N  N   . TRP B  2  324 ? 18.964  7.177   2.560   1.00 5.68  ? 436  TRP C N   1 
ATOM   3429  C  CA  . TRP B  2  324 ? 20.202  6.648   1.982   1.00 6.57  ? 436  TRP C CA  1 
ATOM   3430  C  C   . TRP B  2  324 ? 20.917  7.683   1.105   1.00 8.13  ? 436  TRP C C   1 
ATOM   3431  O  O   . TRP B  2  324 ? 22.148  7.717   1.097   1.00 5.57  ? 436  TRP C O   1 
ATOM   3432  C  CB  . TRP B  2  324 ? 19.955  5.321   1.227   1.00 7.88  ? 436  TRP C CB  1 
ATOM   3433  C  CG  . TRP B  2  324 ? 19.781  4.171   2.176   1.00 8.18  ? 436  TRP C CG  1 
ATOM   3434  C  CD1 . TRP B  2  324 ? 18.618  3.508   2.467   1.00 7.43  ? 436  TRP C CD1 1 
ATOM   3435  C  CD2 . TRP B  2  324 ? 20.757  3.672   3.107   1.00 8.26  ? 436  TRP C CD2 1 
ATOM   3436  N  NE1 . TRP B  2  324 ? 18.796  2.647   3.520   1.00 5.47  ? 436  TRP C NE1 1 
ATOM   3437  C  CE2 . TRP B  2  324 ? 20.096  2.720   3.938   1.00 6.05  ? 436  TRP C CE2 1 
ATOM   3438  C  CE3 . TRP B  2  324 ? 22.124  3.931   3.329   1.00 8.99  ? 436  TRP C CE3 1 
ATOM   3439  C  CZ2 . TRP B  2  324 ? 20.757  2.038   4.963   1.00 6.52  ? 436  TRP C CZ2 1 
ATOM   3440  C  CZ3 . TRP B  2  324 ? 22.776  3.251   4.350   1.00 6.81  ? 436  TRP C CZ3 1 
ATOM   3441  C  CH2 . TRP B  2  324 ? 22.096  2.319   5.152   1.00 5.96  ? 436  TRP C CH2 1 
ATOM   3442  N  N   . ARG B  2  325 ? 20.151  8.536   0.381   1.00 5.14  ? 437  ARG C N   1 
ATOM   3443  C  CA  . ARG B  2  325 ? 20.737  9.650   -0.405  1.00 6.67  ? 437  ARG C CA  1 
ATOM   3444  C  C   . ARG B  2  325 ? 21.506  10.593  0.556   1.00 5.06  ? 437  ARG C C   1 
ATOM   3445  O  O   . ARG B  2  325 ? 22.619  11.006  0.294   1.00 4.46  ? 437  ARG C O   1 
ATOM   3446  C  CB  . ARG B  2  325 ? 19.631  10.457  -1.135  1.00 6.22  ? 437  ARG C CB  1 
ATOM   3447  C  CG  . ARG B  2  325 ? 18.810  9.681   -2.175  1.00 6.61  ? 437  ARG C CG  1 
ATOM   3448  C  CD  . ARG B  2  325 ? 19.516  9.678   -3.516  1.00 6.94  ? 437  ARG C CD  1 
ATOM   3449  N  NE  . ARG B  2  325 ? 19.728  11.049  -4.008  1.00 7.75  ? 437  ARG C NE  1 
ATOM   3450  C  CZ  . ARG B  2  325 ? 20.334  11.378  -5.164  1.00 7.88  ? 437  ARG C CZ  1 
ATOM   3451  N  NH1 . ARG B  2  325 ? 20.817  10.439  -5.987  1.00 6.54  ? 437  ARG C NH1 1 
ATOM   3452  N  NH2 . ARG B  2  325 ? 20.459  12.656  -5.486  1.00 7.33  ? 437  ARG C NH2 1 
ATOM   3453  N  N   . ARG B  2  326 ? 20.893  10.879  1.686   1.00 4.90  ? 438  ARG C N   1 
ATOM   3454  C  CA  . ARG B  2  326 ? 21.459  11.733  2.723   1.00 6.06  ? 438  ARG C CA  1 
ATOM   3455  C  C   . ARG B  2  326 ? 22.731  11.123  3.317   1.00 5.54  ? 438  ARG C C   1 
ATOM   3456  O  O   . ARG B  2  326 ? 23.733  11.815  3.487   1.00 5.97  ? 438  ARG C O   1 
ATOM   3457  C  CB  . ARG B  2  326 ? 20.421  11.929  3.825   1.00 6.99  ? 438  ARG C CB  1 
ATOM   3458  C  CG  . ARG B  2  326 ? 20.817  12.896  4.927   1.00 7.09  ? 438  ARG C CG  1 
ATOM   3459  C  CD  . ARG B  2  326 ? 19.663  13.058  5.916   1.00 9.52  ? 438  ARG C CD  1 
ATOM   3460  N  NE  . ARG B  2  326 ? 18.482  13.532  5.201   1.00 8.92  ? 438  ARG C NE  1 
ATOM   3461  C  CZ  . ARG B  2  326 ? 17.309  12.932  5.151   1.00 6.75  ? 438  ARG C CZ  1 
ATOM   3462  N  NH1 . ARG B  2  326 ? 17.075  11.841  5.862   1.00 5.70  ? 438  ARG C NH1 1 
ATOM   3463  N  NH2 . ARG B  2  326 ? 16.372  13.448  4.387   1.00 4.85  ? 438  ARG C NH2 1 
ATOM   3464  N  N   . PHE B  2  327 ? 22.663  9.840   3.639   1.00 6.14  ? 439  PHE C N   1 
ATOM   3465  C  CA  . PHE B  2  327 ? 23.803  9.090   4.145   1.00 5.34  ? 439  PHE C CA  1 
ATOM   3466  C  C   . PHE B  2  327 ? 24.996  9.256   3.198   1.00 6.51  ? 439  PHE C C   1 
ATOM   3467  O  O   . PHE B  2  327 ? 26.133  9.470   3.626   1.00 6.67  ? 439  PHE C O   1 
ATOM   3468  C  CB  . PHE B  2  327 ? 23.402  7.587   4.292   1.00 5.11  ? 439  PHE C CB  1 
ATOM   3469  C  CG  . PHE B  2  327 ? 24.573  6.653   4.473   1.00 7.21  ? 439  PHE C CG  1 
ATOM   3470  C  CD1 . PHE B  2  327 ? 25.202  6.525   5.712   1.00 7.11  ? 439  PHE C CD1 1 
ATOM   3471  C  CD2 . PHE B  2  327 ? 25.117  5.982   3.370   1.00 6.88  ? 439  PHE C CD2 1 
ATOM   3472  C  CE1 . PHE B  2  327 ? 26.361  5.756   5.852   1.00 4.22  ? 439  PHE C CE1 1 
ATOM   3473  C  CE2 . PHE B  2  327 ? 26.267  5.213   3.496   1.00 6.42  ? 439  PHE C CE2 1 
ATOM   3474  C  CZ  . PHE B  2  327 ? 26.891  5.105   4.748   1.00 4.44  ? 439  PHE C CZ  1 
ATOM   3475  N  N   . CYS B  2  328 ? 24.708  9.202   1.911   1.00 4.47  ? 440  CYS C N   1 
ATOM   3476  C  CA  . CYS B  2  328 ? 25.691  9.332   0.836   1.00 5.82  ? 440  CYS C CA  1 
ATOM   3477  C  C   . CYS B  2  328 ? 26.033  10.797  0.451   1.00 5.29  ? 440  CYS C C   1 
ATOM   3478  O  O   . CYS B  2  328 ? 26.764  11.022  -0.513  1.00 8.15  ? 440  CYS C O   1 
ATOM   3479  C  CB  . CYS B  2  328 ? 25.139  8.612   -0.392  1.00 7.09  ? 440  CYS C CB  1 
ATOM   3480  S  SG  . CYS B  2  328 ? 25.127  6.814   -0.222  1.00 8.81  ? 440  CYS C SG  1 
ATOM   3481  N  N   . GLY B  2  329 ? 25.486  11.794  1.173   1.00 4.79  ? 441  GLY C N   1 
ATOM   3482  C  CA  . GLY B  2  329 ? 25.744  13.181  0.816   1.00 2.00  ? 441  GLY C CA  1 
ATOM   3483  C  C   . GLY B  2  329 ? 25.172  13.587  -0.538  1.00 4.24  ? 441  GLY C C   1 
ATOM   3484  O  O   . GLY B  2  329 ? 25.708  14.465  -1.193  1.00 3.93  ? 441  GLY C O   1 
ATOM   3485  N  N   . LEU B  2  330 ? 24.087  12.944  -0.960  1.00 4.21  ? 442  LEU C N   1 
ATOM   3486  C  CA  . LEU B  2  330 ? 23.395  13.278  -2.220  1.00 6.25  ? 442  LEU C CA  1 
ATOM   3487  C  C   . LEU B  2  330 ? 22.085  14.002  -1.924  1.00 4.41  ? 442  LEU C C   1 
ATOM   3488  O  O   . LEU B  2  330 ? 21.454  13.731  -0.912  1.00 6.32  ? 442  LEU C O   1 
ATOM   3489  C  CB  . LEU B  2  330 ? 23.090  11.996  -3.007  1.00 8.15  ? 442  LEU C CB  1 
ATOM   3490  C  CG  . LEU B  2  330 ? 24.290  11.095  -3.333  1.00 8.55  ? 442  LEU C CG  1 
ATOM   3491  C  CD1 . LEU B  2  330 ? 23.796  9.723   -3.727  1.00 6.75  ? 442  LEU C CD1 1 
ATOM   3492  C  CD2 . LEU B  2  330 ? 25.156  11.701  -4.441  1.00 10.12 ? 442  LEU C CD2 1 
ATOM   3493  N  N   . PRO B  2  331 ? 21.675  14.955  -2.779  1.00 6.31  ? 443  PRO C N   1 
ATOM   3494  C  CA  . PRO B  2  331 ? 20.422  15.725  -2.610  1.00 6.59  ? 443  PRO C CA  1 
ATOM   3495  C  C   . PRO B  2  331 ? 19.198  14.803  -2.480  1.00 8.66  ? 443  PRO C C   1 
ATOM   3496  O  O   . PRO B  2  331 ? 19.090  13.781  -3.170  1.00 10.01 ? 443  PRO C O   1 
ATOM   3497  C  CB  . PRO B  2  331 ? 20.372  16.566  -3.879  1.00 5.46  ? 443  PRO C CB  1 
ATOM   3498  C  CG  . PRO B  2  331 ? 21.809  16.778  -4.170  1.00 6.44  ? 443  PRO C CG  1 
ATOM   3499  C  CD  . PRO B  2  331 ? 22.394  15.409  -3.983  1.00 6.44  ? 443  PRO C CD  1 
ATOM   3500  N  N   . GLN B  2  332 ? 18.296  15.171  -1.573  1.00 8.46  ? 444  GLN C N   1 
ATOM   3501  C  CA  . GLN B  2  332 ? 17.123  14.358  -1.258  1.00 8.63  ? 444  GLN C CA  1 
ATOM   3502  C  C   . GLN B  2  332 ? 15.877  14.960  -1.890  1.00 7.96  ? 444  GLN C C   1 
ATOM   3503  O  O   . GLN B  2  332 ? 15.335  15.920  -1.376  1.00 8.83  ? 444  GLN C O   1 
ATOM   3504  C  CB  . GLN B  2  332 ? 16.937  14.265  0.276   1.00 8.10  ? 444  GLN C CB  1 
ATOM   3505  C  CG  . GLN B  2  332 ? 18.127  13.658  1.036   1.00 6.77  ? 444  GLN C CG  1 
ATOM   3506  C  CD  . GLN B  2  332 ? 18.912  14.674  1.862   1.00 4.79  ? 444  GLN C CD  1 
ATOM   3507  O  OE1 . GLN B  2  332 ? 18.444  15.143  2.893   1.00 7.03  ? 444  GLN C OE1 1 
ATOM   3508  N  NE2 . GLN B  2  332 ? 20.120  15.001  1.416   1.00 4.43  ? 444  GLN C NE2 1 
ATOM   3509  N  N   . PRO B  2  333 ? 15.412  14.445  -3.022  1.00 6.08  ? 445  PRO C N   1 
ATOM   3510  C  CA  . PRO B  2  333 ? 14.203  14.980  -3.661  1.00 8.28  ? 445  PRO C CA  1 
ATOM   3511  C  C   . PRO B  2  333 ? 12.969  14.789  -2.750  1.00 5.49  ? 445  PRO C C   1 
ATOM   3512  O  O   . PRO B  2  333 ? 12.729  13.693  -2.264  1.00 6.26  ? 445  PRO C O   1 
ATOM   3513  C  CB  . PRO B  2  333 ? 14.126  14.180  -4.976  1.00 6.30  ? 445  PRO C CB  1 
ATOM   3514  C  CG  . PRO B  2  333 ? 14.795  12.896  -4.624  1.00 5.44  ? 445  PRO C CG  1 
ATOM   3515  C  CD  . PRO B  2  333 ? 15.976  13.313  -3.785  1.00 6.27  ? 445  PRO C CD  1 
ATOM   3516  N  N   . GLU B  2  334 ? 12.218  15.883  -2.482  1.00 7.43  ? 446  GLU C N   1 
ATOM   3517  C  CA  . GLU B  2  334 ? 11.038  15.806  -1.616  1.00 7.47  ? 446  GLU C CA  1 
ATOM   3518  C  C   . GLU B  2  334 ? 9.737   15.869  -2.382  1.00 7.94  ? 446  GLU C C   1 
ATOM   3519  O  O   . GLU B  2  334 ? 8.709   15.534  -1.829  1.00 12.29 ? 446  GLU C O   1 
ATOM   3520  C  CB  . GLU B  2  334 ? 11.023  16.917  -0.574  1.00 5.89  ? 446  GLU C CB  1 
ATOM   3521  C  CG  . GLU B  2  334 ? 12.217  16.932  0.352   1.00 9.55  ? 446  GLU C CG  1 
ATOM   3522  C  CD  . GLU B  2  334 ? 12.290  15.755  1.307   1.00 8.97  ? 446  GLU C CD  1 
ATOM   3523  O  OE1 . GLU B  2  334 ? 13.364  15.573  1.931   1.00 10.38 ? 446  GLU C OE1 1 
ATOM   3524  O  OE2 . GLU B  2  334 ? 11.297  15.024  1.453   1.00 7.46  ? 446  GLU C OE2 1 
ATOM   3525  N  N   . THR B  2  335 ? 9.772   16.292  -3.638  1.00 9.42  ? 447  THR C N   1 
ATOM   3526  C  CA  . THR B  2  335 ? 8.542   16.408  -4.436  1.00 10.88 ? 447  THR C CA  1 
ATOM   3527  C  C   . THR B  2  335 ? 8.681   15.618  -5.729  1.00 11.03 ? 447  THR C C   1 
ATOM   3528  O  O   . THR B  2  335 ? 9.787   15.165  -6.046  1.00 7.78  ? 447  THR C O   1 
ATOM   3529  C  CB  . THR B  2  335 ? 8.241   17.881  -4.801  1.00 10.49 ? 447  THR C CB  1 
ATOM   3530  O  OG1 . THR B  2  335 ? 9.272   18.352  -5.678  1.00 11.11 ? 447  THR C OG1 1 
ATOM   3531  C  CG2 . THR B  2  335 ? 8.208   18.772  -3.573  1.00 10.12 ? 447  THR C CG2 1 
ATOM   3532  N  N   . VAL B  2  336 ? 7.570   15.480  -6.497  1.00 9.31  ? 448  VAL C N   1 
ATOM   3533  C  CA  . VAL B  2  336 ? 7.634   14.738  -7.759  1.00 10.37 ? 448  VAL C CA  1 
ATOM   3534  C  C   . VAL B  2  336 ? 8.592   15.429  -8.749  1.00 9.88  ? 448  VAL C C   1 
ATOM   3535  O  O   . VAL B  2  336 ? 9.419   14.760  -9.433  1.00 6.15  ? 448  VAL C O   1 
ATOM   3536  C  CB  . VAL B  2  336 ? 6.229   14.543  -8.423  1.00 8.74  ? 448  VAL C CB  1 
ATOM   3537  C  CG1 . VAL B  2  336 ? 5.594   15.886  -8.793  1.00 8.05  ? 448  VAL C CG1 1 
ATOM   3538  C  CG2 . VAL B  2  336 ? 6.355   13.625  -9.646  1.00 7.59  ? 448  VAL C CG2 1 
ATOM   3539  N  N   . GLY B  2  337 ? 8.486   16.775  -8.779  1.00 8.47  ? 449  GLY C N   1 
ATOM   3540  C  CA  . GLY B  2  337 ? 9.318   17.590  -9.627  1.00 8.22  ? 449  GLY C CA  1 
ATOM   3541  C  C   . GLY B  2  337 ? 10.780  17.383  -9.287  1.00 6.85  ? 449  GLY C C   1 
ATOM   3542  O  O   . GLY B  2  337 ? 11.590  17.175  -10.167 1.00 6.94  ? 449  GLY C O   1 
ATOM   3543  N  N   . GLN B  2  338 ? 11.111  17.413  -8.009  1.00 7.93  ? 450  GLN C N   1 
ATOM   3544  C  CA  . GLN B  2  338 ? 12.501  17.215  -7.588  1.00 8.81  ? 450  GLN C CA  1 
ATOM   3545  C  C   . GLN B  2  338 ? 13.010  15.787  -7.906  1.00 10.58 ? 450  GLN C C   1 
ATOM   3546  O  O   . GLN B  2  338 ? 14.175  15.599  -8.336  1.00 8.35  ? 450  GLN C O   1 
ATOM   3547  C  CB  . GLN B  2  338 ? 12.633  17.547  -6.109  1.00 7.05  ? 450  GLN C CB  1 
ATOM   3548  C  CG  . GLN B  2  338 ? 12.500  19.030  -5.850  1.00 6.72  ? 450  GLN C CG  1 
ATOM   3549  C  CD  . GLN B  2  338 ? 12.171  19.339  -4.418  1.00 9.07  ? 450  GLN C CD  1 
ATOM   3550  O  OE1 . GLN B  2  338 ? 12.476  18.552  -3.526  1.00 9.63  ? 450  GLN C OE1 1 
ATOM   3551  N  NE2 . GLN B  2  338 ? 11.543  20.494  -4.195  1.00 7.03  ? 450  GLN C NE2 1 
ATOM   3552  N  N   . LEU B  2  339 ? 12.112  14.785  -7.742  1.00 10.63 ? 451  LEU C N   1 
ATOM   3553  C  CA  . LEU B  2  339 ? 12.465  13.404  -8.054  1.00 9.89  ? 451  LEU C CA  1 
ATOM   3554  C  C   . LEU B  2  339 ? 12.655  13.267  -9.554  1.00 9.65  ? 451  LEU C C   1 
ATOM   3555  O  O   . LEU B  2  339 ? 13.562  12.536  -10.014 1.00 6.43  ? 451  LEU C O   1 
ATOM   3556  C  CB  . LEU B  2  339 ? 11.387  12.416  -7.574  1.00 10.05 ? 451  LEU C CB  1 
ATOM   3557  C  CG  . LEU B  2  339 ? 11.759  10.926  -7.704  1.00 8.41  ? 451  LEU C CG  1 
ATOM   3558  C  CD1 . LEU B  2  339 ? 12.956  10.609  -6.800  1.00 6.80  ? 451  LEU C CD1 1 
ATOM   3559  C  CD2 . LEU B  2  339 ? 10.559  10.051  -7.366  1.00 8.72  ? 451  LEU C CD2 1 
ATOM   3560  N  N   . GLY B  2  340 ? 11.776  13.977  -10.308 1.00 7.95  ? 452  GLY C N   1 
ATOM   3561  C  CA  . GLY B  2  340 ? 11.890  13.988  -11.759 1.00 6.96  ? 452  GLY C CA  1 
ATOM   3562  C  C   . GLY B  2  340 ? 13.257  14.504  -12.196 1.00 9.95  ? 452  GLY C C   1 
ATOM   3563  O  O   . GLY B  2  340 ? 13.860  13.992  -13.158 1.00 7.97  ? 452  GLY C O   1 
ATOM   3564  N  N   . THR B  2  341 ? 13.767  15.502  -11.467 1.00 9.40  ? 453  THR C N   1 
ATOM   3565  C  CA  . THR B  2  341 ? 15.072  16.080  -11.779 1.00 11.45 ? 453  THR C CA  1 
ATOM   3566  C  C   . THR B  2  341 ? 16.201  15.081  -11.506 1.00 7.75  ? 453  THR C C   1 
ATOM   3567  O  O   . THR B  2  341 ? 17.067  14.868  -12.356 1.00 7.27  ? 453  THR C O   1 
ATOM   3568  C  CB  . THR B  2  341 ? 15.300  17.381  -10.960 1.00 10.47 ? 453  THR C CB  1 
ATOM   3569  O  OG1 . THR B  2  341 ? 14.296  18.346  -11.326 1.00 13.45 ? 453  THR C OG1 1 
ATOM   3570  C  CG2 . THR B  2  341 ? 16.683  17.962  -11.224 1.00 10.37 ? 453  THR C CG2 1 
ATOM   3571  N  N   . VAL B  2  342 ? 16.160  14.455  -10.339 1.00 8.49  ? 454  VAL C N   1 
ATOM   3572  C  CA  . VAL B  2  342 ? 17.210  13.502  -9.938  1.00 9.53  ? 454  VAL C CA  1 
ATOM   3573  C  C   . VAL B  2  342 ? 17.238  12.303  -10.865 1.00 10.13 ? 454  VAL C C   1 
ATOM   3574  O  O   . VAL B  2  342 ? 18.312  11.880  -11.295 1.00 8.46  ? 454  VAL C O   1 
ATOM   3575  C  CB  . VAL B  2  342 ? 17.024  13.035  -8.459  1.00 9.24  ? 454  VAL C CB  1 
ATOM   3576  C  CG1 . VAL B  2  342 ? 18.003  11.917  -8.083  1.00 7.48  ? 454  VAL C CG1 1 
ATOM   3577  C  CG2 . VAL B  2  342 ? 17.229  14.225  -7.538  1.00 10.22 ? 454  VAL C CG2 1 
ATOM   3578  N  N   . LEU B  2  343 ? 16.039  11.797  -11.233 1.00 9.13  ? 455  LEU C N   1 
ATOM   3579  C  CA  . LEU B  2  343 ? 15.944  10.634  -12.109 1.00 8.36  ? 455  LEU C CA  1 
ATOM   3580  C  C   . LEU B  2  343 ? 16.084  10.964  -13.584 1.00 8.02  ? 455  LEU C C   1 
ATOM   3581  O  O   . LEU B  2  343 ? 16.219  10.054  -14.395 1.00 6.45  ? 455  LEU C O   1 
ATOM   3582  C  CB  . LEU B  2  343 ? 14.619  9.911   -11.882 1.00 7.35  ? 455  LEU C CB  1 
ATOM   3583  C  CG  . LEU B  2  343 ? 14.389  9.375   -10.466 1.00 8.11  ? 455  LEU C CG  1 
ATOM   3584  C  CD1 . LEU B  2  343 ? 13.055  8.644   -10.410 1.00 6.84  ? 455  LEU C CD1 1 
ATOM   3585  C  CD2 . LEU B  2  343 ? 15.523  8.426   -10.072 1.00 7.82  ? 455  LEU C CD2 1 
ATOM   3586  N  N   . ARG B  2  344 ? 16.090  12.259  -13.925 1.00 7.97  ? 456  ARG C N   1 
ATOM   3587  C  CA  . ARG B  2  344 ? 16.091  12.706  -15.322 1.00 11.55 ? 456  ARG C CA  1 
ATOM   3588  C  C   . ARG B  2  344 ? 14.929  12.045  -16.091 1.00 11.64 ? 456  ARG C C   1 
ATOM   3589  O  O   . ARG B  2  344 ? 15.036  11.682  -17.280 1.00 9.91  ? 456  ARG C O   1 
ATOM   3590  C  CB  . ARG B  2  344 ? 17.442  12.395  -15.996 1.00 16.05 ? 456  ARG C CB  1 
ATOM   3591  C  CG  . ARG B  2  344 ? 18.565  13.277  -15.519 1.00 20.10 ? 456  ARG C CG  1 
ATOM   3592  C  CD  . ARG B  2  344 ? 19.836  13.005  -16.292 1.00 25.67 ? 456  ARG C CD  1 
ATOM   3593  N  NE  . ARG B  2  344 ? 20.545  11.811  -15.824 1.00 31.07 ? 456  ARG C NE  1 
ATOM   3594  C  CZ  . ARG B  2  344 ? 21.766  11.818  -15.259 1.00 29.82 ? 456  ARG C CZ  1 
ATOM   3595  N  NH1 . ARG B  2  344 ? 22.406  12.962  -15.048 1.00 32.50 ? 456  ARG C NH1 1 
ATOM   3596  N  NH2 . ARG B  2  344 ? 22.335  10.675  -14.899 1.00 31.05 ? 456  ARG C NH2 1 
ATOM   3597  N  N   . ASN B  2  345 ? 13.796  11.924  -15.396 1.00 11.79 ? 457  ASN C N   1 
ATOM   3598  C  CA  . ASN B  2  345 ? 12.640  11.231  -15.926 1.00 11.02 ? 457  ASN C CA  1 
ATOM   3599  C  C   . ASN B  2  345 ? 11.457  11.537  -15.055 1.00 11.68 ? 457  ASN C C   1 
ATOM   3600  O  O   . ASN B  2  345 ? 11.291  10.926  -13.990 1.00 9.93  ? 457  ASN C O   1 
ATOM   3601  C  CB  . ASN B  2  345 ? 12.923  9.723   -15.901 1.00 12.51 ? 457  ASN C CB  1 
ATOM   3602  C  CG  . ASN B  2  345 ? 11.893  8.917   -16.675 1.00 13.23 ? 457  ASN C CG  1 
ATOM   3603  O  OD1 . ASN B  2  345 ? 10.713  9.320   -16.822 1.00 9.88  ? 457  ASN C OD1 1 
ATOM   3604  N  ND2 . ASN B  2  345 ? 12.343  7.767   -17.182 1.00 13.33 ? 457  ASN C ND2 1 
ATOM   3605  N  N   . LEU B  2  346 ? 10.635  12.503  -15.495 1.00 11.71 ? 458  LEU C N   1 
ATOM   3606  C  CA  . LEU B  2  346 ? 9.478   12.910  -14.705 1.00 11.50 ? 458  LEU C CA  1 
ATOM   3607  C  C   . LEU B  2  346 ? 8.390   11.839  -14.686 1.00 8.31  ? 458  LEU C C   1 
ATOM   3608  O  O   . LEU B  2  346 ? 7.686   11.688  -13.694 1.00 6.14  ? 458  LEU C O   1 
ATOM   3609  C  CB  . LEU B  2  346 ? 8.915   14.241  -15.211 1.00 12.84 ? 458  LEU C CB  1 
ATOM   3610  C  CG  . LEU B  2  346 ? 7.692   14.781  -14.462 1.00 14.81 ? 458  LEU C CG  1 
ATOM   3611  C  CD1 . LEU B  2  346 ? 7.892   14.666  -12.957 1.00 16.02 ? 458  LEU C CD1 1 
ATOM   3612  C  CD2 . LEU B  2  346 ? 7.426   16.230  -14.865 1.00 17.09 ? 458  LEU C CD2 1 
ATOM   3613  N  N   . LYS B  2  347 ? 8.288   11.074  -15.773 1.00 10.30 ? 459  LYS C N   1 
ATOM   3614  C  CA  . LYS B  2  347 ? 7.273   10.024  -15.859 1.00 12.59 ? 459  LYS C CA  1 
ATOM   3615  C  C   . LYS B  2  347 ? 7.523   8.955   -14.804 1.00 10.93 ? 459  LYS C C   1 
ATOM   3616  O  O   . LYS B  2  347 ? 6.614   8.583   -14.077 1.00 10.79 ? 459  LYS C O   1 
ATOM   3617  C  CB  . LYS B  2  347 ? 7.240   9.386   -17.251 1.00 13.46 ? 459  LYS C CB  1 
ATOM   3618  C  CG  . LYS B  2  347 ? 6.105   8.400   -17.414 1.00 19.46 ? 459  LYS C CG  1 
ATOM   3619  C  CD  . LYS B  2  347 ? 6.335   7.509   -18.610 1.00 25.93 ? 459  LYS C CD  1 
ATOM   3620  C  CE  . LYS B  2  347 ? 5.114   6.656   -18.914 1.00 28.84 ? 459  LYS C CE  1 
ATOM   3621  N  NZ  . LYS B  2  347 ? 4.080   7.417   -19.675 1.00 34.27 ? 459  LYS C NZ  1 
ATOM   3622  N  N   . LEU B  2  348 ? 8.768   8.491   -14.708 1.00 9.96  ? 460  LEU C N   1 
ATOM   3623  C  CA  . LEU B  2  348 ? 9.144   7.507   -13.702 1.00 7.26  ? 460  LEU C CA  1 
ATOM   3624  C  C   . LEU B  2  348 ? 8.884   8.043   -12.322 1.00 5.97  ? 460  LEU C C   1 
ATOM   3625  O  O   . LEU B  2  348 ? 8.384   7.315   -11.465 1.00 6.06  ? 460  LEU C O   1 
ATOM   3626  C  CB  . LEU B  2  348 ? 10.624  7.152   -13.798 1.00 4.81  ? 460  LEU C CB  1 
ATOM   3627  C  CG  . LEU B  2  348 ? 11.136  6.099   -12.805 1.00 5.45  ? 460  LEU C CG  1 
ATOM   3628  C  CD1 . LEU B  2  348 ? 10.324  4.808   -12.924 1.00 7.34  ? 460  LEU C CD1 1 
ATOM   3629  C  CD2 . LEU B  2  348 ? 12.589  5.814   -13.077 1.00 8.24  ? 460  LEU C CD2 1 
ATOM   3630  N  N   . ALA B  2  349 ? 9.253   9.322   -12.115 1.00 6.46  ? 461  ALA C N   1 
ATOM   3631  C  CA  . ALA B  2  349 ? 9.071   9.948   -10.808 1.00 6.27  ? 461  ALA C CA  1 
ATOM   3632  C  C   . ALA B  2  349 ? 7.573   9.982   -10.443 1.00 7.96  ? 461  ALA C C   1 
ATOM   3633  O  O   . ALA B  2  349 ? 7.193   9.757   -9.291  1.00 6.55  ? 461  ALA C O   1 
ATOM   3634  C  CB  . ALA B  2  349 ? 9.677   11.355  -10.801 1.00 4.93  ? 461  ALA C CB  1 
ATOM   3635  N  N   . ARG B  2  350 ? 6.723   10.274  -11.439 1.00 10.21 ? 462  ARG C N   1 
ATOM   3636  C  CA  . ARG B  2  350 ? 5.300   10.273  -11.218 1.00 11.04 ? 462  ARG C CA  1 
ATOM   3637  C  C   . ARG B  2  350 ? 4.850   8.877   -10.800 1.00 7.98  ? 462  ARG C C   1 
ATOM   3638  O  O   . ARG B  2  350 ? 4.162   8.716   -9.808  1.00 7.40  ? 462  ARG C O   1 
ATOM   3639  C  CB  . ARG B  2  350 ? 4.578   10.693  -12.490 1.00 16.45 ? 462  ARG C CB  1 
ATOM   3640  C  CG  . ARG B  2  350 ? 4.334   12.182  -12.611 1.00 23.78 ? 462  ARG C CG  1 
ATOM   3641  C  CD  . ARG B  2  350 ? 3.131   12.435  -13.507 1.00 28.59 ? 462  ARG C CD  1 
ATOM   3642  N  NE  . ARG B  2  350 ? 2.671   13.819  -13.444 1.00 35.21 ? 462  ARG C NE  1 
ATOM   3643  C  CZ  . ARG B  2  350 ? 3.248   14.843  -14.071 1.00 35.98 ? 462  ARG C CZ  1 
ATOM   3644  N  NH1 . ARG B  2  350 ? 4.341   14.669  -14.786 1.00 36.23 ? 462  ARG C NH1 1 
ATOM   3645  N  NH2 . ARG B  2  350 ? 2.728   16.052  -13.968 1.00 39.17 ? 462  ARG C NH2 1 
ATOM   3646  N  N   . LYS B  2  351 ? 5.271   7.872   -11.562 1.00 8.28  ? 463  LYS C N   1 
ATOM   3647  C  CA  . LYS B  2  351 ? 4.952   6.475   -11.247 1.00 10.77 ? 463  LYS C CA  1 
ATOM   3648  C  C   . LYS B  2  351 ? 5.365   6.128   -9.817  1.00 9.21  ? 463  LYS C C   1 
ATOM   3649  O  O   . LYS B  2  351 ? 4.594   5.566   -9.073  1.00 8.75  ? 463  LYS C O   1 
ATOM   3650  C  CB  . LYS B  2  351 ? 5.645   5.511   -12.208 1.00 11.01 ? 463  LYS C CB  1 
ATOM   3651  C  CG  . LYS B  2  351 ? 4.983   5.343   -13.560 1.00 14.33 ? 463  LYS C CG  1 
ATOM   3652  C  CD  . LYS B  2  351 ? 5.861   4.471   -14.455 1.00 18.50 ? 463  LYS C CD  1 
ATOM   3653  C  CE  . LYS B  2  351 ? 5.324   4.349   -15.879 1.00 21.09 ? 463  LYS C CE  1 
ATOM   3654  N  NZ  . LYS B  2  351 ? 4.041   3.583   -15.949 1.00 24.31 ? 463  LYS C NZ  1 
ATOM   3655  N  N   . LEU B  2  352 ? 6.578   6.483   -9.443  1.00 7.09  ? 464  LEU C N   1 
ATOM   3656  C  CA  . LEU B  2  352 ? 7.070   6.209   -8.099  1.00 6.97  ? 464  LEU C CA  1 
ATOM   3657  C  C   . LEU B  2  352 ? 6.201   6.852   -7.046  1.00 5.75  ? 464  LEU C C   1 
ATOM   3658  O  O   . LEU B  2  352 ? 5.877   6.241   -6.048  1.00 5.33  ? 464  LEU C O   1 
ATOM   3659  C  CB  . LEU B  2  352 ? 8.526   6.698   -7.933  1.00 4.43  ? 464  LEU C CB  1 
ATOM   3660  C  CG  . LEU B  2  352 ? 9.613   5.880   -8.631  1.00 8.72  ? 464  LEU C CG  1 
ATOM   3661  C  CD1 . LEU B  2  352 ? 10.926  6.618   -8.533  1.00 9.56  ? 464  LEU C CD1 1 
ATOM   3662  C  CD2 . LEU B  2  352 ? 9.743   4.495   -7.996  1.00 10.23 ? 464  LEU C CD2 1 
ATOM   3663  N  N   . MET B  2  353 ? 5.810   8.085   -7.280  1.00 8.30  ? 465  MET C N   1 
ATOM   3664  C  CA  . MET B  2  353 ? 5.012   8.802   -6.297  1.00 9.65  ? 465  MET C CA  1 
ATOM   3665  C  C   . MET B  2  353 ? 3.573   8.274   -6.166  1.00 9.01  ? 465  MET C C   1 
ATOM   3666  O  O   . MET B  2  353 ? 2.988   8.350   -5.084  1.00 9.31  ? 465  MET C O   1 
ATOM   3667  C  CB  . MET B  2  353 ? 5.043   10.305  -6.597  1.00 7.74  ? 465  MET C CB  1 
ATOM   3668  C  CG  . MET B  2  353 ? 6.423   10.898  -6.384  1.00 7.89  ? 465  MET C CG  1 
ATOM   3669  S  SD  . MET B  2  353 ? 6.952   10.662  -4.691  1.00 9.12  ? 465  MET C SD  1 
ATOM   3670  C  CE  . MET B  2  353 ? 6.927   12.365  -4.173  1.00 17.63 ? 465  MET C CE  1 
ATOM   3671  N  N   . GLU B  2  354 ? 3.017   7.737   -7.243  1.00 11.03 ? 466  GLU C N   1 
ATOM   3672  C  CA  . GLU B  2  354 ? 1.668   7.213   -7.153  1.00 11.37 ? 466  GLU C CA  1 
ATOM   3673  C  C   . GLU B  2  354 ? 1.655   5.977   -6.274  1.00 11.10 ? 466  GLU C C   1 
ATOM   3674  O  O   . GLU B  2  354 ? 0.689   5.742   -5.573  1.00 12.83 ? 466  GLU C O   1 
ATOM   3675  C  CB  . GLU B  2  354 ? 1.081   6.907   -8.527  1.00 13.93 ? 466  GLU C CB  1 
ATOM   3676  C  CG  . GLU B  2  354 ? 1.233   8.036   -9.564  1.00 22.93 ? 466  GLU C CG  1 
ATOM   3677  C  CD  . GLU B  2  354 ? 0.867   9.466   -9.114  1.00 25.34 ? 466  GLU C CD  1 
ATOM   3678  O  OE1 . GLU B  2  354 ? 1.322   10.418  -9.792  1.00 26.28 ? 466  GLU C OE1 1 
ATOM   3679  O  OE2 . GLU B  2  354 ? 0.134   9.648   -8.104  1.00 26.06 ? 466  GLU C OE2 1 
ATOM   3680  N  N   . GLN B  2  355 ? 2.756   5.224   -6.272  1.00 8.97  ? 467  GLN C N   1 
ATOM   3681  C  CA  . GLN B  2  355 ? 2.890   4.057   -5.419  1.00 7.37  ? 467  GLN C CA  1 
ATOM   3682  C  C   . GLN B  2  355 ? 3.285   4.422   -4.005  1.00 7.16  ? 467  GLN C C   1 
ATOM   3683  O  O   . GLN B  2  355 ? 2.672   3.950   -3.062  1.00 10.43 ? 467  GLN C O   1 
ATOM   3684  C  CB  . GLN B  2  355 ? 3.961   3.113   -5.957  1.00 10.10 ? 467  GLN C CB  1 
ATOM   3685  C  CG  . GLN B  2  355 ? 3.668   2.523   -7.319  1.00 14.52 ? 467  GLN C CG  1 
ATOM   3686  C  CD  . GLN B  2  355 ? 2.418   1.668   -7.333  1.00 15.29 ? 467  GLN C CD  1 
ATOM   3687  O  OE1 . GLN B  2  355 ? 2.300   0.715   -6.561  1.00 16.30 ? 467  GLN C OE1 1 
ATOM   3688  N  NE2 . GLN B  2  355 ? 1.487   2.006   -8.223  1.00 14.58 ? 467  GLN C NE2 1 
ATOM   3689  N  N   . TYR B  2  356 ? 4.299   5.283   -3.847  1.00 7.35  ? 468  TYR C N   1 
ATOM   3690  C  CA  . TYR B  2  356 ? 4.884   5.535   -2.522  1.00 6.32  ? 468  TYR C CA  1 
ATOM   3691  C  C   . TYR B  2  356 ? 4.415   6.820   -1.821  1.00 6.66  ? 468  TYR C C   1 
ATOM   3692  O  O   . TYR B  2  356 ? 4.586   6.960   -0.604  1.00 7.42  ? 468  TYR C O   1 
ATOM   3693  C  CB  . TYR B  2  356 ? 6.419   5.538   -2.632  1.00 5.84  ? 468  TYR C CB  1 
ATOM   3694  C  CG  . TYR B  2  356 ? 7.053   4.202   -2.963  1.00 5.72  ? 468  TYR C CG  1 
ATOM   3695  C  CD1 . TYR B  2  356 ? 7.248   3.216   -1.978  1.00 5.17  ? 468  TYR C CD1 1 
ATOM   3696  C  CD2 . TYR B  2  356 ? 7.569   3.958   -4.235  1.00 4.63  ? 468  TYR C CD2 1 
ATOM   3697  C  CE1 . TYR B  2  356 ? 7.949   2.046   -2.253  1.00 3.61  ? 468  TYR C CE1 1 
ATOM   3698  C  CE2 . TYR B  2  356 ? 8.267   2.787   -4.515  1.00 6.51  ? 468  TYR C CE2 1 
ATOM   3699  C  CZ  . TYR B  2  356 ? 8.461   1.844   -3.524  1.00 4.97  ? 468  TYR C CZ  1 
ATOM   3700  O  OH  . TYR B  2  356 ? 9.197   0.732   -3.797  1.00 2.25  ? 468  TYR C OH  1 
ATOM   3701  N  N   . GLY B  2  357 ? 3.867   7.774   -2.565  1.00 7.93  ? 469  GLY C N   1 
ATOM   3702  C  CA  . GLY B  2  357 ? 3.403   9.004   -1.933  1.00 7.93  ? 469  GLY C CA  1 
ATOM   3703  C  C   . GLY B  2  357 ? 4.514   10.006  -1.652  1.00 9.92  ? 469  GLY C C   1 
ATOM   3704  O  O   . GLY B  2  357 ? 4.370   11.190  -1.935  1.00 11.03 ? 469  GLY C O   1 
ATOM   3705  N  N   . THR B  2  358 ? 5.613   9.540   -1.073  1.00 8.77  ? 470  THR C N   1 
ATOM   3706  C  CA  . THR B  2  358 ? 6.769   10.406  -0.788  1.00 10.51 ? 470  THR C CA  1 
ATOM   3707  C  C   . THR B  2  358 ? 8.045   9.700   -1.197  1.00 9.88  ? 470  THR C C   1 
ATOM   3708  O  O   . THR B  2  358 ? 8.116   8.475   -1.111  1.00 10.26 ? 470  THR C O   1 
ATOM   3709  C  CB  . THR B  2  358 ? 6.866   10.738  0.732   1.00 10.16 ? 470  THR C CB  1 
ATOM   3710  O  OG1 . THR B  2  358 ? 8.165   11.280  1.029   1.00 11.11 ? 470  THR C OG1 1 
ATOM   3711  C  CG2 . THR B  2  358 ? 6.653   9.490   1.571   1.00 11.56 ? 470  THR C CG2 1 
ATOM   3712  N  N   . PRO B  2  359 ? 9.079   10.436  -1.682  1.00 11.38 ? 471  PRO C N   1 
ATOM   3713  C  CA  . PRO B  2  359 ? 10.356  9.820   -2.074  1.00 8.18  ? 471  PRO C CA  1 
ATOM   3714  C  C   . PRO B  2  359 ? 11.069  9.249   -0.844  1.00 9.74  ? 471  PRO C C   1 
ATOM   3715  O  O   . PRO B  2  359 ? 11.946  8.409   -0.981  1.00 9.47  ? 471  PRO C O   1 
ATOM   3716  C  CB  . PRO B  2  359 ? 11.133  10.961  -2.708  1.00 8.58  ? 471  PRO C CB  1 
ATOM   3717  C  CG  . PRO B  2  359 ? 10.052  11.918  -3.094  1.00 9.06  ? 471  PRO C CG  1 
ATOM   3718  C  CD  . PRO B  2  359 ? 9.100   11.884  -1.943  1.00 7.84  ? 471  PRO C CD  1 
ATOM   3719  N  N   . ASN B  2  360 ? 10.668  9.696   0.364   1.00 9.44  ? 472  ASN C N   1 
ATOM   3720  C  CA  . ASN B  2  360 ? 11.227  9.155   1.624   1.00 11.10 ? 472  ASN C CA  1 
ATOM   3721  C  C   . ASN B  2  360 ? 10.892  7.636   1.843   1.00 10.00 ? 472  ASN C C   1 
ATOM   3722  O  O   . ASN B  2  360 ? 11.607  6.928   2.584   1.00 5.44  ? 472  ASN C O   1 
ATOM   3723  C  CB  . ASN B  2  360 ? 10.701  9.945   2.841   1.00 10.70 ? 472  ASN C CB  1 
ATOM   3724  C  CG  . ASN B  2  360 ? 11.246  11.341  2.966   1.00 10.24 ? 472  ASN C CG  1 
ATOM   3725  O  OD1 . ASN B  2  360 ? 12.408  11.586  2.752   1.00 10.65 ? 472  ASN C OD1 1 
ATOM   3726  N  ND2 . ASN B  2  360 ? 10.389  12.267  3.339   1.00 14.40 ? 472  ASN C ND2 1 
ATOM   3727  N  N   . ASN B  2  361 ? 9.803   7.158   1.208   1.00 6.12  ? 473  ASN C N   1 
ATOM   3728  C  CA  . ASN B  2  361 ? 9.322   5.790   1.401   1.00 8.71  ? 473  ASN C CA  1 
ATOM   3729  C  C   . ASN B  2  361 ? 9.707   4.850   0.266   1.00 7.61  ? 473  ASN C C   1 
ATOM   3730  O  O   . ASN B  2  361 ? 9.421   3.649   0.348   1.00 10.01 ? 473  ASN C O   1 
ATOM   3731  C  CB  . ASN B  2  361 ? 7.779   5.758   1.598   1.00 7.90  ? 473  ASN C CB  1 
ATOM   3732  C  CG  . ASN B  2  361 ? 7.302   6.275   2.971   1.00 9.01  ? 473  ASN C CG  1 
ATOM   3733  O  OD1 . ASN B  2  361 ? 8.067   6.852   3.740   1.00 6.41  ? 473  ASN C OD1 1 
ATOM   3734  N  ND2 . ASN B  2  361 ? 6.015   6.073   3.278   1.00 5.45  ? 473  ASN C ND2 1 
ATOM   3735  N  N   . ILE B  2  362 ? 10.311  5.360   -0.806  1.00 6.84  ? 474  ILE C N   1 
ATOM   3736  C  CA  . ILE B  2  362 ? 10.727  4.453   -1.866  1.00 5.74  ? 474  ILE C CA  1 
ATOM   3737  C  C   . ILE B  2  362 ? 11.765  3.458   -1.277  1.00 6.80  ? 474  ILE C C   1 
ATOM   3738  O  O   . ILE B  2  362 ? 12.705  3.870   -0.580  1.00 2.82  ? 474  ILE C O   1 
ATOM   3739  C  CB  . ILE B  2  362 ? 11.345  5.200   -3.088  1.00 6.61  ? 474  ILE C CB  1 
ATOM   3740  C  CG1 . ILE B  2  362 ? 10.398  6.299   -3.597  1.00 4.97  ? 474  ILE C CG1 1 
ATOM   3741  C  CG2 . ILE B  2  362 ? 11.616  4.210   -4.209  1.00 6.01  ? 474  ILE C CG2 1 
ATOM   3742  C  CD1 . ILE B  2  362 ? 10.989  7.162   -4.686  1.00 2.00  ? 474  ILE C CD1 1 
ATOM   3743  N  N   . ASP B  2  363 ? 11.533  2.145   -1.491  1.00 5.61  ? 475  ASP C N   1 
ATOM   3744  C  CA  . ASP B  2  363 ? 12.464  1.092   -1.011  1.00 6.85  ? 475  ASP C CA  1 
ATOM   3745  C  C   . ASP B  2  363 ? 13.838  1.239   -1.707  1.00 3.34  ? 475  ASP C C   1 
ATOM   3746  O  O   . ASP B  2  363 ? 13.928  1.581   -2.887  1.00 2.00  ? 475  ASP C O   1 
ATOM   3747  C  CB  . ASP B  2  363 ? 11.895  -0.310  -1.258  1.00 2.90  ? 475  ASP C CB  1 
ATOM   3748  C  CG  . ASP B  2  363 ? 10.496  -0.467  -0.692  1.00 6.13  ? 475  ASP C CG  1 
ATOM   3749  O  OD1 . ASP B  2  363 ? 9.558   -0.630  -1.485  1.00 5.27  ? 475  ASP C OD1 1 
ATOM   3750  O  OD2 . ASP B  2  363 ? 10.329  -0.413  0.536   1.00 4.75  ? 475  ASP C OD2 1 
ATOM   3751  N  N   . ILE B  2  364 ? 14.890  0.981   -0.950  1.00 6.41  ? 476  ILE C N   1 
ATOM   3752  C  CA  . ILE B  2  364 ? 16.245  1.185   -1.416  1.00 3.36  ? 476  ILE C CA  1 
ATOM   3753  C  C   . ILE B  2  364 ? 16.542  0.525   -2.759  1.00 4.25  ? 476  ILE C C   1 
ATOM   3754  O  O   . ILE B  2  364 ? 17.115  1.182   -3.628  1.00 3.38  ? 476  ILE C O   1 
ATOM   3755  C  CB  . ILE B  2  364 ? 17.272  0.755   -0.346  1.00 5.80  ? 476  ILE C CB  1 
ATOM   3756  C  CG1 . ILE B  2  364 ? 18.711  1.082   -0.849  1.00 5.70  ? 476  ILE C CG1 1 
ATOM   3757  C  CG2 . ILE B  2  364 ? 17.119  -0.734  -0.014  1.00 3.23  ? 476  ILE C CG2 1 
ATOM   3758  C  CD1 . ILE B  2  364 ? 18.936  2.539   -1.218  1.00 3.32  ? 476  ILE C CD1 1 
ATOM   3759  N  N   . TRP B  2  365 ? 16.165  -0.759  -2.960  1.00 4.20  ? 477  TRP C N   1 
ATOM   3760  C  CA  . TRP B  2  365 ? 16.434  -1.374  -4.270  1.00 4.90  ? 477  TRP C CA  1 
ATOM   3761  C  C   . TRP B  2  365 ? 15.725  -0.624  -5.394  1.00 3.30  ? 477  TRP C C   1 
ATOM   3762  O  O   . TRP B  2  365 ? 16.316  -0.332  -6.412  1.00 2.52  ? 477  TRP C O   1 
ATOM   3763  C  CB  . TRP B  2  365 ? 16.018  -2.856  -4.335  1.00 4.66  ? 477  TRP C CB  1 
ATOM   3764  C  CG  . TRP B  2  365 ? 16.292  -3.520  -5.673  1.00 5.47  ? 477  TRP C CG  1 
ATOM   3765  C  CD1 . TRP B  2  365 ? 17.456  -4.123  -6.079  1.00 4.47  ? 477  TRP C CD1 1 
ATOM   3766  C  CD2 . TRP B  2  365 ? 15.380  -3.652  -6.782  1.00 5.53  ? 477  TRP C CD2 1 
ATOM   3767  N  NE1 . TRP B  2  365 ? 17.324  -4.616  -7.361  1.00 4.84  ? 477  TRP C NE1 1 
ATOM   3768  C  CE2 . TRP B  2  365 ? 16.065  -4.346  -7.811  1.00 2.37  ? 477  TRP C CE2 1 
ATOM   3769  C  CE3 . TRP B  2  365 ? 14.043  -3.260  -7.007  1.00 6.87  ? 477  TRP C CE3 1 
ATOM   3770  C  CZ2 . TRP B  2  365 ? 15.469  -4.648  -9.030  1.00 3.86  ? 477  TRP C CZ2 1 
ATOM   3771  C  CZ3 . TRP B  2  365 ? 13.452  -3.573  -8.237  1.00 6.04  ? 477  TRP C CZ3 1 
ATOM   3772  C  CH2 . TRP B  2  365 ? 14.165  -4.261  -9.226  1.00 2.58  ? 477  TRP C CH2 1 
ATOM   3773  N  N   . MET B  2  366 ? 14.454  -0.316  -5.183  1.00 4.85  ? 478  MET C N   1 
ATOM   3774  C  CA  . MET B  2  366 ? 13.626  0.319   -6.212  1.00 4.70  ? 478  MET C CA  1 
ATOM   3775  C  C   . MET B  2  366 ? 14.197  1.704   -6.577  1.00 3.26  ? 478  MET C C   1 
ATOM   3776  O  O   . MET B  2  366 ? 14.449  1.983   -7.728  1.00 2.10  ? 478  MET C O   1 
ATOM   3777  C  CB  . MET B  2  366 ? 12.156  0.406   -5.709  1.00 5.28  ? 478  MET C CB  1 
ATOM   3778  C  CG  . MET B  2  366 ? 11.124  0.828   -6.774  1.00 4.35  ? 478  MET C CG  1 
ATOM   3779  S  SD  . MET B  2  366 ? 10.839  -0.445  -8.009  1.00 6.28  ? 478  MET C SD  1 
ATOM   3780  C  CE  . MET B  2  366 ? 11.908  0.054   -9.346  1.00 2.56  ? 478  MET C CE  1 
ATOM   3781  N  N   . GLY B  2  367 ? 14.423  2.542   -5.572  1.00 3.33  ? 479  GLY C N   1 
ATOM   3782  C  CA  . GLY B  2  367 ? 15.011  3.847   -5.828  1.00 3.93  ? 479  GLY C CA  1 
ATOM   3783  C  C   . GLY B  2  367 ? 16.387  3.720   -6.470  1.00 4.01  ? 479  GLY C C   1 
ATOM   3784  O  O   . GLY B  2  367 ? 16.687  4.412   -7.434  1.00 2.71  ? 479  GLY C O   1 
ATOM   3785  N  N   . GLY B  2  368 ? 17.219  2.805   -5.917  1.00 5.96  ? 480  GLY C N   1 
ATOM   3786  C  CA  . GLY B  2  368 ? 18.568  2.589   -6.425  1.00 2.16  ? 480  GLY C CA  1 
ATOM   3787  C  C   . GLY B  2  368 ? 18.577  2.225   -7.895  1.00 2.96  ? 480  GLY C C   1 
ATOM   3788  O  O   . GLY B  2  368 ? 19.279  2.845   -8.668  1.00 4.73  ? 480  GLY C O   1 
ATOM   3789  N  N   . VAL B  2  369 ? 17.780  1.226   -8.319  1.00 2.60  ? 481  VAL C N   1 
ATOM   3790  C  CA  . VAL B  2  369 ? 17.826  0.837   -9.732  1.00 2.00  ? 481  VAL C CA  1 
ATOM   3791  C  C   . VAL B  2  369 ? 17.090  1.792   -10.647 1.00 2.00  ? 481  VAL C C   1 
ATOM   3792  O  O   . VAL B  2  369 ? 17.264  1.715   -11.849 1.00 2.57  ? 481  VAL C O   1 
ATOM   3793  C  CB  . VAL B  2  369 ? 17.340  -0.629  -9.993  1.00 2.42  ? 481  VAL C CB  1 
ATOM   3794  C  CG1 . VAL B  2  369 ? 18.173  -1.585  -9.152  1.00 2.00  ? 481  VAL C CG1 1 
ATOM   3795  C  CG2 . VAL B  2  369 ? 15.840  -0.806  -9.691  1.00 2.00  ? 481  VAL C CG2 1 
ATOM   3796  N  N   . SER B  2  370 ? 16.287  2.693   -10.090 1.00 2.00  ? 482  SER C N   1 
ATOM   3797  C  CA  . SER B  2  370 ? 15.559  3.700   -10.904 1.00 4.53  ? 482  SER C CA  1 
ATOM   3798  C  C   . SER B  2  370 ? 16.470  4.820   -11.396 1.00 4.83  ? 482  SER C C   1 
ATOM   3799  O  O   . SER B  2  370 ? 16.228  5.404   -12.460 1.00 2.13  ? 482  SER C O   1 
ATOM   3800  C  CB  . SER B  2  370 ? 14.412  4.329   -10.106 1.00 4.23  ? 482  SER C CB  1 
ATOM   3801  O  OG  . SER B  2  370 ? 13.345  3.413   -9.958  1.00 6.04  ? 482  SER C OG  1 
ATOM   3802  N  N   . GLU B  2  371 ? 17.526  5.113   -10.605 1.00 4.74  ? 483  GLU C N   1 
ATOM   3803  C  CA  . GLU B  2  371 ? 18.426  6.197   -10.934 1.00 5.71  ? 483  GLU C CA  1 
ATOM   3804  C  C   . GLU B  2  371 ? 19.169  5.957   -12.247 1.00 7.18  ? 483  GLU C C   1 
ATOM   3805  O  O   . GLU B  2  371 ? 19.546  4.810   -12.577 1.00 5.54  ? 483  GLU C O   1 
ATOM   3806  C  CB  . GLU B  2  371 ? 19.450  6.424   -9.814  1.00 3.05  ? 483  GLU C CB  1 
ATOM   3807  C  CG  . GLU B  2  371 ? 18.868  6.906   -8.477  1.00 8.09  ? 483  GLU C CG  1 
ATOM   3808  C  CD  . GLU B  2  371 ? 19.943  7.362   -7.441  1.00 7.31  ? 483  GLU C CD  1 
ATOM   3809  O  OE1 . GLU B  2  371 ? 19.568  8.010   -6.420  1.00 4.38  ? 483  GLU C OE1 1 
ATOM   3810  O  OE2 . GLU B  2  371 ? 21.159  7.064   -7.653  1.00 7.51  ? 483  GLU C OE2 1 
ATOM   3811  N  N   . PRO B  2  372 ? 19.352  7.038   -13.045 1.00 6.73  ? 484  PRO C N   1 
ATOM   3812  C  CA  . PRO B  2  372 ? 20.075  6.954   -14.304 1.00 7.91  ? 484  PRO C CA  1 
ATOM   3813  C  C   . PRO B  2  372 ? 21.538  6.472   -14.048 1.00 7.64  ? 484  PRO C C   1 
ATOM   3814  O  O   . PRO B  2  372 ? 22.172  6.862   -13.074 1.00 4.45  ? 484  PRO C O   1 
ATOM   3815  C  CB  . PRO B  2  372 ? 19.957  8.375   -14.863 1.00 7.59  ? 484  PRO C CB  1 
ATOM   3816  C  CG  . PRO B  2  372 ? 19.699  9.223   -13.675 1.00 8.62  ? 484  PRO C CG  1 
ATOM   3817  C  CD  . PRO B  2  372 ? 18.808  8.396   -12.817 1.00 7.50  ? 484  PRO C CD  1 
ATOM   3818  N  N   . LEU B  2  373 ? 22.023  5.578   -14.898 1.00 8.94  ? 485  LEU C N   1 
ATOM   3819  C  CA  . LEU B  2  373 ? 23.330  4.961   -14.701 1.00 9.93  ? 485  LEU C CA  1 
ATOM   3820  C  C   . LEU B  2  373 ? 24.475  5.947   -14.885 1.00 8.35  ? 485  LEU C C   1 
ATOM   3821  O  O   . LEU B  2  373 ? 24.425  6.798   -15.752 1.00 9.88  ? 485  LEU C O   1 
ATOM   3822  C  CB  . LEU B  2  373 ? 23.522  3.765   -15.662 1.00 8.73  ? 485  LEU C CB  1 
ATOM   3823  C  CG  . LEU B  2  373 ? 22.412  2.694   -15.690 1.00 7.46  ? 485  LEU C CG  1 
ATOM   3824  C  CD1 . LEU B  2  373 ? 22.909  1.450   -16.427 1.00 6.14  ? 485  LEU C CD1 1 
ATOM   3825  C  CD2 . LEU B  2  373 ? 21.974  2.347   -14.271 1.00 4.86  ? 485  LEU C CD2 1 
ATOM   3826  N  N   . LYS B  2  374 ? 25.502  5.836   -14.052 1.00 9.58  ? 486  LYS C N   1 
ATOM   3827  C  CA  . LYS B  2  374 ? 26.684  6.690   -14.214 1.00 12.09 ? 486  LYS C CA  1 
ATOM   3828  C  C   . LYS B  2  374 ? 27.423  6.340   -15.511 1.00 8.74  ? 486  LYS C C   1 
ATOM   3829  O  O   . LYS B  2  374 ? 27.308  5.229   -16.003 1.00 5.83  ? 486  LYS C O   1 
ATOM   3830  C  CB  . LYS B  2  374 ? 27.629  6.588   -12.990 1.00 14.20 ? 486  LYS C CB  1 
ATOM   3831  C  CG  . LYS B  2  374 ? 27.009  7.206   -11.729 1.00 18.13 ? 486  LYS C CG  1 
ATOM   3832  C  CD  . LYS B  2  374 ? 27.941  7.171   -10.517 1.00 21.82 ? 486  LYS C CD  1 
ATOM   3833  C  CE  . LYS B  2  374 ? 28.425  8.569   -10.120 1.00 23.54 ? 486  LYS C CE  1 
ATOM   3834  N  NZ  . LYS B  2  374 ? 29.436  9.117   -11.076 1.00 23.48 ? 486  LYS C NZ  1 
ATOM   3835  N  N   . ARG B  2  375 ? 28.124  7.325   -16.072 1.00 8.98  ? 487  ARG C N   1 
ATOM   3836  C  CA  . ARG B  2  375 ? 28.888  7.157   -17.310 1.00 10.45 ? 487  ARG C CA  1 
ATOM   3837  C  C   . ARG B  2  375 ? 29.907  5.989   -17.190 1.00 11.75 ? 487  ARG C C   1 
ATOM   3838  O  O   . ARG B  2  375 ? 30.783  5.984   -16.297 1.00 10.50 ? 487  ARG C O   1 
ATOM   3839  C  CB  . ARG B  2  375 ? 29.597  8.484   -17.660 1.00 7.95  ? 487  ARG C CB  1 
ATOM   3840  C  CG  . ARG B  2  375 ? 30.604  8.387   -18.792 1.00 9.53  ? 487  ARG C CG  1 
ATOM   3841  C  CD  . ARG B  2  375 ? 31.340  9.712   -19.005 1.00 14.88 ? 487  ARG C CD  1 
ATOM   3842  N  NE  . ARG B  2  375 ? 32.048  10.185  -17.794 1.00 21.05 ? 487  ARG C NE  1 
ATOM   3843  C  CZ  . ARG B  2  375 ? 33.386  10.177  -17.608 1.00 21.58 ? 487  ARG C CZ  1 
ATOM   3844  N  NH1 . ARG B  2  375 ? 34.191  9.725   -18.566 1.00 24.19 ? 487  ARG C NH1 1 
ATOM   3845  N  NH2 . ARG B  2  375 ? 33.910  10.628  -16.469 1.00 20.27 ? 487  ARG C NH2 1 
ATOM   3846  N  N   . LYS B  2  376 ? 29.743  4.991   -18.103 1.00 12.08 ? 488  LYS C N   1 
ATOM   3847  C  CA  . LYS B  2  376 ? 30.567  3.771   -18.167 1.00 11.96 ? 488  LYS C CA  1 
ATOM   3848  C  C   . LYS B  2  376 ? 30.425  2.878   -16.895 1.00 12.11 ? 488  LYS C C   1 
ATOM   3849  O  O   . LYS B  2  376 ? 31.251  1.976   -16.633 1.00 10.26 ? 488  LYS C O   1 
ATOM   3850  C  CB  . LYS B  2  376 ? 32.033  4.157   -18.465 1.00 12.71 ? 488  LYS C CB  1 
ATOM   3851  C  CG  . LYS B  2  376 ? 32.195  4.632   -19.898 1.00 17.12 ? 488  LYS C CG  1 
ATOM   3852  C  CD  . LYS B  2  376 ? 33.637  4.931   -20.279 1.00 21.64 ? 488  LYS C CD  1 
ATOM   3853  C  CE  . LYS B  2  376 ? 33.732  5.197   -21.782 1.00 23.66 ? 488  LYS C CE  1 
ATOM   3854  N  NZ  . LYS B  2  376 ? 35.142  5.314   -22.250 1.00 25.88 ? 488  LYS C NZ  1 
ATOM   3855  N  N   . GLY B  2  377 ? 29.362  3.162   -16.110 1.00 8.58  ? 489  GLY C N   1 
ATOM   3856  C  CA  . GLY B  2  377 ? 28.992  2.369   -14.961 1.00 7.57  ? 489  GLY C CA  1 
ATOM   3857  C  C   . GLY B  2  377 ? 27.621  1.724   -15.198 1.00 9.83  ? 489  GLY C C   1 
ATOM   3858  O  O   . GLY B  2  377 ? 26.923  2.033   -16.195 1.00 8.19  ? 489  GLY C O   1 
ATOM   3859  N  N   . ARG B  2  378 ? 27.205  0.824   -14.323 1.00 7.35  ? 490  ARG C N   1 
ATOM   3860  C  CA  . ARG B  2  378 ? 25.910  0.193   -14.530 1.00 6.84  ? 490  ARG C CA  1 
ATOM   3861  C  C   . ARG B  2  378 ? 24.994  0.387   -13.311 1.00 7.33  ? 490  ARG C C   1 
ATOM   3862  O  O   . ARG B  2  378 ? 24.001  -0.337  -13.132 1.00 8.14  ? 490  ARG C O   1 
ATOM   3863  C  CB  . ARG B  2  378 ? 26.081  -1.296  -14.936 1.00 2.29  ? 490  ARG C CB  1 
ATOM   3864  C  CG  . ARG B  2  378 ? 26.663  -1.512  -16.341 1.00 2.00  ? 490  ARG C CG  1 
ATOM   3865  C  CD  . ARG B  2  378 ? 25.808  -0.807  -17.393 1.00 3.73  ? 490  ARG C CD  1 
ATOM   3866  N  NE  . ARG B  2  378 ? 26.264  -0.988  -18.789 1.00 5.20  ? 490  ARG C NE  1 
ATOM   3867  C  CZ  . ARG B  2  378 ? 27.010  -0.116  -19.488 1.00 3.38  ? 490  ARG C CZ  1 
ATOM   3868  N  NH1 . ARG B  2  378 ? 27.460  1.001   -18.932 1.00 4.49  ? 490  ARG C NH1 1 
ATOM   3869  N  NH2 . ARG B  2  378 ? 27.321  -0.374  -20.746 1.00 5.83  ? 490  ARG C NH2 1 
ATOM   3870  N  N   . VAL B  2  379 ? 25.344  1.384   -12.481 1.00 3.94  ? 491  VAL C N   1 
ATOM   3871  C  CA  . VAL B  2  379 ? 24.526  1.808   -11.360 1.00 5.76  ? 491  VAL C CA  1 
ATOM   3872  C  C   . VAL B  2  379 ? 24.516  3.316   -11.300 1.00 5.15  ? 491  VAL C C   1 
ATOM   3873  O  O   . VAL B  2  379 ? 25.397  3.966   -11.833 1.00 9.24  ? 491  VAL C O   1 
ATOM   3874  C  CB  . VAL B  2  379 ? 25.042  1.270   -10.002 1.00 6.86  ? 491  VAL C CB  1 
ATOM   3875  C  CG1 . VAL B  2  379 ? 25.070  -0.248  -10.030 1.00 6.44  ? 491  VAL C CG1 1 
ATOM   3876  C  CG2 . VAL B  2  379 ? 26.410  1.848   -9.663  1.00 6.37  ? 491  VAL C CG2 1 
ATOM   3877  N  N   . GLY B  2  380 ? 23.522  3.865   -10.663 1.00 7.67  ? 492  GLY C N   1 
ATOM   3878  C  CA  . GLY B  2  380 ? 23.465  5.307   -10.474 1.00 7.44  ? 492  GLY C CA  1 
ATOM   3879  C  C   . GLY B  2  380 ? 24.277  5.760   -9.253  1.00 8.49  ? 492  GLY C C   1 
ATOM   3880  O  O   . GLY B  2  380 ? 24.952  4.941   -8.625  1.00 5.89  ? 492  GLY C O   1 
ATOM   3881  N  N   . PRO B  2  381 ? 24.223  7.068   -8.883  1.00 8.26  ? 493  PRO C N   1 
ATOM   3882  C  CA  . PRO B  2  381 ? 24.973  7.631   -7.727  1.00 6.15  ? 493  PRO C CA  1 
ATOM   3883  C  C   . PRO B  2  381 ? 24.701  6.942   -6.376  1.00 4.30  ? 493  PRO C C   1 
ATOM   3884  O  O   . PRO B  2  381 ? 25.638  6.681   -5.597  1.00 3.08  ? 493  PRO C O   1 
ATOM   3885  C  CB  . PRO B  2  381 ? 24.540  9.089   -7.709  1.00 4.34  ? 493  PRO C CB  1 
ATOM   3886  C  CG  . PRO B  2  381 ? 24.211  9.348   -9.138  1.00 8.25  ? 493  PRO C CG  1 
ATOM   3887  C  CD  . PRO B  2  381 ? 23.469  8.134   -9.587  1.00 6.52  ? 493  PRO C CD  1 
ATOM   3888  N  N   . LEU B  2  382 ? 23.430  6.665   -6.073  1.00 3.60  ? 494  LEU C N   1 
ATOM   3889  C  CA  . LEU B  2  382 ? 23.103  6.055   -4.789  1.00 5.98  ? 494  LEU C CA  1 
ATOM   3890  C  C   . LEU B  2  382 ? 23.695  4.651   -4.637  1.00 5.97  ? 494  LEU C C   1 
ATOM   3891  O  O   . LEU B  2  382 ? 24.373  4.363   -3.635  1.00 6.35  ? 494  LEU C O   1 
ATOM   3892  C  CB  . LEU B  2  382 ? 21.598  6.007   -4.547  1.00 2.00  ? 494  LEU C CB  1 
ATOM   3893  C  CG  . LEU B  2  382 ? 21.199  5.426   -3.213  1.00 3.13  ? 494  LEU C CG  1 
ATOM   3894  C  CD1 . LEU B  2  382 ? 21.929  6.162   -2.085  1.00 2.00  ? 494  LEU C CD1 1 
ATOM   3895  C  CD2 . LEU B  2  382 ? 19.693  5.522   -3.047  1.00 5.69  ? 494  LEU C CD2 1 
ATOM   3896  N  N   . LEU B  2  383 ? 23.467  3.793   -5.619  1.00 4.51  ? 495  LEU C N   1 
ATOM   3897  C  CA  . LEU B  2  383 ? 24.024  2.467   -5.555  1.00 6.28  ? 495  LEU C CA  1 
ATOM   3898  C  C   . LEU B  2  383 ? 25.553  2.517   -5.614  1.00 6.34  ? 495  LEU C C   1 
ATOM   3899  O  O   . LEU B  2  383 ? 26.210  1.702   -4.983  1.00 6.49  ? 495  LEU C O   1 
ATOM   3900  C  CB  . LEU B  2  383 ? 23.488  1.607   -6.682  1.00 6.18  ? 495  LEU C CB  1 
ATOM   3901  C  CG  . LEU B  2  383 ? 21.963  1.345   -6.691  1.00 8.46  ? 495  LEU C CG  1 
ATOM   3902  C  CD1 . LEU B  2  383 ? 21.560  0.614   -7.965  1.00 5.91  ? 495  LEU C CD1 1 
ATOM   3903  C  CD2 . LEU B  2  383 ? 21.545  0.555   -5.448  1.00 11.27 ? 495  LEU C CD2 1 
ATOM   3904  N  N   . ALA B  2  384 ? 26.115  3.473   -6.379  1.00 6.18  ? 496  ALA C N   1 
ATOM   3905  C  CA  . ALA B  2  384 ? 27.571  3.628   -6.469  1.00 5.96  ? 496  ALA C CA  1 
ATOM   3906  C  C   . ALA B  2  384 ? 28.157  3.900   -5.091  1.00 5.79  ? 496  ALA C C   1 
ATOM   3907  O  O   . ALA B  2  384 ? 29.147  3.301   -4.699  1.00 4.72  ? 496  ALA C O   1 
ATOM   3908  C  CB  . ALA B  2  384 ? 27.939  4.766   -7.409  1.00 3.57  ? 496  ALA C CB  1 
ATOM   3909  N  N   . CYS B  2  385 ? 27.524  4.802   -4.359  1.00 6.12  ? 497  CYS C N   1 
ATOM   3910  C  CA  . CYS B  2  385 ? 27.960  5.159   -3.021  1.00 6.54  ? 497  CYS C CA  1 
ATOM   3911  C  C   . CYS B  2  385 ? 27.935  3.972   -2.087  1.00 6.15  ? 497  CYS C C   1 
ATOM   3912  O  O   . CYS B  2  385 ? 28.908  3.696   -1.411  1.00 5.91  ? 497  CYS C O   1 
ATOM   3913  C  CB  . CYS B  2  385 ? 27.069  6.266   -2.454  1.00 7.39  ? 497  CYS C CB  1 
ATOM   3914  S  SG  . CYS B  2  385 ? 27.046  6.376   -0.632  1.00 8.13  ? 497  CYS C SG  1 
ATOM   3915  N  N   . ILE B  2  386 ? 26.816  3.281   -2.051  1.00 4.60  ? 498  ILE C N   1 
ATOM   3916  C  CA  . ILE B  2  386 ? 26.660  2.127   -1.185  1.00 5.40  ? 498  ILE C CA  1 
ATOM   3917  C  C   . ILE B  2  386 ? 27.602  0.960   -1.563  1.00 2.96  ? 498  ILE C C   1 
ATOM   3918  O  O   . ILE B  2  386 ? 28.218  0.357   -0.691  1.00 3.17  ? 498  ILE C O   1 
ATOM   3919  C  CB  . ILE B  2  386 ? 25.174  1.657   -1.191  1.00 5.00  ? 498  ILE C CB  1 
ATOM   3920  C  CG1 . ILE B  2  386 ? 24.306  2.788   -0.615  1.00 5.08  ? 498  ILE C CG1 1 
ATOM   3921  C  CG2 . ILE B  2  386 ? 24.997  0.364   -0.373  1.00 3.92  ? 498  ILE C CG2 1 
ATOM   3922  C  CD1 . ILE B  2  386 ? 22.818  2.596   -0.807  1.00 7.90  ? 498  ILE C CD1 1 
ATOM   3923  N  N   . ILE B  2  387 ? 27.694  0.653   -2.841  1.00 3.54  ? 499  ILE C N   1 
ATOM   3924  C  CA  . ILE B  2  387 ? 28.526  -0.459  -3.309  1.00 4.51  ? 499  ILE C CA  1 
ATOM   3925  C  C   . ILE B  2  387 ? 30.009  -0.126  -3.218  1.00 5.60  ? 499  ILE C C   1 
ATOM   3926  O  O   . ILE B  2  387 ? 30.800  -0.938  -2.745  1.00 3.97  ? 499  ILE C O   1 
ATOM   3927  C  CB  . ILE B  2  387 ? 28.153  -0.846  -4.750  1.00 5.65  ? 499  ILE C CB  1 
ATOM   3928  C  CG1 . ILE B  2  387 ? 26.705  -1.378  -4.754  1.00 5.15  ? 499  ILE C CG1 1 
ATOM   3929  C  CG2 . ILE B  2  387 ? 29.122  -1.886  -5.295  1.00 2.00  ? 499  ILE C CG2 1 
ATOM   3930  C  CD1 . ILE B  2  387 ? 26.111  -1.577  -6.134  1.00 4.62  ? 499  ILE C CD1 1 
ATOM   3931  N  N   . GLY B  2  388 ? 30.364  1.063   -3.661  1.00 5.25  ? 500  GLY C N   1 
ATOM   3932  C  CA  . GLY B  2  388 ? 31.749  1.504   -3.564  1.00 7.90  ? 500  GLY C CA  1 
ATOM   3933  C  C   . GLY B  2  388 ? 32.227  1.625   -2.115  1.00 8.33  ? 500  GLY C C   1 
ATOM   3934  O  O   . GLY B  2  388 ? 33.386  1.322   -1.824  1.00 9.18  ? 500  GLY C O   1 
ATOM   3935  N  N   . THR B  2  389 ? 31.336  2.065   -1.207  1.00 6.24  ? 501  THR C N   1 
ATOM   3936  C  CA  . THR B  2  389 ? 31.678  2.195   0.212   1.00 6.65  ? 501  THR C CA  1 
ATOM   3937  C  C   . THR B  2  389 ? 31.915  0.825   0.843   1.00 6.43  ? 501  THR C C   1 
ATOM   3938  O  O   . THR B  2  389 ? 32.854  0.644   1.621   1.00 5.75  ? 501  THR C O   1 
ATOM   3939  C  CB  . THR B  2  389 ? 30.586  2.966   1.026   1.00 6.28  ? 501  THR C CB  1 
ATOM   3940  O  OG1 . THR B  2  389 ? 30.495  4.302   0.523   1.00 4.76  ? 501  THR C OG1 1 
ATOM   3941  C  CG2 . THR B  2  389 ? 30.925  3.028   2.518   1.00 5.60  ? 501  THR C CG2 1 
ATOM   3942  N  N   . GLN B  2  390 ? 31.095  -0.140  0.469   1.00 4.91  ? 502  GLN C N   1 
ATOM   3943  C  CA  . GLN B  2  390 ? 31.234  -1.488  0.977   1.00 6.43  ? 502  GLN C CA  1 
ATOM   3944  C  C   . GLN B  2  390 ? 32.522  -2.167  0.515   1.00 5.23  ? 502  GLN C C   1 
ATOM   3945  O  O   . GLN B  2  390 ? 33.220  -2.776  1.340   1.00 2.72  ? 502  GLN C O   1 
ATOM   3946  C  CB  . GLN B  2  390 ? 30.038  -2.352  0.559   1.00 7.88  ? 502  GLN C CB  1 
ATOM   3947  C  CG  . GLN B  2  390 ? 30.094  -3.764  1.132   1.00 8.23  ? 502  GLN C CG  1 
ATOM   3948  C  CD  . GLN B  2  390 ? 29.938  -3.790  2.634   1.00 6.54  ? 502  GLN C CD  1 
ATOM   3949  O  OE1 . GLN B  2  390 ? 28.821  -3.711  3.152   1.00 3.71  ? 502  GLN C OE1 1 
ATOM   3950  N  NE2 . GLN B  2  390 ? 31.064  -3.904  3.341   1.00 3.47  ? 502  GLN C NE2 1 
ATOM   3951  N  N   . PHE B  2  391 ? 32.834  -2.085  -0.793  1.00 4.36  ? 503  PHE C N   1 
ATOM   3952  C  CA  . PHE B  2  391 ? 34.012  -2.763  -1.303  1.00 5.12  ? 503  PHE C CA  1 
ATOM   3953  C  C   . PHE B  2  391 ? 35.300  -2.117  -0.776  1.00 5.80  ? 503  PHE C C   1 
ATOM   3954  O  O   . PHE B  2  391 ? 36.292  -2.815  -0.581  1.00 7.05  ? 503  PHE C O   1 
ATOM   3955  C  CB  . PHE B  2  391 ? 34.011  -2.862  -2.843  1.00 3.49  ? 503  PHE C CB  1 
ATOM   3956  C  CG  . PHE B  2  391 ? 33.153  -4.008  -3.373  1.00 4.44  ? 503  PHE C CG  1 
ATOM   3957  C  CD1 . PHE B  2  391 ? 33.625  -5.327  -3.350  1.00 5.10  ? 503  PHE C CD1 1 
ATOM   3958  C  CD2 . PHE B  2  391 ? 31.844  -3.780  -3.829  1.00 3.74  ? 503  PHE C CD2 1 
ATOM   3959  C  CE1 . PHE B  2  391 ? 32.812  -6.387  -3.754  1.00 6.04  ? 503  PHE C CE1 1 
ATOM   3960  C  CE2 . PHE B  2  391 ? 31.024  -4.843  -4.244  1.00 4.85  ? 503  PHE C CE2 1 
ATOM   3961  C  CZ  . PHE B  2  391 ? 31.501  -6.140  -4.203  1.00 6.05  ? 503  PHE C CZ  1 
ATOM   3962  N  N   . ARG B  2  392 ? 35.274  -0.816  -0.480  1.00 4.48  ? 504  ARG C N   1 
ATOM   3963  C  CA  . ARG B  2  392 ? 36.488  -0.193  0.079   1.00 5.73  ? 504  ARG C CA  1 
ATOM   3964  C  C   . ARG B  2  392 ? 36.797  -0.762  1.464   1.00 5.84  ? 504  ARG C C   1 
ATOM   3965  O  O   . ARG B  2  392 ? 37.977  -1.051  1.803   1.00 5.71  ? 504  ARG C O   1 
ATOM   3966  C  CB  . ARG B  2  392 ? 36.396  1.329   0.179   1.00 4.45  ? 504  ARG C CB  1 
ATOM   3967  C  CG  . ARG B  2  392 ? 37.752  1.897   0.650   1.00 9.67  ? 504  ARG C CG  1 
ATOM   3968  C  CD  . ARG B  2  392 ? 37.779  3.393   0.743   1.00 12.53 ? 504  ARG C CD  1 
ATOM   3969  N  NE  . ARG B  2  392 ? 39.065  3.854   1.237   1.00 14.24 ? 504  ARG C NE  1 
ATOM   3970  C  CZ  . ARG B  2  392 ? 39.385  5.136   1.392   1.00 16.19 ? 504  ARG C CZ  1 
ATOM   3971  N  NH1 . ARG B  2  392 ? 38.508  6.077   1.122   1.00 15.80 ? 504  ARG C NH1 1 
ATOM   3972  N  NH2 . ARG B  2  392 ? 40.595  5.474   1.828   1.00 17.34 ? 504  ARG C NH2 1 
ATOM   3973  N  N   . LYS B  2  393 ? 35.752  -0.922  2.260   1.00 3.74  ? 505  LYS C N   1 
ATOM   3974  C  CA  . LYS B  2  393 ? 35.917  -1.461  3.581   1.00 5.27  ? 505  LYS C CA  1 
ATOM   3975  C  C   . LYS B  2  393 ? 36.332  -2.927  3.539   1.00 6.65  ? 505  LYS C C   1 
ATOM   3976  O  O   . LYS B  2  393 ? 37.059  -3.399  4.442   1.00 6.09  ? 505  LYS C O   1 
ATOM   3977  C  CB  . LYS B  2  393 ? 34.651  -1.284  4.374   1.00 7.35  ? 505  LYS C CB  1 
ATOM   3978  C  CG  . LYS B  2  393 ? 34.359  0.167   4.737   1.00 9.02  ? 505  LYS C CG  1 
ATOM   3979  C  CD  . LYS B  2  393 ? 32.855  0.354   4.931   1.00 13.01 ? 505  LYS C CD  1 
ATOM   3980  C  CE  . LYS B  2  393 ? 32.508  1.678   5.585   1.00 13.96 ? 505  LYS C CE  1 
ATOM   3981  N  NZ  . LYS B  2  393 ? 32.933  1.722   7.010   1.00 12.85 ? 505  LYS C NZ  1 
ATOM   3982  N  N   . LEU B  2  394 ? 35.907  -3.654  2.485   1.00 4.86  ? 506  LEU C N   1 
ATOM   3983  C  CA  . LEU B  2  394 ? 36.327  -5.056  2.343   1.00 7.61  ? 506  LEU C CA  1 
ATOM   3984  C  C   . LEU B  2  394 ? 37.826  -5.158  1.906   1.00 6.44  ? 506  LEU C C   1 
ATOM   3985  O  O   . LEU B  2  394 ? 38.529  -6.096  2.289   1.00 5.14  ? 506  LEU C O   1 
ATOM   3986  C  CB  . LEU B  2  394 ? 35.424  -5.833  1.361   1.00 4.20  ? 506  LEU C CB  1 
ATOM   3987  C  CG  . LEU B  2  394 ? 33.940  -6.000  1.745   1.00 7.64  ? 506  LEU C CG  1 
ATOM   3988  C  CD1 . LEU B  2  394 ? 33.208  -6.754  0.655   1.00 8.65  ? 506  LEU C CD1 1 
ATOM   3989  C  CD2 . LEU B  2  394 ? 33.801  -6.748  3.042   1.00 2.00  ? 506  LEU C CD2 1 
ATOM   3990  N  N   . ARG B  2  395 ? 38.291  -4.200  1.105   1.00 4.52  ? 507  ARG C N   1 
ATOM   3991  C  CA  . ARG B  2  395 ? 39.683  -4.179  0.707   1.00 4.72  ? 507  ARG C CA  1 
ATOM   3992  C  C   . ARG B  2  395 ? 40.560  -3.667  1.851   1.00 8.07  ? 507  ARG C C   1 
ATOM   3993  O  O   . ARG B  2  395 ? 41.528  -4.344  2.273   1.00 6.10  ? 507  ARG C O   1 
ATOM   3994  C  CB  . ARG B  2  395 ? 39.885  -3.263  -0.492  1.00 2.87  ? 507  ARG C CB  1 
ATOM   3995  C  CG  . ARG B  2  395 ? 41.339  -3.149  -0.938  1.00 2.98  ? 507  ARG C CG  1 
ATOM   3996  C  CD  . ARG B  2  395 ? 41.535  -2.033  -1.946  1.00 3.29  ? 507  ARG C CD  1 
ATOM   3997  N  NE  . ARG B  2  395 ? 41.379  -0.722  -1.333  1.00 4.07  ? 507  ARG C NE  1 
ATOM   3998  C  CZ  . ARG B  2  395 ? 41.518  0.437   -1.981  1.00 2.53  ? 507  ARG C CZ  1 
ATOM   3999  N  NH1 . ARG B  2  395 ? 41.775  0.454   -3.292  1.00 4.15  ? 507  ARG C NH1 1 
ATOM   4000  N  NH2 . ARG B  2  395 ? 41.399  1.577   -1.323  1.00 4.28  ? 507  ARG C NH2 1 
ATOM   4001  N  N   . ASP B  2  396 ? 40.214  -2.474  2.355   1.00 8.23  ? 508  ASP C N   1 
ATOM   4002  C  CA  . ASP B  2  396 ? 41.033  -1.793  3.342   1.00 9.18  ? 508  ASP C CA  1 
ATOM   4003  C  C   . ASP B  2  396 ? 41.058  -2.473  4.701   1.00 9.29  ? 508  ASP C C   1 
ATOM   4004  O  O   . ASP B  2  396 ? 42.102  -2.412  5.395   1.00 5.23  ? 508  ASP C O   1 
ATOM   4005  C  CB  . ASP B  2  396 ? 40.601  -0.328  3.472   1.00 10.18 ? 508  ASP C CB  1 
ATOM   4006  C  CG  . ASP B  2  396 ? 41.113  0.538   2.323   1.00 10.39 ? 508  ASP C CG  1 
ATOM   4007  O  OD1 . ASP B  2  396 ? 40.939  1.775   2.389   1.00 10.21 ? 508  ASP C OD1 1 
ATOM   4008  O  OD2 . ASP B  2  396 ? 41.681  -0.014  1.356   1.00 9.92  ? 508  ASP C OD2 1 
ATOM   4009  N  N   . GLY B  2  397 ? 39.939  -3.144  5.046   1.00 4.61  ? 509  GLY C N   1 
ATOM   4010  C  CA  . GLY B  2  397 ? 39.802  -3.802  6.318   1.00 3.70  ? 509  GLY C CA  1 
ATOM   4011  C  C   . GLY B  2  397 ? 40.144  -5.288  6.305   1.00 5.14  ? 509  GLY C C   1 
ATOM   4012  O  O   . GLY B  2  397 ? 39.771  -6.006  7.233   1.00 7.59  ? 509  GLY C O   1 
ATOM   4013  N  N   . ASP B  2  398 ? 40.872  -5.747  5.291   1.00 3.97  ? 510  ASP C N   1 
ATOM   4014  C  CA  . ASP B  2  398 ? 41.227  -7.163  5.167   1.00 4.96  ? 510  ASP C CA  1 
ATOM   4015  C  C   . ASP B  2  398 ? 42.714  -7.380  5.419   1.00 3.78  ? 510  ASP C C   1 
ATOM   4016  O  O   . ASP B  2  398 ? 43.545  -6.982  4.615   1.00 4.72  ? 510  ASP C O   1 
ATOM   4017  C  CB  . ASP B  2  398 ? 40.861  -7.667  3.753   1.00 4.01  ? 510  ASP C CB  1 
ATOM   4018  C  CG  . ASP B  2  398 ? 41.075  -9.187  3.514   1.00 4.93  ? 510  ASP C CG  1 
ATOM   4019  O  OD1 . ASP B  2  398 ? 40.939  -9.618  2.346   1.00 6.36  ? 510  ASP C OD1 1 
ATOM   4020  O  OD2 . ASP B  2  398 ? 41.378  -9.944  4.481   1.00 4.84  ? 510  ASP C OD2 1 
ATOM   4021  N  N   . ARG B  2  399 ? 43.041  -8.035  6.527   1.00 6.37  ? 511  ARG C N   1 
ATOM   4022  C  CA  . ARG B  2  399 ? 44.433  -8.303  6.864   1.00 6.25  ? 511  ARG C CA  1 
ATOM   4023  C  C   . ARG B  2  399 ? 45.071  -9.272  5.839   1.00 9.94  ? 511  ARG C C   1 
ATOM   4024  O  O   . ARG B  2  399 ? 46.318  -9.311  5.662   1.00 10.11 ? 511  ARG C O   1 
ATOM   4025  C  CB  . ARG B  2  399 ? 44.523  -8.854  8.285   1.00 5.60  ? 511  ARG C CB  1 
ATOM   4026  C  CG  . ARG B  2  399 ? 45.961  -9.061  8.774   1.00 4.16  ? 511  ARG C CG  1 
ATOM   4027  C  CD  . ARG B  2  399 ? 46.028  -9.139  10.290  1.00 4.19  ? 511  ARG C CD  1 
ATOM   4028  N  NE  . ARG B  2  399 ? 45.313  -10.280 10.846  1.00 6.69  ? 511  ARG C NE  1 
ATOM   4029  C  CZ  . ARG B  2  399 ? 45.726  -11.541 10.808  1.00 9.84  ? 511  ARG C CZ  1 
ATOM   4030  N  NH1 . ARG B  2  399 ? 46.868  -11.859 10.211  1.00 11.99 ? 511  ARG C NH1 1 
ATOM   4031  N  NH2 . ARG B  2  399 ? 44.998  -12.490 11.372  1.00 9.43  ? 511  ARG C NH2 1 
ATOM   4032  N  N   . PHE B  2  400 ? 44.204  -10.025 5.127   1.00 8.69  ? 512  PHE C N   1 
ATOM   4033  C  CA  . PHE B  2  400 ? 44.675  -10.944 4.109   1.00 7.57  ? 512  PHE C CA  1 
ATOM   4034  C  C   . PHE B  2  400 ? 44.452  -10.447 2.669   1.00 6.26  ? 512  PHE C C   1 
ATOM   4035  O  O   . PHE B  2  400 ? 44.482  -11.226 1.715   1.00 7.25  ? 512  PHE C O   1 
ATOM   4036  C  CB  . PHE B  2  400 ? 44.080  -12.320 4.372   1.00 5.60  ? 512  PHE C CB  1 
ATOM   4037  C  CG  . PHE B  2  400 ? 44.616  -12.891 5.670   1.00 8.39  ? 512  PHE C CG  1 
ATOM   4038  C  CD1 . PHE B  2  400 ? 43.865  -12.840 6.837   1.00 9.01  ? 512  PHE C CD1 1 
ATOM   4039  C  CD2 . PHE B  2  400 ? 45.891  -13.473 5.727   1.00 10.86 ? 512  PHE C CD2 1 
ATOM   4040  C  CE1 . PHE B  2  400 ? 44.365  -13.359 8.036   1.00 11.37 ? 512  PHE C CE1 1 
ATOM   4041  C  CE2 . PHE B  2  400 ? 46.402  -13.994 6.928   1.00 11.55 ? 512  PHE C CE2 1 
ATOM   4042  C  CZ  . PHE B  2  400 ? 45.635  -13.935 8.082   1.00 12.54 ? 512  PHE C CZ  1 
ATOM   4043  N  N   . TRP B  2  401 ? 44.264  -9.139  2.499   1.00 6.24  ? 513  TRP C N   1 
ATOM   4044  C  CA  . TRP B  2  401 ? 44.167  -8.561  1.143   1.00 7.75  ? 513  TRP C CA  1 
ATOM   4045  C  C   . TRP B  2  401 ? 45.440  -8.948  0.346   1.00 7.94  ? 513  TRP C C   1 
ATOM   4046  O  O   . TRP B  2  401 ? 46.554  -8.901  0.894   1.00 5.90  ? 513  TRP C O   1 
ATOM   4047  C  CB  . TRP B  2  401 ? 44.014  -7.017  1.204   1.00 7.04  ? 513  TRP C CB  1 
ATOM   4048  C  CG  . TRP B  2  401 ? 43.846  -6.394  -0.155  1.00 7.77  ? 513  TRP C CG  1 
ATOM   4049  C  CD1 . TRP B  2  401 ? 44.770  -5.664  -0.851  1.00 4.80  ? 513  TRP C CD1 1 
ATOM   4050  C  CD2 . TRP B  2  401 ? 42.719  -6.547  -1.020  1.00 6.89  ? 513  TRP C CD2 1 
ATOM   4051  N  NE1 . TRP B  2  401 ? 44.295  -5.361  -2.102  1.00 5.10  ? 513  TRP C NE1 1 
ATOM   4052  C  CE2 . TRP B  2  401 ? 43.034  -5.889  -2.234  1.00 8.72  ? 513  TRP C CE2 1 
ATOM   4053  C  CE3 . TRP B  2  401 ? 41.469  -7.185  -0.885  1.00 4.68  ? 513  TRP C CE3 1 
ATOM   4054  C  CZ2 . TRP B  2  401 ? 42.127  -5.850  -3.326  1.00 8.43  ? 513  TRP C CZ2 1 
ATOM   4055  C  CZ3 . TRP B  2  401 ? 40.580  -7.140  -1.969  1.00 4.38  ? 513  TRP C CZ3 1 
ATOM   4056  C  CH2 . TRP B  2  401 ? 40.911  -6.484  -3.164  1.00 4.27  ? 513  TRP C CH2 1 
ATOM   4057  N  N   . TRP B  2  402 ? 45.268  -9.311  -0.931  1.00 5.76  ? 514  TRP C N   1 
ATOM   4058  C  CA  . TRP B  2  402 ? 46.377  -9.846  -1.729  1.00 9.86  ? 514  TRP C CA  1 
ATOM   4059  C  C   . TRP B  2  402 ? 47.581  -8.912  -1.811  1.00 8.81  ? 514  TRP C C   1 
ATOM   4060  O  O   . TRP B  2  402 ? 48.716  -9.383  -1.856  1.00 6.76  ? 514  TRP C O   1 
ATOM   4061  C  CB  . TRP B  2  402 ? 45.921  -10.251 -3.150  1.00 8.57  ? 514  TRP C CB  1 
ATOM   4062  C  CG  . TRP B  2  402 ? 45.809  -9.134  -4.111  1.00 11.03 ? 514  TRP C CG  1 
ATOM   4063  C  CD1 . TRP B  2  402 ? 44.781  -8.256  -4.229  1.00 10.66 ? 514  TRP C CD1 1 
ATOM   4064  C  CD2 . TRP B  2  402 ? 46.783  -8.760  -5.087  1.00 11.88 ? 514  TRP C CD2 1 
ATOM   4065  N  NE1 . TRP B  2  402 ? 45.042  -7.342  -5.223  1.00 11.61 ? 514  TRP C NE1 1 
ATOM   4066  C  CE2 . TRP B  2  402 ? 46.268  -7.629  -5.774  1.00 12.99 ? 514  TRP C CE2 1 
ATOM   4067  C  CE3 . TRP B  2  402 ? 48.054  -9.266  -5.450  1.00 11.53 ? 514  TRP C CE3 1 
ATOM   4068  C  CZ2 . TRP B  2  402 ? 46.979  -6.990  -6.804  1.00 12.50 ? 514  TRP C CZ2 1 
ATOM   4069  C  CZ3 . TRP B  2  402 ? 48.761  -8.628  -6.467  1.00 11.30 ? 514  TRP C CZ3 1 
ATOM   4070  C  CH2 . TRP B  2  402 ? 48.221  -7.497  -7.135  1.00 12.90 ? 514  TRP C CH2 1 
ATOM   4071  N  N   . GLU B  2  403 ? 47.316  -7.604  -1.834  1.00 9.88  ? 515  GLU C N   1 
ATOM   4072  C  CA  . GLU B  2  403 ? 48.371  -6.599  -1.904  1.00 11.21 ? 515  GLU C CA  1 
ATOM   4073  C  C   . GLU B  2  403 ? 48.894  -6.153  -0.564  1.00 9.13  ? 515  GLU C C   1 
ATOM   4074  O  O   . GLU B  2  403 ? 49.803  -5.335  -0.523  1.00 10.51 ? 515  GLU C O   1 
ATOM   4075  C  CB  . GLU B  2  403 ? 47.891  -5.364  -2.634  1.00 15.35 ? 515  GLU C CB  1 
ATOM   4076  C  CG  . GLU B  2  403 ? 47.838  -5.557  -4.108  1.00 20.25 ? 515  GLU C CG  1 
ATOM   4077  C  CD  . GLU B  2  403 ? 47.303  -4.356  -4.827  1.00 26.37 ? 515  GLU C CD  1 
ATOM   4078  O  OE1 . GLU B  2  403 ? 48.092  -3.756  -5.589  1.00 28.17 ? 515  GLU C OE1 1 
ATOM   4079  O  OE2 . GLU B  2  403 ? 46.089  -4.026  -4.645  1.00 30.93 ? 515  GLU C OE2 1 
ATOM   4080  N  N   . ASN B  2  404 ? 48.321  -6.630  0.520   1.00 7.84  ? 516  ASN C N   1 
ATOM   4081  C  CA  . ASN B  2  404 ? 48.828  -6.228  1.825   1.00 8.91  ? 516  ASN C CA  1 
ATOM   4082  C  C   . ASN B  2  404 ? 50.260  -6.769  2.062   1.00 9.09  ? 516  ASN C C   1 
ATOM   4083  O  O   . ASN B  2  404 ? 50.555  -7.943  1.820   1.00 5.50  ? 516  ASN C O   1 
ATOM   4084  C  CB  . ASN B  2  404 ? 47.898  -6.686  2.972   1.00 7.22  ? 516  ASN C CB  1 
ATOM   4085  C  CG  . ASN B  2  404 ? 48.367  -6.152  4.330   1.00 6.56  ? 516  ASN C CG  1 
ATOM   4086  O  OD1 . ASN B  2  404 ? 48.911  -5.048  4.423   1.00 6.64  ? 516  ASN C OD1 1 
ATOM   4087  N  ND2 . ASN B  2  404 ? 48.159  -6.929  5.387   1.00 6.59  ? 516  ASN C ND2 1 
ATOM   4088  N  N   . GLU B  2  405 ? 51.133  -5.890  2.544   1.00 12.76 ? 517  GLU C N   1 
ATOM   4089  C  CA  . GLU B  2  405 ? 52.510  -6.262  2.842   1.00 15.20 ? 517  GLU C CA  1 
ATOM   4090  C  C   . GLU B  2  405 ? 52.550  -7.484  3.766   1.00 12.05 ? 517  GLU C C   1 
ATOM   4091  O  O   . GLU B  2  405 ? 51.849  -7.537  4.765   1.00 12.15 ? 517  GLU C O   1 
ATOM   4092  C  CB  . GLU B  2  405 ? 53.211  -5.068  3.504   1.00 21.06 ? 517  GLU C CB  1 
ATOM   4093  C  CG  . GLU B  2  405 ? 54.658  -5.316  3.926   1.00 31.48 ? 517  GLU C CG  1 
ATOM   4094  C  CD  . GLU B  2  405 ? 55.592  -5.662  2.763   1.00 40.04 ? 517  GLU C CD  1 
ATOM   4095  O  OE1 . GLU B  2  405 ? 55.269  -5.319  1.586   1.00 42.41 ? 517  GLU C OE1 1 
ATOM   4096  O  OE2 . GLU B  2  405 ? 56.662  -6.281  3.022   1.00 45.32 ? 517  GLU C OE2 1 
ATOM   4097  N  N   . GLY B  2  406 ? 53.362  -8.465  3.414   1.00 11.60 ? 518  GLY C N   1 
ATOM   4098  C  CA  . GLY B  2  406 ? 53.478  -9.653  4.237   1.00 11.49 ? 518  GLY C CA  1 
ATOM   4099  C  C   . GLY B  2  406 ? 52.564  -10.825 3.832   1.00 11.66 ? 518  GLY C C   1 
ATOM   4100  O  O   . GLY B  2  406 ? 52.740  -11.945 4.325   1.00 12.44 ? 518  GLY C O   1 
ATOM   4101  N  N   . VAL B  2  407 ? 51.581  -10.607 2.960   1.00 8.68  ? 519  VAL C N   1 
ATOM   4102  C  CA  . VAL B  2  407 ? 50.708  -11.724 2.564   1.00 7.59  ? 519  VAL C CA  1 
ATOM   4103  C  C   . VAL B  2  407 ? 51.351  -12.558 1.431   1.00 8.35  ? 519  VAL C C   1 
ATOM   4104  O  O   . VAL B  2  407 ? 51.497  -13.769 1.540   1.00 8.19  ? 519  VAL C O   1 
ATOM   4105  C  CB  . VAL B  2  407 ? 49.288  -11.203 2.167   1.00 9.05  ? 519  VAL C CB  1 
ATOM   4106  C  CG1 . VAL B  2  407 ? 48.348  -12.368 1.784   1.00 4.21  ? 519  VAL C CG1 1 
ATOM   4107  C  CG2 . VAL B  2  407 ? 48.702  -10.387 3.338   1.00 5.44  ? 519  VAL C CG2 1 
ATOM   4108  N  N   . PHE B  2  408 ? 51.737  -11.904 0.366   1.00 8.75  ? 520  PHE C N   1 
ATOM   4109  C  CA  . PHE B  2  408 ? 52.471  -12.512 -0.729  1.00 8.04  ? 520  PHE C CA  1 
ATOM   4110  C  C   . PHE B  2  408 ? 53.792  -11.776 -0.897  1.00 9.27  ? 520  PHE C C   1 
ATOM   4111  O  O   . PHE B  2  408 ? 53.927  -10.629 -0.491  1.00 9.57  ? 520  PHE C O   1 
ATOM   4112  C  CB  . PHE B  2  408 ? 51.699  -12.367 -2.053  1.00 10.27 ? 520  PHE C CB  1 
ATOM   4113  C  CG  . PHE B  2  408 ? 50.494  -13.243 -2.200  1.00 11.41 ? 520  PHE C CG  1 
ATOM   4114  C  CD1 . PHE B  2  408 ? 50.637  -14.607 -2.461  1.00 9.55  ? 520  PHE C CD1 1 
ATOM   4115  C  CD2 . PHE B  2  408 ? 49.214  -12.702 -2.132  1.00 10.66 ? 520  PHE C CD2 1 
ATOM   4116  C  CE1 . PHE B  2  408 ? 49.527  -15.418 -2.661  1.00 9.57  ? 520  PHE C CE1 1 
ATOM   4117  C  CE2 . PHE B  2  408 ? 48.094  -13.513 -2.329  1.00 9.19  ? 520  PHE C CE2 1 
ATOM   4118  C  CZ  . PHE B  2  408 ? 48.255  -14.870 -2.596  1.00 8.54  ? 520  PHE C CZ  1 
ATOM   4119  N  N   . SER B  2  409 ? 54.753  -12.418 -1.536  1.00 9.94  ? 521  SER C N   1 
ATOM   4120  C  CA  . SER B  2  409 ? 55.998  -11.748 -1.875  1.00 11.13 ? 521  SER C CA  1 
ATOM   4121  C  C   . SER B  2  409 ? 55.783  -10.816 -3.071  1.00 10.55 ? 521  SER C C   1 
ATOM   4122  O  O   . SER B  2  409 ? 54.767  -10.900 -3.772  1.00 7.99  ? 521  SER C O   1 
ATOM   4123  C  CB  . SER B  2  409 ? 57.101  -12.778 -2.212  1.00 8.66  ? 521  SER C CB  1 
ATOM   4124  O  OG  . SER B  2  409 ? 56.889  -13.410 -3.469  1.00 5.88  ? 521  SER C OG  1 
ATOM   4125  N  N   . MET B  2  410 ? 56.743  -9.940  -3.297  1.00 11.34 ? 522  MET C N   1 
ATOM   4126  C  CA  . MET B  2  410 ? 56.724  -9.045  -4.445  1.00 11.86 ? 522  MET C CA  1 
ATOM   4127  C  C   . MET B  2  410 ? 56.634  -9.836  -5.749  1.00 13.28 ? 522  MET C C   1 
ATOM   4128  O  O   . MET B  2  410 ? 55.812  -9.513  -6.632  1.00 10.79 ? 522  MET C O   1 
ATOM   4129  C  CB  . MET B  2  410 ? 57.988  -8.196  -4.447  1.00 16.59 ? 522  MET C CB  1 
ATOM   4130  C  CG  . MET B  2  410 ? 58.359  -7.603  -5.797  1.00 18.77 ? 522  MET C CG  1 
ATOM   4131  S  SD  . MET B  2  410 ? 59.835  -6.577  -5.684  1.00 27.68 ? 522  MET C SD  1 
ATOM   4132  C  CE  . MET B  2  410 ? 59.104  -5.093  -4.985  1.00 23.80 ? 522  MET C CE  1 
ATOM   4133  N  N   . GLN B  2  411 ? 57.486  -10.877 -5.873  1.00 10.77 ? 523  GLN C N   1 
ATOM   4134  C  CA  . GLN B  2  411 ? 57.488  -11.722 -7.072  1.00 12.53 ? 523  GLN C CA  1 
ATOM   4135  C  C   . GLN B  2  411 ? 56.160  -12.468 -7.212  1.00 9.81  ? 523  GLN C C   1 
ATOM   4136  O  O   . GLN B  2  411 ? 55.672  -12.691 -8.308  1.00 8.60  ? 523  GLN C O   1 
ATOM   4137  C  CB  . GLN B  2  411 ? 58.660  -12.710 -7.052  1.00 13.04 ? 523  GLN C CB  1 
ATOM   4138  C  CG  . GLN B  2  411 ? 59.207  -13.019 -5.675  1.00 21.27 ? 523  GLN C CG  1 
ATOM   4139  C  CD  . GLN B  2  411 ? 60.044  -11.883 -5.077  1.00 20.87 ? 523  GLN C CD  1 
ATOM   4140  O  OE1 . GLN B  2  411 ? 59.636  -11.237 -4.120  1.00 18.06 ? 523  GLN C OE1 1 
ATOM   4141  N  NE2 . GLN B  2  411 ? 61.228  -11.652 -5.635  1.00 25.54 ? 523  GLN C NE2 1 
ATOM   4142  N  N   . GLN B  2  412 ? 55.573  -12.838 -6.089  1.00 9.16  ? 524  GLN C N   1 
ATOM   4143  C  CA  . GLN B  2  412 ? 54.283  -13.484 -6.144  1.00 8.87  ? 524  GLN C CA  1 
ATOM   4144  C  C   . GLN B  2  412 ? 53.216  -12.499 -6.622  1.00 8.36  ? 524  GLN C C   1 
ATOM   4145  O  O   . GLN B  2  412 ? 52.375  -12.843 -7.459  1.00 8.95  ? 524  GLN C O   1 
ATOM   4146  C  CB  . GLN B  2  412 ? 53.929  -14.080 -4.785  1.00 6.14  ? 524  GLN C CB  1 
ATOM   4147  C  CG  . GLN B  2  412 ? 54.658  -15.383 -4.526  1.00 6.22  ? 524  GLN C CG  1 
ATOM   4148  C  CD  . GLN B  2  412 ? 54.287  -16.011 -3.222  1.00 7.81  ? 524  GLN C CD  1 
ATOM   4149  O  OE1 . GLN B  2  412 ? 54.108  -15.324 -2.198  1.00 6.81  ? 524  GLN C OE1 1 
ATOM   4150  N  NE2 . GLN B  2  412 ? 54.173  -17.334 -3.241  1.00 10.25 ? 524  GLN C NE2 1 
ATOM   4151  N  N   . ARG B  2  413 ? 53.284  -11.266 -6.121  1.00 8.20  ? 525  ARG C N   1 
ATOM   4152  C  CA  . ARG B  2  413 ? 52.332  -10.230 -6.520  1.00 9.44  ? 525  ARG C CA  1 
ATOM   4153  C  C   . ARG B  2  413 ? 52.421  -9.941  -7.991  1.00 11.04 ? 525  ARG C C   1 
ATOM   4154  O  O   . ARG B  2  413 ? 51.394  -9.810  -8.657  1.00 10.23 ? 525  ARG C O   1 
ATOM   4155  C  CB  . ARG B  2  413 ? 52.526  -8.939  -5.726  1.00 8.83  ? 525  ARG C CB  1 
ATOM   4156  C  CG  . ARG B  2  413 ? 52.069  -9.040  -4.276  1.00 6.42  ? 525  ARG C CG  1 
ATOM   4157  C  CD  . ARG B  2  413 ? 51.966  -7.674  -3.624  1.00 9.29  ? 525  ARG C CD  1 
ATOM   4158  N  NE  . ARG B  2  413 ? 53.264  -7.008  -3.521  1.00 9.53  ? 525  ARG C NE  1 
ATOM   4159  C  CZ  . ARG B  2  413 ? 54.102  -7.088  -2.474  1.00 9.31  ? 525  ARG C CZ  1 
ATOM   4160  N  NH1 . ARG B  2  413 ? 53.812  -7.817  -1.405  1.00 2.00  ? 525  ARG C NH1 1 
ATOM   4161  N  NH2 . ARG B  2  413 ? 55.251  -6.422  -2.513  1.00 10.56 ? 525  ARG C NH2 1 
ATOM   4162  N  N   . GLN B  2  414 ? 53.637  -9.869  -8.521  1.00 10.37 ? 526  GLN C N   1 
ATOM   4163  C  CA  . GLN B  2  414 ? 53.809  -9.609  -9.950  1.00 12.90 ? 526  GLN C CA  1 
ATOM   4164  C  C   . GLN B  2  414 ? 53.219  -10.769 -10.810 1.00 9.60  ? 526  GLN C C   1 
ATOM   4165  O  O   . GLN B  2  414 ? 52.655  -10.547 -11.889 1.00 9.04  ? 526  GLN C O   1 
ATOM   4166  C  CB  . GLN B  2  414 ? 55.304  -9.380  -10.256 1.00 15.82 ? 526  GLN C CB  1 
ATOM   4167  C  CG  . GLN B  2  414 ? 55.584  -8.485  -11.457 1.00 25.32 ? 526  GLN C CG  1 
ATOM   4168  C  CD  . GLN B  2  414 ? 55.458  -9.171  -12.818 1.00 30.53 ? 526  GLN C CD  1 
ATOM   4169  O  OE1 . GLN B  2  414 ? 55.633  -10.395 -12.946 1.00 34.71 ? 526  GLN C OE1 1 
ATOM   4170  N  NE2 . GLN B  2  414 ? 55.169  -8.375  -13.852 1.00 31.54 ? 526  GLN C NE2 1 
ATOM   4171  N  N   . ALA B  2  415 ? 53.343  -11.999 -10.324 1.00 8.13  ? 527  ALA C N   1 
ATOM   4172  C  CA  . ALA B  2  415 ? 52.792  -13.144 -11.026 1.00 5.79  ? 527  ALA C CA  1 
ATOM   4173  C  C   . ALA B  2  415 ? 51.263  -13.102 -10.987 1.00 6.68  ? 527  ALA C C   1 
ATOM   4174  O  O   . ALA B  2  415 ? 50.603  -13.318 -11.990 1.00 5.65  ? 527  ALA C O   1 
ATOM   4175  C  CB  . ALA B  2  415 ? 53.286  -14.423 -10.383 1.00 6.89  ? 527  ALA C CB  1 
ATOM   4176  N  N   . LEU B  2  416 ? 50.711  -12.824 -9.811  1.00 7.46  ? 528  LEU C N   1 
ATOM   4177  C  CA  . LEU B  2  416 ? 49.257  -12.748 -9.608  1.00 8.97  ? 528  LEU C CA  1 
ATOM   4178  C  C   . LEU B  2  416 ? 48.590  -11.631 -10.442 1.00 9.80  ? 528  LEU C C   1 
ATOM   4179  O  O   . LEU B  2  416 ? 47.431  -11.780 -10.845 1.00 8.20  ? 528  LEU C O   1 
ATOM   4180  C  CB  . LEU B  2  416 ? 48.950  -12.536 -8.116  1.00 7.20  ? 528  LEU C CB  1 
ATOM   4181  C  CG  . LEU B  2  416 ? 49.336  -13.675 -7.179  1.00 7.67  ? 528  LEU C CG  1 
ATOM   4182  C  CD1 . LEU B  2  416 ? 49.279  -13.192 -5.745  1.00 6.22  ? 528  LEU C CD1 1 
ATOM   4183  C  CD2 . LEU B  2  416 ? 48.427  -14.882 -7.402  1.00 6.34  ? 528  LEU C CD2 1 
ATOM   4184  N  N   . ALA B  2  417 ? 49.328  -10.530 -10.694 1.00 7.65  ? 529  ALA C N   1 
ATOM   4185  C  CA  . ALA B  2  417 ? 48.818  -9.386  -11.457 1.00 8.43  ? 529  ALA C CA  1 
ATOM   4186  C  C   . ALA B  2  417 ? 48.497  -9.768  -12.931 1.00 8.92  ? 529  ALA C C   1 
ATOM   4187  O  O   . ALA B  2  417 ? 47.683  -9.118  -13.621 1.00 7.69  ? 529  ALA C O   1 
ATOM   4188  C  CB  . ALA B  2  417 ? 49.837  -8.248  -11.402 1.00 6.54  ? 529  ALA C CB  1 
ATOM   4189  N  N   . GLN B  2  418 ? 49.113  -10.844 -13.397 1.00 7.81  ? 530  GLN C N   1 
ATOM   4190  C  CA  . GLN B  2  418 ? 48.902  -11.311 -14.742 1.00 9.78  ? 530  GLN C CA  1 
ATOM   4191  C  C   . GLN B  2  418 ? 47.675  -12.236 -14.879 1.00 8.17  ? 530  GLN C C   1 
ATOM   4192  O  O   . GLN B  2  418 ? 47.288  -12.568 -15.992 1.00 8.55  ? 530  GLN C O   1 
ATOM   4193  C  CB  . GLN B  2  418 ? 50.150  -12.037 -15.209 1.00 11.35 ? 530  GLN C CB  1 
ATOM   4194  C  CG  . GLN B  2  418 ? 51.427  -11.213 -15.039 1.00 16.57 ? 530  GLN C CG  1 
ATOM   4195  C  CD  . GLN B  2  418 ? 51.297  -9.798  -15.572 1.00 18.13 ? 530  GLN C CD  1 
ATOM   4196  O  OE1 . GLN B  2  418 ? 50.832  -9.570  -16.701 1.00 17.50 ? 530  GLN C OE1 1 
ATOM   4197  N  NE2 . GLN B  2  418 ? 51.716  -8.836  -14.757 1.00 22.39 ? 530  GLN C NE2 1 
ATOM   4198  N  N   . ILE B  2  419 ? 47.061  -12.651 -13.760 1.00 7.93  ? 531  ILE C N   1 
ATOM   4199  C  CA  . ILE B  2  419 ? 45.937  -13.579 -13.860 1.00 9.37  ? 531  ILE C CA  1 
ATOM   4200  C  C   . ILE B  2  419 ? 44.746  -12.933 -14.577 1.00 7.80  ? 531  ILE C C   1 
ATOM   4201  O  O   . ILE B  2  419 ? 44.585  -11.724 -14.579 1.00 6.93  ? 531  ILE C O   1 
ATOM   4202  C  CB  . ILE B  2  419 ? 45.479  -14.156 -12.475 1.00 8.25  ? 531  ILE C CB  1 
ATOM   4203  C  CG1 . ILE B  2  419 ? 44.797  -13.090 -11.623 1.00 8.17  ? 531  ILE C CG1 1 
ATOM   4204  C  CG2 . ILE B  2  419 ? 46.670  -14.753 -11.721 1.00 13.60 ? 531  ILE C CG2 1 
ATOM   4205  C  CD1 . ILE B  2  419 ? 43.274  -13.147 -11.660 1.00 8.84  ? 531  ILE C CD1 1 
ATOM   4206  N  N   . SER B  2  420 ? 43.949  -13.752 -15.213 1.00 9.44  ? 532  SER C N   1 
ATOM   4207  C  CA  . SER B  2  420 ? 42.714  -13.272 -15.855 1.00 9.47  ? 532  SER C CA  1 
ATOM   4208  C  C   . SER B  2  420 ? 41.670  -14.405 -15.897 1.00 7.70  ? 532  SER C C   1 
ATOM   4209  O  O   . SER B  2  420 ? 42.020  -15.592 -15.925 1.00 4.04  ? 532  SER C O   1 
ATOM   4210  C  CB  . SER B  2  420 ? 42.991  -12.717 -17.277 1.00 8.26  ? 532  SER C CB  1 
ATOM   4211  O  OG  . SER B  2  420 ? 42.933  -13.712 -18.293 1.00 10.24 ? 532  SER C OG  1 
ATOM   4212  N  N   . LEU B  2  421 ? 40.393  -14.024 -15.862 1.00 6.97  ? 533  LEU C N   1 
ATOM   4213  C  CA  . LEU B  2  421 ? 39.299  -15.009 -15.920 1.00 7.46  ? 533  LEU C CA  1 
ATOM   4214  C  C   . LEU B  2  421 ? 39.372  -15.810 -17.229 1.00 4.42  ? 533  LEU C C   1 
ATOM   4215  O  O   . LEU B  2  421 ? 39.208  -17.017 -17.226 1.00 6.14  ? 533  LEU C O   1 
ATOM   4216  C  CB  . LEU B  2  421 ? 37.921  -14.309 -15.725 1.00 4.07  ? 533  LEU C CB  1 
ATOM   4217  C  CG  . LEU B  2  421 ? 36.715  -15.219 -15.587 1.00 2.00  ? 533  LEU C CG  1 
ATOM   4218  C  CD1 . LEU B  2  421 ? 37.044  -16.392 -14.685 1.00 2.73  ? 533  LEU C CD1 1 
ATOM   4219  C  CD2 . LEU B  2  421 ? 35.538  -14.430 -15.044 1.00 5.08  ? 533  LEU C CD2 1 
ATOM   4220  N  N   . PRO B  2  422 ? 39.605  -15.169 -18.366 1.00 6.49  ? 534  PRO C N   1 
ATOM   4221  C  CA  . PRO B  2  422 ? 39.724  -15.894 -19.623 1.00 8.12  ? 534  PRO C CA  1 
ATOM   4222  C  C   . PRO B  2  422 ? 40.792  -17.028 -19.552 1.00 6.71  ? 534  PRO C C   1 
ATOM   4223  O  O   . PRO B  2  422 ? 40.529  -18.146 -20.003 1.00 6.38  ? 534  PRO C O   1 
ATOM   4224  C  CB  . PRO B  2  422 ? 40.084  -14.786 -20.621 1.00 7.79  ? 534  PRO C CB  1 
ATOM   4225  C  CG  . PRO B  2  422 ? 39.379  -13.605 -20.060 1.00 6.04  ? 534  PRO C CG  1 
ATOM   4226  C  CD  . PRO B  2  422 ? 39.636  -13.695 -18.590 1.00 4.24  ? 534  PRO C CD  1 
ATOM   4227  N  N   . ARG B  2  423 ? 41.987  -16.749 -18.974 1.00 7.42  ? 535  ARG C N   1 
ATOM   4228  C  CA  . ARG B  2  423 ? 43.040  -17.809 -18.845 1.00 8.99  ? 535  ARG C CA  1 
ATOM   4229  C  C   . ARG B  2  423 ? 42.627  -18.934 -17.892 1.00 7.57  ? 535  ARG C C   1 
ATOM   4230  O  O   . ARG B  2  423 ? 42.837  -20.111 -18.189 1.00 6.36  ? 535  ARG C O   1 
ATOM   4231  C  CB  . ARG B  2  423 ? 44.399  -17.233 -18.393 1.00 12.39 ? 535  ARG C CB  1 
ATOM   4232  C  CG  . ARG B  2  423 ? 45.509  -18.291 -18.269 1.00 11.36 ? 535  ARG C CG  1 
ATOM   4233  C  CD  . ARG B  2  423 ? 45.869  -18.930 -19.607 1.00 13.07 ? 535  ARG C CD  1 
ATOM   4234  N  NE  . ARG B  2  423 ? 46.419  -20.270 -19.379 1.00 20.18 ? 535  ARG C NE  1 
ATOM   4235  C  CZ  . ARG B  2  423 ? 47.449  -20.842 -20.027 1.00 21.83 ? 535  ARG C CZ  1 
ATOM   4236  N  NH1 . ARG B  2  423 ? 48.075  -20.207 -21.003 1.00 23.70 ? 535  ARG C NH1 1 
ATOM   4237  N  NH2 . ARG B  2  423 ? 47.852  -22.061 -19.685 1.00 19.81 ? 535  ARG C NH2 1 
ATOM   4238  N  N   . ILE B  2  424 ? 42.048  -18.565 -16.745 1.00 8.64  ? 536  ILE C N   1 
ATOM   4239  C  CA  . ILE B  2  424 ? 41.471  -19.544 -15.813 1.00 9.52  ? 536  ILE C CA  1 
ATOM   4240  C  C   . ILE B  2  424 ? 40.455  -20.480 -16.546 1.00 7.00  ? 536  ILE C C   1 
ATOM   4241  O  O   . ILE B  2  424 ? 40.464  -21.683 -16.341 1.00 5.18  ? 536  ILE C O   1 
ATOM   4242  C  CB  . ILE B  2  424 ? 40.780  -18.825 -14.613 1.00 10.04 ? 536  ILE C CB  1 
ATOM   4243  C  CG1 . ILE B  2  424 ? 41.835  -18.138 -13.723 1.00 10.82 ? 536  ILE C CG1 1 
ATOM   4244  C  CG2 . ILE B  2  424 ? 39.984  -19.822 -13.791 1.00 12.89 ? 536  ILE C CG2 1 
ATOM   4245  C  CD1 . ILE B  2  424 ? 41.250  -17.365 -12.550 1.00 11.36 ? 536  ILE C CD1 1 
ATOM   4246  N  N   . ILE B  2  425 ? 39.605  -19.927 -17.421 1.00 6.66  ? 537  ILE C N   1 
ATOM   4247  C  CA  . ILE B  2  425 ? 38.667  -20.774 -18.202 1.00 6.76  ? 537  ILE C CA  1 
ATOM   4248  C  C   . ILE B  2  425 ? 39.466  -21.714 -19.113 1.00 7.77  ? 537  ILE C C   1 
ATOM   4249  O  O   . ILE B  2  425 ? 39.216  -22.928 -19.168 1.00 3.67  ? 537  ILE C O   1 
ATOM   4250  C  CB  . ILE B  2  425 ? 37.671  -19.909 -19.017 1.00 4.27  ? 537  ILE C CB  1 
ATOM   4251  C  CG1 . ILE B  2  425 ? 36.632  -19.330 -18.044 1.00 6.66  ? 537  ILE C CG1 1 
ATOM   4252  C  CG2 . ILE B  2  425 ? 36.983  -20.724 -20.108 1.00 2.77  ? 537  ILE C CG2 1 
ATOM   4253  C  CD1 . ILE B  2  425 ? 35.924  -18.074 -18.544 1.00 6.57  ? 537  ILE C CD1 1 
ATOM   4254  N  N   . CYS B  2  426 ? 40.500  -21.143 -19.758 1.00 11.90 ? 538  CYS C N   1 
ATOM   4255  C  CA  . CYS B  2  426 ? 41.399  -21.928 -20.618 1.00 12.55 ? 538  CYS C CA  1 
ATOM   4256  C  C   . CYS B  2  426 ? 42.044  -23.065 -19.821 1.00 11.41 ? 538  CYS C C   1 
ATOM   4257  O  O   . CYS B  2  426 ? 42.190  -24.166 -20.334 1.00 14.43 ? 538  CYS C O   1 
ATOM   4258  C  CB  . CYS B  2  426 ? 42.511  -21.038 -21.233 1.00 11.60 ? 538  CYS C CB  1 
ATOM   4259  S  SG  . CYS B  2  426 ? 41.956  -19.714 -22.371 1.00 12.55 ? 538  CYS C SG  1 
ATOM   4260  N  N   . ASP B  2  427 ? 42.381  -22.815 -18.571 1.00 8.76  ? 539  ASP C N   1 
ATOM   4261  C  CA  . ASP B  2  427 ? 43.070  -23.800 -17.744 1.00 8.34  ? 539  ASP C CA  1 
ATOM   4262  C  C   . ASP B  2  427 ? 42.207  -24.945 -17.244 1.00 10.24 ? 539  ASP C C   1 
ATOM   4263  O  O   . ASP B  2  427 ? 42.749  -25.986 -16.849 1.00 7.09  ? 539  ASP C O   1 
ATOM   4264  C  CB  . ASP B  2  427 ? 43.660  -23.139 -16.497 1.00 9.13  ? 539  ASP C CB  1 
ATOM   4265  C  CG  . ASP B  2  427 ? 44.878  -22.283 -16.739 1.00 6.83  ? 539  ASP C CG  1 
ATOM   4266  O  OD1 . ASP B  2  427 ? 45.195  -21.487 -15.860 1.00 11.98 ? 539  ASP C OD1 1 
ATOM   4267  O  OD2 . ASP B  2  427 ? 45.507  -22.408 -17.785 1.00 8.69  ? 539  ASP C OD2 1 
ATOM   4268  N  N   . ASN B  2  428 ? 40.858  -24.765 -17.237 1.00 11.12 ? 540  ASN C N   1 
ATOM   4269  C  CA  . ASN B  2  428 ? 39.994  -25.748 -16.564 1.00 10.24 ? 540  ASN C CA  1 
ATOM   4270  C  C   . ASN B  2  428 ? 38.821  -26.266 -17.398 1.00 10.77 ? 540  ASN C C   1 
ATOM   4271  O  O   . ASN B  2  428 ? 37.944  -26.932 -16.857 1.00 12.75 ? 540  ASN C O   1 
ATOM   4272  C  CB  . ASN B  2  428 ? 39.505  -25.124 -15.245 1.00 9.66  ? 540  ASN C CB  1 
ATOM   4273  C  CG  . ASN B  2  428 ? 40.691  -24.725 -14.335 1.00 10.26 ? 540  ASN C CG  1 
ATOM   4274  O  OD1 . ASN B  2  428 ? 41.363  -25.588 -13.808 1.00 10.47 ? 540  ASN C OD1 1 
ATOM   4275  N  ND2 . ASN B  2  428 ? 40.964  -23.429 -14.171 1.00 5.60  ? 540  ASN C ND2 1 
ATOM   4276  N  N   . THR B  2  429 ? 38.829  -26.001 -18.705 1.00 10.42 ? 541  THR C N   1 
ATOM   4277  C  CA  . THR B  2  429 ? 37.731  -26.420 -19.587 1.00 12.38 ? 541  THR C CA  1 
ATOM   4278  C  C   . THR B  2  429 ? 38.248  -26.836 -20.962 1.00 13.59 ? 541  THR C C   1 
ATOM   4279  O  O   . THR B  2  429 ? 39.431  -26.646 -21.275 1.00 14.28 ? 541  THR C O   1 
ATOM   4280  C  CB  . THR B  2  429 ? 36.717  -25.270 -19.824 1.00 9.49  ? 541  THR C CB  1 
ATOM   4281  O  OG1 . THR B  2  429 ? 37.321  -24.276 -20.647 1.00 8.39  ? 541  THR C OG1 1 
ATOM   4282  C  CG2 . THR B  2  429 ? 36.268  -24.644 -18.513 1.00 9.50  ? 541  THR C CG2 1 
ATOM   4283  N  N   . GLY B  2  430 ? 37.335  -27.388 -21.788 1.00 12.63 ? 542  GLY C N   1 
ATOM   4284  C  CA  . GLY B  2  430 ? 37.650  -27.757 -23.165 1.00 11.63 ? 542  GLY C CA  1 
ATOM   4285  C  C   . GLY B  2  430 ? 37.518  -26.568 -24.139 1.00 13.09 ? 542  GLY C C   1 
ATOM   4286  O  O   . GLY B  2  430 ? 37.638  -26.738 -25.358 1.00 11.80 ? 542  GLY C O   1 
ATOM   4287  N  N   . ILE B  2  431 ? 37.257  -25.355 -23.607 1.00 12.82 ? 543  ILE C N   1 
ATOM   4288  C  CA  . ILE B  2  431 ? 37.164  -24.147 -24.449 1.00 11.99 ? 543  ILE C CA  1 
ATOM   4289  C  C   . ILE B  2  431 ? 38.590  -23.621 -24.783 1.00 12.03 ? 543  ILE C C   1 
ATOM   4290  O  O   . ILE B  2  431 ? 39.410  -23.378 -23.878 1.00 11.15 ? 543  ILE C O   1 
ATOM   4291  C  CB  . ILE B  2  431 ? 36.340  -23.030 -23.737 1.00 12.08 ? 543  ILE C CB  1 
ATOM   4292  C  CG1 . ILE B  2  431 ? 34.995  -23.586 -23.270 1.00 9.86  ? 543  ILE C CG1 1 
ATOM   4293  C  CG2 . ILE B  2  431 ? 36.125  -21.832 -24.656 1.00 11.89 ? 543  ILE C CG2 1 
ATOM   4294  C  CD1 . ILE B  2  431 ? 34.283  -22.688 -22.284 1.00 8.07  ? 543  ILE C CD1 1 
ATOM   4295  N  N   . THR B  2  432 ? 38.865  -23.451 -26.089 1.00 10.72 ? 544  THR C N   1 
ATOM   4296  C  CA  . THR B  2  432 ? 40.160  -23.014 -26.579 1.00 10.86 ? 544  THR C CA  1 
ATOM   4297  C  C   . THR B  2  432 ? 40.134  -21.593 -27.175 1.00 9.35  ? 544  THR C C   1 
ATOM   4298  O  O   . THR B  2  432 ? 41.150  -21.088 -27.653 1.00 9.32  ? 544  THR C O   1 
ATOM   4299  C  CB  . THR B  2  432 ? 40.668  -24.009 -27.624 1.00 10.54 ? 544  THR C CB  1 
ATOM   4300  O  OG1 . THR B  2  432 ? 39.716  -24.118 -28.660 1.00 13.37 ? 544  THR C OG1 1 
ATOM   4301  C  CG2 . THR B  2  432 ? 40.859  -25.376 -27.002 1.00 11.42 ? 544  THR C CG2 1 
ATOM   4302  N  N   . THR B  2  433 ? 38.959  -20.974 -27.146 1.00 9.29  ? 545  THR C N   1 
ATOM   4303  C  CA  . THR B  2  433 ? 38.715  -19.604 -27.621 1.00 13.01 ? 545  THR C CA  1 
ATOM   4304  C  C   . THR B  2  433 ? 37.904  -18.879 -26.544 1.00 12.37 ? 545  THR C C   1 
ATOM   4305  O  O   . THR B  2  433 ? 36.808  -19.319 -26.178 1.00 12.02 ? 545  THR C O   1 
ATOM   4306  C  CB  . THR B  2  433 ? 37.924  -19.603 -28.976 1.00 16.00 ? 545  THR C CB  1 
ATOM   4307  O  OG1 . THR B  2  433 ? 38.786  -20.107 -30.002 1.00 20.87 ? 545  THR C OG1 1 
ATOM   4308  C  CG2 . THR B  2  433 ? 37.450  -18.201 -29.379 1.00 14.91 ? 545  THR C CG2 1 
ATOM   4309  N  N   . VAL B  2  434 ? 38.469  -17.788 -26.016 1.00 12.91 ? 546  VAL C N   1 
ATOM   4310  C  CA  . VAL B  2  434 ? 37.868  -17.056 -24.914 1.00 11.54 ? 546  VAL C CA  1 
ATOM   4311  C  C   . VAL B  2  434 ? 37.834  -15.566 -25.223 1.00 13.15 ? 546  VAL C C   1 
ATOM   4312  O  O   . VAL B  2  434 ? 38.453  -15.101 -26.194 1.00 13.66 ? 546  VAL C O   1 
ATOM   4313  C  CB  . VAL B  2  434 ? 38.665  -17.281 -23.597 1.00 9.39  ? 546  VAL C CB  1 
ATOM   4314  C  CG1 . VAL B  2  434 ? 38.559  -18.719 -23.132 1.00 10.75 ? 546  VAL C CG1 1 
ATOM   4315  C  CG2 . VAL B  2  434 ? 40.129  -16.920 -23.800 1.00 8.47  ? 546  VAL C CG2 1 
ATOM   4316  N  N   . SER B  2  435 ? 37.130  -14.811 -24.372 1.00 13.88 ? 547  SER C N   1 
ATOM   4317  C  CA  . SER B  2  435 ? 37.003  -13.356 -24.524 1.00 15.14 ? 547  SER C CA  1 
ATOM   4318  C  C   . SER B  2  435 ? 38.356  -12.607 -24.363 1.00 16.88 ? 547  SER C C   1 
ATOM   4319  O  O   . SER B  2  435 ? 39.247  -13.011 -23.564 1.00 14.97 ? 547  SER C O   1 
ATOM   4320  C  CB  . SER B  2  435 ? 36.018  -12.775 -23.478 1.00 13.38 ? 547  SER C CB  1 
ATOM   4321  O  OG  . SER B  2  435 ? 34.960  -13.652 -23.194 1.00 12.39 ? 547  SER C OG  1 
ATOM   4322  N  N   . LYS B  2  436 ? 38.486  -11.515 -25.150 1.00 16.77 ? 548  LYS C N   1 
ATOM   4323  C  CA  . LYS B  2  436 ? 39.546  -10.525 -25.002 1.00 16.89 ? 548  LYS C CA  1 
ATOM   4324  C  C   . LYS B  2  436 ? 39.354  -9.814  -23.664 1.00 15.86 ? 548  LYS C C   1 
ATOM   4325  O  O   . LYS B  2  436 ? 38.220  -9.663  -23.172 1.00 14.55 ? 548  LYS C O   1 
ATOM   4326  C  CB  . LYS B  2  436 ? 39.412  -9.444  -26.060 1.00 17.54 ? 548  LYS C CB  1 
ATOM   4327  C  CG  . LYS B  2  436 ? 39.786  -9.770  -27.479 1.00 21.40 ? 548  LYS C CG  1 
ATOM   4328  C  CD  . LYS B  2  436 ? 39.560  -8.510  -28.326 1.00 24.42 ? 548  LYS C CD  1 
ATOM   4329  C  CE  . LYS B  2  436 ? 39.608  -8.790  -29.823 1.00 23.78 ? 548  LYS C CE  1 
ATOM   4330  N  NZ  . LYS B  2  436 ? 40.932  -9.308  -30.239 1.00 28.34 ? 548  LYS C NZ  1 
ATOM   4331  N  N   . ASN B  2  437 ? 40.418  -9.342  -23.062 1.00 15.94 ? 549  ASN C N   1 
ATOM   4332  C  CA  . ASN B  2  437 ? 40.247  -8.561  -21.861 1.00 15.27 ? 549  ASN C CA  1 
ATOM   4333  C  C   . ASN B  2  437 ? 39.664  -7.208  -22.307 1.00 14.03 ? 549  ASN C C   1 
ATOM   4334  O  O   . ASN B  2  437 ? 40.094  -6.667  -23.326 1.00 14.34 ? 549  ASN C O   1 
ATOM   4335  C  CB  . ASN B  2  437 ? 41.600  -8.359  -21.170 1.00 17.45 ? 549  ASN C CB  1 
ATOM   4336  C  CG  . ASN B  2  437 ? 42.260  -9.675  -20.778 1.00 16.39 ? 549  ASN C CG  1 
ATOM   4337  O  OD1 . ASN B  2  437 ? 43.448  -9.898  -21.071 1.00 18.89 ? 549  ASN C OD1 1 
ATOM   4338  N  ND2 . ASN B  2  437 ? 41.506  -10.544 -20.112 1.00 11.97 ? 549  ASN C ND2 1 
ATOM   4339  N  N   . ASN B  2  438 ? 38.682  -6.633  -21.555 1.00 12.08 ? 550  ASN C N   1 
ATOM   4340  C  CA  . ASN B  2  438 ? 38.076  -7.131  -20.298 1.00 8.78  ? 550  ASN C CA  1 
ATOM   4341  C  C   . ASN B  2  438 ? 36.915  -8.112  -20.577 1.00 9.73  ? 550  ASN C C   1 
ATOM   4342  O  O   . ASN B  2  438 ? 36.028  -7.820  -21.371 1.00 6.81  ? 550  ASN C O   1 
ATOM   4343  C  CB  . ASN B  2  438 ? 37.568  -5.887  -19.543 1.00 8.46  ? 550  ASN C CB  1 
ATOM   4344  C  CG  . ASN B  2  438 ? 37.008  -6.090  -18.139 1.00 6.48  ? 550  ASN C CG  1 
ATOM   4345  O  OD1 . ASN B  2  438 ? 36.338  -7.086  -17.825 1.00 6.64  ? 550  ASN C OD1 1 
ATOM   4346  N  ND2 . ASN B  2  438 ? 37.250  -5.105  -17.286 1.00 8.24  ? 550  ASN C ND2 1 
ATOM   4347  N  N   . ILE B  2  439 ? 36.904  -9.245  -19.892 1.00 8.23  ? 551  ILE C N   1 
ATOM   4348  C  CA  . ILE B  2  439 ? 35.873  -10.263 -20.128 1.00 6.78  ? 551  ILE C CA  1 
ATOM   4349  C  C   . ILE B  2  439 ? 34.452  -9.751  -19.835 1.00 8.91  ? 551  ILE C C   1 
ATOM   4350  O  O   . ILE B  2  439 ? 33.505  -10.177 -20.467 1.00 8.22  ? 551  ILE C O   1 
ATOM   4351  C  CB  . ILE B  2  439 ? 36.151  -11.536 -19.298 1.00 6.87  ? 551  ILE C CB  1 
ATOM   4352  C  CG1 . ILE B  2  439 ? 35.241  -12.683 -19.758 1.00 3.11  ? 551  ILE C CG1 1 
ATOM   4353  C  CG2 . ILE B  2  439 ? 36.012  -11.251 -17.796 1.00 2.00  ? 551  ILE C CG2 1 
ATOM   4354  C  CD1 . ILE B  2  439 ? 35.589  -14.015 -19.141 1.00 4.41  ? 551  ILE C CD1 1 
ATOM   4355  N  N   . PHE B  2  440 ? 34.316  -8.818  -18.911 1.00 7.54  ? 552  PHE C N   1 
ATOM   4356  C  CA  . PHE B  2  440 ? 33.001  -8.331  -18.545 1.00 8.21  ? 552  PHE C CA  1 
ATOM   4357  C  C   . PHE B  2  440 ? 32.403  -7.374  -19.604 1.00 9.97  ? 552  PHE C C   1 
ATOM   4358  O  O   . PHE B  2  440 ? 31.186  -7.095  -19.587 1.00 9.72  ? 552  PHE C O   1 
ATOM   4359  C  CB  . PHE B  2  440 ? 33.070  -7.680  -17.152 1.00 5.66  ? 552  PHE C CB  1 
ATOM   4360  C  CG  . PHE B  2  440 ? 33.494  -8.633  -16.072 1.00 5.97  ? 552  PHE C CG  1 
ATOM   4361  C  CD1 . PHE B  2  440 ? 34.557  -8.324  -15.219 1.00 6.13  ? 552  PHE C CD1 1 
ATOM   4362  C  CD2 . PHE B  2  440 ? 32.855  -9.867  -15.914 1.00 7.37  ? 552  PHE C CD2 1 
ATOM   4363  C  CE1 . PHE B  2  440 ? 34.965  -9.225  -14.231 1.00 4.57  ? 552  PHE C CE1 1 
ATOM   4364  C  CE2 . PHE B  2  440 ? 33.264  -10.771 -14.924 1.00 5.17  ? 552  PHE C CE2 1 
ATOM   4365  C  CZ  . PHE B  2  440 ? 34.319  -10.447 -14.080 1.00 4.64  ? 552  PHE C CZ  1 
ATOM   4366  N  N   . MET B  2  441 ? 33.257  -6.886  -20.522 1.00 9.32  ? 553  MET C N   1 
ATOM   4367  C  CA  . MET B  2  441 ? 32.846  -5.956  -21.597 1.00 12.69 ? 553  MET C CA  1 
ATOM   4368  C  C   . MET B  2  441 ? 32.643  -6.713  -22.903 1.00 12.75 ? 553  MET C C   1 
ATOM   4369  O  O   . MET B  2  441 ? 31.566  -6.673  -23.488 1.00 13.40 ? 553  MET C O   1 
ATOM   4370  C  CB  . MET B  2  441 ? 33.904  -4.843  -21.779 1.00 14.45 ? 553  MET C CB  1 
ATOM   4371  C  CG  . MET B  2  441 ? 33.381  -3.582  -22.466 1.00 18.78 ? 553  MET C CG  1 
ATOM   4372  S  SD  . MET B  2  441 ? 34.575  -2.217  -22.500 1.00 24.26 ? 553  MET C SD  1 
ATOM   4373  C  CE  . MET B  2  441 ? 34.370  -1.524  -20.870 1.00 25.32 ? 553  MET C CE  1 
ATOM   4374  N  N   . SER B  2  442 ? 33.692  -7.431  -23.331 1.00 12.51 ? 554  SER C N   1 
ATOM   4375  C  CA  . SER B  2  442 ? 33.659  -8.292  -24.526 1.00 13.06 ? 554  SER C CA  1 
ATOM   4376  C  C   . SER B  2  442 ? 32.397  -9.147  -24.528 1.00 11.39 ? 554  SER C C   1 
ATOM   4377  O  O   . SER B  2  442 ? 32.081  -9.764  -23.523 1.00 8.16  ? 554  SER C O   1 
ATOM   4378  C  CB  . SER B  2  442 ? 34.876  -9.237  -24.519 1.00 13.08 ? 554  SER C CB  1 
ATOM   4379  O  OG  . SER B  2  442 ? 36.081  -8.549  -24.791 1.00 12.44 ? 554  SER C OG  1 
ATOM   4380  N  N   . ASN B  2  443 ? 31.698  -9.225  -25.650 1.00 10.09 ? 555  ASN C N   1 
ATOM   4381  C  CA  . ASN B  2  443 ? 30.463  -9.995  -25.642 1.00 13.81 ? 555  ASN C CA  1 
ATOM   4382  C  C   . ASN B  2  443 ? 30.031  -10.457 -27.026 1.00 14.31 ? 555  ASN C C   1 
ATOM   4383  O  O   . ASN B  2  443 ? 28.934  -10.970 -27.188 1.00 15.28 ? 555  ASN C O   1 
ATOM   4384  C  CB  . ASN B  2  443 ? 29.345  -9.158  -24.997 1.00 13.60 ? 555  ASN C CB  1 
ATOM   4385  C  CG  . ASN B  2  443 ? 28.863  -7.962  -25.843 1.00 15.90 ? 555  ASN C CG  1 
ATOM   4386  O  OD1 . ASN B  2  443 ? 29.431  -7.625  -26.884 1.00 16.86 ? 555  ASN C OD1 1 
ATOM   4387  N  ND2 . ASN B  2  443 ? 27.801  -7.314  -25.381 1.00 12.56 ? 555  ASN C ND2 1 
ATOM   4388  N  N   . SER B  2  444 ? 30.901  -10.294 -28.001 1.00 15.30 ? 556  SER C N   1 
ATOM   4389  C  CA  . SER B  2  444 ? 30.557  -10.568 -29.384 1.00 16.15 ? 556  SER C CA  1 
ATOM   4390  C  C   . SER B  2  444 ? 31.582  -11.452 -30.083 1.00 18.49 ? 556  SER C C   1 
ATOM   4391  O  O   . SER B  2  444 ? 32.728  -11.037 -30.311 1.00 17.92 ? 556  SER C O   1 
ATOM   4392  C  CB  . SER B  2  444 ? 30.437  -9.239  -30.130 1.00 14.18 ? 556  SER C CB  1 
ATOM   4393  O  OG  . SER B  2  444 ? 30.009  -9.442  -31.460 1.00 18.20 ? 556  SER C OG  1 
ATOM   4394  N  N   . TYR B  2  445 ? 31.162  -12.675 -30.421 1.00 19.48 ? 557  TYR C N   1 
ATOM   4395  C  CA  . TYR B  2  445 ? 32.008  -13.622 -31.152 1.00 19.96 ? 557  TYR C CA  1 
ATOM   4396  C  C   . TYR B  2  445 ? 31.822  -13.412 -32.654 1.00 19.30 ? 557  TYR C C   1 
ATOM   4397  O  O   . TYR B  2  445 ? 30.690  -13.294 -33.112 1.00 18.19 ? 557  TYR C O   1 
ATOM   4398  C  CB  . TYR B  2  445 ? 31.641  -15.070 -30.764 1.00 20.86 ? 557  TYR C CB  1 
ATOM   4399  C  CG  . TYR B  2  445 ? 32.585  -16.104 -31.325 1.00 22.43 ? 557  TYR C CG  1 
ATOM   4400  C  CD1 . TYR B  2  445 ? 33.677  -16.539 -30.589 1.00 22.06 ? 557  TYR C CD1 1 
ATOM   4401  C  CD2 . TYR B  2  445 ? 32.417  -16.615 -32.619 1.00 25.12 ? 557  TYR C CD2 1 
ATOM   4402  C  CE1 . TYR B  2  445 ? 34.584  -17.454 -31.123 1.00 25.41 ? 557  TYR C CE1 1 
ATOM   4403  C  CE2 . TYR B  2  445 ? 33.322  -17.525 -33.166 1.00 25.42 ? 557  TYR C CE2 1 
ATOM   4404  C  CZ  . TYR B  2  445 ? 34.402  -17.940 -32.411 1.00 26.81 ? 557  TYR C CZ  1 
ATOM   4405  O  OH  . TYR B  2  445 ? 35.304  -18.838 -32.935 1.00 28.41 ? 557  TYR C OH  1 
ATOM   4406  N  N   . PRO B  2  446 ? 32.899  -13.424 -33.457 1.00 18.51 ? 558  PRO C N   1 
ATOM   4407  C  CA  . PRO B  2  446 ? 34.284  -13.664 -33.011 1.00 19.33 ? 558  PRO C CA  1 
ATOM   4408  C  C   . PRO B  2  446 ? 35.084  -12.403 -32.652 1.00 18.60 ? 558  PRO C C   1 
ATOM   4409  O  O   . PRO B  2  446 ? 36.195  -12.515 -32.133 1.00 17.70 ? 558  PRO C O   1 
ATOM   4410  C  CB  . PRO B  2  446 ? 34.858  -14.351 -34.234 1.00 20.49 ? 558  PRO C CB  1 
ATOM   4411  C  CG  . PRO B  2  446 ? 34.296  -13.491 -35.331 1.00 20.29 ? 558  PRO C CG  1 
ATOM   4412  C  CD  . PRO B  2  446 ? 32.858  -13.275 -34.939 1.00 19.54 ? 558  PRO C CD  1 
ATOM   4413  N  N   . ARG B  2  447 ? 34.512  -11.225 -32.940 1.00 17.41 ? 559  ARG C N   1 
ATOM   4414  C  CA  . ARG B  2  447 ? 35.156  -9.910  -32.730 1.00 17.18 ? 559  ARG C CA  1 
ATOM   4415  C  C   . ARG B  2  447 ? 35.896  -9.755  -31.377 1.00 15.39 ? 559  ARG C C   1 
ATOM   4416  O  O   . ARG B  2  447 ? 37.034  -9.290  -31.326 1.00 14.58 ? 559  ARG C O   1 
ATOM   4417  C  CB  . ARG B  2  447 ? 34.098  -8.799  -32.867 1.00 17.55 ? 559  ARG C CB  1 
ATOM   4418  C  CG  . ARG B  2  447 ? 34.636  -7.392  -32.708 1.00 20.47 ? 559  ARG C CG  1 
ATOM   4419  C  CD  . ARG B  2  447 ? 33.520  -6.368  -32.490 1.00 25.23 ? 559  ARG C CD  1 
ATOM   4420  N  NE  . ARG B  2  447 ? 32.964  -6.379  -31.120 1.00 27.53 ? 559  ARG C NE  1 
ATOM   4421  C  CZ  . ARG B  2  447 ? 31.830  -5.732  -30.736 1.00 30.02 ? 559  ARG C CZ  1 
ATOM   4422  N  NH1 . ARG B  2  447 ? 31.130  -5.037  -31.623 1.00 30.85 ? 559  ARG C NH1 1 
ATOM   4423  N  NH2 . ARG B  2  447 ? 31.391  -5.791  -29.472 1.00 26.92 ? 559  ARG C NH2 1 
ATOM   4424  N  N   . ASP B  2  448 ? 35.246  -10.124 -30.291 1.00 13.42 ? 560  ASP C N   1 
ATOM   4425  C  CA  . ASP B  2  448 ? 35.812  -9.915  -28.962 1.00 12.44 ? 560  ASP C CA  1 
ATOM   4426  C  C   . ASP B  2  448 ? 36.567  -11.125 -28.429 1.00 12.31 ? 560  ASP C C   1 
ATOM   4427  O  O   . ASP B  2  448 ? 36.758  -11.250 -27.206 1.00 11.12 ? 560  ASP C O   1 
ATOM   4428  C  CB  . ASP B  2  448 ? 34.689  -9.570  -27.992 1.00 11.81 ? 560  ASP C CB  1 
ATOM   4429  C  CG  . ASP B  2  448 ? 33.941  -8.294  -28.345 1.00 15.59 ? 560  ASP C CG  1 
ATOM   4430  O  OD1 . ASP B  2  448 ? 34.481  -7.467  -29.135 1.00 13.44 ? 560  ASP C OD1 1 
ATOM   4431  O  OD2 . ASP B  2  448 ? 32.817  -8.104  -27.812 1.00 17.05 ? 560  ASP C OD2 1 
ATOM   4432  N  N   . PHE B  2  449 ? 37.018  -12.014 -29.314 1.00 11.68 ? 561  PHE C N   1 
ATOM   4433  C  CA  . PHE B  2  449 ? 37.632  -13.233 -28.833 1.00 11.62 ? 561  PHE C CA  1 
ATOM   4434  C  C   . PHE B  2  449 ? 39.019  -13.500 -29.428 1.00 13.60 ? 561  PHE C C   1 
ATOM   4435  O  O   . PHE B  2  449 ? 39.381  -12.966 -30.483 1.00 10.59 ? 561  PHE C O   1 
ATOM   4436  C  CB  . PHE B  2  449 ? 36.689  -14.416 -29.096 1.00 11.93 ? 561  PHE C CB  1 
ATOM   4437  C  CG  . PHE B  2  449 ? 35.419  -14.449 -28.246 1.00 14.23 ? 561  PHE C CG  1 
ATOM   4438  C  CD1 . PHE B  2  449 ? 35.240  -15.448 -27.267 1.00 12.02 ? 561  PHE C CD1 1 
ATOM   4439  C  CD2 . PHE B  2  449 ? 34.386  -13.502 -28.429 1.00 11.25 ? 561  PHE C CD2 1 
ATOM   4440  C  CE1 . PHE B  2  449 ? 34.084  -15.512 -26.497 1.00 10.96 ? 561  PHE C CE1 1 
ATOM   4441  C  CE2 . PHE B  2  449 ? 33.223  -13.563 -27.649 1.00 11.82 ? 561  PHE C CE2 1 
ATOM   4442  C  CZ  . PHE B  2  449 ? 33.073  -14.566 -26.687 1.00 12.86 ? 561  PHE C CZ  1 
ATOM   4443  N  N   . VAL B  2  450 ? 39.807  -14.306 -28.695 1.00 15.11 ? 562  VAL C N   1 
ATOM   4444  C  CA  . VAL B  2  450 ? 41.162  -14.741 -29.124 1.00 15.17 ? 562  VAL C CA  1 
ATOM   4445  C  C   . VAL B  2  450 ? 41.421  -16.179 -28.660 1.00 13.00 ? 562  VAL C C   1 
ATOM   4446  O  O   . VAL B  2  450 ? 40.689  -16.716 -27.815 1.00 10.85 ? 562  VAL C O   1 
ATOM   4447  C  CB  . VAL B  2  450 ? 42.294  -13.836 -28.550 1.00 15.77 ? 562  VAL C CB  1 
ATOM   4448  C  CG1 . VAL B  2  450 ? 42.148  -12.393 -29.038 1.00 12.94 ? 562  VAL C CG1 1 
ATOM   4449  C  CG2 . VAL B  2  450 ? 42.284  -13.907 -27.030 1.00 16.15 ? 562  VAL C CG2 1 
ATOM   4450  N  N   . ASN B  2  451 ? 42.448  -16.797 -29.232 1.00 13.70 ? 563  ASN C N   1 
ATOM   4451  C  CA  . ASN B  2  451 ? 42.838  -18.158 -28.887 1.00 14.66 ? 563  ASN C CA  1 
ATOM   4452  C  C   . ASN B  2  451 ? 43.506  -18.210 -27.541 1.00 13.99 ? 563  ASN C C   1 
ATOM   4453  O  O   . ASN B  2  451 ? 44.310  -17.346 -27.210 1.00 14.52 ? 563  ASN C O   1 
ATOM   4454  C  CB  . ASN B  2  451 ? 43.797  -18.734 -29.908 1.00 15.77 ? 563  ASN C CB  1 
ATOM   4455  C  CG  . ASN B  2  451 ? 43.156  -18.895 -31.240 1.00 19.17 ? 563  ASN C CG  1 
ATOM   4456  O  OD1 . ASN B  2  451 ? 41.943  -19.043 -31.333 1.00 23.85 ? 563  ASN C OD1 1 
ATOM   4457  N  ND2 . ASN B  2  451 ? 43.965  -18.865 -32.285 1.00 25.44 ? 563  ASN C ND2 1 
ATOM   4458  N  N   . CYS B  2  452 ? 43.161  -19.243 -26.780 1.00 13.71 ? 564  CYS C N   1 
ATOM   4459  C  CA  . CYS B  2  452 ? 43.740  -19.456 -25.481 1.00 13.65 ? 564  CYS C CA  1 
ATOM   4460  C  C   . CYS B  2  452 ? 45.265  -19.446 -25.567 1.00 14.15 ? 564  CYS C C   1 
ATOM   4461  O  O   . CYS B  2  452 ? 45.931  -18.936 -24.674 1.00 13.56 ? 564  CYS C O   1 
ATOM   4462  C  CB  . CYS B  2  452 ? 43.243  -20.790 -24.908 1.00 12.39 ? 564  CYS C CB  1 
ATOM   4463  S  SG  . CYS B  2  452 ? 41.594  -20.693 -24.116 1.00 12.14 ? 564  CYS C SG  1 
ATOM   4464  N  N   . SER B  2  453 ? 45.783  -19.958 -26.680 1.00 15.54 ? 565  SER C N   1 
ATOM   4465  C  CA  . SER B  2  453 ? 47.222  -20.112 -26.941 1.00 16.87 ? 565  SER C CA  1 
ATOM   4466  C  C   . SER B  2  453 ? 48.035  -18.801 -26.851 1.00 16.44 ? 565  SER C C   1 
ATOM   4467  O  O   . SER B  2  453 ? 49.244  -18.840 -26.582 1.00 15.83 ? 565  SER C O   1 
ATOM   4468  C  CB  . SER B  2  453 ? 47.436  -20.811 -28.309 1.00 17.24 ? 565  SER C CB  1 
ATOM   4469  O  OG  . SER B  2  453 ? 46.920  -20.063 -29.400 1.00 19.70 ? 565  SER C OG  1 
ATOM   4470  N  N   . THR B  2  454 ? 47.353  -17.655 -27.046 1.00 15.13 ? 566  THR C N   1 
ATOM   4471  C  CA  . THR B  2  454 ? 47.969  -16.316 -26.997 1.00 14.13 ? 566  THR C CA  1 
ATOM   4472  C  C   . THR B  2  454 ? 48.009  -15.729 -25.573 1.00 11.06 ? 566  THR C C   1 
ATOM   4473  O  O   . THR B  2  454 ? 48.476  -14.618 -25.355 1.00 10.86 ? 566  THR C O   1 
ATOM   4474  C  CB  . THR B  2  454 ? 47.212  -15.332 -27.923 1.00 15.83 ? 566  THR C CB  1 
ATOM   4475  O  OG1 . THR B  2  454 ? 45.844  -15.196 -27.485 1.00 17.99 ? 566  THR C OG1 1 
ATOM   4476  C  CG2 . THR B  2  454 ? 47.249  -15.824 -29.366 1.00 13.51 ? 566  THR C CG2 1 
ATOM   4477  N  N   . LEU B  2  455 ? 47.498  -16.464 -24.622 1.00 9.97  ? 567  LEU C N   1 
ATOM   4478  C  CA  . LEU B  2  455 ? 47.461  -16.025 -23.236 1.00 11.99 ? 567  LEU C CA  1 
ATOM   4479  C  C   . LEU B  2  455 ? 48.496  -16.793 -22.416 1.00 11.33 ? 567  LEU C C   1 
ATOM   4480  O  O   . LEU B  2  455 ? 48.452  -17.998 -22.349 1.00 13.38 ? 567  LEU C O   1 
ATOM   4481  C  CB  . LEU B  2  455 ? 46.061  -16.281 -22.655 1.00 13.30 ? 567  LEU C CB  1 
ATOM   4482  C  CG  . LEU B  2  455 ? 44.868  -15.655 -23.404 1.00 13.88 ? 567  LEU C CG  1 
ATOM   4483  C  CD1 . LEU B  2  455 ? 43.563  -16.160 -22.802 1.00 14.30 ? 567  LEU C CD1 1 
ATOM   4484  C  CD2 . LEU B  2  455 ? 44.936  -14.137 -23.328 1.00 14.40 ? 567  LEU C CD2 1 
ATOM   4485  N  N   . PRO B  2  456 ? 49.418  -16.125 -21.759 1.00 13.09 ? 568  PRO C N   1 
ATOM   4486  C  CA  . PRO B  2  456 ? 50.452  -16.796 -20.946 1.00 14.24 ? 568  PRO C CA  1 
ATOM   4487  C  C   . PRO B  2  456 ? 49.877  -17.477 -19.709 1.00 13.50 ? 568  PRO C C   1 
ATOM   4488  O  O   . PRO B  2  456 ? 48.944  -16.951 -19.065 1.00 12.36 ? 568  PRO C O   1 
ATOM   4489  C  CB  . PRO B  2  456 ? 51.372  -15.647 -20.550 1.00 16.08 ? 568  PRO C CB  1 
ATOM   4490  C  CG  . PRO B  2  456 ? 50.408  -14.516 -20.426 1.00 17.24 ? 568  PRO C CG  1 
ATOM   4491  C  CD  . PRO B  2  456 ? 49.541  -14.659 -21.658 1.00 15.16 ? 568  PRO C CD  1 
ATOM   4492  N  N   . ALA B  2  457 ? 50.427  -18.649 -19.375 1.00 10.92 ? 569  ALA C N   1 
ATOM   4493  C  CA  . ALA B  2  457 ? 50.010  -19.333 -18.167 1.00 10.51 ? 569  ALA C CA  1 
ATOM   4494  C  C   . ALA B  2  457 ? 50.498  -18.578 -16.934 1.00 9.32  ? 569  ALA C C   1 
ATOM   4495  O  O   . ALA B  2  457 ? 51.405  -17.762 -17.029 1.00 9.22  ? 569  ALA C O   1 
ATOM   4496  C  CB  . ALA B  2  457 ? 50.550  -20.755 -18.144 1.00 10.27 ? 569  ALA C CB  1 
ATOM   4497  N  N   . LEU B  2  458 ? 49.845  -18.813 -15.802 1.00 7.50  ? 570  LEU C N   1 
ATOM   4498  C  CA  . LEU B  2  458 ? 50.269  -18.289 -14.504 1.00 10.04 ? 570  LEU C CA  1 
ATOM   4499  C  C   . LEU B  2  458 ? 51.678  -18.829 -14.186 1.00 8.75  ? 570  LEU C C   1 
ATOM   4500  O  O   . LEU B  2  458 ? 51.902  -20.026 -14.245 1.00 7.76  ? 570  LEU C O   1 
ATOM   4501  C  CB  . LEU B  2  458 ? 49.294  -18.765 -13.398 1.00 10.72 ? 570  LEU C CB  1 
ATOM   4502  C  CG  . LEU B  2  458 ? 49.766  -18.642 -11.930 1.00 12.70 ? 570  LEU C CG  1 
ATOM   4503  C  CD1 . LEU B  2  458 ? 49.948  -17.172 -11.549 1.00 12.39 ? 570  LEU C CD1 1 
ATOM   4504  C  CD2 . LEU B  2  458 ? 48.758  -19.307 -10.995 1.00 11.07 ? 570  LEU C CD2 1 
ATOM   4505  N  N   . ASN B  2  459 ? 52.615  -17.936 -13.870 1.00 9.14  ? 571  ASN C N   1 
ATOM   4506  C  CA  . ASN B  2  459 ? 53.969  -18.331 -13.545 1.00 6.13  ? 571  ASN C CA  1 
ATOM   4507  C  C   . ASN B  2  459 ? 54.058  -18.604 -12.049 1.00 7.25  ? 571  ASN C C   1 
ATOM   4508  O  O   . ASN B  2  459 ? 53.988  -17.690 -11.231 1.00 5.77  ? 571  ASN C O   1 
ATOM   4509  C  CB  . ASN B  2  459 ? 54.917  -17.209 -13.983 1.00 8.58  ? 571  ASN C CB  1 
ATOM   4510  C  CG  . ASN B  2  459 ? 56.406  -17.515 -13.794 1.00 13.03 ? 571  ASN C CG  1 
ATOM   4511  O  OD1 . ASN B  2  459 ? 56.805  -18.627 -13.423 1.00 13.65 ? 571  ASN C OD1 1 
ATOM   4512  N  ND2 . ASN B  2  459 ? 57.244  -16.524 -14.050 1.00 12.60 ? 571  ASN C ND2 1 
ATOM   4513  N  N   . LEU B  2  460 ? 54.191  -19.877 -11.679 1.00 6.49  ? 572  LEU C N   1 
ATOM   4514  C  CA  . LEU B  2  460 ? 54.234  -20.237 -10.255 1.00 8.86  ? 572  LEU C CA  1 
ATOM   4515  C  C   . LEU B  2  460 ? 55.650  -20.342 -9.669  1.00 7.76  ? 572  LEU C C   1 
ATOM   4516  O  O   . LEU B  2  460 ? 55.812  -20.695 -8.501  1.00 4.66  ? 572  LEU C O   1 
ATOM   4517  C  CB  . LEU B  2  460 ? 53.495  -21.549 -10.026 1.00 11.31 ? 572  LEU C CB  1 
ATOM   4518  C  CG  . LEU B  2  460 ? 51.981  -21.481 -10.114 1.00 10.07 ? 572  LEU C CG  1 
ATOM   4519  C  CD1 . LEU B  2  460 ? 51.422  -22.901 -10.150 1.00 11.95 ? 572  LEU C CD1 1 
ATOM   4520  C  CD2 . LEU B  2  460 ? 51.428  -20.656 -8.952  1.00 7.12  ? 572  LEU C CD2 1 
ATOM   4521  N  N   . ALA B  2  461 ? 56.646  -19.997 -10.469 1.00 10.32 ? 573  ALA C N   1 
ATOM   4522  C  CA  . ALA B  2  461 ? 58.065  -20.053 -10.059 1.00 11.04 ? 573  ALA C CA  1 
ATOM   4523  C  C   . ALA B  2  461 ? 58.305  -19.507 -8.644  1.00 10.98 ? 573  ALA C C   1 
ATOM   4524  O  O   . ALA B  2  461 ? 58.968  -20.157 -7.845  1.00 11.22 ? 573  ALA C O   1 
ATOM   4525  C  CB  . ALA B  2  461 ? 58.936  -19.302 -11.072 1.00 8.21  ? 573  ALA C CB  1 
ATOM   4526  N  N   . SER B  2  462 ? 57.737  -18.346 -8.308  1.00 11.09 ? 574  SER C N   1 
ATOM   4527  C  CA  . SER B  2  462 ? 57.996  -17.751 -6.996  1.00 10.61 ? 574  SER C CA  1 
ATOM   4528  C  C   . SER B  2  462 ? 57.294  -18.455 -5.825  1.00 10.46 ? 574  SER C C   1 
ATOM   4529  O  O   . SER B  2  462 ? 57.469  -18.053 -4.690  1.00 10.78 ? 574  SER C O   1 
ATOM   4530  C  CB  . SER B  2  462 ? 57.685  -16.240 -6.988  1.00 12.01 ? 574  SER C CB  1 
ATOM   4531  O  OG  . SER B  2  462 ? 56.311  -15.962 -7.185  1.00 12.54 ? 574  SER C OG  1 
ATOM   4532  N  N   . TRP B  2  463 ? 56.498  -19.481 -6.085  1.00 9.00  ? 575  TRP C N   1 
ATOM   4533  C  CA  . TRP B  2  463 ? 55.918  -20.250 -4.973  1.00 9.60  ? 575  TRP C CA  1 
ATOM   4534  C  C   . TRP B  2  463 ? 56.844  -21.422 -4.592  1.00 10.75 ? 575  TRP C C   1 
ATOM   4535  O  O   . TRP B  2  463 ? 56.548  -22.210 -3.695  1.00 9.87  ? 575  TRP C O   1 
ATOM   4536  C  CB  . TRP B  2  463 ? 54.532  -20.798 -5.342  1.00 9.34  ? 575  TRP C CB  1 
ATOM   4537  C  CG  . TRP B  2  463 ? 53.396  -19.823 -5.126  1.00 9.21  ? 575  TRP C CG  1 
ATOM   4538  C  CD1 . TRP B  2  463 ? 52.506  -19.816 -4.074  1.00 5.90  ? 575  TRP C CD1 1 
ATOM   4539  C  CD2 . TRP B  2  463 ? 53.035  -18.714 -5.973  1.00 7.34  ? 575  TRP C CD2 1 
ATOM   4540  N  NE1 . TRP B  2  463 ? 51.625  -18.774 -4.219  1.00 5.45  ? 575  TRP C NE1 1 
ATOM   4541  C  CE2 . TRP B  2  463 ? 51.923  -18.081 -5.371  1.00 5.40  ? 575  TRP C CE2 1 
ATOM   4542  C  CE3 . TRP B  2  463 ? 53.542  -18.200 -7.179  1.00 5.85  ? 575  TRP C CE3 1 
ATOM   4543  C  CZ2 . TRP B  2  463 ? 51.311  -16.966 -5.934  1.00 2.56  ? 575  TRP C CZ2 1 
ATOM   4544  C  CZ3 . TRP B  2  463 ? 52.933  -17.094 -7.729  1.00 5.59  ? 575  TRP C CZ3 1 
ATOM   4545  C  CH2 . TRP B  2  463 ? 51.822  -16.488 -7.100  1.00 4.69  ? 575  TRP C CH2 1 
ATOM   4546  N  N   . ARG B  2  464 ? 57.957  -21.549 -5.306  1.00 13.04 ? 576  ARG C N   1 
ATOM   4547  C  CA  . ARG B  2  464 ? 58.947  -22.581 -4.997  1.00 17.13 ? 576  ARG C CA  1 
ATOM   4548  C  C   . ARG B  2  464 ? 59.663  -22.280 -3.660  1.00 19.17 ? 576  ARG C C   1 
ATOM   4549  O  O   . ARG B  2  464 ? 60.316  -21.241 -3.493  1.00 16.21 ? 576  ARG C O   1 
ATOM   4550  C  CB  . ARG B  2  464 ? 59.977  -22.664 -6.103  1.00 18.60 ? 576  ARG C CB  1 
ATOM   4551  C  CG  . ARG B  2  464 ? 61.071  -23.661 -5.810  1.00 23.58 ? 576  ARG C CG  1 
ATOM   4552  C  CD  . ARG B  2  464 ? 60.952  -24.851 -6.724  1.00 27.81 ? 576  ARG C CD  1 
ATOM   4553  N  NE  . ARG B  2  464 ? 61.354  -24.523 -8.090  1.00 30.11 ? 576  ARG C NE  1 
ATOM   4554  C  CZ  . ARG B  2  464 ? 61.323  -25.377 -9.098  1.00 30.11 ? 576  ARG C CZ  1 
ATOM   4555  N  NH1 . ARG B  2  464 ? 60.870  -26.606 -8.920  1.00 30.30 ? 576  ARG C NH1 1 
ATOM   4556  N  NH2 . ARG B  2  464 ? 61.739  -24.992 -10.292 1.00 33.06 ? 576  ARG C NH2 1 
ATOM   4557  N  N   . GLU B  2  465 ? 59.505  -23.178 -2.692  1.00 21.51 ? 577  GLU C N   1 
ATOM   4558  C  CA  . GLU B  2  465 ? 60.175  -23.006 -1.417  1.00 24.52 ? 577  GLU C CA  1 
ATOM   4559  C  C   . GLU B  2  465 ? 61.673  -23.331 -1.591  1.00 24.48 ? 577  GLU C C   1 
ATOM   4560  O  O   . GLU B  2  465 ? 62.046  -24.467 -1.906  1.00 22.42 ? 577  GLU C O   1 
ATOM   4561  C  CB  . GLU B  2  465 ? 59.511  -23.896 -0.323  1.00 25.96 ? 577  GLU C CB  1 
ATOM   4562  C  CG  . GLU B  2  465 ? 60.102  -23.682 1.072   1.00 29.52 ? 577  GLU C CG  1 
ATOM   4563  C  CD  . GLU B  2  465 ? 59.174  -24.044 2.222   1.00 30.76 ? 577  GLU C CD  1 
ATOM   4564  O  OE1 . GLU B  2  465 ? 58.538  -25.117 2.185   1.00 34.03 ? 577  GLU C OE1 1 
ATOM   4565  O  OE2 . GLU B  2  465 ? 59.097  -23.255 3.179   1.00 32.57 ? 577  GLU C OE2 1 
ATOM   4566  N  N   . ALA B  2  466 ? 62.520  -22.316 -1.449  1.00 23.77 ? 578  ALA C N   1 
ATOM   4567  C  CA  . ALA B  2  466 ? 63.953  -22.522 -1.600  1.00 25.58 ? 578  ALA C CA  1 
ATOM   4568  C  C   . ALA B  2  466 ? 64.556  -23.107 -0.323  1.00 25.73 ? 578  ALA C C   1 
ATOM   4569  O  O   . ALA B  2  466 ? 64.023  -22.816 0.773   1.00 26.98 ? 578  ALA C O   1 
ATOM   4570  C  CB  . ALA B  2  466 ? 64.636  -21.215 -1.972  1.00 24.57 ? 578  ALA C CB  1 
ATOM   4571  O  OXT . ALA B  2  466 ? 65.529  -23.875 -0.437  1.00 24.98 ? 578  ALA C OXT 1 
ATOM   4572  N  N   . CYS C  1  1   ? 3.596   5.227   16.570  1.00 21.86 ? 1    CYS B N   1 
ATOM   4573  C  CA  . CYS C  1  1   ? 3.700   6.653   17.053  1.00 22.45 ? 1    CYS B CA  1 
ATOM   4574  C  C   . CYS C  1  1   ? 2.558   7.521   16.575  1.00 24.24 ? 1    CYS B C   1 
ATOM   4575  O  O   . CYS C  1  1   ? 2.274   7.564   15.367  1.00 25.11 ? 1    CYS B O   1 
ATOM   4576  C  CB  . CYS C  1  1   ? 4.990   7.312   16.572  1.00 21.70 ? 1    CYS B CB  1 
ATOM   4577  S  SG  . CYS C  1  1   ? 6.495   6.582   17.274  1.00 13.99 ? 1    CYS B SG  1 
ATOM   4578  N  N   . PRO C  1  2   ? 1.882   8.226   17.517  1.00 25.21 ? 2    PRO B N   1 
ATOM   4579  C  CA  . PRO C  1  2   ? 0.769   9.147   17.196  1.00 25.41 ? 2    PRO B CA  1 
ATOM   4580  C  C   . PRO C  1  2   ? 1.176   10.140  16.094  1.00 25.19 ? 2    PRO B C   1 
ATOM   4581  O  O   . PRO C  1  2   ? 2.240   10.771  16.171  1.00 25.69 ? 2    PRO B O   1 
ATOM   4582  C  CB  . PRO C  1  2   ? 0.521   9.843   18.531  1.00 23.41 ? 2    PRO B CB  1 
ATOM   4583  C  CG  . PRO C  1  2   ? 0.806   8.750   19.494  1.00 23.87 ? 2    PRO B CG  1 
ATOM   4584  C  CD  . PRO C  1  2   ? 2.079   8.135   18.978  1.00 22.40 ? 2    PRO B CD  1 
ATOM   4585  N  N   . GLU C  1  3   ? 0.340   10.254  15.072  1.00 23.82 ? 3    GLU B N   1 
ATOM   4586  C  CA  . GLU C  1  3   ? 0.587   11.166  13.956  1.00 24.65 ? 3    GLU B CA  1 
ATOM   4587  C  C   . GLU C  1  3   ? 0.976   12.560  14.470  1.00 23.79 ? 3    GLU B C   1 
ATOM   4588  O  O   . GLU C  1  3   ? 1.780   13.270  13.855  1.00 22.83 ? 3    GLU B O   1 
ATOM   4589  C  CB  . GLU C  1  3   ? -0.687  11.264  13.076  1.00 26.66 ? 3    GLU B CB  1 
ATOM   4590  C  CG  . GLU C  1  3   ? -0.430  11.653  11.628  1.00 28.93 ? 3    GLU B CG  1 
ATOM   4591  C  CD  . GLU C  1  3   ? -1.539  12.503  11.005  1.00 31.08 ? 3    GLU B CD  1 
ATOM   4592  O  OE1 . GLU C  1  3   ? -1.205  13.583  10.460  1.00 28.43 ? 3    GLU B OE1 1 
ATOM   4593  O  OE2 . GLU C  1  3   ? -2.729  12.092  11.048  1.00 25.33 ? 3    GLU B OE2 1 
ATOM   4594  N  N   . GLN C  1  4   ? 0.386   12.921  15.618  1.00 24.83 ? 4    GLN B N   1 
ATOM   4595  C  CA  . GLN C  1  4   ? 0.593   14.206  16.285  1.00 25.81 ? 4    GLN B CA  1 
ATOM   4596  C  C   . GLN C  1  4   ? 0.584   14.012  17.811  1.00 26.57 ? 4    GLN B C   1 
ATOM   4597  O  O   . GLN C  1  4   ? -0.130  13.157  18.345  1.00 26.94 ? 4    GLN B O   1 
ATOM   4598  C  CB  . GLN C  1  4   ? -0.516  15.210  15.879  1.00 25.04 ? 4    GLN B CB  1 
ATOM   4599  C  CG  . GLN C  1  4   ? -0.319  16.630  16.403  1.00 22.32 ? 4    GLN B CG  1 
ATOM   4600  C  CD  . GLN C  1  4   ? -1.448  17.588  16.035  1.00 24.83 ? 4    GLN B CD  1 
ATOM   4601  O  OE1 . GLN C  1  4   ? -2.568  17.174  15.794  1.00 23.65 ? 4    GLN B OE1 1 
ATOM   4602  N  NE2 . GLN C  1  4   ? -1.157  18.893  16.003  1.00 23.97 ? 4    GLN B NE2 1 
ATOM   4603  N  N   . ASP C  1  5   ? 1.413   14.790  18.491  1.00 26.05 ? 5    ASP B N   1 
ATOM   4604  C  CA  . ASP C  1  5   ? 1.483   14.791  19.944  1.00 26.68 ? 5    ASP B CA  1 
ATOM   4605  C  C   . ASP C  1  5   ? 1.612   16.223  20.463  1.00 28.03 ? 5    ASP B C   1 
ATOM   4606  O  O   . ASP C  1  5   ? 1.431   17.199  19.713  1.00 29.19 ? 5    ASP B O   1 
ATOM   4607  C  CB  . ASP C  1  5   ? 2.651   13.931  20.450  1.00 25.90 ? 5    ASP B CB  1 
ATOM   4608  C  CG  . ASP C  1  5   ? 3.926   14.066  19.626  1.00 29.00 ? 5    ASP B CG  1 
ATOM   4609  O  OD1 . ASP C  1  5   ? 4.664   13.056  19.520  1.00 30.17 ? 5    ASP B OD1 1 
ATOM   4610  O  OD2 . ASP C  1  5   ? 4.190   15.167  19.077  1.00 28.10 ? 5    ASP B OD2 1 
ATOM   4611  N  N   . LYS C  1  6   ? 1.936   16.358  21.739  1.00 26.06 ? 6    LYS B N   1 
ATOM   4612  C  CA  . LYS C  1  6   ? 2.019   17.665  22.372  1.00 23.92 ? 6    LYS B CA  1 
ATOM   4613  C  C   . LYS C  1  6   ? 3.241   17.738  23.262  1.00 20.93 ? 6    LYS B C   1 
ATOM   4614  O  O   . LYS C  1  6   ? 3.824   18.793  23.429  1.00 21.52 ? 6    LYS B O   1 
ATOM   4615  C  CB  . LYS C  1  6   ? 0.780   17.883  23.251  1.00 24.57 ? 6    LYS B CB  1 
ATOM   4616  C  CG  . LYS C  1  6   ? -0.533  17.439  22.616  1.00 30.02 ? 6    LYS B CG  1 
ATOM   4617  C  CD  . LYS C  1  6   ? -1.604  17.137  23.669  1.00 31.44 ? 6    LYS B CD  1 
ATOM   4618  C  CE  . LYS C  1  6   ? -1.208  15.961  24.567  1.00 33.36 ? 6    LYS B CE  1 
ATOM   4619  N  NZ  . LYS C  1  6   ? -0.961  14.700  23.796  1.00 33.57 ? 6    LYS B NZ  1 
ATOM   4620  N  N   . TYR C  1  7   ? 3.599   16.607  23.841  1.00 17.79 ? 7    TYR B N   1 
ATOM   4621  C  CA  . TYR C  1  7   ? 4.686   16.541  24.808  1.00 15.25 ? 7    TYR B CA  1 
ATOM   4622  C  C   . TYR C  1  7   ? 5.526   15.304  24.596  1.00 13.58 ? 7    TYR B C   1 
ATOM   4623  O  O   . TYR C  1  7   ? 5.122   14.384  23.873  1.00 12.77 ? 7    TYR B O   1 
ATOM   4624  C  CB  . TYR C  1  7   ? 4.104   16.463  26.219  1.00 13.46 ? 7    TYR B CB  1 
ATOM   4625  C  CG  . TYR C  1  7   ? 3.126   17.558  26.536  1.00 14.78 ? 7    TYR B CG  1 
ATOM   4626  C  CD1 . TYR C  1  7   ? 3.570   18.860  26.807  1.00 13.54 ? 7    TYR B CD1 1 
ATOM   4627  C  CD2 . TYR C  1  7   ? 1.749   17.303  26.531  1.00 12.94 ? 7    TYR B CD2 1 
ATOM   4628  C  CE1 . TYR C  1  7   ? 2.669   19.877  27.060  1.00 14.33 ? 7    TYR B CE1 1 
ATOM   4629  C  CE2 . TYR C  1  7   ? 0.844   18.313  26.779  1.00 15.45 ? 7    TYR B CE2 1 
ATOM   4630  C  CZ  . TYR C  1  7   ? 1.302   19.598  27.042  1.00 15.43 ? 7    TYR B CZ  1 
ATOM   4631  O  OH  . TYR C  1  7   ? 0.397   20.603  27.262  1.00 12.99 ? 7    TYR B OH  1 
ATOM   4632  N  N   . ARG C  1  8   ? 6.688   15.257  25.267  1.00 11.45 ? 8    ARG B N   1 
ATOM   4633  C  CA  . ARG C  1  8   ? 7.531   14.052  25.260  1.00 7.90  ? 8    ARG B CA  1 
ATOM   4634  C  C   . ARG C  1  8   ? 6.796   12.885  25.915  1.00 6.02  ? 8    ARG B C   1 
ATOM   4635  O  O   . ARG C  1  8   ? 6.045   13.056  26.876  1.00 5.16  ? 8    ARG B O   1 
ATOM   4636  C  CB  . ARG C  1  8   ? 8.800   14.242  26.091  1.00 4.77  ? 8    ARG B CB  1 
ATOM   4637  C  CG  . ARG C  1  8   ? 9.718   15.357  25.674  1.00 7.69  ? 8    ARG B CG  1 
ATOM   4638  C  CD  . ARG C  1  8   ? 10.951  15.393  26.587  1.00 7.54  ? 8    ARG B CD  1 
ATOM   4639  N  NE  . ARG C  1  8   ? 11.857  16.487  26.244  1.00 6.78  ? 8    ARG B NE  1 
ATOM   4640  C  CZ  . ARG C  1  8   ? 12.772  16.406  25.300  1.00 4.64  ? 8    ARG B CZ  1 
ATOM   4641  N  NH1 . ARG C  1  8   ? 12.923  15.275  24.624  1.00 4.94  ? 8    ARG B NH1 1 
ATOM   4642  N  NH2 . ARG C  1  8   ? 13.538  17.450  25.035  1.00 7.30  ? 8    ARG B NH2 1 
ATOM   4643  N  N   . THR C  1  9   ? 7.012   11.702  25.387  1.00 7.19  ? 9    THR B N   1 
ATOM   4644  C  CA  . THR C  1  9   ? 6.577   10.521  26.100  1.00 8.86  ? 9    THR B CA  1 
ATOM   4645  C  C   . THR C  1  9   ? 7.537   10.371  27.257  1.00 9.35  ? 9    THR B C   1 
ATOM   4646  O  O   . THR C  1  9   ? 8.637   10.926  27.230  1.00 10.12 ? 9    THR B O   1 
ATOM   4647  C  CB  . THR C  1  9   ? 6.681   9.238   25.264  1.00 12.23 ? 9    THR B CB  1 
ATOM   4648  O  OG1 . THR C  1  9   ? 8.057   9.046   24.867  1.00 12.40 ? 9    THR B OG1 1 
ATOM   4649  C  CG2 . THR C  1  9   ? 5.757   9.301   24.034  1.00 9.44  ? 9    THR B CG2 1 
ATOM   4650  N  N   . ILE C  1  10  ? 7.135   9.643   28.259  1.00 8.79  ? 10   ILE B N   1 
ATOM   4651  C  CA  . ILE C  1  10  ? 7.982   9.427   29.409  1.00 10.92 ? 10   ILE B CA  1 
ATOM   4652  C  C   . ILE C  1  10  ? 9.191   8.537   29.063  1.00 11.12 ? 10   ILE B C   1 
ATOM   4653  O  O   . ILE C  1  10  ? 10.274  8.707   29.627  1.00 11.37 ? 10   ILE B O   1 
ATOM   4654  C  CB  . ILE C  1  10  ? 7.137   8.812   30.545  1.00 13.43 ? 10   ILE B CB  1 
ATOM   4655  C  CG1 . ILE C  1  10  ? 6.385   9.931   31.294  1.00 11.98 ? 10   ILE B CG1 1 
ATOM   4656  C  CG2 . ILE C  1  10  ? 7.990   7.969   31.493  1.00 15.41 ? 10   ILE B CG2 1 
ATOM   4657  C  CD1 . ILE C  1  10  ? 7.283   10.930  31.987  1.00 12.58 ? 10   ILE B CD1 1 
ATOM   4658  N  N   . THR C  1  11  ? 9.010   7.609   28.117  1.00 10.88 ? 11   THR B N   1 
ATOM   4659  C  CA  . THR C  1  11  ? 10.097  6.694   27.755  1.00 10.49 ? 11   THR B CA  1 
ATOM   4660  C  C   . THR C  1  11  ? 10.988  7.216   26.621  1.00 8.50  ? 11   THR B C   1 
ATOM   4661  O  O   . THR C  1  11  ? 12.023  6.643   26.362  1.00 8.96  ? 11   THR B O   1 
ATOM   4662  C  CB  . THR C  1  11  ? 9.573   5.303   27.361  1.00 10.16 ? 11   THR B CB  1 
ATOM   4663  O  OG1 . THR C  1  11  ? 8.786   5.423   26.161  1.00 11.21 ? 11   THR B OG1 1 
ATOM   4664  C  CG2 . THR C  1  11  ? 8.720   4.710   28.482  1.00 11.37 ? 11   THR B CG2 1 
ATOM   4665  N  N   . GLY C  1  12  ? 10.595  8.292   25.955  1.00 7.82  ? 12   GLY B N   1 
ATOM   4666  C  CA  . GLY C  1  12  ? 11.405  8.806   24.852  1.00 9.61  ? 12   GLY B CA  1 
ATOM   4667  C  C   . GLY C  1  12  ? 11.004  8.198   23.508  1.00 8.28  ? 12   GLY B C   1 
ATOM   4668  O  O   . GLY C  1  12  ? 11.452  8.623   22.437  1.00 8.07  ? 12   GLY B O   1 
ATOM   4669  N  N   . MET C  1  13  ? 10.181  7.168   23.576  1.00 8.48  ? 13   MET B N   1 
ATOM   4670  C  CA  . MET C  1  13  ? 9.681   6.545   22.383  1.00 10.35 ? 13   MET B CA  1 
ATOM   4671  C  C   . MET C  1  13  ? 9.035   7.609   21.497  1.00 10.36 ? 13   MET B C   1 
ATOM   4672  O  O   . MET C  1  13  ? 8.467   8.579   21.990  1.00 12.16 ? 13   MET B O   1 
ATOM   4673  C  CB  . MET C  1  13  ? 8.667   5.468   22.778  1.00 13.59 ? 13   MET B CB  1 
ATOM   4674  C  CG  . MET C  1  13  ? 7.864   4.900   21.626  1.00 23.85 ? 13   MET B CG  1 
ATOM   4675  S  SD  . MET C  1  13  ? 8.694   3.551   20.755  1.00 36.99 ? 13   MET B SD  1 
ATOM   4676  C  CE  . MET C  1  13  ? 7.526   2.225   21.087  1.00 32.97 ? 13   MET B CE  1 
ATOM   4677  N  N   . CYS C  1  14  ? 9.178   7.462   20.185  1.00 10.46 ? 14   CYS B N   1 
ATOM   4678  C  CA  . CYS C  1  14  ? 8.543   8.358   19.230  1.00 11.09 ? 14   CYS B CA  1 
ATOM   4679  C  C   . CYS C  1  14  ? 9.132   9.758   19.162  1.00 11.58 ? 14   CYS B C   1 
ATOM   4680  O  O   . CYS C  1  14  ? 8.579   10.609  18.442  1.00 12.05 ? 14   CYS B O   1 
ATOM   4681  C  CB  . CYS C  1  14  ? 7.028   8.428   19.492  1.00 10.83 ? 14   CYS B CB  1 
ATOM   4682  S  SG  . CYS C  1  14  ? 6.210   6.829   19.226  1.00 13.31 ? 14   CYS B SG  1 
ATOM   4683  N  N   . ASN C  1  15  ? 10.227  10.027  19.903  1.00 9.39  ? 15   ASN B N   1 
ATOM   4684  C  CA  . ASN C  1  15  ? 10.913  11.291  19.711  1.00 7.04  ? 15   ASN B CA  1 
ATOM   4685  C  C   . ASN C  1  15  ? 11.397  11.298  18.270  1.00 5.94  ? 15   ASN B C   1 
ATOM   4686  O  O   . ASN C  1  15  ? 11.125  12.236  17.527  1.00 4.46  ? 15   ASN B O   1 
ATOM   4687  C  CB  . ASN C  1  15  ? 12.104  11.439  20.662  1.00 5.72  ? 15   ASN B CB  1 
ATOM   4688  C  CG  . ASN C  1  15  ? 12.721  12.833  20.618  1.00 3.13  ? 15   ASN B CG  1 
ATOM   4689  O  OD1 . ASN C  1  15  ? 13.190  13.279  19.578  1.00 5.61  ? 15   ASN B OD1 1 
ATOM   4690  N  ND2 . ASN C  1  15  ? 12.730  13.522  21.752  1.00 5.02  ? 15   ASN B ND2 1 
ATOM   4691  N  N   . ASN C  1  16  ? 12.103  10.237  17.871  1.00 4.97  ? 16   ASN B N   1 
ATOM   4692  C  CA  . ASN C  1  16  ? 12.434  10.077  16.467  1.00 6.26  ? 16   ASN B CA  1 
ATOM   4693  C  C   . ASN C  1  16  ? 11.304  9.256   15.821  1.00 9.43  ? 16   ASN B C   1 
ATOM   4694  O  O   . ASN C  1  16  ? 11.033  8.140   16.243  1.00 9.17  ? 16   ASN B O   1 
ATOM   4695  C  CB  . ASN C  1  16  ? 13.767  9.346   16.256  1.00 6.39  ? 16   ASN B CB  1 
ATOM   4696  C  CG  . ASN C  1  16  ? 14.203  9.420   14.789  1.00 8.08  ? 16   ASN B CG  1 
ATOM   4697  O  OD1 . ASN C  1  16  ? 13.699  8.695   13.909  1.00 8.69  ? 16   ASN B OD1 1 
ATOM   4698  N  ND2 . ASN C  1  16  ? 15.122  10.325  14.506  1.00 11.06 ? 16   ASN B ND2 1 
ATOM   4699  N  N   . ARG C  1  17  ? 10.640  9.804   14.807  1.00 10.07 ? 17   ARG B N   1 
ATOM   4700  C  CA  . ARG C  1  17  ? 9.508   9.094   14.233  1.00 12.07 ? 17   ARG B CA  1 
ATOM   4701  C  C   . ARG C  1  17  ? 9.882   7.975   13.267  1.00 9.98  ? 17   ARG B C   1 
ATOM   4702  O  O   . ARG C  1  17  ? 9.297   6.891   13.326  1.00 13.48 ? 17   ARG B O   1 
ATOM   4703  C  CB  . ARG C  1  17  ? 8.511   10.112  13.674  1.00 14.80 ? 17   ARG B CB  1 
ATOM   4704  C  CG  . ARG C  1  17  ? 7.806   10.778  14.856  1.00 17.54 ? 17   ARG B CG  1 
ATOM   4705  C  CD  . ARG C  1  17  ? 6.904   11.904  14.446  1.00 22.42 ? 17   ARG B CD  1 
ATOM   4706  N  NE  . ARG C  1  17  ? 5.986   12.271  15.524  1.00 23.38 ? 17   ARG B NE  1 
ATOM   4707  C  CZ  . ARG C  1  17  ? 5.258   13.372  15.500  1.00 24.94 ? 17   ARG B CZ  1 
ATOM   4708  N  NH1 . ARG C  1  17  ? 5.413   14.220  14.487  1.00 26.51 ? 17   ARG B NH1 1 
ATOM   4709  N  NH2 . ARG C  1  17  ? 4.399   13.646  16.487  1.00 21.98 ? 17   ARG B NH2 1 
ATOM   4710  N  N   . ARG C  1  18  ? 10.884  8.191   12.443  1.00 10.39 ? 18   ARG B N   1 
ATOM   4711  C  CA  . ARG C  1  18  ? 11.333  7.154   11.537  1.00 10.84 ? 18   ARG B CA  1 
ATOM   4712  C  C   . ARG C  1  18  ? 11.958  5.960   12.290  1.00 10.37 ? 18   ARG B C   1 
ATOM   4713  O  O   . ARG C  1  18  ? 11.846  4.811   11.828  1.00 9.40  ? 18   ARG B O   1 
ATOM   4714  C  CB  . ARG C  1  18  ? 12.317  7.727   10.511  1.00 12.56 ? 18   ARG B CB  1 
ATOM   4715  C  CG  . ARG C  1  18  ? 11.641  8.384   9.307   1.00 14.79 ? 18   ARG B CG  1 
ATOM   4716  C  CD  . ARG C  1  18  ? 12.643  8.647   8.197   1.00 15.62 ? 18   ARG B CD  1 
ATOM   4717  N  NE  . ARG C  1  18  ? 13.677  9.571   8.646   1.00 16.41 ? 18   ARG B NE  1 
ATOM   4718  C  CZ  . ARG C  1  18  ? 14.984  9.327   8.627   1.00 18.47 ? 18   ARG B CZ  1 
ATOM   4719  N  NH1 . ARG C  1  18  ? 15.454  8.172   8.168   1.00 15.08 ? 18   ARG B NH1 1 
ATOM   4720  N  NH2 . ARG C  1  18  ? 15.829  10.259  9.060   1.00 16.05 ? 18   ARG B NH2 1 
ATOM   4721  N  N   . SER C  1  19  ? 12.624  6.223   13.432  1.00 5.17  ? 19   SER B N   1 
ATOM   4722  C  CA  . SER C  1  19  ? 13.210  5.146   14.237  1.00 7.06  ? 19   SER B CA  1 
ATOM   4723  C  C   . SER C  1  19  ? 12.859  5.440   15.704  1.00 8.61  ? 19   SER B C   1 
ATOM   4724  O  O   . SER C  1  19  ? 13.664  5.962   16.483  1.00 6.11  ? 19   SER B O   1 
ATOM   4725  C  CB  . SER C  1  19  ? 14.731  5.060   13.969  1.00 9.51  ? 19   SER B CB  1 
ATOM   4726  O  OG  . SER C  1  19  ? 15.297  3.843   14.448  1.00 11.96 ? 19   SER B OG  1 
ATOM   4727  N  N   . PRO C  1  20  ? 11.606  5.040   16.063  1.00 8.93  ? 20   PRO B N   1 
ATOM   4728  C  CA  . PRO C  1  20  ? 10.940  5.242   17.375  1.00 9.50  ? 20   PRO B CA  1 
ATOM   4729  C  C   . PRO C  1  20  ? 11.615  4.867   18.681  1.00 6.48  ? 20   PRO B C   1 
ATOM   4730  O  O   . PRO C  1  20  ? 11.180  5.366   19.700  1.00 5.51  ? 20   PRO B O   1 
ATOM   4731  C  CB  . PRO C  1  20  ? 9.617   4.490   17.213  1.00 11.87 ? 20   PRO B CB  1 
ATOM   4732  C  CG  . PRO C  1  20  ? 9.376   4.557   15.759  1.00 9.90  ? 20   PRO B CG  1 
ATOM   4733  C  CD  . PRO C  1  20  ? 10.712  4.241   15.185  1.00 9.36  ? 20   PRO B CD  1 
ATOM   4734  N  N   . THR C  1  21  ? 12.608  3.981   18.698  1.00 8.34  ? 21   THR B N   1 
ATOM   4735  C  CA  . THR C  1  21  ? 13.254  3.625   19.995  1.00 7.49  ? 21   THR B CA  1 
ATOM   4736  C  C   . THR C  1  21  ? 14.524  4.446   20.260  1.00 6.14  ? 21   THR B C   1 
ATOM   4737  O  O   . THR C  1  21  ? 15.104  4.346   21.337  1.00 5.66  ? 21   THR B O   1 
ATOM   4738  C  CB  . THR C  1  21  ? 13.660  2.134   20.085  1.00 7.37  ? 21   THR B CB  1 
ATOM   4739  O  OG1 . THR C  1  21  ? 14.764  1.904   19.201  1.00 7.74  ? 21   THR B OG1 1 
ATOM   4740  C  CG2 . THR C  1  21  ? 12.511  1.210   19.705  1.00 5.82  ? 21   THR B CG2 1 
ATOM   4741  N  N   . LEU C  1  22  ? 14.966  5.217   19.283  1.00 4.64  ? 22   LEU B N   1 
ATOM   4742  C  CA  . LEU C  1  22  ? 16.205  5.984   19.440  1.00 7.26  ? 22   LEU B CA  1 
ATOM   4743  C  C   . LEU C  1  22  ? 16.094  7.023   20.547  1.00 7.26  ? 22   LEU B C   1 
ATOM   4744  O  O   . LEU C  1  22  ? 15.286  7.962   20.472  1.00 5.61  ? 22   LEU B O   1 
ATOM   4745  C  CB  . LEU C  1  22  ? 16.605  6.646   18.117  1.00 4.81  ? 22   LEU B CB  1 
ATOM   4746  C  CG  . LEU C  1  22  ? 16.867  5.735   16.905  1.00 4.92  ? 22   LEU B CG  1 
ATOM   4747  C  CD1 . LEU C  1  22  ? 17.244  6.570   15.690  1.00 2.00  ? 22   LEU B CD1 1 
ATOM   4748  C  CD2 . LEU C  1  22  ? 17.964  4.722   17.214  1.00 5.02  ? 22   LEU B CD2 1 
ATOM   4749  N  N   . GLY C  1  23  ? 16.905  6.831   21.589  1.00 7.59  ? 23   GLY B N   1 
ATOM   4750  C  CA  . GLY C  1  23  ? 16.897  7.743   22.724  1.00 9.67  ? 23   GLY B CA  1 
ATOM   4751  C  C   . GLY C  1  23  ? 15.938  7.317   23.812  1.00 8.78  ? 23   GLY B C   1 
ATOM   4752  O  O   . GLY C  1  23  ? 15.922  7.887   24.907  1.00 9.54  ? 23   GLY B O   1 
ATOM   4753  N  N   . ALA C  1  24  ? 15.133  6.299   23.503  1.00 9.41  ? 24   ALA B N   1 
ATOM   4754  C  CA  . ALA C  1  24  ? 14.167  5.763   24.428  1.00 7.50  ? 24   ALA B CA  1 
ATOM   4755  C  C   . ALA C  1  24  ? 14.849  4.854   25.428  1.00 7.91  ? 24   ALA B C   1 
ATOM   4756  O  O   . ALA C  1  24  ? 15.914  4.328   25.163  1.00 6.73  ? 24   ALA B O   1 
ATOM   4757  C  CB  . ALA C  1  24  ? 13.068  5.003   23.670  1.00 9.41  ? 24   ALA B CB  1 
ATOM   4758  N  N   . SER C  1  25  ? 14.200  4.691   26.565  1.00 8.32  ? 25   SER B N   1 
ATOM   4759  C  CA  . SER C  1  25  ? 14.671  3.889   27.679  1.00 8.87  ? 25   SER B CA  1 
ATOM   4760  C  C   . SER C  1  25  ? 14.669  2.373   27.410  1.00 8.93  ? 25   SER B C   1 
ATOM   4761  O  O   . SER C  1  25  ? 13.901  1.845   26.595  1.00 6.05  ? 25   SER B O   1 
ATOM   4762  C  CB  . SER C  1  25  ? 13.812  4.203   28.920  1.00 10.10 ? 25   SER B CB  1 
ATOM   4763  O  OG  . SER C  1  25  ? 12.451  3.835   28.736  1.00 6.56  ? 25   SER B OG  1 
ATOM   4764  N  N   . ASN C  1  26  ? 15.553  1.688   28.128  1.00 6.75  ? 26   ASN B N   1 
ATOM   4765  C  CA  . ASN C  1  26  ? 15.732  0.235   28.084  1.00 8.63  ? 26   ASN B CA  1 
ATOM   4766  C  C   . ASN C  1  26  ? 16.104  -0.272  26.696  1.00 7.47  ? 26   ASN B C   1 
ATOM   4767  O  O   . ASN C  1  26  ? 15.546  -1.253  26.183  1.00 6.02  ? 26   ASN B O   1 
ATOM   4768  C  CB  . ASN C  1  26  ? 14.490  -0.473  28.667  1.00 8.51  ? 26   ASN B CB  1 
ATOM   4769  C  CG  . ASN C  1  26  ? 14.395  -0.224  30.161  1.00 10.64 ? 26   ASN B CG  1 
ATOM   4770  O  OD1 . ASN C  1  26  ? 15.312  -0.559  30.936  1.00 9.87  ? 26   ASN B OD1 1 
ATOM   4771  N  ND2 . ASN C  1  26  ? 13.295  0.392   30.582  1.00 13.82 ? 26   ASN B ND2 1 
ATOM   4772  N  N   . ARG C  1  27  ? 17.078  0.408   26.101  1.00 4.60  ? 27   ARG B N   1 
ATOM   4773  C  CA  . ARG C  1  27  ? 17.567  0.051   24.793  1.00 6.11  ? 27   ARG B CA  1 
ATOM   4774  C  C   . ARG C  1  27  ? 19.075  -0.045  24.853  1.00 6.76  ? 27   ARG B C   1 
ATOM   4775  O  O   . ARG C  1  27  ? 19.688  0.557   25.715  1.00 8.13  ? 27   ARG B O   1 
ATOM   4776  C  CB  . ARG C  1  27  ? 17.135  1.105   23.743  1.00 4.95  ? 27   ARG B CB  1 
ATOM   4777  C  CG  . ARG C  1  27  ? 15.622  1.250   23.527  1.00 2.00  ? 27   ARG B CG  1 
ATOM   4778  C  CD  . ARG C  1  27  ? 15.007  -0.028  22.982  1.00 3.75  ? 27   ARG B CD  1 
ATOM   4779  N  NE  . ARG C  1  27  ? 13.545  0.050   22.910  1.00 7.97  ? 27   ARG B NE  1 
ATOM   4780  C  CZ  . ARG C  1  27  ? 12.745  -0.992  22.609  1.00 11.93 ? 27   ARG B CZ  1 
ATOM   4781  N  NH1 . ARG C  1  27  ? 13.281  -2.186  22.363  1.00 14.07 ? 27   ARG B NH1 1 
ATOM   4782  N  NH2 . ARG C  1  27  ? 11.415  -0.843  22.548  1.00 6.92  ? 27   ARG B NH2 1 
ATOM   4783  N  N   . ALA C  1  28  ? 19.662  -0.804  23.951  1.00 7.96  ? 28   ALA B N   1 
ATOM   4784  C  CA  . ALA C  1  28  ? 21.112  -0.948  23.929  1.00 10.24 ? 28   ALA B CA  1 
ATOM   4785  C  C   . ALA C  1  28  ? 21.786  0.351   23.496  1.00 8.76  ? 28   ALA B C   1 
ATOM   4786  O  O   . ALA C  1  28  ? 21.255  1.092   22.638  1.00 9.67  ? 28   ALA B O   1 
ATOM   4787  C  CB  . ALA C  1  28  ? 21.505  -2.076  22.986  1.00 8.63  ? 28   ALA B CB  1 
ATOM   4788  N  N   . PHE C  1  29  ? 22.927  0.658   24.106  1.00 7.21  ? 29   PHE B N   1 
ATOM   4789  C  CA  . PHE C  1  29  ? 23.713  1.838   23.685  1.00 5.87  ? 29   PHE B CA  1 
ATOM   4790  C  C   . PHE C  1  29  ? 24.097  1.686   22.219  1.00 3.50  ? 29   PHE B C   1 
ATOM   4791  O  O   . PHE C  1  29  ? 24.143  0.560   21.720  1.00 5.90  ? 29   PHE B O   1 
ATOM   4792  C  CB  . PHE C  1  29  ? 25.020  1.947   24.510  1.00 3.34  ? 29   PHE B CB  1 
ATOM   4793  C  CG  . PHE C  1  29  ? 24.807  2.238   25.961  1.00 6.17  ? 29   PHE B CG  1 
ATOM   4794  C  CD1 . PHE C  1  29  ? 24.884  1.217   26.913  1.00 7.17  ? 29   PHE B CD1 1 
ATOM   4795  C  CD2 . PHE C  1  29  ? 24.463  3.516   26.385  1.00 5.39  ? 29   PHE B CD2 1 
ATOM   4796  C  CE1 . PHE C  1  29  ? 24.608  1.472   28.258  1.00 8.02  ? 29   PHE B CE1 1 
ATOM   4797  C  CE2 . PHE C  1  29  ? 24.189  3.773   27.726  1.00 7.82  ? 29   PHE B CE2 1 
ATOM   4798  C  CZ  . PHE C  1  29  ? 24.255  2.752   28.666  1.00 5.22  ? 29   PHE B CZ  1 
ATOM   4799  N  N   . VAL C  1  30  ? 24.354  2.788   21.526  1.00 2.38  ? 30   VAL B N   1 
ATOM   4800  C  CA  . VAL C  1  30  ? 24.908  2.688   20.172  1.00 3.15  ? 30   VAL B CA  1 
ATOM   4801  C  C   . VAL C  1  30  ? 26.429  2.493   20.271  1.00 4.14  ? 30   VAL B C   1 
ATOM   4802  O  O   . VAL C  1  30  ? 27.044  2.970   21.217  1.00 6.88  ? 30   VAL B O   1 
ATOM   4803  C  CB  . VAL C  1  30  ? 24.608  3.934   19.297  1.00 2.78  ? 30   VAL B CB  1 
ATOM   4804  C  CG1 . VAL C  1  30  ? 25.200  5.214   19.902  1.00 2.88  ? 30   VAL B CG1 1 
ATOM   4805  C  CG2 . VAL C  1  30  ? 25.132  3.713   17.881  1.00 2.00  ? 30   VAL B CG2 1 
ATOM   4806  N  N   . ARG C  1  31  ? 27.008  1.753   19.337  1.00 5.78  ? 31   ARG B N   1 
ATOM   4807  C  CA  . ARG C  1  31  ? 28.485  1.570   19.313  1.00 7.02  ? 31   ARG B CA  1 
ATOM   4808  C  C   . ARG C  1  31  ? 29.141  2.534   18.332  1.00 6.65  ? 31   ARG B C   1 
ATOM   4809  O  O   . ARG C  1  31  ? 28.894  2.464   17.124  1.00 5.46  ? 31   ARG B O   1 
ATOM   4810  C  CB  . ARG C  1  31  ? 28.865  0.141   18.902  1.00 6.89  ? 31   ARG B CB  1 
ATOM   4811  C  CG  . ARG C  1  31  ? 28.595  -0.904  19.962  1.00 10.17 ? 31   ARG B CG  1 
ATOM   4812  C  CD  . ARG C  1  31  ? 29.681  -0.913  21.029  1.00 9.05  ? 31   ARG B CD  1 
ATOM   4813  N  NE  . ARG C  1  31  ? 29.440  -1.969  22.008  1.00 6.39  ? 31   ARG B NE  1 
ATOM   4814  C  CZ  . ARG C  1  31  ? 30.168  -2.179  23.106  1.00 5.91  ? 31   ARG B CZ  1 
ATOM   4815  N  NH1 . ARG C  1  31  ? 31.229  -1.414  23.368  1.00 5.05  ? 31   ARG B NH1 1 
ATOM   4816  N  NH2 . ARG C  1  31  ? 29.837  -3.161  23.925  1.00 3.15  ? 31   ARG B NH2 1 
ATOM   4817  N  N   . TRP C  1  32  ? 29.965  3.446   18.843  1.00 6.27  ? 32   TRP B N   1 
ATOM   4818  C  CA  . TRP C  1  32  ? 30.706  4.337   17.954  1.00 6.80  ? 32   TRP B CA  1 
ATOM   4819  C  C   . TRP C  1  32  ? 31.919  3.602   17.357  1.00 6.47  ? 32   TRP B C   1 
ATOM   4820  O  O   . TRP C  1  32  ? 32.376  3.913   16.257  1.00 6.42  ? 32   TRP B O   1 
ATOM   4821  C  CB  . TRP C  1  32  ? 31.113  5.613   18.700  1.00 9.24  ? 32   TRP B CB  1 
ATOM   4822  C  CG  . TRP C  1  32  ? 30.017  6.641   18.769  1.00 11.47 ? 32   TRP B CG  1 
ATOM   4823  C  CD1 . TRP C  1  32  ? 28.764  6.571   18.184  1.00 9.55  ? 32   TRP B CD1 1 
ATOM   4824  C  CD2 . TRP C  1  32  ? 30.039  7.866   19.544  1.00 11.66 ? 32   TRP B CD2 1 
ATOM   4825  N  NE1 . TRP C  1  32  ? 28.011  7.669   18.564  1.00 11.40 ? 32   TRP B NE1 1 
ATOM   4826  C  CE2 . TRP C  1  32  ? 28.767  8.479   19.400  1.00 10.57 ? 32   TRP B CE2 1 
ATOM   4827  C  CE3 . TRP C  1  32  ? 31.009  8.506   20.346  1.00 10.24 ? 32   TRP B CE3 1 
ATOM   4828  C  CZ2 . TRP C  1  32  ? 28.445  9.688   20.038  1.00 9.02  ? 32   TRP B CZ2 1 
ATOM   4829  C  CZ3 . TRP C  1  32  ? 30.679  9.710   20.974  1.00 6.75  ? 32   TRP B CZ3 1 
ATOM   4830  C  CH2 . TRP C  1  32  ? 29.408  10.288  20.819  1.00 8.52  ? 32   TRP B CH2 1 
ATOM   4831  N  N   . LEU C  1  33  ? 32.428  2.615   18.097  1.00 5.36  ? 33   LEU B N   1 
ATOM   4832  C  CA  . LEU C  1  33  ? 33.436  1.719   17.575  1.00 8.38  ? 33   LEU B CA  1 
ATOM   4833  C  C   . LEU C  1  33  ? 33.057  0.276   17.927  1.00 8.72  ? 33   LEU B C   1 
ATOM   4834  O  O   . LEU C  1  33  ? 32.355  0.039   18.914  1.00 11.21 ? 33   LEU B O   1 
ATOM   4835  C  CB  . LEU C  1  33  ? 34.802  2.004   18.187  1.00 4.44  ? 33   LEU B CB  1 
ATOM   4836  C  CG  . LEU C  1  33  ? 35.542  3.248   17.688  1.00 8.05  ? 33   LEU B CG  1 
ATOM   4837  C  CD1 . LEU C  1  33  ? 36.787  3.469   18.541  1.00 5.82  ? 33   LEU B CD1 1 
ATOM   4838  C  CD2 . LEU C  1  33  ? 35.917  3.101   16.218  1.00 5.48  ? 33   LEU B CD2 1 
ATOM   4839  N  N   . PRO C  1  34  ? 33.469  -0.696  17.103  1.00 8.53  ? 34   PRO B N   1 
ATOM   4840  C  CA  . PRO C  1  34  ? 33.222  -2.133  17.358  1.00 9.51  ? 34   PRO B CA  1 
ATOM   4841  C  C   . PRO C  1  34  ? 33.829  -2.534  18.732  1.00 11.39 ? 34   PRO B C   1 
ATOM   4842  O  O   . PRO C  1  34  ? 34.965  -2.120  19.077  1.00 10.77 ? 34   PRO B O   1 
ATOM   4843  C  CB  . PRO C  1  34  ? 33.975  -2.796  16.209  1.00 10.25 ? 34   PRO B CB  1 
ATOM   4844  C  CG  . PRO C  1  34  ? 33.812  -1.792  15.120  1.00 10.87 ? 34   PRO B CG  1 
ATOM   4845  C  CD  . PRO C  1  34  ? 34.141  -0.498  15.801  1.00 9.52  ? 34   PRO B CD  1 
ATOM   4846  N  N   . ALA C  1  35  ? 33.086  -3.314  19.515  1.00 6.65  ? 35   ALA B N   1 
ATOM   4847  C  CA  . ALA C  1  35  ? 33.543  -3.740  20.822  1.00 6.98  ? 35   ALA B CA  1 
ATOM   4848  C  C   . ALA C  1  35  ? 34.794  -4.627  20.757  1.00 6.85  ? 35   ALA B C   1 
ATOM   4849  O  O   . ALA C  1  35  ? 35.042  -5.358  19.774  1.00 4.55  ? 35   ALA B O   1 
ATOM   4850  C  CB  . ALA C  1  35  ? 32.439  -4.474  21.574  1.00 3.96  ? 35   ALA B CB  1 
ATOM   4851  N  N   . GLU C  1  36  ? 35.548  -4.549  21.848  1.00 7.71  ? 36   GLU B N   1 
ATOM   4852  C  CA  . GLU C  1  36  ? 36.800  -5.254  22.023  1.00 9.73  ? 36   GLU B CA  1 
ATOM   4853  C  C   . GLU C  1  36  ? 36.775  -6.126  23.277  1.00 8.49  ? 36   GLU B C   1 
ATOM   4854  O  O   . GLU C  1  36  ? 37.041  -5.673  24.387  1.00 9.03  ? 36   GLU B O   1 
ATOM   4855  C  CB  . GLU C  1  36  ? 37.933  -4.213  22.064  1.00 10.17 ? 36   GLU B CB  1 
ATOM   4856  C  CG  . GLU C  1  36  ? 38.180  -3.547  20.698  1.00 12.06 ? 36   GLU B CG  1 
ATOM   4857  C  CD  . GLU C  1  36  ? 39.504  -2.795  20.584  1.00 12.42 ? 36   GLU B CD  1 
ATOM   4858  O  OE1 . GLU C  1  36  ? 40.378  -2.969  21.455  1.00 9.91  ? 36   GLU B OE1 1 
ATOM   4859  O  OE2 . GLU C  1  36  ? 39.662  -2.037  19.617  1.00 12.81 ? 36   GLU B OE2 1 
ATOM   4860  N  N   . TYR C  1  37  ? 36.408  -7.387  23.076  1.00 9.85  ? 37   TYR B N   1 
ATOM   4861  C  CA  . TYR C  1  37  ? 36.333  -8.370  24.141  1.00 10.15 ? 37   TYR B CA  1 
ATOM   4862  C  C   . TYR C  1  37  ? 37.438  -9.394  23.971  1.00 11.49 ? 37   TYR B C   1 
ATOM   4863  O  O   . TYR C  1  37  ? 37.889  -9.650  22.847  1.00 10.32 ? 37   TYR B O   1 
ATOM   4864  C  CB  . TYR C  1  37  ? 34.997  -9.115  24.117  1.00 9.42  ? 37   TYR B CB  1 
ATOM   4865  C  CG  . TYR C  1  37  ? 33.802  -8.292  24.528  1.00 11.92 ? 37   TYR B CG  1 
ATOM   4866  C  CD1 . TYR C  1  37  ? 33.613  -7.892  25.862  1.00 7.81  ? 37   TYR B CD1 1 
ATOM   4867  C  CD2 . TYR C  1  37  ? 32.834  -7.926  23.585  1.00 10.86 ? 37   TYR B CD2 1 
ATOM   4868  C  CE1 . TYR C  1  37  ? 32.492  -7.156  26.235  1.00 9.58  ? 37   TYR B CE1 1 
ATOM   4869  C  CE2 . TYR C  1  37  ? 31.709  -7.184  23.953  1.00 12.15 ? 37   TYR B CE2 1 
ATOM   4870  C  CZ  . TYR C  1  37  ? 31.542  -6.800  25.276  1.00 9.84  ? 37   TYR B CZ  1 
ATOM   4871  O  OH  . TYR C  1  37  ? 30.474  -6.029  25.624  1.00 5.54  ? 37   TYR B OH  1 
ATOM   4872  N  N   . GLU C  1  38  ? 37.817  -10.002 25.087  1.00 11.19 ? 38   GLU B N   1 
ATOM   4873  C  CA  . GLU C  1  38  ? 38.862  -11.001 25.151  1.00 13.12 ? 38   GLU B CA  1 
ATOM   4874  C  C   . GLU C  1  38  ? 38.651  -12.167 24.158  1.00 15.15 ? 38   GLU B C   1 
ATOM   4875  O  O   . GLU C  1  38  ? 39.593  -12.629 23.499  1.00 15.48 ? 38   GLU B O   1 
ATOM   4876  C  CB  . GLU C  1  38  ? 38.916  -11.524 26.572  1.00 12.09 ? 38   GLU B CB  1 
ATOM   4877  C  CG  . GLU C  1  38  ? 40.219  -12.162 26.915  1.00 12.76 ? 38   GLU B CG  1 
ATOM   4878  C  CD  . GLU C  1  38  ? 40.090  -12.996 28.139  1.00 13.56 ? 38   GLU B CD  1 
ATOM   4879  O  OE1 . GLU C  1  38  ? 40.727  -12.658 29.163  1.00 12.28 ? 38   GLU B OE1 1 
ATOM   4880  O  OE2 . GLU C  1  38  ? 39.342  -13.995 28.077  1.00 13.50 ? 38   GLU B OE2 1 
ATOM   4881  N  N   . ASP C  1  39  ? 37.411  -12.642 24.048  1.00 16.16 ? 39   ASP B N   1 
ATOM   4882  C  CA  . ASP C  1  39  ? 37.096  -13.735 23.135  1.00 14.01 ? 39   ASP B CA  1 
ATOM   4883  C  C   . ASP C  1  39  ? 36.509  -13.224 21.837  1.00 13.03 ? 39   ASP B C   1 
ATOM   4884  O  O   . ASP C  1  39  ? 36.183  -14.001 20.961  1.00 13.28 ? 39   ASP B O   1 
ATOM   4885  C  CB  . ASP C  1  39  ? 36.120  -14.719 23.813  1.00 13.92 ? 39   ASP B CB  1 
ATOM   4886  C  CG  . ASP C  1  39  ? 34.803  -14.083 24.280  1.00 14.74 ? 39   ASP B CG  1 
ATOM   4887  O  OD1 . ASP C  1  39  ? 34.003  -14.799 24.924  1.00 11.60 ? 39   ASP B OD1 1 
ATOM   4888  O  OD2 . ASP C  1  39  ? 34.569  -12.872 24.001  1.00 13.68 ? 39   ASP B OD2 1 
ATOM   4889  N  N   . GLY C  1  40  ? 36.360  -11.907 21.729  1.00 13.45 ? 40   GLY B N   1 
ATOM   4890  C  CA  . GLY C  1  40  ? 35.828  -11.316 20.520  1.00 12.58 ? 40   GLY B CA  1 
ATOM   4891  C  C   . GLY C  1  40  ? 34.345  -10.941 20.596  1.00 12.21 ? 40   GLY B C   1 
ATOM   4892  O  O   . GLY C  1  40  ? 33.871  -10.173 19.755  1.00 11.60 ? 40   GLY B O   1 
ATOM   4893  N  N   . PHE C  1  41  ? 33.608  -11.430 21.605  1.00 10.74 ? 41   PHE B N   1 
ATOM   4894  C  CA  . PHE C  1  41  ? 32.166  -11.154 21.618  1.00 11.66 ? 41   PHE B CA  1 
ATOM   4895  C  C   . PHE C  1  41  ? 31.523  -11.020 22.992  1.00 10.33 ? 41   PHE B C   1 
ATOM   4896  O  O   . PHE C  1  41  ? 30.380  -10.564 23.055  1.00 9.55  ? 41   PHE B O   1 
ATOM   4897  C  CB  . PHE C  1  41  ? 31.421  -12.246 20.807  1.00 12.41 ? 41   PHE B CB  1 
ATOM   4898  C  CG  . PHE C  1  41  ? 31.536  -13.636 21.392  1.00 13.00 ? 41   PHE B CG  1 
ATOM   4899  C  CD1 . PHE C  1  41  ? 32.595  -14.469 21.049  1.00 12.60 ? 41   PHE B CD1 1 
ATOM   4900  C  CD2 . PHE C  1  41  ? 30.615  -14.090 22.326  1.00 14.53 ? 41   PHE B CD2 1 
ATOM   4901  C  CE1 . PHE C  1  41  ? 32.733  -15.723 21.631  1.00 13.33 ? 41   PHE B CE1 1 
ATOM   4902  C  CE2 . PHE C  1  41  ? 30.746  -15.341 22.915  1.00 16.69 ? 41   PHE B CE2 1 
ATOM   4903  C  CZ  . PHE C  1  41  ? 31.810  -16.160 22.565  1.00 14.00 ? 41   PHE B CZ  1 
ATOM   4904  N  N   . SER C  1  42  ? 32.214  -11.389 24.095  1.00 10.34 ? 42   SER B N   1 
ATOM   4905  C  CA  . SER C  1  42  ? 31.528  -11.370 25.406  1.00 11.43 ? 42   SER B CA  1 
ATOM   4906  C  C   . SER C  1  42  ? 32.411  -11.289 26.646  1.00 9.85  ? 42   SER B C   1 
ATOM   4907  O  O   . SER C  1  42  ? 32.013  -10.651 27.611  1.00 9.70  ? 42   SER B O   1 
ATOM   4908  C  CB  . SER C  1  42  ? 30.604  -12.611 25.544  1.00 13.61 ? 42   SER B CB  1 
ATOM   4909  O  OG  . SER C  1  42  ? 29.834  -12.559 26.739  1.00 17.53 ? 42   SER B OG  1 
ATOM   4910  N  N   . LEU C  1  43  ? 33.557  -12.003 26.658  1.00 10.26 ? 43   LEU B N   1 
ATOM   4911  C  CA  . LEU C  1  43  ? 34.465  -11.995 27.819  1.00 8.04  ? 43   LEU B CA  1 
ATOM   4912  C  C   . LEU C  1  43  ? 35.307  -10.729 27.886  1.00 7.61  ? 43   LEU B C   1 
ATOM   4913  O  O   . LEU C  1  43  ? 35.924  -10.340 26.903  1.00 7.59  ? 43   LEU B O   1 
ATOM   4914  C  CB  . LEU C  1  43  ? 35.389  -13.205 27.798  1.00 8.34  ? 43   LEU B CB  1 
ATOM   4915  C  CG  . LEU C  1  43  ? 34.717  -14.579 27.953  1.00 8.22  ? 43   LEU B CG  1 
ATOM   4916  C  CD1 . LEU C  1  43  ? 35.783  -15.645 28.032  1.00 9.56  ? 43   LEU B CD1 1 
ATOM   4917  C  CD2 . LEU C  1  43  ? 33.821  -14.620 29.185  1.00 8.35  ? 43   LEU B CD2 1 
ATOM   4918  N  N   . PRO C  1  44  ? 35.336  -10.068 29.055  1.00 8.58  ? 44   PRO B N   1 
ATOM   4919  C  CA  . PRO C  1  44  ? 36.109  -8.834  29.266  1.00 9.02  ? 44   PRO B CA  1 
ATOM   4920  C  C   . PRO C  1  44  ? 37.611  -9.071  29.403  1.00 8.85  ? 44   PRO B C   1 
ATOM   4921  O  O   . PRO C  1  44  ? 38.058  -10.083 29.956  1.00 6.04  ? 44   PRO B O   1 
ATOM   4922  C  CB  . PRO C  1  44  ? 35.522  -8.283  30.550  1.00 8.65  ? 44   PRO B CB  1 
ATOM   4923  C  CG  . PRO C  1  44  ? 35.177  -9.515  31.319  1.00 9.54  ? 44   PRO B CG  1 
ATOM   4924  C  CD  . PRO C  1  44  ? 34.595  -10.447 30.293  1.00 9.99  ? 44   PRO B CD  1 
ATOM   4925  N  N   . TYR C  1  45  ? 38.387  -8.137  28.880  1.00 9.81  ? 45   TYR B N   1 
ATOM   4926  C  CA  . TYR C  1  45  ? 39.821  -8.222  29.034  1.00 11.28 ? 45   TYR B CA  1 
ATOM   4927  C  C   . TYR C  1  45  ? 40.143  -8.300  30.505  1.00 10.08 ? 45   TYR B C   1 
ATOM   4928  O  O   . TYR C  1  45  ? 39.536  -7.575  31.313  1.00 11.76 ? 45   TYR B O   1 
ATOM   4929  C  CB  . TYR C  1  45  ? 40.530  -7.037  28.345  1.00 7.45  ? 45   TYR B CB  1 
ATOM   4930  C  CG  . TYR C  1  45  ? 40.868  -7.415  26.932  1.00 8.32  ? 45   TYR B CG  1 
ATOM   4931  C  CD1 . TYR C  1  45  ? 40.356  -6.734  25.832  1.00 7.71  ? 45   TYR B CD1 1 
ATOM   4932  C  CD2 . TYR C  1  45  ? 41.634  -8.548  26.697  1.00 9.15  ? 45   TYR B CD2 1 
ATOM   4933  C  CE1 . TYR C  1  45  ? 40.603  -7.184  24.544  1.00 9.94  ? 45   TYR B CE1 1 
ATOM   4934  C  CE2 . TYR C  1  45  ? 41.889  -9.006  25.431  1.00 10.67 ? 45   TYR B CE2 1 
ATOM   4935  C  CZ  . TYR C  1  45  ? 41.372  -8.334  24.358  1.00 12.09 ? 45   TYR B CZ  1 
ATOM   4936  O  OH  . TYR C  1  45  ? 41.603  -8.831  23.104  1.00 13.58 ? 45   TYR B OH  1 
ATOM   4937  N  N   . GLY C  1  46  ? 41.024  -9.259  30.845  1.00 11.45 ? 46   GLY B N   1 
ATOM   4938  C  CA  . GLY C  1  46  ? 41.394  -9.480  32.221  1.00 8.91  ? 46   GLY B CA  1 
ATOM   4939  C  C   . GLY C  1  46  ? 40.635  -10.618 32.832  1.00 10.07 ? 46   GLY B C   1 
ATOM   4940  O  O   . GLY C  1  46  ? 40.855  -10.928 33.986  1.00 11.44 ? 46   GLY B O   1 
ATOM   4941  N  N   . TRP C  1  47  ? 39.738  -11.252 32.047  1.00 10.89 ? 47   TRP B N   1 
ATOM   4942  C  CA  . TRP C  1  47  ? 38.917  -12.388 32.528  1.00 11.92 ? 47   TRP B CA  1 
ATOM   4943  C  C   . TRP C  1  47  ? 39.696  -13.700 32.601  1.00 12.14 ? 47   TRP B C   1 
ATOM   4944  O  O   . TRP C  1  47  ? 39.627  -14.398 33.610  1.00 13.65 ? 47   TRP B O   1 
ATOM   4945  C  CB  . TRP C  1  47  ? 37.682  -12.605 31.627  1.00 13.44 ? 47   TRP B CB  1 
ATOM   4946  C  CG  . TRP C  1  47  ? 36.733  -13.717 32.064  1.00 13.12 ? 47   TRP B CG  1 
ATOM   4947  C  CD1 . TRP C  1  47  ? 36.811  -15.055 31.735  1.00 11.96 ? 47   TRP B CD1 1 
ATOM   4948  C  CD2 . TRP C  1  47  ? 35.561  -13.584 32.905  1.00 9.61  ? 47   TRP B CD2 1 
ATOM   4949  N  NE1 . TRP C  1  47  ? 35.769  -15.755 32.321  1.00 10.67 ? 47   TRP B NE1 1 
ATOM   4950  C  CE2 . TRP C  1  47  ? 34.988  -14.880 33.046  1.00 10.93 ? 47   TRP B CE2 1 
ATOM   4951  C  CE3 . TRP C  1  47  ? 34.942  -12.510 33.553  1.00 8.32  ? 47   TRP B CE3 1 
ATOM   4952  C  CZ2 . TRP C  1  47  ? 33.833  -15.111 33.815  1.00 9.00  ? 47   TRP B CZ2 1 
ATOM   4953  C  CZ3 . TRP C  1  47  ? 33.808  -12.747 34.315  1.00 6.15  ? 47   TRP B CZ3 1 
ATOM   4954  C  CH2 . TRP C  1  47  ? 33.267  -14.032 34.438  1.00 7.83  ? 47   TRP B CH2 1 
ATOM   4955  N  N   . THR C  1  48  ? 40.427  -14.031 31.541  1.00 13.26 ? 48   THR B N   1 
ATOM   4956  C  CA  . THR C  1  48  ? 41.126  -15.315 31.463  1.00 15.24 ? 48   THR B CA  1 
ATOM   4957  C  C   . THR C  1  48  ? 42.601  -15.153 31.742  1.00 16.40 ? 48   THR B C   1 
ATOM   4958  O  O   . THR C  1  48  ? 43.316  -14.482 30.994  1.00 15.93 ? 48   THR B O   1 
ATOM   4959  C  CB  . THR C  1  48  ? 40.930  -15.993 30.077  1.00 15.15 ? 48   THR B CB  1 
ATOM   4960  O  OG1 . THR C  1  48  ? 39.519  -16.209 29.849  1.00 15.69 ? 48   THR B OG1 1 
ATOM   4961  C  CG2 . THR C  1  48  ? 41.659  -17.335 30.009  1.00 14.42 ? 48   THR B CG2 1 
ATOM   4962  N  N   . PRO C  1  49  ? 43.071  -15.786 32.827  1.00 17.44 ? 49   PRO B N   1 
ATOM   4963  C  CA  . PRO C  1  49  ? 44.491  -15.733 33.258  1.00 19.10 ? 49   PRO B CA  1 
ATOM   4964  C  C   . PRO C  1  49  ? 45.472  -16.033 32.104  1.00 20.41 ? 49   PRO B C   1 
ATOM   4965  O  O   . PRO C  1  49  ? 45.251  -16.972 31.318  1.00 19.86 ? 49   PRO B O   1 
ATOM   4966  C  CB  . PRO C  1  49  ? 44.537  -16.799 34.349  1.00 19.84 ? 49   PRO B CB  1 
ATOM   4967  C  CG  . PRO C  1  49  ? 43.165  -16.712 34.929  1.00 21.35 ? 49   PRO B CG  1 
ATOM   4968  C  CD  . PRO C  1  49  ? 42.269  -16.646 33.724  1.00 15.90 ? 49   PRO B CD  1 
ATOM   4969  N  N   . GLY C  1  50  ? 46.535  -15.208 31.987  1.00 20.96 ? 50   GLY B N   1 
ATOM   4970  C  CA  . GLY C  1  50  ? 47.542  -15.374 30.919  1.00 21.77 ? 50   GLY B CA  1 
ATOM   4971  C  C   . GLY C  1  50  ? 47.148  -14.783 29.549  1.00 21.37 ? 50   GLY B C   1 
ATOM   4972  O  O   . GLY C  1  50  ? 48.001  -14.593 28.670  1.00 21.64 ? 50   GLY B O   1 
ATOM   4973  N  N   . VAL C  1  51  ? 45.866  -14.500 29.347  1.00 20.37 ? 51   VAL B N   1 
ATOM   4974  C  CA  . VAL C  1  51  ? 45.419  -13.967 28.070  1.00 19.67 ? 51   VAL B CA  1 
ATOM   4975  C  C   . VAL C  1  51  ? 45.659  -12.452 27.983  1.00 19.97 ? 51   VAL B C   1 
ATOM   4976  O  O   . VAL C  1  51  ? 45.063  -11.643 28.702  1.00 20.29 ? 51   VAL B O   1 
ATOM   4977  C  CB  . VAL C  1  51  ? 43.939  -14.337 27.802  1.00 19.73 ? 51   VAL B CB  1 
ATOM   4978  C  CG1 . VAL C  1  51  ? 43.435  -13.686 26.525  1.00 17.94 ? 51   VAL B CG1 1 
ATOM   4979  C  CG2 . VAL C  1  51  ? 43.821  -15.846 27.685  1.00 15.88 ? 51   VAL B CG2 1 
ATOM   4980  N  N   . LYS C  1  52  ? 46.572  -12.102 27.089  1.00 20.05 ? 52   LYS B N   1 
ATOM   4981  C  CA  . LYS C  1  52  ? 47.000  -10.734 26.880  1.00 20.39 ? 52   LYS B CA  1 
ATOM   4982  C  C   . LYS C  1  52  ? 46.057  -9.977  25.948  1.00 19.83 ? 52   LYS B C   1 
ATOM   4983  O  O   . LYS C  1  52  ? 45.231  -10.571 25.239  1.00 16.56 ? 52   LYS B O   1 
ATOM   4984  C  CB  . LYS C  1  52  ? 48.420  -10.712 26.284  1.00 18.28 ? 52   LYS B CB  1 
ATOM   4985  C  CG  . LYS C  1  52  ? 49.425  -11.533 27.054  1.00 18.75 ? 52   LYS B CG  1 
ATOM   4986  C  CD  . LYS C  1  52  ? 50.836  -11.261 26.589  1.00 21.41 ? 52   LYS B CD  1 
ATOM   4987  C  CE  . LYS C  1  52  ? 51.830  -11.952 27.504  1.00 26.33 ? 52   LYS B CE  1 
ATOM   4988  N  NZ  . LYS C  1  52  ? 53.188  -11.345 27.423  1.00 29.00 ? 52   LYS B NZ  1 
ATOM   4989  N  N   . ARG C  1  53  ? 46.200  -8.652  25.989  1.00 20.37 ? 53   ARG B N   1 
ATOM   4990  C  CA  . ARG C  1  53  ? 45.491  -7.734  25.110  1.00 20.43 ? 53   ARG B CA  1 
ATOM   4991  C  C   . ARG C  1  53  ? 46.503  -7.054  24.194  1.00 21.71 ? 53   ARG B C   1 
ATOM   4992  O  O   . ARG C  1  53  ? 47.491  -6.494  24.675  1.00 21.97 ? 53   ARG B O   1 
ATOM   4993  C  CB  . ARG C  1  53  ? 44.754  -6.663  25.910  1.00 16.84 ? 53   ARG B CB  1 
ATOM   4994  C  CG  . ARG C  1  53  ? 44.030  -5.701  25.001  1.00 20.29 ? 53   ARG B CG  1 
ATOM   4995  C  CD  . ARG C  1  53  ? 43.126  -4.741  25.747  1.00 20.77 ? 53   ARG B CD  1 
ATOM   4996  N  NE  . ARG C  1  53  ? 42.123  -4.150  24.839  1.00 21.20 ? 53   ARG B NE  1 
ATOM   4997  C  CZ  . ARG C  1  53  ? 41.142  -3.320  25.217  1.00 20.12 ? 53   ARG B CZ  1 
ATOM   4998  N  NH1 . ARG C  1  53  ? 41.027  -2.954  26.491  1.00 19.44 ? 53   ARG B NH1 1 
ATOM   4999  N  NH2 . ARG C  1  53  ? 40.283  -2.856  24.324  1.00 16.37 ? 53   ARG B NH2 1 
ATOM   5000  N  N   . ASN C  1  54  ? 46.286  -7.142  22.878  1.00 23.58 ? 54   ASN B N   1 
ATOM   5001  C  CA  . ASN C  1  54  ? 47.156  -6.473  21.894  1.00 24.36 ? 54   ASN B CA  1 
ATOM   5002  C  C   . ASN C  1  54  ? 48.651  -6.733  22.165  1.00 22.85 ? 54   ASN B C   1 
ATOM   5003  O  O   . ASN C  1  54  ? 49.461  -5.833  22.040  1.00 24.63 ? 54   ASN B O   1 
ATOM   5004  C  CB  . ASN C  1  54  ? 46.878  -4.955  21.917  1.00 26.04 ? 54   ASN B CB  1 
ATOM   5005  C  CG  . ASN C  1  54  ? 46.862  -4.306  20.543  1.00 29.01 ? 54   ASN B CG  1 
ATOM   5006  O  OD1 . ASN C  1  54  ? 46.017  -3.443  20.249  1.00 29.47 ? 54   ASN B OD1 1 
ATOM   5007  N  ND2 . ASN C  1  54  ? 47.790  -4.712  19.687  1.00 29.89 ? 54   ASN B ND2 1 
ATOM   5008  N  N   . GLY C  1  55  ? 48.998  -7.959  22.566  1.00 23.00 ? 55   GLY B N   1 
ATOM   5009  C  CA  . GLY C  1  55  ? 50.402  -8.304  22.816  1.00 20.81 ? 55   GLY B CA  1 
ATOM   5010  C  C   . GLY C  1  55  ? 50.909  -8.014  24.237  1.00 19.13 ? 55   GLY B C   1 
ATOM   5011  O  O   . GLY C  1  55  ? 52.061  -8.306  24.559  1.00 17.58 ? 55   GLY B O   1 
ATOM   5012  N  N   . PHE C  1  56  ? 50.074  -7.469  25.099  1.00 16.08 ? 56   PHE B N   1 
ATOM   5013  C  CA  . PHE C  1  56  ? 50.552  -7.134  26.417  1.00 15.87 ? 56   PHE B CA  1 
ATOM   5014  C  C   . PHE C  1  56  ? 49.629  -7.596  27.513  1.00 14.18 ? 56   PHE B C   1 
ATOM   5015  O  O   . PHE C  1  56  ? 48.430  -7.708  27.308  1.00 13.61 ? 56   PHE B O   1 
ATOM   5016  C  CB  . PHE C  1  56  ? 50.770  -5.618  26.525  1.00 18.04 ? 56   PHE B CB  1 
ATOM   5017  C  CG  . PHE C  1  56  ? 51.882  -5.129  25.654  1.00 19.90 ? 56   PHE B CG  1 
ATOM   5018  C  CD1 . PHE C  1  56  ? 53.201  -5.231  26.070  1.00 22.62 ? 56   PHE B CD1 1 
ATOM   5019  C  CD2 . PHE C  1  56  ? 51.621  -4.623  24.394  1.00 20.59 ? 56   PHE B CD2 1 
ATOM   5020  C  CE1 . PHE C  1  56  ? 54.245  -4.843  25.238  1.00 21.56 ? 56   PHE B CE1 1 
ATOM   5021  C  CE2 . PHE C  1  56  ? 52.662  -4.234  23.560  1.00 23.71 ? 56   PHE B CE2 1 
ATOM   5022  C  CZ  . PHE C  1  56  ? 53.980  -4.348  23.985  1.00 21.56 ? 56   PHE B CZ  1 
ATOM   5023  N  N   . PRO C  1  57  ? 50.201  -7.871  28.715  1.00 13.87 ? 57   PRO B N   1 
ATOM   5024  C  CA  . PRO C  1  57  ? 49.439  -8.310  29.875  1.00 12.01 ? 57   PRO B CA  1 
ATOM   5025  C  C   . PRO C  1  57  ? 48.435  -7.242  30.280  1.00 9.65  ? 57   PRO B C   1 
ATOM   5026  O  O   . PRO C  1  57  ? 48.754  -6.067  30.292  1.00 6.63  ? 57   PRO B O   1 
ATOM   5027  C  CB  . PRO C  1  57  ? 50.507  -8.480  30.960  1.00 12.65 ? 57   PRO B CB  1 
ATOM   5028  C  CG  . PRO C  1  57  ? 51.741  -8.754  30.181  1.00 12.91 ? 57   PRO B CG  1 
ATOM   5029  C  CD  . PRO C  1  57  ? 51.652  -7.791  29.045  1.00 13.71 ? 57   PRO B CD  1 
ATOM   5030  N  N   . VAL C  1  58  ? 47.225  -7.665  30.585  1.00 8.87  ? 58   VAL B N   1 
ATOM   5031  C  CA  . VAL C  1  58  ? 46.197  -6.760  31.082  1.00 8.23  ? 58   VAL B CA  1 
ATOM   5032  C  C   . VAL C  1  58  ? 46.582  -6.316  32.507  1.00 9.49  ? 58   VAL B C   1 
ATOM   5033  O  O   . VAL C  1  58  ? 46.910  -7.146  33.353  1.00 12.00 ? 58   VAL B O   1 
ATOM   5034  C  CB  . VAL C  1  58  ? 44.814  -7.471  31.114  1.00 6.72  ? 58   VAL B CB  1 
ATOM   5035  C  CG1 . VAL C  1  58  ? 43.742  -6.575  31.725  1.00 3.47  ? 58   VAL B CG1 1 
ATOM   5036  C  CG2 . VAL C  1  58  ? 44.439  -7.931  29.699  1.00 5.18  ? 58   VAL B CG2 1 
ATOM   5037  N  N   . ALA C  1  59  ? 46.586  -5.015  32.757  1.00 9.16  ? 59   ALA B N   1 
ATOM   5038  C  CA  . ALA C  1  59  ? 46.936  -4.511  34.076  1.00 8.66  ? 59   ALA B CA  1 
ATOM   5039  C  C   . ALA C  1  59  ? 45.725  -4.545  34.980  1.00 8.84  ? 59   ALA B C   1 
ATOM   5040  O  O   . ALA C  1  59  ? 44.638  -4.217  34.551  1.00 10.23 ? 59   ALA B O   1 
ATOM   5041  C  CB  . ALA C  1  59  ? 47.460  -3.094  33.956  1.00 8.21  ? 59   ALA B CB  1 
ATOM   5042  N  N   . LEU C  1  60  ? 45.902  -4.966  36.214  1.00 9.95  ? 60   LEU B N   1 
ATOM   5043  C  CA  . LEU C  1  60  ? 44.806  -4.936  37.196  1.00 11.82 ? 60   LEU B CA  1 
ATOM   5044  C  C   . LEU C  1  60  ? 44.334  -3.499  37.368  1.00 11.07 ? 60   LEU B C   1 
ATOM   5045  O  O   . LEU C  1  60  ? 45.156  -2.603  37.568  1.00 8.43  ? 60   LEU B O   1 
ATOM   5046  C  CB  . LEU C  1  60  ? 45.264  -5.489  38.571  1.00 14.44 ? 60   LEU B CB  1 
ATOM   5047  C  CG  . LEU C  1  60  ? 45.156  -7.017  38.803  1.00 17.48 ? 60   LEU B CG  1 
ATOM   5048  C  CD1 . LEU C  1  60  ? 46.039  -7.770  37.803  1.00 17.43 ? 60   LEU B CD1 1 
ATOM   5049  C  CD2 . LEU C  1  60  ? 45.535  -7.362  40.252  1.00 14.33 ? 60   LEU B CD2 1 
ATOM   5050  N  N   . ALA C  1  61  ? 43.016  -3.287  37.253  1.00 10.93 ? 61   ALA B N   1 
ATOM   5051  C  CA  . ALA C  1  61  ? 42.428  -1.948  37.359  1.00 10.12 ? 61   ALA B CA  1 
ATOM   5052  C  C   . ALA C  1  61  ? 42.851  -1.274  38.669  1.00 8.74  ? 61   ALA B C   1 
ATOM   5053  O  O   . ALA C  1  61  ? 43.172  -0.092  38.689  1.00 7.63  ? 61   ALA B O   1 
ATOM   5054  C  CB  . ALA C  1  61  ? 40.916  -2.045  37.264  1.00 5.17  ? 61   ALA B CB  1 
ATOM   5055  N  N   . ARG C  1  62  ? 42.871  -2.062  39.747  1.00 8.96  ? 62   ARG B N   1 
ATOM   5056  C  CA  . ARG C  1  62  ? 43.282  -1.592  41.081  1.00 9.95  ? 62   ARG B CA  1 
ATOM   5057  C  C   . ARG C  1  62  ? 44.770  -1.194  41.072  1.00 8.69  ? 62   ARG B C   1 
ATOM   5058  O  O   . ARG C  1  62  ? 45.138  -0.188  41.655  1.00 7.03  ? 62   ARG B O   1 
ATOM   5059  C  CB  . ARG C  1  62  ? 42.996  -2.696  42.128  1.00 10.51 ? 62   ARG B CB  1 
ATOM   5060  C  CG  . ARG C  1  62  ? 43.342  -2.371  43.583  1.00 10.91 ? 62   ARG B CG  1 
ATOM   5061  C  CD  . ARG C  1  62  ? 42.570  -1.189  44.151  1.00 9.87  ? 62   ARG B CD  1 
ATOM   5062  N  NE  . ARG C  1  62  ? 43.013  -0.956  45.524  1.00 14.68 ? 62   ARG B NE  1 
ATOM   5063  C  CZ  . ARG C  1  62  ? 42.785  0.110   46.292  1.00 15.31 ? 62   ARG B CZ  1 
ATOM   5064  N  NH1 . ARG C  1  62  ? 42.077  1.135   45.858  1.00 11.96 ? 62   ARG B NH1 1 
ATOM   5065  N  NH2 . ARG C  1  62  ? 43.286  0.140   47.525  1.00 17.71 ? 62   ARG B NH2 1 
ATOM   5066  N  N   . ALA C  1  63  ? 45.599  -1.985  40.362  1.00 9.94  ? 63   ALA B N   1 
ATOM   5067  C  CA  . ALA C  1  63  ? 47.024  -1.663  40.192  1.00 9.09  ? 63   ALA B CA  1 
ATOM   5068  C  C   . ALA C  1  63  ? 47.224  -0.303  39.469  1.00 9.72  ? 63   ALA B C   1 
ATOM   5069  O  O   . ALA C  1  63  ? 48.038  0.530   39.908  1.00 6.97  ? 63   ALA B O   1 
ATOM   5070  C  CB  . ALA C  1  63  ? 47.710  -2.779  39.422  1.00 6.30  ? 63   ALA B CB  1 
ATOM   5071  N  N   . VAL C  1  64  ? 46.481  -0.061  38.354  1.00 9.72  ? 64   VAL B N   1 
ATOM   5072  C  CA  . VAL C  1  64  ? 46.591  1.224   37.652  1.00 7.33  ? 64   VAL B CA  1 
ATOM   5073  C  C   . VAL C  1  64  ? 46.178  2.385   38.591  1.00 7.81  ? 64   VAL B C   1 
ATOM   5074  O  O   . VAL C  1  64  ? 46.825  3.432   38.629  1.00 6.84  ? 64   VAL B O   1 
ATOM   5075  C  CB  . VAL C  1  64  ? 45.743  1.257   36.332  1.00 7.17  ? 64   VAL B CB  1 
ATOM   5076  C  CG1 . VAL C  1  64  ? 45.973  2.576   35.594  1.00 5.92  ? 64   VAL B CG1 1 
ATOM   5077  C  CG2 . VAL C  1  64  ? 46.104  0.102   35.429  1.00 4.31  ? 64   VAL B CG2 1 
ATOM   5078  N  N   . SER C  1  65  ? 45.121  2.164   39.370  1.00 9.00  ? 65   SER B N   1 
ATOM   5079  C  CA  . SER C  1  65  ? 44.597  3.164   40.316  1.00 11.53 ? 65   SER B CA  1 
ATOM   5080  C  C   . SER C  1  65  ? 45.601  3.476   41.437  1.00 10.44 ? 65   SER B C   1 
ATOM   5081  O  O   . SER C  1  65  ? 45.750  4.636   41.858  1.00 8.70  ? 65   SER B O   1 
ATOM   5082  C  CB  . SER C  1  65  ? 43.288  2.655   40.913  1.00 11.41 ? 65   SER B CB  1 
ATOM   5083  O  OG  . SER C  1  65  ? 42.701  3.618   41.769  1.00 12.81 ? 65   SER B OG  1 
ATOM   5084  N  N   . ASN C  1  66  ? 46.260  2.418   41.927  1.00 10.57 ? 66   ASN B N   1 
ATOM   5085  C  CA  . ASN C  1  66  ? 47.305  2.537   42.964  1.00 11.73 ? 66   ASN B CA  1 
ATOM   5086  C  C   . ASN C  1  66  ? 48.511  3.318   42.445  1.00 12.15 ? 66   ASN B C   1 
ATOM   5087  O  O   . ASN C  1  66  ? 49.021  4.211   43.128  1.00 11.40 ? 66   ASN B O   1 
ATOM   5088  C  CB  . ASN C  1  66  ? 47.795  1.138   43.453  1.00 9.81  ? 66   ASN B CB  1 
ATOM   5089  C  CG  . ASN C  1  66  ? 46.836  0.396   44.386  1.00 9.04  ? 66   ASN B CG  1 
ATOM   5090  O  OD1 . ASN C  1  66  ? 45.899  0.966   44.934  1.00 8.13  ? 66   ASN B OD1 1 
ATOM   5091  N  ND2 . ASN C  1  66  ? 47.075  -0.904  44.579  1.00 7.98  ? 66   ASN B ND2 1 
ATOM   5092  N  N   . GLU C  1  67  ? 48.924  3.018   41.212  1.00 12.30 ? 67   GLU B N   1 
ATOM   5093  C  CA  . GLU C  1  67  ? 50.143  3.598   40.640  1.00 14.24 ? 67   GLU B CA  1 
ATOM   5094  C  C   . GLU C  1  67  ? 49.979  4.949   39.963  1.00 12.50 ? 67   GLU B C   1 
ATOM   5095  O  O   . GLU C  1  67  ? 50.941  5.703   39.869  1.00 11.16 ? 67   GLU B O   1 
ATOM   5096  C  CB  . GLU C  1  67  ? 50.752  2.606   39.652  1.00 18.67 ? 67   GLU B CB  1 
ATOM   5097  C  CG  . GLU C  1  67  ? 51.078  1.259   40.285  1.00 23.80 ? 67   GLU B CG  1 
ATOM   5098  C  CD  . GLU C  1  67  ? 51.998  1.399   41.475  1.00 27.57 ? 67   GLU B CD  1 
ATOM   5099  O  OE1 . GLU C  1  67  ? 51.501  1.329   42.625  1.00 29.88 ? 67   GLU B OE1 1 
ATOM   5100  O  OE2 . GLU C  1  67  ? 53.216  1.588   41.265  1.00 28.92 ? 67   GLU B OE2 1 
ATOM   5101  N  N   . ILE C  1  68  ? 48.784  5.259   39.507  1.00 9.91  ? 68   ILE B N   1 
ATOM   5102  C  CA  . ILE C  1  68  ? 48.592  6.486   38.759  1.00 10.79 ? 68   ILE B CA  1 
ATOM   5103  C  C   . ILE C  1  68  ? 47.580  7.429   39.393  1.00 9.61  ? 68   ILE B C   1 
ATOM   5104  O  O   . ILE C  1  68  ? 47.775  8.628   39.367  1.00 9.73  ? 68   ILE B O   1 
ATOM   5105  C  CB  . ILE C  1  68  ? 48.171  6.170   37.288  1.00 13.75 ? 68   ILE B CB  1 
ATOM   5106  C  CG1 . ILE C  1  68  ? 49.321  5.434   36.588  1.00 17.56 ? 68   ILE B CG1 1 
ATOM   5107  C  CG2 . ILE C  1  68  ? 47.827  7.441   36.527  1.00 9.59  ? 68   ILE B CG2 1 
ATOM   5108  C  CD1 . ILE C  1  68  ? 49.045  5.087   35.143  1.00 16.72 ? 68   ILE B CD1 1 
ATOM   5109  N  N   . VAL C  1  69  ? 46.526  6.901   39.982  1.00 8.90  ? 69   VAL B N   1 
ATOM   5110  C  CA  . VAL C  1  69  ? 45.465  7.763   40.474  1.00 9.48  ? 69   VAL B CA  1 
ATOM   5111  C  C   . VAL C  1  69  ? 45.692  8.243   41.903  1.00 10.67 ? 69   VAL B C   1 
ATOM   5112  O  O   . VAL C  1  69  ? 45.493  9.439   42.200  1.00 11.23 ? 69   VAL B O   1 
ATOM   5113  C  CB  . VAL C  1  69  ? 44.084  7.072   40.365  1.00 9.71  ? 69   VAL B CB  1 
ATOM   5114  C  CG1 . VAL C  1  69  ? 42.977  8.069   40.723  1.00 9.95  ? 69   VAL B CG1 1 
ATOM   5115  C  CG2 . VAL C  1  69  ? 43.879  6.543   38.942  1.00 9.28  ? 69   VAL B CG2 1 
ATOM   5116  N  N   . ARG C  1  70  ? 46.137  7.323   42.762  1.00 10.22 ? 70   ARG B N   1 
ATOM   5117  C  CA  . ARG C  1  70  ? 46.379  7.618   44.169  1.00 10.92 ? 70   ARG B CA  1 
ATOM   5118  C  C   . ARG C  1  70  ? 47.286  8.843   44.349  1.00 11.27 ? 70   ARG B C   1 
ATOM   5119  O  O   . ARG C  1  70  ? 48.292  9.003   43.658  1.00 12.74 ? 70   ARG B O   1 
ATOM   5120  C  CB  . ARG C  1  70  ? 47.018  6.403   44.807  1.00 10.68 ? 70   ARG B CB  1 
ATOM   5121  C  CG  . ARG C  1  70  ? 47.288  6.484   46.304  1.00 16.20 ? 70   ARG B CG  1 
ATOM   5122  C  CD  . ARG C  1  70  ? 48.274  5.365   46.687  1.00 20.81 ? 70   ARG B CD  1 
ATOM   5123  N  NE  . ARG C  1  70  ? 48.416  5.162   48.133  1.00 21.83 ? 70   ARG B NE  1 
ATOM   5124  C  CZ  . ARG C  1  70  ? 49.575  5.160   48.803  1.00 20.97 ? 70   ARG B CZ  1 
ATOM   5125  N  NH1 . ARG C  1  70  ? 50.717  5.392   48.172  1.00 21.06 ? 70   ARG B NH1 1 
ATOM   5126  N  NH2 . ARG C  1  70  ? 49.582  4.954   50.110  1.00 18.68 ? 70   ARG B NH2 1 
ATOM   5127  N  N   . PHE C  1  71  ? 46.895  9.733   45.239  1.00 11.51 ? 71   PHE B N   1 
ATOM   5128  C  CA  . PHE C  1  71  ? 47.735  10.878  45.579  1.00 12.59 ? 71   PHE B CA  1 
ATOM   5129  C  C   . PHE C  1  71  ? 47.419  11.356  47.005  1.00 13.72 ? 71   PHE B C   1 
ATOM   5130  O  O   . PHE C  1  71  ? 46.290  11.161  47.496  1.00 13.12 ? 71   PHE B O   1 
ATOM   5131  C  CB  . PHE C  1  71  ? 47.568  12.027  44.554  1.00 11.73 ? 71   PHE B CB  1 
ATOM   5132  C  CG  . PHE C  1  71  ? 46.345  12.881  44.717  1.00 10.02 ? 71   PHE B CG  1 
ATOM   5133  C  CD1 . PHE C  1  71  ? 45.093  12.423  44.298  1.00 9.08  ? 71   PHE B CD1 1 
ATOM   5134  C  CD2 . PHE C  1  71  ? 46.447  14.152  45.282  1.00 8.94  ? 71   PHE B CD2 1 
ATOM   5135  C  CE1 . PHE C  1  71  ? 43.947  13.230  44.439  1.00 11.97 ? 71   PHE B CE1 1 
ATOM   5136  C  CE2 . PHE C  1  71  ? 45.313  14.967  45.435  1.00 13.21 ? 71   PHE B CE2 1 
ATOM   5137  C  CZ  . PHE C  1  71  ? 44.052  14.503  45.008  1.00 13.03 ? 71   PHE B CZ  1 
ATOM   5138  N  N   . PRO C  1  72  ? 48.417  11.954  47.719  1.00 12.95 ? 72   PRO B N   1 
ATOM   5139  C  CA  . PRO C  1  72  ? 48.219  12.459  49.094  1.00 14.64 ? 72   PRO B CA  1 
ATOM   5140  C  C   . PRO C  1  72  ? 47.236  13.631  49.067  1.00 16.63 ? 72   PRO B C   1 
ATOM   5141  O  O   . PRO C  1  72  ? 47.481  14.616  48.371  1.00 18.89 ? 72   PRO B O   1 
ATOM   5142  C  CB  . PRO C  1  72  ? 49.623  12.899  49.521  1.00 12.08 ? 72   PRO B CB  1 
ATOM   5143  C  CG  . PRO C  1  72  ? 50.523  12.133  48.600  1.00 13.13 ? 72   PRO B CG  1 
ATOM   5144  C  CD  . PRO C  1  72  ? 49.808  12.161  47.280  1.00 14.17 ? 72   PRO B CD  1 
ATOM   5145  N  N   . THR C  1  73  ? 46.122  13.521  49.793  1.00 18.36 ? 73   THR B N   1 
ATOM   5146  C  CA  . THR C  1  73  ? 45.073  14.562  49.770  1.00 21.29 ? 73   THR B CA  1 
ATOM   5147  C  C   . THR C  1  73  ? 45.625  15.977  50.049  1.00 22.14 ? 73   THR B C   1 
ATOM   5148  O  O   . THR C  1  73  ? 45.150  16.962  49.463  1.00 21.48 ? 73   THR B O   1 
ATOM   5149  C  CB  . THR C  1  73  ? 43.927  14.246  50.784  1.00 23.41 ? 73   THR B CB  1 
ATOM   5150  O  OG1 . THR C  1  73  ? 43.472  12.899  50.582  1.00 23.63 ? 73   THR B OG1 1 
ATOM   5151  C  CG2 . THR C  1  73  ? 42.735  15.194  50.592  1.00 22.33 ? 73   THR B CG2 1 
ATOM   5152  N  N   . ASP C  1  74  ? 46.652  16.066  50.907  1.00 22.62 ? 74   ASP B N   1 
ATOM   5153  C  CA  . ASP C  1  74  ? 47.231  17.359  51.276  1.00 24.07 ? 74   ASP B CA  1 
ATOM   5154  C  C   . ASP C  1  74  ? 47.693  18.163  50.063  1.00 23.95 ? 74   ASP B C   1 
ATOM   5155  O  O   . ASP C  1  74  ? 47.794  19.389  50.146  1.00 26.44 ? 74   ASP B O   1 
ATOM   5156  C  CB  . ASP C  1  74  ? 48.394  17.179  52.275  1.00 26.03 ? 74   ASP B CB  1 
ATOM   5157  C  CG  . ASP C  1  74  ? 49.568  16.375  51.738  1.00 29.51 ? 74   ASP B CG  1 
ATOM   5158  O  OD1 . ASP C  1  74  ? 49.852  15.295  52.293  1.00 34.13 ? 74   ASP B OD1 1 
ATOM   5159  O  OD2 . ASP C  1  74  ? 50.217  16.822  50.772  1.00 29.15 ? 74   ASP B OD2 1 
ATOM   5160  N  N   . GLN C  1  75  ? 47.967  17.464  48.939  1.00 22.97 ? 75   GLN B N   1 
ATOM   5161  C  CA  . GLN C  1  75  ? 48.413  18.097  47.677  1.00 20.94 ? 75   GLN B CA  1 
ATOM   5162  C  C   . GLN C  1  75  ? 47.232  18.599  46.824  1.00 17.77 ? 75   GLN B C   1 
ATOM   5163  O  O   . GLN C  1  75  ? 47.453  19.189  45.758  1.00 16.13 ? 75   GLN B O   1 
ATOM   5164  C  CB  . GLN C  1  75  ? 49.243  17.102  46.840  1.00 21.31 ? 75   GLN B CB  1 
ATOM   5165  C  CG  . GLN C  1  75  ? 50.506  16.587  47.518  1.00 23.35 ? 75   GLN B CG  1 
ATOM   5166  C  CD  . GLN C  1  75  ? 51.642  17.616  47.554  1.00 26.11 ? 75   GLN B CD  1 
ATOM   5167  O  OE1 . GLN C  1  75  ? 52.031  18.178  46.520  1.00 27.19 ? 75   GLN B OE1 1 
ATOM   5168  N  NE2 . GLN C  1  75  ? 52.194  17.857  48.746  1.00 24.86 ? 75   GLN B NE2 1 
ATOM   5169  N  N   . LEU C  1  76  ? 45.992  18.377  47.300  1.00 15.36 ? 76   LEU B N   1 
ATOM   5170  C  CA  . LEU C  1  76  ? 44.788  18.738  46.538  1.00 13.45 ? 76   LEU B CA  1 
ATOM   5171  C  C   . LEU C  1  76  ? 44.781  20.198  46.116  1.00 11.83 ? 76   LEU B C   1 
ATOM   5172  O  O   . LEU C  1  76  ? 45.025  21.100  46.925  1.00 11.52 ? 76   LEU B O   1 
ATOM   5173  C  CB  . LEU C  1  76  ? 43.522  18.401  47.344  1.00 12.60 ? 76   LEU B CB  1 
ATOM   5174  C  CG  . LEU C  1  76  ? 42.152  18.673  46.685  1.00 11.89 ? 76   LEU B CG  1 
ATOM   5175  C  CD1 . LEU C  1  76  ? 41.112  17.764  47.302  1.00 10.20 ? 76   LEU B CD1 1 
ATOM   5176  C  CD2 . LEU C  1  76  ? 41.736  20.140  46.834  1.00 11.14 ? 76   LEU B CD2 1 
ATOM   5177  N  N   . THR C  1  77  ? 44.481  20.416  44.837  1.00 11.22 ? 77   THR B N   1 
ATOM   5178  C  CA  . THR C  1  77  ? 44.431  21.748  44.274  1.00 10.57 ? 77   THR B CA  1 
ATOM   5179  C  C   . THR C  1  77  ? 42.988  22.235  44.101  1.00 13.24 ? 77   THR B C   1 
ATOM   5180  O  O   . THR C  1  77  ? 42.224  21.687  43.269  1.00 13.46 ? 77   THR B O   1 
ATOM   5181  C  CB  . THR C  1  77  ? 45.109  21.798  42.885  1.00 10.10 ? 77   THR B CB  1 
ATOM   5182  O  OG1 . THR C  1  77  ? 46.445  21.311  42.978  1.00 10.24 ? 77   THR B OG1 1 
ATOM   5183  C  CG2 . THR C  1  77  ? 45.117  23.230  42.343  1.00 10.56 ? 77   THR B CG2 1 
ATOM   5184  N  N   . PRO C  1  78  ? 42.550  23.219  44.927  1.00 12.91 ? 78   PRO B N   1 
ATOM   5185  C  CA  . PRO C  1  78  ? 41.213  23.797  44.799  1.00 13.98 ? 78   PRO B CA  1 
ATOM   5186  C  C   . PRO C  1  78  ? 41.120  24.514  43.440  1.00 12.36 ? 78   PRO B C   1 
ATOM   5187  O  O   . PRO C  1  78  ? 42.024  25.253  43.070  1.00 10.87 ? 78   PRO B O   1 
ATOM   5188  C  CB  . PRO C  1  78  ? 41.151  24.800  45.957  1.00 15.34 ? 78   PRO B CB  1 
ATOM   5189  C  CG  . PRO C  1  78  ? 42.101  24.221  46.935  1.00 14.63 ? 78   PRO B CG  1 
ATOM   5190  C  CD  . PRO C  1  78  ? 43.254  23.770  46.099  1.00 11.23 ? 78   PRO B CD  1 
ATOM   5191  N  N   . ASP C  1  79  ? 40.060  24.257  42.686  1.00 13.53 ? 79   ASP B N   1 
ATOM   5192  C  CA  . ASP C  1  79  ? 39.851  24.940  41.394  1.00 14.93 ? 79   ASP B CA  1 
ATOM   5193  C  C   . ASP C  1  79  ? 39.332  26.383  41.617  1.00 16.10 ? 79   ASP B C   1 
ATOM   5194  O  O   . ASP C  1  79  ? 38.172  26.599  42.002  1.00 13.37 ? 79   ASP B O   1 
ATOM   5195  C  CB  . ASP C  1  79  ? 38.861  24.163  40.518  1.00 12.33 ? 79   ASP B CB  1 
ATOM   5196  C  CG  . ASP C  1  79  ? 38.767  24.695  39.084  1.00 12.75 ? 79   ASP B CG  1 
ATOM   5197  O  OD1 . ASP C  1  79  ? 38.262  23.944  38.246  1.00 14.72 ? 79   ASP B OD1 1 
ATOM   5198  O  OD2 . ASP C  1  79  ? 39.206  25.847  38.781  1.00 9.76  ? 79   ASP B OD2 1 
ATOM   5199  N  N   . GLN C  1  80  ? 40.214  27.346  41.349  1.00 16.06 ? 80   GLN B N   1 
ATOM   5200  C  CA  . GLN C  1  80  ? 39.925  28.752  41.541  1.00 17.24 ? 80   GLN B CA  1 
ATOM   5201  C  C   . GLN C  1  80  ? 38.812  29.234  40.628  1.00 15.70 ? 80   GLN B C   1 
ATOM   5202  O  O   . GLN C  1  80  ? 38.231  30.271  40.898  1.00 15.43 ? 80   GLN B O   1 
ATOM   5203  C  CB  . GLN C  1  80  ? 41.174  29.592  41.254  1.00 17.38 ? 80   GLN B CB  1 
ATOM   5204  C  CG  . GLN C  1  80  ? 42.372  29.306  42.137  1.00 21.71 ? 80   GLN B CG  1 
ATOM   5205  C  CD  . GLN C  1  80  ? 43.582  30.145  41.716  1.00 26.66 ? 80   GLN B CD  1 
ATOM   5206  O  OE1 . GLN C  1  80  ? 44.110  30.001  40.597  1.00 26.98 ? 80   GLN B OE1 1 
ATOM   5207  N  NE2 . GLN C  1  80  ? 44.031  31.036  42.606  1.00 29.36 ? 80   GLN B NE2 1 
ATOM   5208  N  N   . GLU C  1  81  ? 38.529  28.494  39.544  1.00 14.80 ? 81   GLU B N   1 
ATOM   5209  C  CA  . GLU C  1  81  ? 37.520  28.944  38.581  1.00 14.73 ? 81   GLU B CA  1 
ATOM   5210  C  C   . GLU C  1  81  ? 36.293  28.032  38.459  1.00 13.79 ? 81   GLU B C   1 
ATOM   5211  O  O   . GLU C  1  81  ? 35.543  28.145  37.477  1.00 13.08 ? 81   GLU B O   1 
ATOM   5212  C  CB  . GLU C  1  81  ? 38.139  29.098  37.196  1.00 18.02 ? 81   GLU B CB  1 
ATOM   5213  C  CG  . GLU C  1  81  ? 39.577  29.598  37.176  1.00 26.84 ? 81   GLU B CG  1 
ATOM   5214  C  CD  . GLU C  1  81  ? 39.759  31.034  37.615  1.00 28.28 ? 81   GLU B CD  1 
ATOM   5215  O  OE1 . GLU C  1  81  ? 38.764  31.691  38.025  1.00 27.75 ? 81   GLU B OE1 1 
ATOM   5216  O  OE2 . GLU C  1  81  ? 40.914  31.505  37.548  1.00 31.40 ? 81   GLU B OE2 1 
ATOM   5217  N  N   . ARG C  1  82  ? 36.096  27.114  39.391  1.00 10.80 ? 82   ARG B N   1 
ATOM   5218  C  CA  . ARG C  1  82  ? 34.887  26.290  39.362  1.00 12.84 ? 82   ARG B CA  1 
ATOM   5219  C  C   . ARG C  1  82  ? 34.350  26.045  40.762  1.00 12.99 ? 82   ARG B C   1 
ATOM   5220  O  O   . ARG C  1  82  ? 35.109  25.877  41.735  1.00 12.86 ? 82   ARG B O   1 
ATOM   5221  C  CB  . ARG C  1  82  ? 35.095  24.897  38.693  1.00 14.41 ? 82   ARG B CB  1 
ATOM   5222  C  CG  . ARG C  1  82  ? 35.486  24.876  37.215  1.00 11.90 ? 82   ARG B CG  1 
ATOM   5223  C  CD  . ARG C  1  82  ? 34.324  25.167  36.272  1.00 7.61  ? 82   ARG B CD  1 
ATOM   5224  N  NE  . ARG C  1  82  ? 34.803  25.076  34.888  1.00 10.32 ? 82   ARG B NE  1 
ATOM   5225  C  CZ  . ARG C  1  82  ? 35.642  25.969  34.333  1.00 14.10 ? 82   ARG B CZ  1 
ATOM   5226  N  NH1 . ARG C  1  82  ? 36.009  27.040  35.034  1.00 18.41 ? 82   ARG B NH1 1 
ATOM   5227  N  NH2 . ARG C  1  82  ? 36.099  25.821  33.083  1.00 10.33 ? 82   ARG B NH2 1 
ATOM   5228  N  N   . SER C  1  83  ? 33.030  26.009  40.853  1.00 11.08 ? 83   SER B N   1 
ATOM   5229  C  CA  . SER C  1  83  ? 32.374  25.690  42.102  1.00 11.54 ? 83   SER B CA  1 
ATOM   5230  C  C   . SER C  1  83  ? 32.102  24.199  42.156  1.00 11.26 ? 83   SER B C   1 
ATOM   5231  O  O   . SER C  1  83  ? 32.082  23.534  41.116  1.00 10.63 ? 83   SER B O   1 
ATOM   5232  C  CB  . SER C  1  83  ? 31.042  26.433  42.221  1.00 11.94 ? 83   SER B CB  1 
ATOM   5233  O  OG  . SER C  1  83  ? 30.151  25.999  41.215  1.00 9.55  ? 83   SER B OG  1 
ATOM   5234  N  N   . LEU C  1  84  ? 31.882  23.699  43.370  1.00 10.09 ? 84   LEU B N   1 
ATOM   5235  C  CA  . LEU C  1  84  ? 31.570  22.301  43.599  1.00 8.43  ? 84   LEU B CA  1 
ATOM   5236  C  C   . LEU C  1  84  ? 30.256  21.965  42.888  1.00 8.13  ? 84   LEU B C   1 
ATOM   5237  O  O   . LEU C  1  84  ? 29.991  20.815  42.547  1.00 8.47  ? 84   LEU B O   1 
ATOM   5238  C  CB  . LEU C  1  84  ? 31.485  22.079  45.098  1.00 6.09  ? 84   LEU B CB  1 
ATOM   5239  C  CG  . LEU C  1  84  ? 31.504  20.643  45.606  1.00 6.99  ? 84   LEU B CG  1 
ATOM   5240  C  CD1 . LEU C  1  84  ? 32.479  19.799  44.796  1.00 10.16 ? 84   LEU B CD1 1 
ATOM   5241  C  CD2 . LEU C  1  84  ? 31.881  20.645  47.073  1.00 8.68  ? 84   LEU B CD2 1 
ATOM   5242  N  N   . MET C  1  85  ? 29.459  23.001  42.647  1.00 10.07 ? 85   MET B N   1 
ATOM   5243  C  CA  . MET C  1  85  ? 28.209  22.887  41.916  1.00 9.98  ? 85   MET B CA  1 
ATOM   5244  C  C   . MET C  1  85  ? 28.497  22.455  40.476  1.00 9.73  ? 85   MET B C   1 
ATOM   5245  O  O   . MET C  1  85  ? 27.647  21.836  39.837  1.00 7.69  ? 85   MET B O   1 
ATOM   5246  C  CB  . MET C  1  85  ? 27.459  24.240  41.961  1.00 13.17 ? 85   MET B CB  1 
ATOM   5247  C  CG  . MET C  1  85  ? 26.104  24.306  41.214  1.00 11.93 ? 85   MET B CG  1 
ATOM   5248  S  SD  . MET C  1  85  ? 24.818  23.198  41.858  1.00 10.90 ? 85   MET B SD  1 
ATOM   5249  C  CE  . MET C  1  85  ? 24.222  24.107  43.297  1.00 8.63  ? 85   MET B CE  1 
ATOM   5250  N  N   . PHE C  1  86  ? 29.724  22.736  39.991  1.00 9.72  ? 86   PHE B N   1 
ATOM   5251  C  CA  . PHE C  1  86  ? 30.170  22.281  38.655  1.00 10.38 ? 86   PHE B CA  1 
ATOM   5252  C  C   . PHE C  1  86  ? 30.270  20.748  38.635  1.00 8.75  ? 86   PHE B C   1 
ATOM   5253  O  O   . PHE C  1  86  ? 29.902  20.112  37.653  1.00 9.98  ? 86   PHE B O   1 
ATOM   5254  C  CB  . PHE C  1  86  ? 31.527  22.881  38.283  1.00 7.38  ? 86   PHE B CB  1 
ATOM   5255  C  CG  . PHE C  1  86  ? 32.074  22.423  36.963  1.00 8.72  ? 86   PHE B CG  1 
ATOM   5256  C  CD1 . PHE C  1  86  ? 31.431  22.742  35.763  1.00 8.60  ? 86   PHE B CD1 1 
ATOM   5257  C  CD2 . PHE C  1  86  ? 33.290  21.746  36.899  1.00 9.64  ? 86   PHE B CD2 1 
ATOM   5258  C  CE1 . PHE C  1  86  ? 31.998  22.411  34.535  1.00 9.35  ? 86   PHE B CE1 1 
ATOM   5259  C  CE2 . PHE C  1  86  ? 33.864  21.412  35.674  1.00 7.40  ? 86   PHE B CE2 1 
ATOM   5260  C  CZ  . PHE C  1  86  ? 33.223  21.748  34.488  1.00 9.86  ? 86   PHE B CZ  1 
ATOM   5261  N  N   . MET C  1  87  ? 30.771  20.175  39.726  1.00 7.02  ? 87   MET B N   1 
ATOM   5262  C  CA  . MET C  1  87  ? 30.805  18.740  39.880  1.00 5.89  ? 87   MET B CA  1 
ATOM   5263  C  C   . MET C  1  87  ? 29.369  18.191  39.990  1.00 5.90  ? 87   MET B C   1 
ATOM   5264  O  O   . MET C  1  87  ? 28.980  17.324  39.211  1.00 4.72  ? 87   MET B O   1 
ATOM   5265  C  CB  . MET C  1  87  ? 31.627  18.355  41.136  1.00 6.17  ? 87   MET B CB  1 
ATOM   5266  C  CG  . MET C  1  87  ? 31.706  16.844  41.481  1.00 8.58  ? 87   MET B CG  1 
ATOM   5267  S  SD  . MET C  1  87  ? 30.232  16.156  42.319  1.00 8.16  ? 87   MET B SD  1 
ATOM   5268  C  CE  . MET C  1  87  ? 30.544  16.530  44.039  1.00 8.14  ? 87   MET B CE  1 
ATOM   5269  N  N   . GLN C  1  88  ? 28.582  18.728  40.923  1.00 5.25  ? 88   GLN B N   1 
ATOM   5270  C  CA  . GLN C  1  88  ? 27.262  18.215  41.180  1.00 6.06  ? 88   GLN B CA  1 
ATOM   5271  C  C   . GLN C  1  88  ? 26.275  18.294  39.994  1.00 8.40  ? 88   GLN B C   1 
ATOM   5272  O  O   . GLN C  1  88  ? 25.455  17.358  39.811  1.00 7.51  ? 88   GLN B O   1 
ATOM   5273  C  CB  . GLN C  1  88  ? 26.681  18.888  42.412  1.00 9.65  ? 88   GLN B CB  1 
ATOM   5274  C  CG  . GLN C  1  88  ? 25.614  18.056  43.095  1.00 10.49 ? 88   GLN B CG  1 
ATOM   5275  C  CD  . GLN C  1  88  ? 26.071  16.630  43.358  1.00 12.48 ? 88   GLN B CD  1 
ATOM   5276  O  OE1 . GLN C  1  88  ? 26.908  16.374  44.234  1.00 8.93  ? 88   GLN B OE1 1 
ATOM   5277  N  NE2 . GLN C  1  88  ? 25.504  15.683  42.598  1.00 15.56 ? 88   GLN B NE2 1 
ATOM   5278  N  N   . TRP C  1  89  ? 26.305  19.392  39.192  1.00 10.10 ? 89   TRP B N   1 
ATOM   5279  C  CA  . TRP C  1  89  ? 25.414  19.467  38.010  1.00 9.53  ? 89   TRP B CA  1 
ATOM   5280  C  C   . TRP C  1  89  ? 25.757  18.327  37.077  1.00 11.35 ? 89   TRP B C   1 
ATOM   5281  O  O   . TRP C  1  89  ? 24.864  17.657  36.524  1.00 10.04 ? 89   TRP B O   1 
ATOM   5282  C  CB  . TRP C  1  89  ? 25.557  20.787  37.256  1.00 8.35  ? 89   TRP B CB  1 
ATOM   5283  C  CG  . TRP C  1  89  ? 24.632  20.885  36.069  1.00 9.70  ? 89   TRP B CG  1 
ATOM   5284  C  CD1 . TRP C  1  89  ? 24.943  20.683  34.743  1.00 10.09 ? 89   TRP B CD1 1 
ATOM   5285  C  CD2 . TRP C  1  89  ? 23.226  21.186  36.115  1.00 13.57 ? 89   TRP B CD2 1 
ATOM   5286  N  NE1 . TRP C  1  89  ? 23.814  20.835  33.952  1.00 9.73  ? 89   TRP B NE1 1 
ATOM   5287  C  CE2 . TRP C  1  89  ? 22.739  21.147  34.774  1.00 12.57 ? 89   TRP B CE2 1 
ATOM   5288  C  CE3 . TRP C  1  89  ? 22.311  21.489  37.171  1.00 12.91 ? 89   TRP B CE3 1 
ATOM   5289  C  CZ2 . TRP C  1  89  ? 21.377  21.409  34.468  1.00 13.43 ? 89   TRP B CZ2 1 
ATOM   5290  C  CZ3 . TRP C  1  89  ? 20.963  21.744  36.850  1.00 14.40 ? 89   TRP B CZ3 1 
ATOM   5291  C  CH2 . TRP C  1  89  ? 20.514  21.699  35.514  1.00 11.38 ? 89   TRP B CH2 1 
ATOM   5292  N  N   . GLY C  1  90  ? 27.091  18.084  36.949  1.00 11.04 ? 90   GLY B N   1 
ATOM   5293  C  CA  . GLY C  1  90  ? 27.606  16.990  36.139  1.00 8.53  ? 90   GLY B CA  1 
ATOM   5294  C  C   . GLY C  1  90  ? 26.978  15.643  36.489  1.00 7.84  ? 90   GLY B C   1 
ATOM   5295  O  O   . GLY C  1  90  ? 26.467  14.960  35.604  1.00 7.69  ? 90   GLY B O   1 
ATOM   5296  N  N   . GLN C  1  91  ? 27.011  15.283  37.771  1.00 5.70  ? 91   GLN B N   1 
ATOM   5297  C  CA  . GLN C  1  91  ? 26.421  14.048  38.234  1.00 7.02  ? 91   GLN B CA  1 
ATOM   5298  C  C   . GLN C  1  91  ? 24.887  14.010  38.013  1.00 7.73  ? 91   GLN B C   1 
ATOM   5299  O  O   . GLN C  1  91  ? 24.326  12.971  37.651  1.00 5.27  ? 91   GLN B O   1 
ATOM   5300  C  CB  . GLN C  1  91  ? 26.729  13.812  39.719  1.00 7.99  ? 91   GLN B CB  1 
ATOM   5301  C  CG  . GLN C  1  91  ? 26.233  12.449  40.183  1.00 7.89  ? 91   GLN B CG  1 
ATOM   5302  C  CD  . GLN C  1  91  ? 26.409  12.182  41.638  1.00 4.90  ? 91   GLN B CD  1 
ATOM   5303  O  OE1 . GLN C  1  91  ? 26.464  13.111  42.432  1.00 8.46  ? 91   GLN B OE1 1 
ATOM   5304  N  NE2 . GLN C  1  91  ? 26.498  10.899  41.999  1.00 3.80  ? 91   GLN B NE2 1 
ATOM   5305  N  N   . LEU C  1  92  ? 24.226  15.134  38.259  1.00 8.62  ? 92   LEU B N   1 
ATOM   5306  C  CA  . LEU C  1  92  ? 22.787  15.225  38.067  1.00 9.75  ? 92   LEU B CA  1 
ATOM   5307  C  C   . LEU C  1  92  ? 22.424  15.044  36.594  1.00 9.90  ? 92   LEU B C   1 
ATOM   5308  O  O   . LEU C  1  92  ? 21.431  14.362  36.238  1.00 7.80  ? 92   LEU B O   1 
ATOM   5309  C  CB  . LEU C  1  92  ? 22.307  16.589  38.547  1.00 9.73  ? 92   LEU B CB  1 
ATOM   5310  C  CG  . LEU C  1  92  ? 20.828  16.909  38.325  1.00 8.67  ? 92   LEU B CG  1 
ATOM   5311  C  CD1 . LEU C  1  92  ? 19.979  16.163  39.333  1.00 6.64  ? 92   LEU B CD1 1 
ATOM   5312  C  CD2 . LEU C  1  92  ? 20.613  18.408  38.454  1.00 9.09  ? 92   LEU B CD2 1 
ATOM   5313  N  N   . LEU C  1  93  ? 23.234  15.670  35.748  1.00 8.86  ? 93   LEU B N   1 
ATOM   5314  C  CA  . LEU C  1  93  ? 23.036  15.622  34.319  1.00 8.26  ? 93   LEU B CA  1 
ATOM   5315  C  C   . LEU C  1  93  ? 23.310  14.237  33.763  1.00 8.41  ? 93   LEU B C   1 
ATOM   5316  O  O   . LEU C  1  93  ? 22.569  13.768  32.896  1.00 7.61  ? 93   LEU B O   1 
ATOM   5317  C  CB  . LEU C  1  93  ? 23.926  16.645  33.653  1.00 5.89  ? 93   LEU B CB  1 
ATOM   5318  C  CG  . LEU C  1  93  ? 23.947  16.605  32.140  1.00 7.54  ? 93   LEU B CG  1 
ATOM   5319  C  CD1 . LEU C  1  93  ? 22.529  16.856  31.596  1.00 8.17  ? 93   LEU B CD1 1 
ATOM   5320  C  CD2 . LEU C  1  93  ? 24.946  17.635  31.623  1.00 5.06  ? 93   LEU B CD2 1 
ATOM   5321  N  N   . ASP C  1  94  ? 24.396  13.590  34.235  1.00 7.84  ? 94   ASP B N   1 
ATOM   5322  C  CA  . ASP C  1  94  ? 24.695  12.208  33.848  1.00 5.11  ? 94   ASP B CA  1 
ATOM   5323  C  C   . ASP C  1  94  ? 23.456  11.327  34.129  1.00 4.83  ? 94   ASP B C   1 
ATOM   5324  O  O   . ASP C  1  94  ? 23.087  10.470  33.335  1.00 3.92  ? 94   ASP B O   1 
ATOM   5325  C  CB  . ASP C  1  94  ? 25.926  11.710  34.654  1.00 5.34  ? 94   ASP B CB  1 
ATOM   5326  C  CG  . ASP C  1  94  ? 26.345  10.259  34.365  1.00 6.84  ? 94   ASP B CG  1 
ATOM   5327  O  OD1 . ASP C  1  94  ? 27.413  10.050  33.696  1.00 7.99  ? 94   ASP B OD1 1 
ATOM   5328  O  OD2 . ASP C  1  94  ? 25.629  9.321   34.815  1.00 4.03  ? 94   ASP B OD2 1 
ATOM   5329  N  N   . HIS C  1  95  ? 22.802  11.589  35.258  1.00 4.81  ? 95   HIS B N   1 
ATOM   5330  C  CA  . HIS C  1  95  ? 21.627  10.831  35.687  1.00 6.73  ? 95   HIS B CA  1 
ATOM   5331  C  C   . HIS C  1  95  ? 20.334  11.186  34.901  1.00 7.81  ? 95   HIS B C   1 
ATOM   5332  O  O   . HIS C  1  95  ? 19.297  10.569  35.129  1.00 8.07  ? 95   HIS B O   1 
ATOM   5333  C  CB  . HIS C  1  95  ? 21.425  10.989  37.200  1.00 4.95  ? 95   HIS B CB  1 
ATOM   5334  C  CG  . HIS C  1  95  ? 22.562  10.438  38.029  1.00 4.44  ? 95   HIS B CG  1 
ATOM   5335  N  ND1 . HIS C  1  95  ? 22.468  10.220  39.387  1.00 4.54  ? 95   HIS B ND1 1 
ATOM   5336  C  CD2 . HIS C  1  95  ? 23.791  10.000  37.675  1.00 6.46  ? 95   HIS B CD2 1 
ATOM   5337  C  CE1 . HIS C  1  95  ? 23.578  9.669   39.824  1.00 3.02  ? 95   HIS B CE1 1 
ATOM   5338  N  NE2 . HIS C  1  95  ? 24.398  9.525   38.802  1.00 4.58  ? 95   HIS B NE2 1 
ATOM   5339  N  N   . ASP C  1  96  ? 20.415  12.172  33.987  1.00 7.84  ? 96   ASP B N   1 
ATOM   5340  C  CA  . ASP C  1  96  ? 19.348  12.458  33.019  1.00 7.50  ? 96   ASP B CA  1 
ATOM   5341  C  C   . ASP C  1  96  ? 19.675  11.698  31.718  1.00 6.61  ? 96   ASP B C   1 
ATOM   5342  O  O   . ASP C  1  96  ? 18.804  11.420  30.900  1.00 7.47  ? 96   ASP B O   1 
ATOM   5343  C  CB  . ASP C  1  96  ? 19.284  13.991  32.729  1.00 10.15 ? 96   ASP B CB  1 
ATOM   5344  C  CG  . ASP C  1  96  ? 18.006  14.499  31.961  1.00 11.84 ? 96   ASP B CG  1 
ATOM   5345  O  OD1 . ASP C  1  96  ? 17.854  15.738  31.809  1.00 8.42  ? 96   ASP B OD1 1 
ATOM   5346  O  OD2 . ASP C  1  96  ? 17.170  13.670  31.513  1.00 10.77 ? 96   ASP B OD2 1 
ATOM   5347  N  N   . LEU C  1  97  ? 20.955  11.305  31.572  1.00 6.48  ? 97   LEU B N   1 
ATOM   5348  C  CA  . LEU C  1  97  ? 21.448  10.705  30.325  1.00 7.30  ? 97   LEU B CA  1 
ATOM   5349  C  C   . LEU C  1  97  ? 21.607  9.168   30.345  1.00 8.39  ? 97   LEU B C   1 
ATOM   5350  O  O   . LEU C  1  97  ? 21.126  8.500   29.404  1.00 8.60  ? 97   LEU B O   1 
ATOM   5351  C  CB  . LEU C  1  97  ? 22.772  11.357  29.908  1.00 9.22  ? 97   LEU B CB  1 
ATOM   5352  C  CG  . LEU C  1  97  ? 22.792  12.886  29.898  1.00 13.21 ? 97   LEU B CG  1 
ATOM   5353  C  CD1 . LEU C  1  97  ? 24.192  13.380  29.579  1.00 10.40 ? 97   LEU B CD1 1 
ATOM   5354  C  CD2 . LEU C  1  97  ? 21.769  13.428  28.913  1.00 8.61  ? 97   LEU B CD2 1 
ATOM   5355  N  N   . ASP C  1  98  ? 22.266  8.595   31.372  1.00 4.92  ? 98   ASP B N   1 
ATOM   5356  C  CA  . ASP C  1  98  ? 22.477  7.139   31.352  1.00 5.08  ? 98   ASP B CA  1 
ATOM   5357  C  C   . ASP C  1  98  ? 22.553  6.445   32.692  1.00 5.41  ? 98   ASP B C   1 
ATOM   5358  O  O   . ASP C  1  98  ? 23.080  6.942   33.678  1.00 6.66  ? 98   ASP B O   1 
ATOM   5359  C  CB  . ASP C  1  98  ? 23.736  6.751   30.509  1.00 7.43  ? 98   ASP B CB  1 
ATOM   5360  C  CG  . ASP C  1  98  ? 25.005  7.539   30.877  1.00 8.37  ? 98   ASP B CG  1 
ATOM   5361  O  OD1 . ASP C  1  98  ? 25.120  8.704   30.423  1.00 8.31  ? 98   ASP B OD1 1 
ATOM   5362  O  OD2 . ASP C  1  98  ? 25.877  6.994   31.622  1.00 5.88  ? 98   ASP B OD2 1 
ATOM   5363  N  N   . PHE C  1  99  ? 21.998  5.257   32.688  1.00 7.85  ? 99   PHE B N   1 
ATOM   5364  C  CA  . PHE C  1  99  ? 22.038  4.338   33.797  1.00 9.78  ? 99   PHE B CA  1 
ATOM   5365  C  C   . PHE C  1  99  ? 22.157  2.950   33.225  1.00 8.70  ? 99   PHE B C   1 
ATOM   5366  O  O   . PHE C  1  99  ? 21.285  2.513   32.470  1.00 7.69  ? 99   PHE B O   1 
ATOM   5367  C  CB  . PHE C  1  99  ? 20.774  4.442   34.691  1.00 11.90 ? 99   PHE B CB  1 
ATOM   5368  C  CG  . PHE C  1  99  ? 20.863  3.524   35.877  1.00 12.09 ? 99   PHE B CG  1 
ATOM   5369  C  CD1 . PHE C  1  99  ? 21.943  3.624   36.762  1.00 12.19 ? 99   PHE B CD1 1 
ATOM   5370  C  CD2 . PHE C  1  99  ? 19.931  2.519   36.068  1.00 12.98 ? 99   PHE B CD2 1 
ATOM   5371  C  CE1 . PHE C  1  99  ? 22.095  2.743   37.802  1.00 11.17 ? 99   PHE B CE1 1 
ATOM   5372  C  CE2 . PHE C  1  99  ? 20.074  1.621   37.122  1.00 15.92 ? 99   PHE B CE2 1 
ATOM   5373  C  CZ  . PHE C  1  99  ? 21.157  1.733   37.989  1.00 13.40 ? 99   PHE B CZ  1 
ATOM   5374  N  N   . THR C  1  100 ? 23.237  2.268   33.573  1.00 7.87  ? 100  THR B N   1 
ATOM   5375  C  CA  . THR C  1  100 ? 23.500  0.933   33.039  1.00 9.19  ? 100  THR B CA  1 
ATOM   5376  C  C   . THR C  1  100 ? 23.163  -0.150  34.052  1.00 9.32  ? 100  THR B C   1 
ATOM   5377  O  O   . THR C  1  100 ? 23.953  -0.397  34.974  1.00 9.76  ? 100  THR B O   1 
ATOM   5378  C  CB  . THR C  1  100 ? 24.980  0.804   32.629  1.00 9.26  ? 100  THR B CB  1 
ATOM   5379  O  OG1 . THR C  1  100 ? 25.335  1.925   31.814  1.00 7.97  ? 100  THR B OG1 1 
ATOM   5380  C  CG2 . THR C  1  100 ? 25.202  -0.467  31.832  1.00 5.47  ? 100  THR B CG2 1 
ATOM   5381  N  N   . PRO C  1  101 ? 21.980  -0.839  33.903  1.00 8.86  ? 101  PRO B N   1 
ATOM   5382  C  CA  . PRO C  1  101 ? 21.564  -1.890  34.823  1.00 7.25  ? 101  PRO B CA  1 
ATOM   5383  C  C   . PRO C  1  101 ? 22.550  -3.038  34.933  1.00 7.13  ? 101  PRO B C   1 
ATOM   5384  O  O   . PRO C  1  101 ? 23.262  -3.368  33.973  1.00 7.58  ? 101  PRO B O   1 
ATOM   5385  C  CB  . PRO C  1  101 ? 20.198  -2.350  34.274  1.00 8.87  ? 101  PRO B CB  1 
ATOM   5386  C  CG  . PRO C  1  101 ? 20.280  -1.996  32.837  1.00 7.49  ? 101  PRO B CG  1 
ATOM   5387  C  CD  . PRO C  1  101 ? 20.959  -0.654  32.840  1.00 6.22  ? 101  PRO B CD  1 
ATOM   5388  N  N   . GLU C  1  102 ? 22.575  -3.601  36.148  1.00 7.63  ? 102  GLU B N   1 
ATOM   5389  C  CA  . GLU C  1  102 ? 23.327  -4.781  36.563  1.00 8.60  ? 102  GLU B CA  1 
ATOM   5390  C  C   . GLU C  1  102 ? 22.370  -5.623  37.376  1.00 9.98  ? 102  GLU B C   1 
ATOM   5391  O  O   . GLU C  1  102 ? 21.373  -5.104  37.864  1.00 7.54  ? 102  GLU B O   1 
ATOM   5392  C  CB  . GLU C  1  102 ? 24.461  -4.409  37.518  1.00 9.40  ? 102  GLU B CB  1 
ATOM   5393  C  CG  . GLU C  1  102 ? 25.511  -3.488  36.965  1.00 12.50 ? 102  GLU B CG  1 
ATOM   5394  C  CD  . GLU C  1  102 ? 26.343  -2.793  38.053  1.00 10.13 ? 102  GLU B CD  1 
ATOM   5395  O  OE1 . GLU C  1  102 ? 26.907  -1.721  37.758  1.00 13.40 ? 102  GLU B OE1 1 
ATOM   5396  O  OE2 . GLU C  1  102 ? 26.435  -3.317  39.199  1.00 9.92  ? 102  GLU B OE2 1 
ATOM   5397  N  N   . PRO C  1  103 ? 22.622  -6.929  37.536  1.00 13.88 ? 103  PRO B N   1 
ATOM   5398  C  CA  . PRO C  1  103 ? 21.754  -7.784  38.355  1.00 17.82 ? 103  PRO B CA  1 
ATOM   5399  C  C   . PRO C  1  103 ? 21.973  -7.422  39.843  1.00 21.99 ? 103  PRO B C   1 
ATOM   5400  O  O   . PRO C  1  103 ? 23.042  -6.897  40.211  1.00 22.08 ? 103  PRO B O   1 
ATOM   5401  C  CB  . PRO C  1  103 ? 22.231  -9.201  37.990  1.00 16.66 ? 103  PRO B CB  1 
ATOM   5402  C  CG  . PRO C  1  103 ? 23.679  -8.998  37.713  1.00 17.24 ? 103  PRO B CG  1 
ATOM   5403  C  CD  . PRO C  1  103 ? 23.725  -7.713  36.917  1.00 15.07 ? 103  PRO B CD  1 
ATOM   5404  N  N   . ALA C  1  104 ? 20.946  -7.654  40.694  1.00 26.09 ? 104  ALA B N   1 
ATOM   5405  C  CA  . ALA C  1  104 ? 21.034  -7.313  42.133  1.00 28.63 ? 104  ALA B CA  1 
ATOM   5406  C  C   . ALA C  1  104 ? 21.957  -8.250  42.911  1.00 28.94 ? 104  ALA B C   1 
ATOM   5407  O  O   . ALA C  1  104 ? 22.568  -7.782  43.902  1.00 30.23 ? 104  ALA B O   1 
ATOM   5408  C  CB  . ALA C  1  104 ? 19.642  -7.308  42.770  1.00 28.78 ? 104  ALA B CB  1 
ATOM   5409  O  OXT . ALA C  1  104 ? 22.057  -9.434  42.512  1.00 30.44 ? 104  ALA B OXT 1 
ATOM   5410  N  N   . VAL D  2  1   ? 26.771  -17.058 41.837  1.00 27.65 ? 113  VAL D N   1 
ATOM   5411  C  CA  . VAL D  2  1   ? 27.826  -16.465 42.727  1.00 25.96 ? 113  VAL D CA  1 
ATOM   5412  C  C   . VAL D  2  1   ? 27.402  -15.080 43.189  1.00 24.25 ? 113  VAL D C   1 
ATOM   5413  O  O   . VAL D  2  1   ? 26.929  -14.276 42.386  1.00 25.86 ? 113  VAL D O   1 
ATOM   5414  C  CB  . VAL D  2  1   ? 29.215  -16.375 41.996  1.00 26.80 ? 113  VAL D CB  1 
ATOM   5415  C  CG1 . VAL D  2  1   ? 30.230  -15.578 42.826  1.00 23.56 ? 113  VAL D CG1 1 
ATOM   5416  C  CG2 . VAL D  2  1   ? 29.749  -17.782 41.714  1.00 26.20 ? 113  VAL D CG2 1 
ATOM   5417  N  N   . ASN D  2  2   ? 27.546  -14.820 44.487  1.00 22.38 ? 114  ASN D N   1 
ATOM   5418  C  CA  . ASN D  2  2   ? 27.213  -13.518 45.043  1.00 21.23 ? 114  ASN D CA  1 
ATOM   5419  C  C   . ASN D  2  2   ? 28.413  -12.578 44.925  1.00 20.24 ? 114  ASN D C   1 
ATOM   5420  O  O   . ASN D  2  2   ? 29.416  -12.727 45.628  1.00 21.53 ? 114  ASN D O   1 
ATOM   5421  C  CB  . ASN D  2  2   ? 26.779  -13.663 46.502  1.00 22.14 ? 114  ASN D CB  1 
ATOM   5422  C  CG  . ASN D  2  2   ? 26.006  -12.457 47.003  1.00 25.28 ? 114  ASN D CG  1 
ATOM   5423  O  OD1 . ASN D  2  2   ? 26.575  -11.380 47.244  1.00 27.89 ? 114  ASN D OD1 1 
ATOM   5424  N  ND2 . ASN D  2  2   ? 24.694  -12.623 47.159  1.00 26.33 ? 114  ASN D ND2 1 
ATOM   5425  N  N   . CYS D  2  3   ? 28.282  -11.599 44.028  1.00 20.61 ? 115  CYS D N   1 
ATOM   5426  C  CA  . CYS D  2  3   ? 29.345  -10.650 43.704  1.00 18.51 ? 115  CYS D CA  1 
ATOM   5427  C  C   . CYS D  2  3   ? 29.664  -9.707  44.850  1.00 19.98 ? 115  CYS D C   1 
ATOM   5428  O  O   . CYS D  2  3   ? 30.773  -9.148  44.903  1.00 18.44 ? 115  CYS D O   1 
ATOM   5429  C  CB  . CYS D  2  3   ? 28.943  -9.830  42.485  1.00 18.72 ? 115  CYS D CB  1 
ATOM   5430  S  SG  . CYS D  2  3   ? 28.170  -10.773 41.148  1.00 15.06 ? 115  CYS D SG  1 
ATOM   5431  N  N   . GLU D  2  4   ? 28.688  -9.491  45.735  1.00 18.38 ? 116  GLU D N   1 
ATOM   5432  C  CA  . GLU D  2  4   ? 28.906  -8.639  46.894  1.00 20.42 ? 116  GLU D CA  1 
ATOM   5433  C  C   . GLU D  2  4   ? 29.663  -9.371  48.014  1.00 20.39 ? 116  GLU D C   1 
ATOM   5434  O  O   . GLU D  2  4   ? 30.496  -8.779  48.703  1.00 20.56 ? 116  GLU D O   1 
ATOM   5435  C  CB  . GLU D  2  4   ? 27.567  -8.109  47.416  1.00 20.87 ? 116  GLU D CB  1 
ATOM   5436  C  CG  . GLU D  2  4   ? 27.643  -7.347  48.744  1.00 25.18 ? 116  GLU D CG  1 
ATOM   5437  C  CD  . GLU D  2  4   ? 28.616  -6.149  48.761  1.00 28.99 ? 116  GLU D CD  1 
ATOM   5438  O  OE1 . GLU D  2  4   ? 28.784  -5.484  47.704  1.00 29.78 ? 116  GLU D OE1 1 
ATOM   5439  O  OE2 . GLU D  2  4   ? 29.199  -5.874  49.841  1.00 26.91 ? 116  GLU D OE2 1 
ATOM   5440  N  N   . THR D  2  5   ? 29.396  -10.661 48.178  1.00 21.47 ? 117  THR D N   1 
ATOM   5441  C  CA  . THR D  2  5   ? 29.985  -11.396 49.292  1.00 21.60 ? 117  THR D CA  1 
ATOM   5442  C  C   . THR D  2  5   ? 31.057  -12.392 48.872  1.00 21.62 ? 117  THR D C   1 
ATOM   5443  O  O   . THR D  2  5   ? 31.746  -12.954 49.734  1.00 24.04 ? 117  THR D O   1 
ATOM   5444  C  CB  . THR D  2  5   ? 28.896  -12.139 50.111  1.00 20.29 ? 117  THR D CB  1 
ATOM   5445  O  OG1 . THR D  2  5   ? 28.385  -13.236 49.350  1.00 19.09 ? 117  THR D OG1 1 
ATOM   5446  C  CG2 . THR D  2  5   ? 27.749  -11.202 50.472  1.00 18.19 ? 117  THR D CG2 1 
ATOM   5447  N  N   . SER D  2  6   ? 31.230  -12.615 47.578  1.00 19.80 ? 118  SER D N   1 
ATOM   5448  C  CA  . SER D  2  6   ? 32.236  -13.582 47.144  1.00 19.05 ? 118  SER D CA  1 
ATOM   5449  C  C   . SER D  2  6   ? 33.231  -12.988 46.114  1.00 19.75 ? 118  SER D C   1 
ATOM   5450  O  O   . SER D  2  6   ? 32.876  -12.096 45.338  1.00 20.97 ? 118  SER D O   1 
ATOM   5451  C  CB  . SER D  2  6   ? 31.515  -14.825 46.578  1.00 18.48 ? 118  SER D CB  1 
ATOM   5452  O  OG  . SER D  2  6   ? 32.425  -15.822 46.150  1.00 15.04 ? 118  SER D OG  1 
ATOM   5453  N  N   . CYS D  2  7   ? 34.487  -13.493 46.126  1.00 16.42 ? 119  CYS D N   1 
ATOM   5454  C  CA  . CYS D  2  7   ? 35.524  -13.069 45.180  1.00 14.76 ? 119  CYS D CA  1 
ATOM   5455  C  C   . CYS D  2  7   ? 35.699  -14.059 44.058  1.00 13.83 ? 119  CYS D C   1 
ATOM   5456  O  O   . CYS D  2  7   ? 36.632  -13.953 43.273  1.00 12.05 ? 119  CYS D O   1 
ATOM   5457  C  CB  . CYS D  2  7   ? 36.870  -12.866 45.907  1.00 14.09 ? 119  CYS D CB  1 
ATOM   5458  S  SG  . CYS D  2  7   ? 36.876  -11.377 46.951  1.00 16.25 ? 119  CYS D SG  1 
ATOM   5459  N  N   . VAL D  2  8   ? 34.792  -15.037 43.981  1.00 15.53 ? 120  VAL D N   1 
ATOM   5460  C  CA  . VAL D  2  8   ? 34.831  -16.047 42.925  1.00 15.68 ? 120  VAL D CA  1 
ATOM   5461  C  C   . VAL D  2  8   ? 34.417  -15.449 41.598  1.00 15.32 ? 120  VAL D C   1 
ATOM   5462  O  O   . VAL D  2  8   ? 33.395  -14.787 41.518  1.00 17.66 ? 120  VAL D O   1 
ATOM   5463  C  CB  . VAL D  2  8   ? 33.899  -17.243 43.237  1.00 17.59 ? 120  VAL D CB  1 
ATOM   5464  C  CG1 . VAL D  2  8   ? 33.803  -18.156 42.014  1.00 17.02 ? 120  VAL D CG1 1 
ATOM   5465  C  CG2 . VAL D  2  8   ? 34.413  -18.018 44.453  1.00 16.24 ? 120  VAL D CG2 1 
ATOM   5466  N  N   . GLN D  2  9   ? 35.199  -15.681 40.559  1.00 14.82 ? 121  GLN D N   1 
ATOM   5467  C  CA  . GLN D  2  9   ? 34.859  -15.100 39.283  1.00 17.54 ? 121  GLN D CA  1 
ATOM   5468  C  C   . GLN D  2  9   ? 33.995  -16.013 38.403  1.00 17.08 ? 121  GLN D C   1 
ATOM   5469  O  O   . GLN D  2  9   ? 34.509  -16.790 37.593  1.00 17.38 ? 121  GLN D O   1 
ATOM   5470  C  CB  . GLN D  2  9   ? 36.101  -14.663 38.497  1.00 17.52 ? 121  GLN D CB  1 
ATOM   5471  C  CG  . GLN D  2  9   ? 35.729  -13.920 37.206  1.00 17.51 ? 121  GLN D CG  1 
ATOM   5472  C  CD  . GLN D  2  9   ? 36.890  -13.736 36.270  1.00 17.51 ? 121  GLN D CD  1 
ATOM   5473  O  OE1 . GLN D  2  9   ? 37.469  -12.660 36.178  1.00 19.62 ? 121  GLN D OE1 1 
ATOM   5474  N  NE2 . GLN D  2  9   ? 37.236  -14.793 35.557  1.00 19.82 ? 121  GLN D NE2 1 
ATOM   5475  N  N   . GLN D  2  10  ? 32.687  -15.901 38.567  1.00 15.76 ? 122  GLN D N   1 
ATOM   5476  C  CA  . GLN D  2  10  ? 31.755  -16.602 37.697  1.00 16.54 ? 122  GLN D CA  1 
ATOM   5477  C  C   . GLN D  2  10  ? 30.581  -15.691 37.412  1.00 14.92 ? 122  GLN D C   1 
ATOM   5478  O  O   . GLN D  2  10  ? 30.251  -14.861 38.247  1.00 13.30 ? 122  GLN D O   1 
ATOM   5479  C  CB  . GLN D  2  10  ? 31.291  -17.917 38.334  1.00 19.00 ? 122  GLN D CB  1 
ATOM   5480  C  CG  . GLN D  2  10  ? 32.335  -19.042 38.282  1.00 22.77 ? 122  GLN D CG  1 
ATOM   5481  C  CD  . GLN D  2  10  ? 32.743  -19.453 36.864  1.00 26.48 ? 122  GLN D CD  1 
ATOM   5482  O  OE1 . GLN D  2  10  ? 31.961  -19.369 35.930  1.00 30.14 ? 122  GLN D OE1 1 
ATOM   5483  N  NE2 . GLN D  2  10  ? 33.978  -19.906 36.694  1.00 26.65 ? 122  GLN D NE2 1 
ATOM   5484  N  N   . PRO D  2  11  ? 29.950  -15.794 36.228  1.00 13.58 ? 123  PRO D N   1 
ATOM   5485  C  CA  . PRO D  2  11  ? 28.797  -14.950 35.856  1.00 14.81 ? 123  PRO D CA  1 
ATOM   5486  C  C   . PRO D  2  11  ? 27.801  -14.805 37.000  1.00 13.60 ? 123  PRO D C   1 
ATOM   5487  O  O   . PRO D  2  11  ? 27.457  -15.799 37.633  1.00 15.73 ? 123  PRO D O   1 
ATOM   5488  C  CB  . PRO D  2  11  ? 28.194  -15.707 34.684  1.00 14.90 ? 123  PRO D CB  1 
ATOM   5489  C  CG  . PRO D  2  11  ? 29.408  -16.233 34.014  1.00 14.37 ? 123  PRO D CG  1 
ATOM   5490  C  CD  . PRO D  2  11  ? 30.261  -16.748 35.150  1.00 15.40 ? 123  PRO D CD  1 
ATOM   5491  N  N   . PRO D  2  12  ? 27.300  -13.579 37.275  1.00 12.91 ? 124  PRO D N   1 
ATOM   5492  C  CA  . PRO D  2  12  ? 27.632  -12.353 36.552  1.00 13.07 ? 124  PRO D CA  1 
ATOM   5493  C  C   . PRO D  2  12  ? 28.742  -11.503 37.208  1.00 12.61 ? 124  PRO D C   1 
ATOM   5494  O  O   . PRO D  2  12  ? 28.865  -10.308 36.936  1.00 12.09 ? 124  PRO D O   1 
ATOM   5495  C  CB  . PRO D  2  12  ? 26.286  -11.643 36.572  1.00 13.39 ? 124  PRO D CB  1 
ATOM   5496  C  CG  . PRO D  2  12  ? 25.853  -11.871 37.983  1.00 13.23 ? 124  PRO D CG  1 
ATOM   5497  C  CD  . PRO D  2  12  ? 26.257  -13.297 38.292  1.00 14.71 ? 124  PRO D CD  1 
ATOM   5498  N  N   . CYS D  2  13  ? 29.550  -12.112 38.052  1.00 12.39 ? 125  CYS D N   1 
ATOM   5499  C  CA  . CYS D  2  13  ? 30.572  -11.369 38.768  1.00 13.08 ? 125  CYS D CA  1 
ATOM   5500  C  C   . CYS D  2  13  ? 31.895  -11.287 38.044  1.00 11.34 ? 125  CYS D C   1 
ATOM   5501  O  O   . CYS D  2  13  ? 32.401  -12.264 37.520  1.00 13.79 ? 125  CYS D O   1 
ATOM   5502  C  CB  . CYS D  2  13  ? 30.803  -11.983 40.138  1.00 12.69 ? 125  CYS D CB  1 
ATOM   5503  S  SG  . CYS D  2  13  ? 29.286  -12.474 41.014  1.00 19.55 ? 125  CYS D SG  1 
ATOM   5504  N  N   . PHE D  2  14  ? 32.467  -10.102 38.076  1.00 11.21 ? 126  PHE D N   1 
ATOM   5505  C  CA  . PHE D  2  14  ? 33.812  -9.835  37.528  1.00 12.12 ? 126  PHE D CA  1 
ATOM   5506  C  C   . PHE D  2  14  ? 34.605  -9.050  38.587  1.00 11.17 ? 126  PHE D C   1 
ATOM   5507  O  O   . PHE D  2  14  ? 34.904  -7.899  38.397  1.00 9.67  ? 126  PHE D O   1 
ATOM   5508  C  CB  . PHE D  2  14  ? 33.680  -9.006  36.238  1.00 9.57  ? 126  PHE D CB  1 
ATOM   5509  C  CG  . PHE D  2  14  ? 34.944  -8.768  35.468  1.00 10.32 ? 126  PHE D CG  1 
ATOM   5510  C  CD1 . PHE D  2  14  ? 36.012  -9.695  35.477  1.00 10.41 ? 126  PHE D CD1 1 
ATOM   5511  C  CD2 . PHE D  2  14  ? 35.068  -7.631  34.692  1.00 9.48  ? 126  PHE D CD2 1 
ATOM   5512  C  CE1 . PHE D  2  14  ? 37.164  -9.470  34.716  1.00 7.20  ? 126  PHE D CE1 1 
ATOM   5513  C  CE2 . PHE D  2  14  ? 36.229  -7.405  33.931  1.00 11.40 ? 126  PHE D CE2 1 
ATOM   5514  C  CZ  . PHE D  2  14  ? 37.272  -8.323  33.943  1.00 7.25  ? 126  PHE D CZ  1 
ATOM   5515  N  N   . PRO D  2  15  ? 34.903  -9.666  39.752  1.00 10.89 ? 127  PRO D N   1 
ATOM   5516  C  CA  . PRO D  2  15  ? 35.640  -9.008  40.836  1.00 10.93 ? 127  PRO D CA  1 
ATOM   5517  C  C   . PRO D  2  15  ? 37.006  -8.460  40.407  1.00 10.05 ? 127  PRO D C   1 
ATOM   5518  O  O   . PRO D  2  15  ? 37.728  -9.098  39.661  1.00 11.66 ? 127  PRO D O   1 
ATOM   5519  C  CB  . PRO D  2  15  ? 35.779  -10.111 41.884  1.00 9.56  ? 127  PRO D CB  1 
ATOM   5520  C  CG  . PRO D  2  15  ? 35.698  -11.351 41.059  1.00 9.78  ? 127  PRO D CG  1 
ATOM   5521  C  CD  . PRO D  2  15  ? 34.590  -11.064 40.107  1.00 8.92  ? 127  PRO D CD  1 
ATOM   5522  N  N   . LEU D  2  16  ? 37.331  -7.256  40.869  1.00 11.91 ? 128  LEU D N   1 
ATOM   5523  C  CA  . LEU D  2  16  ? 38.652  -6.673  40.640  1.00 12.64 ? 128  LEU D CA  1 
ATOM   5524  C  C   . LEU D  2  16  ? 39.638  -7.353  41.584  1.00 14.30 ? 128  LEU D C   1 
ATOM   5525  O  O   . LEU D  2  16  ? 39.422  -7.336  42.810  1.00 13.59 ? 128  LEU D O   1 
ATOM   5526  C  CB  . LEU D  2  16  ? 38.673  -5.161  40.943  1.00 11.61 ? 128  LEU D CB  1 
ATOM   5527  C  CG  . LEU D  2  16  ? 37.999  -4.208  39.946  1.00 10.52 ? 128  LEU D CG  1 
ATOM   5528  C  CD1 . LEU D  2  16  ? 36.477  -4.352  40.005  1.00 9.09  ? 128  LEU D CD1 1 
ATOM   5529  C  CD2 . LEU D  2  16  ? 38.385  -2.783  40.283  1.00 9.40  ? 128  LEU D CD2 1 
ATOM   5530  N  N   . LYS D  2  17  ? 40.696  -7.953  41.017  1.00 13.94 ? 129  LYS D N   1 
ATOM   5531  C  CA  . LYS D  2  17  ? 41.732  -8.614  41.819  1.00 14.69 ? 129  LYS D CA  1 
ATOM   5532  C  C   . LYS D  2  17  ? 42.635  -7.609  42.567  1.00 12.92 ? 129  LYS D C   1 
ATOM   5533  O  O   . LYS D  2  17  ? 42.791  -6.462  42.154  1.00 10.34 ? 129  LYS D O   1 
ATOM   5534  C  CB  . LYS D  2  17  ? 42.557  -9.544  40.911  1.00 17.60 ? 129  LYS D CB  1 
ATOM   5535  C  CG  . LYS D  2  17  ? 41.813  -10.835 40.567  1.00 20.54 ? 129  LYS D CG  1 
ATOM   5536  C  CD  . LYS D  2  17  ? 42.456  -11.601 39.414  1.00 23.13 ? 129  LYS D CD  1 
ATOM   5537  C  CE  . LYS D  2  17  ? 41.775  -12.953 39.245  1.00 23.21 ? 129  LYS D CE  1 
ATOM   5538  N  NZ  . LYS D  2  17  ? 40.284  -12.839 39.329  1.00 27.02 ? 129  LYS D NZ  1 
ATOM   5539  N  N   . ILE D  2  18  ? 43.214  -8.043  43.684  1.00 11.86 ? 130  ILE D N   1 
ATOM   5540  C  CA  . ILE D  2  18  ? 44.065  -7.164  44.475  1.00 11.40 ? 130  ILE D CA  1 
ATOM   5541  C  C   . ILE D  2  18  ? 45.549  -7.411  44.164  1.00 11.08 ? 130  ILE D C   1 
ATOM   5542  O  O   . ILE D  2  18  ? 46.017  -8.535  44.251  1.00 12.19 ? 130  ILE D O   1 
ATOM   5543  C  CB  . ILE D  2  18  ? 43.806  -7.360  46.001  1.00 12.68 ? 130  ILE D CB  1 
ATOM   5544  C  CG1 . ILE D  2  18  ? 42.299  -7.225  46.310  1.00 14.22 ? 130  ILE D CG1 1 
ATOM   5545  C  CG2 . ILE D  2  18  ? 44.619  -6.341  46.820  1.00 10.70 ? 130  ILE D CG2 1 
ATOM   5546  C  CD1 . ILE D  2  18  ? 41.702  -5.846  46.026  1.00 12.24 ? 130  ILE D CD1 1 
ATOM   5547  N  N   . PRO D  2  19  ? 46.317  -6.373  43.783  1.00 9.48  ? 131  PRO D N   1 
ATOM   5548  C  CA  . PRO D  2  19  ? 47.736  -6.538  43.475  1.00 10.77 ? 131  PRO D CA  1 
ATOM   5549  C  C   . PRO D  2  19  ? 48.568  -6.664  44.770  1.00 9.47  ? 131  PRO D C   1 
ATOM   5550  O  O   . PRO D  2  19  ? 48.064  -6.418  45.867  1.00 8.10  ? 131  PRO D O   1 
ATOM   5551  C  CB  . PRO D  2  19  ? 48.058  -5.240  42.710  1.00 11.12 ? 131  PRO D CB  1 
ATOM   5552  C  CG  . PRO D  2  19  ? 47.194  -4.236  43.406  1.00 9.07  ? 131  PRO D CG  1 
ATOM   5553  C  CD  . PRO D  2  19  ? 45.898  -4.956  43.640  1.00 8.85  ? 131  PRO D CD  1 
ATOM   5554  N  N   . PRO D  2  20  ? 49.826  -7.110  44.655  1.00 9.58  ? 132  PRO D N   1 
ATOM   5555  C  CA  . PRO D  2  20  ? 50.746  -7.220  45.804  1.00 10.02 ? 132  PRO D CA  1 
ATOM   5556  C  C   . PRO D  2  20  ? 51.042  -5.829  46.353  1.00 9.15  ? 132  PRO D C   1 
ATOM   5557  O  O   . PRO D  2  20  ? 50.986  -4.842  45.617  1.00 10.21 ? 132  PRO D O   1 
ATOM   5558  C  CB  . PRO D  2  20  ? 52.007  -7.835  45.186  1.00 11.57 ? 132  PRO D CB  1 
ATOM   5559  C  CG  . PRO D  2  20  ? 51.467  -8.569  43.995  1.00 14.51 ? 132  PRO D CG  1 
ATOM   5560  C  CD  . PRO D  2  20  ? 50.442  -7.634  43.422  1.00 8.81  ? 132  PRO D CD  1 
ATOM   5561  N  N   . ASN D  2  21  ? 51.371  -5.748  47.628  1.00 9.74  ? 133  ASN D N   1 
ATOM   5562  C  CA  . ASN D  2  21  ? 51.715  -4.472  48.288  1.00 12.38 ? 133  ASN D CA  1 
ATOM   5563  C  C   . ASN D  2  21  ? 50.688  -3.390  48.021  1.00 14.09 ? 133  ASN D C   1 
ATOM   5564  O  O   . ASN D  2  21  ? 51.043  -2.256  47.726  1.00 13.20 ? 133  ASN D O   1 
ATOM   5565  C  CB  . ASN D  2  21  ? 53.102  -3.943  47.872  1.00 10.96 ? 133  ASN D CB  1 
ATOM   5566  C  CG  . ASN D  2  21  ? 54.258  -4.837  48.303  1.00 10.84 ? 133  ASN D CG  1 
ATOM   5567  O  OD1 . ASN D  2  21  ? 55.155  -5.120  47.506  1.00 11.07 ? 133  ASN D OD1 1 
ATOM   5568  N  ND2 . ASN D  2  21  ? 54.242  -5.282  49.556  1.00 6.90  ? 133  ASN D ND2 1 
ATOM   5569  N  N   . ASP D  2  22  ? 49.407  -3.773  48.070  1.00 16.22 ? 134  ASP D N   1 
ATOM   5570  C  CA  . ASP D  2  22  ? 48.322  -2.814  47.990  1.00 15.56 ? 134  ASP D CA  1 
ATOM   5571  C  C   . ASP D  2  22  ? 48.355  -2.016  49.283  1.00 15.35 ? 134  ASP D C   1 
ATOM   5572  O  O   . ASP D  2  22  ? 48.469  -2.584  50.366  1.00 14.34 ? 134  ASP D O   1 
ATOM   5573  C  CB  . ASP D  2  22  ? 46.968  -3.535  47.863  1.00 16.53 ? 134  ASP D CB  1 
ATOM   5574  C  CG  . ASP D  2  22  ? 45.813  -2.600  47.529  1.00 16.13 ? 134  ASP D CG  1 
ATOM   5575  O  OD1 . ASP D  2  22  ? 45.449  -2.543  46.326  1.00 15.04 ? 134  ASP D OD1 1 
ATOM   5576  O  OD2 . ASP D  2  22  ? 45.276  -1.931  48.458  1.00 11.20 ? 134  ASP D OD2 1 
ATOM   5577  N  N   . PRO D  2  23  ? 48.264  -0.694  49.183  1.00 16.99 ? 135  PRO D N   1 
ATOM   5578  C  CA  . PRO D  2  23  ? 48.293  0.202   50.352  1.00 17.82 ? 135  PRO D CA  1 
ATOM   5579  C  C   . PRO D  2  23  ? 47.094  0.038   51.331  1.00 18.30 ? 135  PRO D C   1 
ATOM   5580  O  O   . PRO D  2  23  ? 47.131  0.543   52.454  1.00 17.23 ? 135  PRO D O   1 
ATOM   5581  C  CB  . PRO D  2  23  ? 48.347  1.592   49.706  1.00 18.41 ? 135  PRO D CB  1 
ATOM   5582  C  CG  . PRO D  2  23  ? 47.592  1.393   48.429  1.00 20.48 ? 135  PRO D CG  1 
ATOM   5583  C  CD  . PRO D  2  23  ? 48.091  0.064   47.920  1.00 17.15 ? 135  PRO D CD  1 
ATOM   5584  N  N   . ARG D  2  24  ? 46.040  -0.682  50.926  1.00 17.42 ? 136  ARG D N   1 
ATOM   5585  C  CA  . ARG D  2  24  ? 44.884  -0.832  51.817  1.00 19.14 ? 136  ARG D CA  1 
ATOM   5586  C  C   . ARG D  2  24  ? 44.484  -2.287  52.054  1.00 18.58 ? 136  ARG D C   1 
ATOM   5587  O  O   . ARG D  2  24  ? 44.265  -2.684  53.202  1.00 17.70 ? 136  ARG D O   1 
ATOM   5588  C  CB  . ARG D  2  24  ? 43.666  -0.051  51.273  1.00 18.08 ? 136  ARG D CB  1 
ATOM   5589  C  CG  . ARG D  2  24  ? 42.374  -0.381  52.004  1.00 17.98 ? 136  ARG D CG  1 
ATOM   5590  C  CD  . ARG D  2  24  ? 41.239  0.552   51.626  1.00 18.70 ? 136  ARG D CD  1 
ATOM   5591  N  NE  . ARG D  2  24  ? 40.890  0.499   50.210  1.00 18.00 ? 136  ARG D NE  1 
ATOM   5592  C  CZ  . ARG D  2  24  ? 39.834  -0.144  49.712  1.00 19.86 ? 136  ARG D CZ  1 
ATOM   5593  N  NH1 . ARG D  2  24  ? 39.048  -0.868  50.522  1.00 14.37 ? 136  ARG D NH1 1 
ATOM   5594  N  NH2 . ARG D  2  24  ? 39.577  -0.079  48.390  1.00 17.09 ? 136  ARG D NH2 1 
ATOM   5595  N  N   . ILE D  2  25  ? 44.334  -3.056  50.963  1.00 19.96 ? 137  ILE D N   1 
ATOM   5596  C  CA  . ILE D  2  25  ? 43.903  -4.452  51.062  1.00 19.84 ? 137  ILE D CA  1 
ATOM   5597  C  C   . ILE D  2  25  ? 45.122  -5.372  50.963  1.00 20.74 ? 137  ILE D C   1 
ATOM   5598  O  O   . ILE D  2  25  ? 45.602  -5.708  49.868  1.00 17.85 ? 137  ILE D O   1 
ATOM   5599  C  CB  . ILE D  2  25  ? 42.840  -4.803  49.973  1.00 21.05 ? 137  ILE D CB  1 
ATOM   5600  C  CG1 . ILE D  2  25  ? 41.747  -3.720  49.933  1.00 18.27 ? 137  ILE D CG1 1 
ATOM   5601  C  CG2 . ILE D  2  25  ? 42.215  -6.165  50.249  1.00 16.06 ? 137  ILE D CG2 1 
ATOM   5602  C  CD1 . ILE D  2  25  ? 41.899  -2.746  48.785  1.00 19.37 ? 137  ILE D CD1 1 
ATOM   5603  N  N   . LYS D  2  26  ? 45.613  -5.746  52.150  1.00 22.05 ? 138  LYS D N   1 
ATOM   5604  C  CA  . LYS D  2  26  ? 46.829  -6.537  52.315  1.00 24.02 ? 138  LYS D CA  1 
ATOM   5605  C  C   . LYS D  2  26  ? 46.607  -7.981  51.930  1.00 22.51 ? 138  LYS D C   1 
ATOM   5606  O  O   . LYS D  2  26  ? 47.537  -8.697  51.576  1.00 21.86 ? 138  LYS D O   1 
ATOM   5607  C  CB  . LYS D  2  26  ? 47.306  -6.463  53.778  1.00 26.96 ? 138  LYS D CB  1 
ATOM   5608  C  CG  . LYS D  2  26  ? 47.052  -5.132  54.484  1.00 30.67 ? 138  LYS D CG  1 
ATOM   5609  C  CD  . LYS D  2  26  ? 47.622  -3.923  53.732  1.00 31.95 ? 138  LYS D CD  1 
ATOM   5610  C  CE  . LYS D  2  26  ? 49.119  -4.041  53.453  1.00 33.25 ? 138  LYS D CE  1 
ATOM   5611  N  NZ  . LYS D  2  26  ? 49.415  -4.856  52.236  1.00 32.95 ? 138  LYS D NZ  1 
ATOM   5612  N  N   . ASN D  2  27  ? 45.369  -8.395  52.009  1.00 22.30 ? 139  ASN D N   1 
ATOM   5613  C  CA  . ASN D  2  27  ? 44.998  -9.739  51.655  1.00 22.87 ? 139  ASN D CA  1 
ATOM   5614  C  C   . ASN D  2  27  ? 44.661  -9.848  50.139  1.00 23.66 ? 139  ASN D C   1 
ATOM   5615  O  O   . ASN D  2  27  ? 43.642  -9.302  49.673  1.00 22.32 ? 139  ASN D O   1 
ATOM   5616  C  CB  . ASN D  2  27  ? 43.815  -10.130 52.535  1.00 25.27 ? 139  ASN D CB  1 
ATOM   5617  C  CG  . ASN D  2  27  ? 43.291  -11.500 52.231  1.00 28.73 ? 139  ASN D CG  1 
ATOM   5618  O  OD1 . ASN D  2  27  ? 44.014  -12.349 51.690  1.00 32.22 ? 139  ASN D OD1 1 
ATOM   5619  N  ND2 . ASN D  2  27  ? 42.024  -11.722 52.567  1.00 31.93 ? 139  ASN D ND2 1 
ATOM   5620  N  N   . GLN D  2  28  ? 45.536  -10.546 49.373  1.00 21.81 ? 140  GLN D N   1 
ATOM   5621  C  CA  . GLN D  2  28  ? 45.353  -10.721 47.921  1.00 20.57 ? 140  GLN D CA  1 
ATOM   5622  C  C   . GLN D  2  28  ? 44.243  -11.717 47.616  1.00 20.32 ? 140  GLN D C   1 
ATOM   5623  O  O   . GLN D  2  28  ? 43.848  -11.873 46.468  1.00 22.55 ? 140  GLN D O   1 
ATOM   5624  C  CB  . GLN D  2  28  ? 46.644  -11.185 47.245  1.00 18.42 ? 140  GLN D CB  1 
ATOM   5625  C  CG  . GLN D  2  28  ? 47.672  -10.094 47.003  1.00 22.47 ? 140  GLN D CG  1 
ATOM   5626  C  CD  . GLN D  2  28  ? 49.080  -10.660 46.775  1.00 26.72 ? 140  GLN D CD  1 
ATOM   5627  O  OE1 . GLN D  2  28  ? 49.933  -10.633 47.676  1.00 27.45 ? 140  GLN D OE1 1 
ATOM   5628  N  NE2 . GLN D  2  28  ? 49.333  -11.190 45.575  1.00 27.89 ? 140  GLN D NE2 1 
ATOM   5629  N  N   . ALA D  2  29  ? 43.756  -12.410 48.638  1.00 19.15 ? 141  ALA D N   1 
ATOM   5630  C  CA  . ALA D  2  29  ? 42.646  -13.333 48.461  1.00 19.80 ? 141  ALA D CA  1 
ATOM   5631  C  C   . ALA D  2  29  ? 41.338  -12.552 48.375  1.00 19.80 ? 141  ALA D C   1 
ATOM   5632  O  O   . ALA D  2  29  ? 40.309  -13.081 47.955  1.00 20.75 ? 141  ALA D O   1 
ATOM   5633  C  CB  . ALA D  2  29  ? 42.589  -14.327 49.621  1.00 19.22 ? 141  ALA D CB  1 
ATOM   5634  N  N   . ASP D  2  30  ? 41.390  -11.283 48.777  1.00 18.29 ? 142  ASP D N   1 
ATOM   5635  C  CA  . ASP D  2  30  ? 40.228  -10.421 48.737  1.00 17.99 ? 142  ASP D CA  1 
ATOM   5636  C  C   . ASP D  2  30  ? 40.059  -9.806  47.327  1.00 17.39 ? 142  ASP D C   1 
ATOM   5637  O  O   . ASP D  2  30  ? 40.853  -10.074 46.405  1.00 16.53 ? 142  ASP D O   1 
ATOM   5638  C  CB  . ASP D  2  30  ? 40.368  -9.323  49.813  1.00 16.59 ? 142  ASP D CB  1 
ATOM   5639  C  CG  . ASP D  2  30  ? 39.045  -8.799  50.360  1.00 15.32 ? 142  ASP D CG  1 
ATOM   5640  O  OD1 . ASP D  2  30  ? 39.040  -8.266  51.481  1.00 16.15 ? 142  ASP D OD1 1 
ATOM   5641  O  OD2 . ASP D  2  30  ? 38.010  -8.917  49.679  1.00 17.49 ? 142  ASP D OD2 1 
ATOM   5642  N  N   . CYS D  2  31  ? 38.996  -9.009  47.172  1.00 16.98 ? 143  CYS D N   1 
ATOM   5643  C  CA  . CYS D  2  31  ? 38.681  -8.347  45.921  1.00 14.00 ? 143  CYS D CA  1 
ATOM   5644  C  C   . CYS D  2  31  ? 37.747  -7.189  46.161  1.00 13.46 ? 143  CYS D C   1 
ATOM   5645  O  O   . CYS D  2  31  ? 37.237  -6.976  47.276  1.00 12.86 ? 143  CYS D O   1 
ATOM   5646  C  CB  . CYS D  2  31  ? 38.010  -9.331  44.965  1.00 13.43 ? 143  CYS D CB  1 
ATOM   5647  S  SG  . CYS D  2  31  ? 36.390  -9.923  45.558  1.00 18.28 ? 143  CYS D SG  1 
ATOM   5648  N  N   . ILE D  2  32  ? 37.579  -6.406  45.131  1.00 14.35 ? 144  ILE D N   1 
ATOM   5649  C  CA  . ILE D  2  32  ? 36.590  -5.332  45.136  1.00 16.28 ? 144  ILE D CA  1 
ATOM   5650  C  C   . ILE D  2  32  ? 35.369  -5.818  44.324  1.00 13.20 ? 144  ILE D C   1 
ATOM   5651  O  O   . ILE D  2  32  ? 35.500  -6.168  43.133  1.00 11.39 ? 144  ILE D O   1 
ATOM   5652  C  CB  . ILE D  2  32  ? 37.199  -4.025  44.554  1.00 16.47 ? 144  ILE D CB  1 
ATOM   5653  C  CG1 . ILE D  2  32  ? 38.256  -3.506  45.545  1.00 16.61 ? 144  ILE D CG1 1 
ATOM   5654  C  CG2 . ILE D  2  32  ? 36.120  -2.975  44.289  1.00 14.92 ? 144  ILE D CG2 1 
ATOM   5655  C  CD1 . ILE D  2  32  ? 39.027  -2.301  45.070  1.00 20.67 ? 144  ILE D CD1 1 
ATOM   5656  N  N   . PRO D  2  33  ? 34.203  -5.923  44.973  1.00 10.06 ? 145  PRO D N   1 
ATOM   5657  C  CA  . PRO D  2  33  ? 32.970  -6.388  44.328  1.00 12.74 ? 145  PRO D CA  1 
ATOM   5658  C  C   . PRO D  2  33  ? 32.698  -5.687  42.995  1.00 11.04 ? 145  PRO D C   1 
ATOM   5659  O  O   . PRO D  2  33  ? 32.918  -4.482  42.846  1.00 12.40 ? 145  PRO D O   1 
ATOM   5660  C  CB  . PRO D  2  33  ? 31.873  -6.105  45.381  1.00 14.86 ? 145  PRO D CB  1 
ATOM   5661  C  CG  . PRO D  2  33  ? 32.625  -6.262  46.659  1.00 13.04 ? 145  PRO D CG  1 
ATOM   5662  C  CD  . PRO D  2  33  ? 33.966  -5.611  46.390  1.00 11.67 ? 145  PRO D CD  1 
ATOM   5663  N  N   . PHE D  2  34  ? 32.242  -6.476  42.026  1.00 11.46 ? 146  PHE D N   1 
ATOM   5664  C  CA  . PHE D  2  34  ? 31.880  -5.979  40.707  1.00 9.61  ? 146  PHE D CA  1 
ATOM   5665  C  C   . PHE D  2  34  ? 30.829  -6.876  40.063  1.00 10.04 ? 146  PHE D C   1 
ATOM   5666  O  O   . PHE D  2  34  ? 31.030  -8.092  39.959  1.00 11.91 ? 146  PHE D O   1 
ATOM   5667  C  CB  . PHE D  2  34  ? 33.116  -5.929  39.812  1.00 7.69  ? 146  PHE D CB  1 
ATOM   5668  C  CG  . PHE D  2  34  ? 32.910  -5.246  38.482  1.00 8.90  ? 146  PHE D CG  1 
ATOM   5669  C  CD1 . PHE D  2  34  ? 33.232  -3.892  38.326  1.00 5.49  ? 146  PHE D CD1 1 
ATOM   5670  C  CD2 . PHE D  2  34  ? 32.415  -5.947  37.383  1.00 8.04  ? 146  PHE D CD2 1 
ATOM   5671  C  CE1 . PHE D  2  34  ? 33.066  -3.246  37.097  1.00 8.22  ? 146  PHE D CE1 1 
ATOM   5672  C  CE2 . PHE D  2  34  ? 32.244  -5.308  36.148  1.00 11.48 ? 146  PHE D CE2 1 
ATOM   5673  C  CZ  . PHE D  2  34  ? 32.569  -3.951  35.999  1.00 7.64  ? 146  PHE D CZ  1 
ATOM   5674  N  N   . PHE D  2  35  ? 29.702  -6.266  39.654  1.00 9.25  ? 147  PHE D N   1 
ATOM   5675  C  CA  . PHE D  2  35  ? 28.639  -6.970  38.893  1.00 9.48  ? 147  PHE D CA  1 
ATOM   5676  C  C   . PHE D  2  35  ? 28.714  -6.583  37.408  1.00 7.37  ? 147  PHE D C   1 
ATOM   5677  O  O   . PHE D  2  35  ? 28.655  -5.397  37.068  1.00 7.64  ? 147  PHE D O   1 
ATOM   5678  C  CB  . PHE D  2  35  ? 27.237  -6.588  39.397  1.00 10.91 ? 147  PHE D CB  1 
ATOM   5679  C  CG  . PHE D  2  35  ? 26.924  -6.912  40.831  1.00 13.00 ? 147  PHE D CG  1 
ATOM   5680  C  CD1 . PHE D  2  35  ? 27.529  -6.210  41.876  1.00 13.92 ? 147  PHE D CD1 1 
ATOM   5681  C  CD2 . PHE D  2  35  ? 25.997  -7.917  41.144  1.00 14.03 ? 147  PHE D CD2 1 
ATOM   5682  C  CE1 . PHE D  2  35  ? 27.216  -6.508  43.212  1.00 16.16 ? 147  PHE D CE1 1 
ATOM   5683  C  CE2 . PHE D  2  35  ? 25.682  -8.218  42.476  1.00 14.79 ? 147  PHE D CE2 1 
ATOM   5684  C  CZ  . PHE D  2  35  ? 26.292  -7.516  43.510  1.00 16.00 ? 147  PHE D CZ  1 
ATOM   5685  N  N   . ARG D  2  36  ? 28.849  -7.561  36.532  1.00 7.48  ? 148  ARG D N   1 
ATOM   5686  C  CA  . ARG D  2  36  ? 28.858  -7.254  35.097  1.00 10.98 ? 148  ARG D CA  1 
ATOM   5687  C  C   . ARG D  2  36  ? 27.560  -6.537  34.684  1.00 10.43 ? 148  ARG D C   1 
ATOM   5688  O  O   . ARG D  2  36  ? 26.480  -6.912  35.140  1.00 8.73  ? 148  ARG D O   1 
ATOM   5689  C  CB  . ARG D  2  36  ? 29.006  -8.534  34.239  1.00 12.88 ? 148  ARG D CB  1 
ATOM   5690  C  CG  . ARG D  2  36  ? 30.425  -9.112  34.185  1.00 9.72  ? 148  ARG D CG  1 
ATOM   5691  C  CD  . ARG D  2  36  ? 30.620  -9.948  32.930  1.00 8.95  ? 148  ARG D CD  1 
ATOM   5692  N  NE  . ARG D  2  36  ? 30.873  -9.110  31.769  1.00 7.66  ? 148  ARG D NE  1 
ATOM   5693  C  CZ  . ARG D  2  36  ? 31.154  -9.547  30.546  1.00 3.66  ? 148  ARG D CZ  1 
ATOM   5694  N  NH1 . ARG D  2  36  ? 31.174  -10.850 30.260  1.00 2.72  ? 148  ARG D NH1 1 
ATOM   5695  N  NH2 . ARG D  2  36  ? 31.406  -8.673  29.598  1.00 5.70  ? 148  ARG D NH2 1 
ATOM   5696  N  N   . SER D  2  37  ? 27.680  -5.500  33.836  1.00 8.51  ? 149  SER D N   1 
ATOM   5697  C  CA  . SER D  2  37  ? 26.498  -4.790  33.337  1.00 7.68  ? 149  SER D CA  1 
ATOM   5698  C  C   . SER D  2  37  ? 25.604  -5.756  32.520  1.00 5.41  ? 149  SER D C   1 
ATOM   5699  O  O   . SER D  2  37  ? 26.099  -6.508  31.681  1.00 7.71  ? 149  SER D O   1 
ATOM   5700  C  CB  . SER D  2  37  ? 26.946  -3.622  32.467  1.00 6.73  ? 149  SER D CB  1 
ATOM   5701  O  OG  . SER D  2  37  ? 27.568  -2.609  33.227  1.00 5.76  ? 149  SER D OG  1 
HETATM 5702  N  N   . CSO D  2  38  ? 24.294  -5.743  32.790  1.00 6.78  ? 150  CSO D N   1 
HETATM 5703  C  CA  . CSO D  2  38  ? 23.339  -6.607  32.094  1.00 7.93  ? 150  CSO D CA  1 
HETATM 5704  C  CB  . CSO D  2  38  ? 21.889  -6.146  32.362  1.00 7.57  ? 150  CSO D CB  1 
HETATM 5705  S  SG  . CSO D  2  38  ? 21.267  -6.344  34.052  1.00 13.55 ? 150  CSO D SG  1 
HETATM 5706  C  C   . CSO D  2  38  ? 23.550  -6.600  30.565  1.00 8.76  ? 150  CSO D C   1 
HETATM 5707  O  O   . CSO D  2  38  ? 23.704  -5.526  29.933  1.00 11.82 ? 150  CSO D O   1 
HETATM 5708  O  OD  . CSO D  2  38  ? 21.113  -7.791  34.296  1.00 7.59  ? 150  CSO D OD  1 
ATOM   5709  N  N   . PRO D  2  39  ? 23.615  -7.789  29.933  1.00 8.61  ? 151  PRO D N   1 
ATOM   5710  C  CA  . PRO D  2  39  ? 23.773  -7.885  28.468  1.00 7.78  ? 151  PRO D CA  1 
ATOM   5711  C  C   . PRO D  2  39  ? 22.449  -7.598  27.723  1.00 7.24  ? 151  PRO D C   1 
ATOM   5712  O  O   . PRO D  2  39  ? 21.395  -8.010  28.165  1.00 8.93  ? 151  PRO D O   1 
ATOM   5713  C  CB  . PRO D  2  39  ? 24.263  -9.315  28.284  1.00 8.71  ? 151  PRO D CB  1 
ATOM   5714  C  CG  . PRO D  2  39  ? 23.593  -10.049 29.407  1.00 9.20  ? 151  PRO D CG  1 
ATOM   5715  C  CD  . PRO D  2  39  ? 23.685  -9.124  30.587  1.00 7.22  ? 151  PRO D CD  1 
ATOM   5716  N  N   . ALA D  2  40  ? 22.508  -6.867  26.620  1.00 8.02  ? 152  ALA D N   1 
ATOM   5717  C  CA  . ALA D  2  40  ? 21.300  -6.543  25.838  1.00 9.42  ? 152  ALA D CA  1 
ATOM   5718  C  C   . ALA D  2  40  ? 20.616  -7.810  25.276  1.00 10.89 ? 152  ALA D C   1 
ATOM   5719  O  O   . ALA D  2  40  ? 19.380  -7.838  25.157  1.00 11.75 ? 152  ALA D O   1 
ATOM   5720  C  CB  . ALA D  2  40  ? 21.640  -5.601  24.692  1.00 5.29  ? 152  ALA D CB  1 
ATOM   5721  N  N   . CYS D  2  41  ? 21.430  -8.830  24.927  1.00 9.25  ? 153  CYS D N   1 
ATOM   5722  C  CA  . CYS D  2  41  ? 20.955  -10.105 24.401  1.00 10.15 ? 153  CYS D CA  1 
ATOM   5723  C  C   . CYS D  2  41  ? 21.624  -11.240 25.144  1.00 10.67 ? 153  CYS D C   1 
ATOM   5724  O  O   . CYS D  2  41  ? 22.575  -11.840 24.629  1.00 11.01 ? 153  CYS D O   1 
ATOM   5725  C  CB  . CYS D  2  41  ? 21.283  -10.241 22.892  1.00 10.57 ? 153  CYS D CB  1 
ATOM   5726  S  SG  . CYS D  2  41  ? 20.541  -11.718 22.082  1.00 11.73 ? 153  CYS D SG  1 
ATOM   5727  N  N   . PRO D  2  42  ? 21.108  -11.587 26.332  1.00 13.47 ? 154  PRO D N   1 
ATOM   5728  C  CA  . PRO D  2  42  ? 21.658  -12.668 27.217  1.00 15.37 ? 154  PRO D CA  1 
ATOM   5729  C  C   . PRO D  2  42  ? 21.852  -14.045 26.558  1.00 16.81 ? 154  PRO D C   1 
ATOM   5730  O  O   . PRO D  2  42  ? 20.976  -14.542 25.850  1.00 16.04 ? 154  PRO D O   1 
ATOM   5731  C  CB  . PRO D  2  42  ? 20.633  -12.759 28.352  1.00 14.63 ? 154  PRO D CB  1 
ATOM   5732  C  CG  . PRO D  2  42  ? 20.038  -11.393 28.394  1.00 15.44 ? 154  PRO D CG  1 
ATOM   5733  C  CD  . PRO D  2  42  ? 19.901  -10.987 26.945  1.00 16.09 ? 154  PRO D CD  1 
ATOM   5734  N  N   . GLY D  2  43  ? 23.023  -14.632 26.808  1.00 18.62 ? 155  GLY D N   1 
ATOM   5735  C  CA  . GLY D  2  43  ? 23.347  -15.991 26.373  1.00 21.42 ? 155  GLY D CA  1 
ATOM   5736  C  C   . GLY D  2  43  ? 23.445  -16.215 24.874  1.00 22.72 ? 155  GLY D C   1 
ATOM   5737  O  O   . GLY D  2  43  ? 23.359  -17.365 24.404  1.00 23.47 ? 155  GLY D O   1 
ATOM   5738  N  N   . SER D  2  44  ? 23.645  -15.138 24.119  1.00 22.64 ? 156  SER D N   1 
ATOM   5739  C  CA  . SER D  2  44  ? 23.716  -15.235 22.658  1.00 20.61 ? 156  SER D CA  1 
ATOM   5740  C  C   . SER D  2  44  ? 25.106  -15.595 22.134  1.00 19.81 ? 156  SER D C   1 
ATOM   5741  O  O   . SER D  2  44  ? 26.127  -15.064 22.577  1.00 16.86 ? 156  SER D O   1 
ATOM   5742  C  CB  . SER D  2  44  ? 23.264  -13.935 22.012  1.00 20.83 ? 156  SER D CB  1 
ATOM   5743  O  OG  . SER D  2  44  ? 23.579  -13.955 20.639  1.00 16.26 ? 156  SER D OG  1 
ATOM   5744  N  N   . ASN D  2  45  ? 25.121  -16.482 21.167  1.00 19.77 ? 157  ASN D N   1 
ATOM   5745  C  CA  . ASN D  2  45  ? 26.358  -16.902 20.564  1.00 22.27 ? 157  ASN D CA  1 
ATOM   5746  C  C   . ASN D  2  45  ? 26.454  -16.308 19.176  1.00 20.49 ? 157  ASN D C   1 
ATOM   5747  O  O   . ASN D  2  45  ? 27.139  -16.833 18.300  1.00 22.26 ? 157  ASN D O   1 
ATOM   5748  C  CB  . ASN D  2  45  ? 26.413  -18.434 20.527  1.00 28.39 ? 157  ASN D CB  1 
ATOM   5749  C  CG  . ASN D  2  45  ? 26.115  -19.065 21.899  1.00 37.06 ? 157  ASN D CG  1 
ATOM   5750  O  OD1 . ASN D  2  45  ? 26.529  -18.548 22.955  1.00 41.26 ? 157  ASN D OD1 1 
ATOM   5751  N  ND2 . ASN D  2  45  ? 25.388  -20.181 21.897  1.00 39.16 ? 157  ASN D ND2 1 
ATOM   5752  N  N   . ILE D  2  46  ? 25.775  -15.175 18.993  1.00 18.53 ? 158  ILE D N   1 
ATOM   5753  C  CA  . ILE D  2  46  ? 25.736  -14.486 17.705  1.00 15.34 ? 158  ILE D CA  1 
ATOM   5754  C  C   . ILE D  2  46  ? 26.076  -13.021 17.856  1.00 10.83 ? 158  ILE D C   1 
ATOM   5755  O  O   . ILE D  2  46  ? 26.890  -12.484 17.119  1.00 10.93 ? 158  ILE D O   1 
ATOM   5756  C  CB  . ILE D  2  46  ? 24.314  -14.599 17.053  1.00 18.44 ? 158  ILE D CB  1 
ATOM   5757  C  CG1 . ILE D  2  46  ? 24.004  -16.077 16.742  1.00 18.80 ? 158  ILE D CG1 1 
ATOM   5758  C  CG2 . ILE D  2  46  ? 24.225  -13.739 15.783  1.00 17.17 ? 158  ILE D CG2 1 
ATOM   5759  C  CD1 . ILE D  2  46  ? 22.558  -16.340 16.395  1.00 22.94 ? 158  ILE D CD1 1 
ATOM   5760  N  N   . THR D  2  47  ? 25.436  -12.379 18.800  1.00 9.35  ? 159  THR D N   1 
ATOM   5761  C  CA  . THR D  2  47  ? 25.606  -10.949 18.975  1.00 11.04 ? 159  THR D CA  1 
ATOM   5762  C  C   . THR D  2  47  ? 26.856  -10.643 19.732  1.00 10.47 ? 159  THR D C   1 
ATOM   5763  O  O   . THR D  2  47  ? 27.291  -11.419 20.555  1.00 13.07 ? 159  THR D O   1 
ATOM   5764  C  CB  . THR D  2  47  ? 24.431  -10.295 19.747  1.00 11.07 ? 159  THR D CB  1 
ATOM   5765  O  OG1 . THR D  2  47  ? 24.444  -10.721 21.116  1.00 13.06 ? 159  THR D OG1 1 
ATOM   5766  C  CG2 . THR D  2  47  ? 23.089  -10.660 19.107  1.00 13.35 ? 159  THR D CG2 1 
ATOM   5767  N  N   . ILE D  2  48  ? 27.448  -9.526  19.415  1.00 9.94  ? 160  ILE D N   1 
ATOM   5768  C  CA  . ILE D  2  48  ? 28.579  -9.030  20.171  1.00 9.20  ? 160  ILE D CA  1 
ATOM   5769  C  C   . ILE D  2  48  ? 27.952  -8.370  21.369  1.00 9.82  ? 160  ILE D C   1 
ATOM   5770  O  O   . ILE D  2  48  ? 27.096  -7.500  21.203  1.00 12.41 ? 160  ILE D O   1 
ATOM   5771  C  CB  . ILE D  2  48  ? 29.339  -7.995  19.332  1.00 8.58  ? 160  ILE D CB  1 
ATOM   5772  C  CG1 . ILE D  2  48  ? 29.940  -8.698  18.114  1.00 7.52  ? 160  ILE D CG1 1 
ATOM   5773  C  CG2 . ILE D  2  48  ? 30.407  -7.292  20.161  1.00 7.80  ? 160  ILE D CG2 1 
ATOM   5774  C  CD1 . ILE D  2  48  ? 30.510  -7.740  17.089  1.00 9.87  ? 160  ILE D CD1 1 
ATOM   5775  N  N   . ARG D  2  49  ? 28.303  -8.815  22.555  1.00 8.75  ? 161  ARG D N   1 
ATOM   5776  C  CA  . ARG D  2  49  ? 27.654  -8.333  23.775  1.00 8.16  ? 161  ARG D CA  1 
ATOM   5777  C  C   . ARG D  2  49  ? 27.605  -6.819  23.849  1.00 9.61  ? 161  ARG D C   1 
ATOM   5778  O  O   . ARG D  2  49  ? 28.601  -6.132  23.529  1.00 7.41  ? 161  ARG D O   1 
ATOM   5779  C  CB  . ARG D  2  49  ? 28.391  -8.871  24.977  1.00 7.45  ? 161  ARG D CB  1 
ATOM   5780  C  CG  . ARG D  2  49  ? 27.764  -8.593  26.316  1.00 7.27  ? 161  ARG D CG  1 
ATOM   5781  C  CD  . ARG D  2  49  ? 28.684  -9.122  27.393  1.00 6.92  ? 161  ARG D CD  1 
ATOM   5782  N  NE  . ARG D  2  49  ? 28.181  -8.898  28.730  1.00 8.04  ? 161  ARG D NE  1 
ATOM   5783  C  CZ  . ARG D  2  49  ? 27.768  -9.849  29.529  1.00 5.52  ? 161  ARG D CZ  1 
ATOM   5784  N  NH1 . ARG D  2  49  ? 27.754  -11.103 29.122  1.00 6.84  ? 161  ARG D NH1 1 
ATOM   5785  N  NH2 . ARG D  2  49  ? 27.358  -9.547  30.740  1.00 8.23  ? 161  ARG D NH2 1 
ATOM   5786  N  N   . ASN D  2  50  ? 26.433  -6.307  24.226  1.00 5.68  ? 162  ASN D N   1 
ATOM   5787  C  CA  . ASN D  2  50  ? 26.277  -4.898  24.428  1.00 7.25  ? 162  ASN D CA  1 
ATOM   5788  C  C   . ASN D  2  50  ? 25.510  -4.656  25.740  1.00 7.70  ? 162  ASN D C   1 
ATOM   5789  O  O   . ASN D  2  50  ? 24.889  -5.581  26.309  1.00 6.00  ? 162  ASN D O   1 
ATOM   5790  C  CB  . ASN D  2  50  ? 25.583  -4.251  23.210  1.00 8.03  ? 162  ASN D CB  1 
ATOM   5791  C  CG  . ASN D  2  50  ? 25.742  -2.717  23.147  1.00 9.54  ? 162  ASN D CG  1 
ATOM   5792  O  OD1 . ASN D  2  50  ? 26.371  -2.085  24.008  1.00 9.02  ? 162  ASN D OD1 1 
ATOM   5793  N  ND2 . ASN D  2  50  ? 25.175  -2.108  22.114  1.00 9.46  ? 162  ASN D ND2 1 
ATOM   5794  N  N   . GLN D  2  51  ? 25.610  -3.420  26.263  1.00 6.66  ? 163  GLN D N   1 
ATOM   5795  C  CA  . GLN D  2  51  ? 24.941  -3.041  27.504  1.00 5.25  ? 163  GLN D CA  1 
ATOM   5796  C  C   . GLN D  2  51  ? 23.697  -2.144  27.226  1.00 6.23  ? 163  GLN D C   1 
ATOM   5797  O  O   . GLN D  2  51  ? 23.489  -1.658  26.088  1.00 6.26  ? 163  GLN D O   1 
ATOM   5798  C  CB  . GLN D  2  51  ? 25.943  -2.365  28.451  1.00 6.44  ? 163  GLN D CB  1 
ATOM   5799  C  CG  . GLN D  2  51  ? 27.108  -3.277  28.908  1.00 5.84  ? 163  GLN D CG  1 
ATOM   5800  C  CD  . GLN D  2  51  ? 28.062  -3.729  27.787  1.00 4.25  ? 163  GLN D CD  1 
ATOM   5801  O  OE1 . GLN D  2  51  ? 28.432  -2.950  26.913  1.00 8.89  ? 163  GLN D OE1 1 
ATOM   5802  N  NE2 . GLN D  2  51  ? 28.451  -4.998  27.800  1.00 2.00  ? 163  GLN D NE2 1 
ATOM   5803  N  N   . ILE D  2  52  ? 22.895  -1.947  28.276  1.00 4.47  ? 164  ILE D N   1 
ATOM   5804  C  CA  . ILE D  2  52  ? 21.599  -1.282  28.192  1.00 5.62  ? 164  ILE D CA  1 
ATOM   5805  C  C   . ILE D  2  52  ? 21.576  0.088   28.844  1.00 6.02  ? 164  ILE D C   1 
ATOM   5806  O  O   . ILE D  2  52  ? 22.112  0.263   29.941  1.00 4.35  ? 164  ILE D O   1 
ATOM   5807  C  CB  . ILE D  2  52  ? 20.523  -2.162  28.910  1.00 5.78  ? 164  ILE D CB  1 
ATOM   5808  C  CG1 . ILE D  2  52  ? 20.429  -3.523  28.217  1.00 8.79  ? 164  ILE D CG1 1 
ATOM   5809  C  CG2 . ILE D  2  52  ? 19.151  -1.464  28.950  1.00 2.84  ? 164  ILE D CG2 1 
ATOM   5810  C  CD1 . ILE D  2  52  ? 19.988  -4.658  29.122  1.00 11.29 ? 164  ILE D CD1 1 
ATOM   5811  N  N   . ASN D  2  53  ? 20.949  1.057   28.151  1.00 6.97  ? 165  ASN D N   1 
ATOM   5812  C  CA  . ASN D  2  53  ? 20.627  2.341   28.781  1.00 6.44  ? 165  ASN D CA  1 
ATOM   5813  C  C   . ASN D  2  53  ? 19.192  2.249   29.312  1.00 7.28  ? 165  ASN D C   1 
ATOM   5814  O  O   . ASN D  2  53  ? 18.269  2.017   28.542  1.00 6.21  ? 165  ASN D O   1 
ATOM   5815  C  CB  . ASN D  2  53  ? 20.738  3.532   27.810  1.00 3.80  ? 165  ASN D CB  1 
ATOM   5816  C  CG  . ASN D  2  53  ? 20.741  4.861   28.563  1.00 2.00  ? 165  ASN D CG  1 
ATOM   5817  O  OD1 . ASN D  2  53  ? 20.420  4.926   29.747  1.00 4.17  ? 165  ASN D OD1 1 
ATOM   5818  N  ND2 . ASN D  2  53  ? 21.131  5.925   27.894  1.00 2.10  ? 165  ASN D ND2 1 
ATOM   5819  N  N   . ALA D  2  54  ? 19.044  2.392   30.625  1.00 5.42  ? 166  ALA D N   1 
ATOM   5820  C  CA  . ALA D  2  54  ? 17.752  2.301   31.301  1.00 8.73  ? 166  ALA D CA  1 
ATOM   5821  C  C   . ALA D  2  54  ? 16.982  3.619   31.271  1.00 7.31  ? 166  ALA D C   1 
ATOM   5822  O  O   . ALA D  2  54  ? 15.828  3.667   31.686  1.00 9.20  ? 166  ALA D O   1 
ATOM   5823  C  CB  . ALA D  2  54  ? 17.976  1.884   32.755  1.00 9.78  ? 166  ALA D CB  1 
ATOM   5824  N  N   . LEU D  2  55  ? 17.621  4.667   30.774  1.00 6.13  ? 167  LEU D N   1 
ATOM   5825  C  CA  . LEU D  2  55  ? 17.061  6.018   30.785  1.00 7.59  ? 167  LEU D CA  1 
ATOM   5826  C  C   . LEU D  2  55  ? 16.881  6.587   29.392  1.00 6.30  ? 167  LEU D C   1 
ATOM   5827  O  O   . LEU D  2  55  ? 17.457  6.079   28.441  1.00 8.71  ? 167  LEU D O   1 
ATOM   5828  C  CB  . LEU D  2  55  ? 17.995  6.972   31.566  1.00 7.45  ? 167  LEU D CB  1 
ATOM   5829  C  CG  . LEU D  2  55  ? 18.490  6.510   32.941  1.00 6.36  ? 167  LEU D CG  1 
ATOM   5830  C  CD1 . LEU D  2  55  ? 19.410  7.574   33.532  1.00 2.00  ? 167  LEU D CD1 1 
ATOM   5831  C  CD2 . LEU D  2  55  ? 17.316  6.195   33.861  1.00 4.12  ? 167  LEU D CD2 1 
ATOM   5832  N  N   . THR D  2  56  ? 16.082  7.681   29.295  1.00 7.75  ? 168  THR D N   1 
ATOM   5833  C  CA  . THR D  2  56  ? 15.961  8.449   28.048  1.00 8.77  ? 168  THR D CA  1 
ATOM   5834  C  C   . THR D  2  56  ? 17.249  9.232   27.877  1.00 6.41  ? 168  THR D C   1 
ATOM   5835  O  O   . THR D  2  56  ? 17.682  9.930   28.815  1.00 7.82  ? 168  THR D O   1 
ATOM   5836  C  CB  . THR D  2  56  ? 14.806  9.481   28.060  1.00 6.88  ? 168  THR D CB  1 
ATOM   5837  O  OG1 . THR D  2  56  ? 15.109  10.511  29.007  1.00 6.54  ? 168  THR D OG1 1 
ATOM   5838  C  CG2 . THR D  2  56  ? 13.477  8.828   28.442  1.00 5.56  ? 168  THR D CG2 1 
ATOM   5839  N  N   . SER D  2  57  ? 17.850  9.110   26.688  1.00 8.49  ? 169  SER D N   1 
ATOM   5840  C  CA  . SER D  2  57  ? 19.114  9.783   26.393  1.00 8.27  ? 169  SER D CA  1 
ATOM   5841  C  C   . SER D  2  57  ? 18.896  11.292  26.400  1.00 6.47  ? 169  SER D C   1 
ATOM   5842  O  O   . SER D  2  57  ? 19.762  12.051  26.828  1.00 6.96  ? 169  SER D O   1 
ATOM   5843  C  CB  . SER D  2  57  ? 19.657  9.327   25.020  1.00 6.15  ? 169  SER D CB  1 
ATOM   5844  O  OG  . SER D  2  57  ? 18.774  9.703   23.966  1.00 9.38  ? 169  SER D OG  1 
ATOM   5845  N  N   . PHE D  2  58  ? 17.701  11.713  25.981  1.00 5.36  ? 170  PHE D N   1 
ATOM   5846  C  CA  . PHE D  2  58  ? 17.419  13.128  25.854  1.00 7.71  ? 170  PHE D CA  1 
ATOM   5847  C  C   . PHE D  2  58  ? 17.603  13.875  27.160  1.00 8.39  ? 170  PHE D C   1 
ATOM   5848  O  O   . PHE D  2  58  ? 17.445  13.308  28.248  1.00 9.89  ? 170  PHE D O   1 
ATOM   5849  C  CB  . PHE D  2  58  ? 15.993  13.352  25.321  1.00 8.21  ? 170  PHE D CB  1 
ATOM   5850  C  CG  . PHE D  2  58  ? 15.717  12.640  24.003  1.00 7.31  ? 170  PHE D CG  1 
ATOM   5851  C  CD1 . PHE D  2  58  ? 16.281  13.096  22.813  1.00 3.66  ? 170  PHE D CD1 1 
ATOM   5852  C  CD2 . PHE D  2  58  ? 14.962  11.447  23.985  1.00 6.01  ? 170  PHE D CD2 1 
ATOM   5853  C  CE1 . PHE D  2  58  ? 16.113  12.368  21.641  1.00 4.69  ? 170  PHE D CE1 1 
ATOM   5854  C  CE2 . PHE D  2  58  ? 14.791  10.716  22.816  1.00 2.00  ? 170  PHE D CE2 1 
ATOM   5855  C  CZ  . PHE D  2  58  ? 15.370  11.174  21.649  1.00 3.50  ? 170  PHE D CZ  1 
ATOM   5856  N  N   . VAL D  2  59  ? 18.015  15.143  27.034  1.00 10.99 ? 171  VAL D N   1 
ATOM   5857  C  CA  . VAL D  2  59  ? 18.087  16.035  28.194  1.00 10.50 ? 171  VAL D CA  1 
ATOM   5858  C  C   . VAL D  2  59  ? 16.660  16.542  28.444  1.00 10.32 ? 171  VAL D C   1 
ATOM   5859  O  O   . VAL D  2  59  ? 16.243  17.590  27.951  1.00 8.22  ? 171  VAL D O   1 
ATOM   5860  C  CB  . VAL D  2  59  ? 19.032  17.236  27.933  1.00 11.05 ? 171  VAL D CB  1 
ATOM   5861  C  CG1 . VAL D  2  59  ? 19.144  18.080  29.193  1.00 9.23  ? 171  VAL D CG1 1 
ATOM   5862  C  CG2 . VAL D  2  59  ? 20.404  16.743  27.496  1.00 11.06 ? 171  VAL D CG2 1 
ATOM   5863  N  N   . ASP D  2  60  ? 15.917  15.760  29.202  1.00 10.19 ? 172  ASP D N   1 
ATOM   5864  C  CA  . ASP D  2  60  ? 14.496  16.007  29.389  1.00 10.74 ? 172  ASP D CA  1 
ATOM   5865  C  C   . ASP D  2  60  ? 14.109  15.912  30.842  1.00 10.16 ? 172  ASP D C   1 
ATOM   5866  O  O   . ASP D  2  60  ? 12.921  15.732  31.176  1.00 11.72 ? 172  ASP D O   1 
ATOM   5867  C  CB  . ASP D  2  60  ? 13.705  14.972  28.543  1.00 9.89  ? 172  ASP D CB  1 
ATOM   5868  C  CG  . ASP D  2  60  ? 14.002  13.497  28.870  1.00 11.92 ? 172  ASP D CG  1 
ATOM   5869  O  OD1 . ASP D  2  60  ? 14.784  13.199  29.798  1.00 10.84 ? 172  ASP D OD1 1 
ATOM   5870  O  OD2 . ASP D  2  60  ? 13.436  12.627  28.198  1.00 14.03 ? 172  ASP D OD2 1 
ATOM   5871  N  N   . ALA D  2  61  ? 15.109  15.992  31.710  1.00 9.16  ? 173  ALA D N   1 
ATOM   5872  C  CA  . ALA D  2  61  ? 14.907  15.899  33.140  1.00 9.59  ? 173  ALA D CA  1 
ATOM   5873  C  C   . ALA D  2  61  ? 14.242  14.574  33.525  1.00 8.88  ? 173  ALA D C   1 
ATOM   5874  O  O   . ALA D  2  61  ? 13.385  14.530  34.422  1.00 9.59  ? 173  ALA D O   1 
ATOM   5875  C  CB  . ALA D  2  61  ? 14.090  17.100  33.621  1.00 11.77 ? 173  ALA D CB  1 
ATOM   5876  N  N   . SER D  2  62  ? 14.625  13.487  32.844  1.00 8.09  ? 174  SER D N   1 
ATOM   5877  C  CA  . SER D  2  62  ? 14.058  12.183  33.164  1.00 8.04  ? 174  SER D CA  1 
ATOM   5878  C  C   . SER D  2  62  ? 14.428  11.745  34.595  1.00 9.10  ? 174  SER D C   1 
ATOM   5879  O  O   . SER D  2  62  ? 13.761  10.872  35.177  1.00 6.05  ? 174  SER D O   1 
ATOM   5880  C  CB  . SER D  2  62  ? 14.459  11.108  32.108  1.00 9.66  ? 174  SER D CB  1 
ATOM   5881  O  OG  . SER D  2  62  ? 15.857  11.088  31.806  1.00 8.26  ? 174  SER D OG  1 
ATOM   5882  N  N   . MET D  2  63  ? 15.500  12.382  35.175  1.00 8.75  ? 175  MET D N   1 
ATOM   5883  C  CA  . MET D  2  63  ? 15.915  12.086  36.567  1.00 9.39  ? 175  MET D CA  1 
ATOM   5884  C  C   . MET D  2  63  ? 14.890  12.663  37.596  1.00 9.57  ? 175  MET D C   1 
ATOM   5885  O  O   . MET D  2  63  ? 14.894  12.311  38.764  1.00 7.98  ? 175  MET D O   1 
ATOM   5886  C  CB  . MET D  2  63  ? 17.351  12.621  36.841  1.00 9.49  ? 175  MET D CB  1 
ATOM   5887  C  CG  . MET D  2  63  ? 17.491  14.139  37.000  1.00 8.17  ? 175  MET D CG  1 
ATOM   5888  S  SD  . MET D  2  63  ? 17.048  15.047  35.517  1.00 10.73 ? 175  MET D SD  1 
ATOM   5889  C  CE  . MET D  2  63  ? 18.014  16.551  35.684  1.00 9.63  ? 175  MET D CE  1 
ATOM   5890  N  N   . VAL D  2  64  ? 14.013  13.558  37.128  1.00 9.98  ? 176  VAL D N   1 
ATOM   5891  C  CA  . VAL D  2  64  ? 12.948  14.129  37.930  1.00 9.42  ? 176  VAL D CA  1 
ATOM   5892  C  C   . VAL D  2  64  ? 11.637  13.319  37.705  1.00 10.83 ? 176  VAL D C   1 
ATOM   5893  O  O   . VAL D  2  64  ? 10.940  12.945  38.662  1.00 8.20  ? 176  VAL D O   1 
ATOM   5894  C  CB  . VAL D  2  64  ? 12.710  15.623  37.504  1.00 13.27 ? 176  VAL D CB  1 
ATOM   5895  C  CG1 . VAL D  2  64  ? 11.601  16.289  38.332  1.00 12.94 ? 176  VAL D CG1 1 
ATOM   5896  C  CG2 . VAL D  2  64  ? 13.994  16.412  37.628  1.00 10.46 ? 176  VAL D CG2 1 
ATOM   5897  N  N   . TYR D  2  65  ? 11.337  13.018  36.418  1.00 11.59 ? 177  TYR D N   1 
ATOM   5898  C  CA  . TYR D  2  65  ? 10.038  12.438  36.052  1.00 12.04 ? 177  TYR D CA  1 
ATOM   5899  C  C   . TYR D  2  65  ? 10.033  10.928  35.835  1.00 14.02 ? 177  TYR D C   1 
ATOM   5900  O  O   . TYR D  2  65  ? 8.933   10.316  35.840  1.00 15.57 ? 177  TYR D O   1 
ATOM   5901  C  CB  . TYR D  2  65  ? 9.478   13.144  34.796  1.00 10.94 ? 177  TYR D CB  1 
ATOM   5902  C  CG  . TYR D  2  65  ? 9.329   14.635  34.971  1.00 11.94 ? 177  TYR D CG  1 
ATOM   5903  C  CD1 . TYR D  2  65  ? 8.232   15.157  35.659  1.00 10.38 ? 177  TYR D CD1 1 
ATOM   5904  C  CD2 . TYR D  2  65  ? 10.346  15.525  34.556  1.00 13.15 ? 177  TYR D CD2 1 
ATOM   5905  C  CE1 . TYR D  2  65  ? 8.137   16.508  35.949  1.00 10.58 ? 177  TYR D CE1 1 
ATOM   5906  C  CE2 . TYR D  2  65  ? 10.268  16.885  34.845  1.00 11.59 ? 177  TYR D CE2 1 
ATOM   5907  C  CZ  . TYR D  2  65  ? 9.150   17.374  35.554  1.00 13.88 ? 177  TYR D CZ  1 
ATOM   5908  O  OH  . TYR D  2  65  ? 9.069   18.712  35.903  1.00 11.29 ? 177  TYR D OH  1 
ATOM   5909  N  N   . GLY D  2  66  ? 11.222  10.320  35.625  1.00 11.23 ? 178  GLY D N   1 
ATOM   5910  C  CA  . GLY D  2  66  ? 11.286  8.872   35.370  1.00 6.80  ? 178  GLY D CA  1 
ATOM   5911  C  C   . GLY D  2  66  ? 11.327  8.547   33.896  1.00 4.35  ? 178  GLY D C   1 
ATOM   5912  O  O   . GLY D  2  66  ? 10.893  9.340   33.075  1.00 5.07  ? 178  GLY D O   1 
ATOM   5913  N  N   . SER D  2  67  ? 11.841  7.368   33.568  1.00 5.29  ? 179  SER D N   1 
ATOM   5914  C  CA  . SER D  2  67  ? 11.985  6.947   32.173  1.00 8.51  ? 179  SER D CA  1 
ATOM   5915  C  C   . SER D  2  67  ? 11.085  5.763   31.830  1.00 10.61 ? 179  SER D C   1 
ATOM   5916  O  O   . SER D  2  67  ? 11.164  5.224   30.727  1.00 10.28 ? 179  SER D O   1 
ATOM   5917  C  CB  . SER D  2  67  ? 13.453  6.598   31.869  1.00 6.83  ? 179  SER D CB  1 
ATOM   5918  O  OG  . SER D  2  67  ? 14.244  7.768   31.945  1.00 2.97  ? 179  SER D OG  1 
ATOM   5919  N  N   . GLU D  2  68  ? 10.255  5.354   32.784  1.00 12.93 ? 180  GLU D N   1 
ATOM   5920  C  CA  . GLU D  2  68  ? 9.300   4.280   32.596  1.00 16.15 ? 180  GLU D CA  1 
ATOM   5921  C  C   . GLU D  2  68  ? 7.969   4.736   33.174  1.00 19.75 ? 180  GLU D C   1 
ATOM   5922  O  O   . GLU D  2  68  ? 7.955   5.368   34.229  1.00 19.90 ? 180  GLU D O   1 
ATOM   5923  C  CB  . GLU D  2  68  ? 9.782   3.017   33.299  1.00 17.50 ? 180  GLU D CB  1 
ATOM   5924  C  CG  . GLU D  2  68  ? 11.070  2.459   32.751  1.00 21.40 ? 180  GLU D CG  1 
ATOM   5925  C  CD  . GLU D  2  68  ? 11.531  1.214   33.481  1.00 25.52 ? 180  GLU D CD  1 
ATOM   5926  O  OE1 . GLU D  2  68  ? 12.708  1.173   33.921  1.00 25.44 ? 180  GLU D OE1 1 
ATOM   5927  O  OE2 . GLU D  2  68  ? 10.723  0.267   33.605  1.00 28.32 ? 180  GLU D OE2 1 
ATOM   5928  N  N   . GLU D  2  69  ? 6.854   4.389   32.474  1.00 22.83 ? 181  GLU D N   1 
ATOM   5929  C  CA  . GLU D  2  69  ? 5.475   4.861   32.765  1.00 23.38 ? 181  GLU D CA  1 
ATOM   5930  C  C   . GLU D  2  69  ? 4.921   4.560   34.138  1.00 21.89 ? 181  GLU D C   1 
ATOM   5931  O  O   . GLU D  2  69  ? 4.165   5.409   34.664  1.00 19.46 ? 181  GLU D O   1 
ATOM   5932  C  CB  . GLU D  2  69  ? 4.498   4.383   31.694  1.00 24.83 ? 181  GLU D CB  1 
ATOM   5933  C  CG  . GLU D  2  69  ? 4.704   5.101   30.358  1.00 30.69 ? 181  GLU D CG  1 
ATOM   5934  C  CD  . GLU D  2  69  ? 4.089   4.376   29.175  1.00 33.01 ? 181  GLU D CD  1 
ATOM   5935  O  OE1 . GLU D  2  69  ? 4.859   3.936   28.287  1.00 33.39 ? 181  GLU D OE1 1 
ATOM   5936  O  OE2 . GLU D  2  69  ? 2.841   4.253   29.130  1.00 32.95 ? 181  GLU D OE2 1 
ATOM   5937  N  N   . PRO D  2  70  ? 5.265   3.381   34.754  1.00 21.14 ? 182  PRO D N   1 
ATOM   5938  C  CA  . PRO D  2  70  ? 4.773   3.008   36.114  1.00 19.70 ? 182  PRO D CA  1 
ATOM   5939  C  C   . PRO D  2  70  ? 5.337   3.975   37.169  1.00 17.92 ? 182  PRO D C   1 
ATOM   5940  O  O   . PRO D  2  70  ? 4.594   4.573   37.951  1.00 14.66 ? 182  PRO D O   1 
ATOM   5941  C  CB  . PRO D  2  70  ? 5.306   1.587   36.326  1.00 20.93 ? 182  PRO D CB  1 
ATOM   5942  C  CG  . PRO D  2  70  ? 5.657   1.116   34.946  1.00 20.92 ? 182  PRO D CG  1 
ATOM   5943  C  CD  . PRO D  2  70  ? 6.156   2.327   34.227  1.00 19.35 ? 182  PRO D CD  1 
ATOM   5944  N  N   . LEU D  2  71  ? 6.676   4.123   37.145  1.00 15.68 ? 183  LEU D N   1 
ATOM   5945  C  CA  . LEU D  2  71  ? 7.387   5.051   38.015  1.00 13.87 ? 183  LEU D CA  1 
ATOM   5946  C  C   . LEU D  2  71  ? 6.842   6.451   37.837  1.00 12.27 ? 183  LEU D C   1 
ATOM   5947  O  O   . LEU D  2  71  ? 6.425   7.087   38.798  1.00 11.87 ? 183  LEU D O   1 
ATOM   5948  C  CB  . LEU D  2  71  ? 8.901   5.065   37.674  1.00 12.71 ? 183  LEU D CB  1 
ATOM   5949  C  CG  . LEU D  2  71  ? 9.764   6.141   38.372  1.00 11.85 ? 183  LEU D CG  1 
ATOM   5950  C  CD1 . LEU D  2  71  ? 9.823   5.889   39.871  1.00 10.82 ? 183  LEU D CD1 1 
ATOM   5951  C  CD2 . LEU D  2  71  ? 11.173  6.138   37.790  1.00 12.17 ? 183  LEU D CD2 1 
ATOM   5952  N  N   . ALA D  2  72  ? 6.866   6.909   36.591  1.00 13.60 ? 184  ALA D N   1 
ATOM   5953  C  CA  . ALA D  2  72  ? 6.464   8.264   36.239  1.00 15.73 ? 184  ALA D CA  1 
ATOM   5954  C  C   . ALA D  2  72  ? 5.111   8.597   36.862  1.00 17.48 ? 184  ALA D C   1 
ATOM   5955  O  O   . ALA D  2  72  ? 4.928   9.686   37.434  1.00 13.98 ? 184  ALA D O   1 
ATOM   5956  C  CB  . ALA D  2  72  ? 6.431   8.418   34.708  1.00 13.14 ? 184  ALA D CB  1 
ATOM   5957  N  N   . ARG D  2  73  ? 4.172   7.655   36.782  1.00 17.08 ? 185  ARG D N   1 
ATOM   5958  C  CA  . ARG D  2  73  ? 2.872   7.903   37.372  1.00 20.75 ? 185  ARG D CA  1 
ATOM   5959  C  C   . ARG D  2  73  ? 2.962   7.872   38.894  1.00 20.15 ? 185  ARG D C   1 
ATOM   5960  O  O   . ARG D  2  73  ? 2.315   8.680   39.569  1.00 21.06 ? 185  ARG D O   1 
ATOM   5961  C  CB  . ARG D  2  73  ? 1.838   6.900   36.845  1.00 22.30 ? 185  ARG D CB  1 
ATOM   5962  C  CG  . ARG D  2  73  ? 0.567   6.817   37.673  1.00 26.59 ? 185  ARG D CG  1 
ATOM   5963  C  CD  . ARG D  2  73  ? -0.419  5.808   37.088  1.00 29.99 ? 185  ARG D CD  1 
ATOM   5964  N  NE  . ARG D  2  73  ? 0.241   4.572   36.687  1.00 32.43 ? 185  ARG D NE  1 
ATOM   5965  C  CZ  . ARG D  2  73  ? 0.500   4.252   35.421  1.00 34.04 ? 185  ARG D CZ  1 
ATOM   5966  N  NH1 . ARG D  2  73  ? 0.124   5.065   34.443  1.00 33.41 ? 185  ARG D NH1 1 
ATOM   5967  N  NH2 . ARG D  2  73  ? 1.128   3.116   35.129  1.00 35.75 ? 185  ARG D NH2 1 
ATOM   5968  N  N   . ASN D  2  74  ? 3.811   6.997   39.442  1.00 18.40 ? 186  ASN D N   1 
ATOM   5969  C  CA  . ASN D  2  74  ? 3.927   6.896   40.894  1.00 18.19 ? 186  ASN D CA  1 
ATOM   5970  C  C   . ASN D  2  74  ? 4.623   8.097   41.509  1.00 18.75 ? 186  ASN D C   1 
ATOM   5971  O  O   . ASN D  2  74  ? 4.499   8.324   42.715  1.00 20.69 ? 186  ASN D O   1 
ATOM   5972  C  CB  . ASN D  2  74  ? 4.638   5.607   41.295  1.00 18.68 ? 186  ASN D CB  1 
ATOM   5973  C  CG  . ASN D  2  74  ? 3.750   4.391   41.106  1.00 18.56 ? 186  ASN D CG  1 
ATOM   5974  O  OD1 . ASN D  2  74  ? 2.529   4.498   41.051  1.00 22.11 ? 186  ASN D OD1 1 
ATOM   5975  N  ND2 . ASN D  2  74  ? 4.356   3.231   40.998  1.00 19.75 ? 186  ASN D ND2 1 
ATOM   5976  N  N   . LEU D  2  75  ? 5.340   8.874   40.673  1.00 17.20 ? 187  LEU D N   1 
ATOM   5977  C  CA  . LEU D  2  75  ? 6.058   10.071  41.114  1.00 15.39 ? 187  LEU D CA  1 
ATOM   5978  C  C   . LEU D  2  75  ? 5.144   11.292  41.138  1.00 16.20 ? 187  LEU D C   1 
ATOM   5979  O  O   . LEU D  2  75  ? 5.518   12.345  41.646  1.00 16.18 ? 187  LEU D O   1 
ATOM   5980  C  CB  . LEU D  2  75  ? 7.250   10.344  40.181  1.00 14.89 ? 187  LEU D CB  1 
ATOM   5981  C  CG  . LEU D  2  75  ? 8.435   9.350   40.221  1.00 14.37 ? 187  LEU D CG  1 
ATOM   5982  C  CD1 . LEU D  2  75  ? 9.391   9.630   39.070  1.00 10.31 ? 187  LEU D CD1 1 
ATOM   5983  C  CD2 . LEU D  2  75  ? 9.170   9.441   41.560  1.00 14.15 ? 187  LEU D CD2 1 
ATOM   5984  N  N   . ARG D  2  76  ? 3.934   11.147  40.598  1.00 15.31 ? 188  ARG D N   1 
ATOM   5985  C  CA  . ARG D  2  76  ? 2.989   12.263  40.505  1.00 16.88 ? 188  ARG D CA  1 
ATOM   5986  C  C   . ARG D  2  76  ? 1.953   12.270  41.634  1.00 17.78 ? 188  ARG D C   1 
ATOM   5987  O  O   . ARG D  2  76  ? 1.588   11.220  42.175  1.00 18.04 ? 188  ARG D O   1 
ATOM   5988  C  CB  . ARG D  2  76  ? 2.268   12.237  39.131  1.00 16.62 ? 188  ARG D CB  1 
ATOM   5989  C  CG  . ARG D  2  76  ? 3.173   12.556  37.942  1.00 14.53 ? 188  ARG D CG  1 
ATOM   5990  C  CD  . ARG D  2  76  ? 2.448   12.384  36.625  1.00 11.43 ? 188  ARG D CD  1 
ATOM   5991  N  NE  . ARG D  2  76  ? 1.294   13.265  36.513  1.00 14.14 ? 188  ARG D NE  1 
ATOM   5992  C  CZ  . ARG D  2  76  ? 0.529   13.333  35.428  1.00 15.64 ? 188  ARG D CZ  1 
ATOM   5993  N  NH1 . ARG D  2  76  ? 0.830   12.603  34.375  1.00 16.94 ? 188  ARG D NH1 1 
ATOM   5994  N  NH2 . ARG D  2  76  ? -0.529  14.134  35.384  1.00 15.33 ? 188  ARG D NH2 1 
ATOM   5995  N  N   . ASN D  2  77  ? 1.500   13.471  41.996  1.00 18.47 ? 189  ASN D N   1 
ATOM   5996  C  CA  . ASN D  2  77  ? 0.448   13.610  42.977  1.00 20.54 ? 189  ASN D CA  1 
ATOM   5997  C  C   . ASN D  2  77  ? -0.874  13.349  42.270  1.00 22.17 ? 189  ASN D C   1 
ATOM   5998  O  O   . ASN D  2  77  ? -1.284  14.124  41.396  1.00 21.94 ? 189  ASN D O   1 
ATOM   5999  C  CB  . ASN D  2  77  ? 0.449   15.010  43.589  1.00 19.24 ? 189  ASN D CB  1 
ATOM   6000  C  CG  . ASN D  2  77  ? -0.488  15.150  44.789  1.00 20.11 ? 189  ASN D CG  1 
ATOM   6001  O  OD1 . ASN D  2  77  ? -1.552  14.525  44.873  1.00 20.63 ? 189  ASN D OD1 1 
ATOM   6002  N  ND2 . ASN D  2  77  ? -0.080  15.965  45.729  1.00 21.99 ? 189  ASN D ND2 1 
ATOM   6003  N  N   . MET D  2  78  ? -1.520  12.245  42.619  1.00 24.96 ? 190  MET D N   1 
ATOM   6004  C  CA  . MET D  2  78  ? -2.766  11.900  41.955  1.00 30.04 ? 190  MET D CA  1 
ATOM   6005  C  C   . MET D  2  78  ? -3.992  12.070  42.864  1.00 29.58 ? 190  MET D C   1 
ATOM   6006  O  O   . MET D  2  78  ? -5.011  11.414  42.658  1.00 31.59 ? 190  MET D O   1 
ATOM   6007  C  CB  . MET D  2  78  ? -2.699  10.458  41.376  1.00 32.48 ? 190  MET D CB  1 
ATOM   6008  C  CG  . MET D  2  78  ? -1.675  10.259  40.248  1.00 34.11 ? 190  MET D CG  1 
ATOM   6009  S  SD  . MET D  2  78  ? -1.768  11.537  38.972  1.00 39.65 ? 190  MET D SD  1 
ATOM   6010  C  CE  . MET D  2  78  ? -1.976  10.569  37.471  1.00 34.80 ? 190  MET D CE  1 
ATOM   6011  N  N   . SER D  2  79  ? -3.908  12.976  43.839  1.00 29.11 ? 191  SER D N   1 
ATOM   6012  C  CA  . SER D  2  79  ? -5.020  13.223  44.776  1.00 29.46 ? 191  SER D CA  1 
ATOM   6013  C  C   . SER D  2  79  ? -5.853  14.473  44.406  1.00 28.86 ? 191  SER D C   1 
ATOM   6014  O  O   . SER D  2  79  ? -6.878  14.761  45.028  1.00 28.66 ? 191  SER D O   1 
ATOM   6015  C  CB  . SER D  2  79  ? -4.464  13.401  46.204  1.00 32.18 ? 191  SER D CB  1 
ATOM   6016  O  OG  . SER D  2  79  ? -3.857  12.215  46.700  1.00 34.65 ? 191  SER D OG  1 
ATOM   6017  N  N   . ASN D  2  80  ? -5.409  15.215  43.407  1.00 26.87 ? 192  ASN D N   1 
ATOM   6018  C  CA  . ASN D  2  80  ? -6.052  16.466  43.011  1.00 24.23 ? 192  ASN D CA  1 
ATOM   6019  C  C   . ASN D  2  80  ? -5.715  16.757  41.548  1.00 23.90 ? 192  ASN D C   1 
ATOM   6020  O  O   . ASN D  2  80  ? -5.035  15.952  40.915  1.00 24.71 ? 192  ASN D O   1 
ATOM   6021  C  CB  . ASN D  2  80  ? -5.574  17.615  43.933  1.00 24.15 ? 192  ASN D CB  1 
ATOM   6022  C  CG  . ASN D  2  80  ? -4.047  17.815  43.938  1.00 25.42 ? 192  ASN D CG  1 
ATOM   6023  O  OD1 . ASN D  2  80  ? -3.439  18.030  42.888  1.00 26.79 ? 192  ASN D OD1 1 
ATOM   6024  N  ND2 . ASN D  2  80  ? -3.420  17.758  45.118  1.00 21.96 ? 192  ASN D ND2 1 
ATOM   6025  N  N   . GLN D  2  81  ? -6.177  17.891  41.007  1.00 22.63 ? 193  GLN D N   1 
ATOM   6026  C  CA  . GLN D  2  81  ? -5.918  18.227  39.604  1.00 22.52 ? 193  GLN D CA  1 
ATOM   6027  C  C   . GLN D  2  81  ? -4.866  19.315  39.440  1.00 20.31 ? 193  GLN D C   1 
ATOM   6028  O  O   . GLN D  2  81  ? -4.879  20.042  38.439  1.00 18.41 ? 193  GLN D O   1 
ATOM   6029  C  CB  . GLN D  2  81  ? -7.204  18.677  38.895  1.00 24.00 ? 193  GLN D CB  1 
ATOM   6030  C  CG  . GLN D  2  81  ? -8.321  17.663  38.924  1.00 28.65 ? 193  GLN D CG  1 
ATOM   6031  C  CD  . GLN D  2  81  ? -7.822  16.305  38.540  1.00 31.54 ? 193  GLN D CD  1 
ATOM   6032  O  OE1 . GLN D  2  81  ? -7.049  16.177  37.592  1.00 33.91 ? 193  GLN D OE1 1 
ATOM   6033  N  NE2 . GLN D  2  81  ? -8.244  15.285  39.284  1.00 33.17 ? 193  GLN D NE2 1 
ATOM   6034  N  N   . LEU D  2  82  ? -3.927  19.412  40.402  1.00 20.11 ? 194  LEU D N   1 
ATOM   6035  C  CA  . LEU D  2  82  ? -2.900  20.462  40.338  1.00 18.58 ? 194  LEU D CA  1 
ATOM   6036  C  C   . LEU D  2  82  ? -1.651  20.112  39.469  1.00 16.39 ? 194  LEU D C   1 
ATOM   6037  O  O   . LEU D  2  82  ? -0.894  21.011  39.103  1.00 16.46 ? 194  LEU D O   1 
ATOM   6038  C  CB  . LEU D  2  82  ? -2.519  20.915  41.755  1.00 19.22 ? 194  LEU D CB  1 
ATOM   6039  C  CG  . LEU D  2  82  ? -3.688  21.380  42.667  1.00 20.78 ? 194  LEU D CG  1 
ATOM   6040  C  CD1 . LEU D  2  82  ? -3.145  22.029  43.923  1.00 21.00 ? 194  LEU D CD1 1 
ATOM   6041  C  CD2 . LEU D  2  82  ? -4.600  22.356  41.939  1.00 20.47 ? 194  LEU D CD2 1 
ATOM   6042  N  N   . GLY D  2  83  ? -1.476  18.827  39.096  1.00 15.01 ? 195  GLY D N   1 
ATOM   6043  C  CA  . GLY D  2  83  ? -0.375  18.406  38.221  1.00 14.38 ? 195  GLY D CA  1 
ATOM   6044  C  C   . GLY D  2  83  ? 0.978   18.397  38.924  1.00 14.78 ? 195  GLY D C   1 
ATOM   6045  O  O   . GLY D  2  83  ? 2.020   18.588  38.300  1.00 15.03 ? 195  GLY D O   1 
ATOM   6046  N  N   . LEU D  2  84  ? 0.954   18.164  40.230  1.00 14.64 ? 196  LEU D N   1 
ATOM   6047  C  CA  . LEU D  2  84  ? 2.154   18.199  41.025  1.00 15.06 ? 196  LEU D CA  1 
ATOM   6048  C  C   . LEU D  2  84  ? 2.848   16.847  41.106  1.00 14.80 ? 196  LEU D C   1 
ATOM   6049  O  O   . LEU D  2  84  ? 2.259   15.798  40.803  1.00 14.39 ? 196  LEU D O   1 
ATOM   6050  C  CB  . LEU D  2  84  ? 1.807   18.655  42.438  1.00 14.60 ? 196  LEU D CB  1 
ATOM   6051  C  CG  . LEU D  2  84  ? 0.967   19.923  42.610  1.00 11.70 ? 196  LEU D CG  1 
ATOM   6052  C  CD1 . LEU D  2  84  ? 0.595   20.068  44.079  1.00 13.64 ? 196  LEU D CD1 1 
ATOM   6053  C  CD2 . LEU D  2  84  ? 1.706   21.147  42.127  1.00 11.04 ? 196  LEU D CD2 1 
ATOM   6054  N  N   . LEU D  2  85  ? 4.127   16.897  41.501  1.00 14.26 ? 197  LEU D N   1 
ATOM   6055  C  CA  . LEU D  2  85  ? 4.905   15.711  41.818  1.00 13.94 ? 197  LEU D CA  1 
ATOM   6056  C  C   . LEU D  2  85  ? 4.686   15.429  43.296  1.00 13.47 ? 197  LEU D C   1 
ATOM   6057  O  O   . LEU D  2  85  ? 4.653   16.362  44.094  1.00 14.35 ? 197  LEU D O   1 
ATOM   6058  C  CB  . LEU D  2  85  ? 6.404   15.947  41.547  1.00 14.29 ? 197  LEU D CB  1 
ATOM   6059  C  CG  . LEU D  2  85  ? 6.837   16.056  40.078  1.00 15.38 ? 197  LEU D CG  1 
ATOM   6060  C  CD1 . LEU D  2  85  ? 8.309   16.432  39.990  1.00 16.75 ? 197  LEU D CD1 1 
ATOM   6061  C  CD2 . LEU D  2  85  ? 6.604   14.738  39.357  1.00 16.64 ? 197  LEU D CD2 1 
ATOM   6062  N  N   . ALA D  2  86  ? 4.494   14.163  43.650  1.00 14.44 ? 198  ALA D N   1 
ATOM   6063  C  CA  . ALA D  2  86  ? 4.232   13.761  45.044  1.00 17.67 ? 198  ALA D CA  1 
ATOM   6064  C  C   . ALA D  2  86  ? 5.391   14.142  45.986  1.00 19.09 ? 198  ALA D C   1 
ATOM   6065  O  O   . ALA D  2  86  ? 6.566   13.905  45.664  1.00 21.88 ? 198  ALA D O   1 
ATOM   6066  C  CB  . ALA D  2  86  ? 3.974   12.258  45.102  1.00 15.47 ? 198  ALA D CB  1 
ATOM   6067  N  N   . VAL D  2  87  ? 5.079   14.730  47.138  1.00 17.89 ? 199  VAL D N   1 
ATOM   6068  C  CA  . VAL D  2  87  ? 6.152   15.119  48.055  1.00 19.92 ? 199  VAL D CA  1 
ATOM   6069  C  C   . VAL D  2  87  ? 6.150   14.261  49.310  1.00 22.68 ? 199  VAL D C   1 
ATOM   6070  O  O   . VAL D  2  87  ? 5.163   13.568  49.589  1.00 21.34 ? 199  VAL D O   1 
ATOM   6071  C  CB  . VAL D  2  87  ? 6.080   16.612  48.453  1.00 19.23 ? 199  VAL D CB  1 
ATOM   6072  C  CG1 . VAL D  2  87  ? 5.984   17.470  47.206  1.00 16.82 ? 199  VAL D CG1 1 
ATOM   6073  C  CG2 . VAL D  2  87  ? 4.901   16.863  49.386  1.00 18.24 ? 199  VAL D CG2 1 
ATOM   6074  N  N   . ASN D  2  88  ? 7.267   14.307  50.071  1.00 22.86 ? 200  ASN D N   1 
ATOM   6075  C  CA  . ASN D  2  88  ? 7.411   13.491  51.273  1.00 23.34 ? 200  ASN D CA  1 
ATOM   6076  C  C   . ASN D  2  88  ? 6.243   13.727  52.265  1.00 25.20 ? 200  ASN D C   1 
ATOM   6077  O  O   . ASN D  2  88  ? 5.915   14.873  52.600  1.00 25.21 ? 200  ASN D O   1 
ATOM   6078  C  CB  . ASN D  2  88  ? 8.751   13.798  51.937  1.00 21.14 ? 200  ASN D CB  1 
ATOM   6079  C  CG  . ASN D  2  88  ? 9.156   12.752  52.954  1.00 22.09 ? 200  ASN D CG  1 
ATOM   6080  O  OD1 . ASN D  2  88  ? 8.659   12.754  54.085  1.00 21.22 ? 200  ASN D OD1 1 
ATOM   6081  N  ND2 . ASN D  2  88  ? 10.068  11.842  52.555  1.00 20.30 ? 200  ASN D ND2 1 
ATOM   6082  N  N   . GLN D  2  89  ? 5.619   12.627  52.710  1.00 25.08 ? 201  GLN D N   1 
ATOM   6083  C  CA  . GLN D  2  89  ? 4.479   12.685  53.610  1.00 25.18 ? 201  GLN D CA  1 
ATOM   6084  C  C   . GLN D  2  89  ? 4.861   12.628  55.086  1.00 25.28 ? 201  GLN D C   1 
ATOM   6085  O  O   . GLN D  2  89  ? 4.005   12.785  55.943  1.00 24.88 ? 201  GLN D O   1 
ATOM   6086  C  CB  . GLN D  2  89  ? 3.514   11.553  53.296  1.00 25.07 ? 201  GLN D CB  1 
ATOM   6087  C  CG  . GLN D  2  89  ? 2.791   11.746  51.989  1.00 29.85 ? 201  GLN D CG  1 
ATOM   6088  C  CD  . GLN D  2  89  ? 2.000   13.045  51.954  1.00 33.05 ? 201  GLN D CD  1 
ATOM   6089  O  OE1 . GLN D  2  89  ? 0.836   13.087  52.367  1.00 35.93 ? 201  GLN D OE1 1 
ATOM   6090  N  NE2 . GLN D  2  89  ? 2.624   14.114  51.454  1.00 34.39 ? 201  GLN D NE2 1 
ATOM   6091  N  N   . ARG D  2  90  ? 6.134   12.425  55.398  1.00 25.27 ? 202  ARG D N   1 
ATOM   6092  C  CA  . ARG D  2  90  ? 6.523   12.337  56.807  1.00 26.02 ? 202  ARG D CA  1 
ATOM   6093  C  C   . ARG D  2  90  ? 7.475   13.457  57.259  1.00 24.60 ? 202  ARG D C   1 
ATOM   6094  O  O   . ARG D  2  90  ? 7.647   13.650  58.473  1.00 23.16 ? 202  ARG D O   1 
ATOM   6095  C  CB  . ARG D  2  90  ? 7.184   10.987  57.097  1.00 28.73 ? 202  ARG D CB  1 
ATOM   6096  C  CG  . ARG D  2  90  ? 6.462   9.782   56.519  1.00 33.86 ? 202  ARG D CG  1 
ATOM   6097  C  CD  . ARG D  2  90  ? 6.731   8.539   57.352  1.00 38.97 ? 202  ARG D CD  1 
ATOM   6098  N  NE  . ARG D  2  90  ? 8.165   8.288   57.574  1.00 41.57 ? 202  ARG D NE  1 
ATOM   6099  C  CZ  . ARG D  2  90  ? 8.805   8.488   58.733  1.00 42.50 ? 202  ARG D CZ  1 
ATOM   6100  N  NH1 . ARG D  2  90  ? 8.168   8.986   59.781  1.00 43.21 ? 202  ARG D NH1 1 
ATOM   6101  N  NH2 . ARG D  2  90  ? 10.091  8.201   58.835  1.00 42.17 ? 202  ARG D NH2 1 
ATOM   6102  N  N   . PHE D  2  91  ? 8.095   14.182  56.301  1.00 22.72 ? 203  PHE D N   1 
ATOM   6103  C  CA  . PHE D  2  91  ? 9.103   15.206  56.630  1.00 21.62 ? 203  PHE D CA  1 
ATOM   6104  C  C   . PHE D  2  91  ? 9.098   16.407  55.687  1.00 21.87 ? 203  PHE D C   1 
ATOM   6105  O  O   . PHE D  2  91  ? 8.842   16.283  54.487  1.00 23.30 ? 203  PHE D O   1 
ATOM   6106  C  CB  . PHE D  2  91  ? 10.515  14.593  56.584  1.00 22.08 ? 203  PHE D CB  1 
ATOM   6107  C  CG  . PHE D  2  91  ? 10.784  13.531  57.608  1.00 21.33 ? 203  PHE D CG  1 
ATOM   6108  C  CD1 . PHE D  2  91  ? 11.113  13.871  58.921  1.00 22.76 ? 203  PHE D CD1 1 
ATOM   6109  C  CD2 . PHE D  2  91  ? 10.732  12.184  57.259  1.00 21.05 ? 203  PHE D CD2 1 
ATOM   6110  C  CE1 . PHE D  2  91  ? 11.386  12.875  59.865  1.00 22.30 ? 203  PHE D CE1 1 
ATOM   6111  C  CE2 . PHE D  2  91  ? 11.002  11.190  58.193  1.00 20.31 ? 203  PHE D CE2 1 
ATOM   6112  C  CZ  . PHE D  2  91  ? 11.330  11.533  59.495  1.00 21.75 ? 203  PHE D CZ  1 
ATOM   6113  N  N   . GLN D  2  92  ? 9.415   17.568  56.247  1.00 21.61 ? 204  GLN D N   1 
ATOM   6114  C  CA  . GLN D  2  92  ? 9.588   18.784  55.466  1.00 22.41 ? 204  GLN D CA  1 
ATOM   6115  C  C   . GLN D  2  92  ? 10.912  19.437  55.839  1.00 21.48 ? 204  GLN D C   1 
ATOM   6116  O  O   . GLN D  2  92  ? 11.456  19.177  56.902  1.00 21.67 ? 204  GLN D O   1 
ATOM   6117  C  CB  . GLN D  2  92  ? 8.451   19.787  55.709  1.00 22.59 ? 204  GLN D CB  1 
ATOM   6118  C  CG  . GLN D  2  92  ? 7.081   19.317  55.244  1.00 26.97 ? 204  GLN D CG  1 
ATOM   6119  C  CD  . GLN D  2  92  ? 5.962   20.271  55.636  1.00 26.87 ? 204  GLN D CD  1 
ATOM   6120  O  OE1 . GLN D  2  92  ? 4.946   20.365  54.966  1.00 26.01 ? 204  GLN D OE1 1 
ATOM   6121  N  NE2 . GLN D  2  92  ? 6.146   20.978  56.732  1.00 29.19 ? 204  GLN D NE2 1 
ATOM   6122  N  N   . ASP D  2  93  ? 11.407  20.273  54.940  1.00 21.43 ? 205  ASP D N   1 
ATOM   6123  C  CA  . ASP D  2  93  ? 12.624  21.032  55.121  1.00 20.01 ? 205  ASP D CA  1 
ATOM   6124  C  C   . ASP D  2  93  ? 12.266  22.520  55.240  1.00 19.94 ? 205  ASP D C   1 
ATOM   6125  O  O   . ASP D  2  93  ? 12.182  23.225  54.237  1.00 18.78 ? 205  ASP D O   1 
ATOM   6126  C  CB  . ASP D  2  93  ? 13.549  20.783  53.920  1.00 20.64 ? 205  ASP D CB  1 
ATOM   6127  C  CG  . ASP D  2  93  ? 14.771  21.697  53.853  1.00 22.46 ? 205  ASP D CG  1 
ATOM   6128  O  OD1 . ASP D  2  93  ? 15.306  21.898  52.732  1.00 22.11 ? 205  ASP D OD1 1 
ATOM   6129  O  OD2 . ASP D  2  93  ? 15.212  22.209  54.917  1.00 23.67 ? 205  ASP D OD2 1 
ATOM   6130  N  N   . ASN D  2  94  ? 12.074  22.980  56.495  1.00 22.21 ? 206  ASN D N   1 
ATOM   6131  C  CA  . ASN D  2  94  ? 11.654  24.372  56.846  1.00 23.41 ? 206  ASN D CA  1 
ATOM   6132  C  C   . ASN D  2  94  ? 10.372  24.801  56.135  1.00 22.46 ? 206  ASN D C   1 
ATOM   6133  O  O   . ASN D  2  94  ? 10.305  25.896  55.598  1.00 24.48 ? 206  ASN D O   1 
ATOM   6134  C  CB  . ASN D  2  94  ? 12.756  25.398  56.546  1.00 24.64 ? 206  ASN D CB  1 
ATOM   6135  C  CG  . ASN D  2  94  ? 13.937  25.285  57.478  1.00 25.10 ? 206  ASN D CG  1 
ATOM   6136  O  OD1 . ASN D  2  94  ? 13.769  25.115  58.674  1.00 27.88 ? 206  ASN D OD1 1 
ATOM   6137  N  ND2 . ASN D  2  94  ? 15.141  25.378  56.929  1.00 26.96 ? 206  ASN D ND2 1 
ATOM   6138  N  N   . GLY D  2  95  ? 9.357   23.940  56.154  1.00 22.54 ? 207  GLY D N   1 
ATOM   6139  C  CA  . GLY D  2  95  ? 8.095   24.250  55.493  1.00 23.10 ? 207  GLY D CA  1 
ATOM   6140  C  C   . GLY D  2  95  ? 8.116   23.983  53.992  1.00 22.13 ? 207  GLY D C   1 
ATOM   6141  O  O   . GLY D  2  95  ? 7.210   24.408  53.267  1.00 20.95 ? 207  GLY D O   1 
ATOM   6142  N  N   . ARG D  2  96  ? 9.177   23.307  53.509  1.00 21.16 ? 208  ARG D N   1 
ATOM   6143  C  CA  . ARG D  2  96  ? 9.281   22.961  52.088  1.00 19.28 ? 208  ARG D CA  1 
ATOM   6144  C  C   . ARG D  2  96  ? 9.370   21.458  51.870  1.00 18.87 ? 208  ARG D C   1 
ATOM   6145  O  O   . ARG D  2  96  ? 9.731   20.683  52.771  1.00 20.27 ? 208  ARG D O   1 
ATOM   6146  C  CB  . ARG D  2  96  ? 10.450  23.672  51.435  1.00 18.53 ? 208  ARG D CB  1 
ATOM   6147  C  CG  . ARG D  2  96  ? 10.275  25.178  51.446  1.00 19.71 ? 208  ARG D CG  1 
ATOM   6148  C  CD  . ARG D  2  96  ? 11.468  25.883  50.846  1.00 20.01 ? 208  ARG D CD  1 
ATOM   6149  N  NE  . ARG D  2  96  ? 11.288  27.320  50.849  1.00 21.57 ? 208  ARG D NE  1 
ATOM   6150  C  CZ  . ARG D  2  96  ? 11.507  28.104  51.892  1.00 22.95 ? 208  ARG D CZ  1 
ATOM   6151  N  NH1 . ARG D  2  96  ? 11.912  27.592  53.047  1.00 24.49 ? 208  ARG D NH1 1 
ATOM   6152  N  NH2 . ARG D  2  96  ? 11.330  29.412  51.774  1.00 24.25 ? 208  ARG D NH2 1 
ATOM   6153  N  N   . ALA D  2  97  ? 9.030   21.055  50.670  1.00 17.38 ? 209  ALA D N   1 
ATOM   6154  C  CA  . ALA D  2  97  ? 8.932   19.658  50.339  1.00 16.36 ? 209  ALA D CA  1 
ATOM   6155  C  C   . ALA D  2  97  ? 10.263  18.924  50.183  1.00 18.34 ? 209  ALA D C   1 
ATOM   6156  O  O   . ALA D  2  97  ? 11.279  19.446  49.662  1.00 19.39 ? 209  ALA D O   1 
ATOM   6157  C  CB  . ALA D  2  97  ? 8.123   19.520  49.068  1.00 16.21 ? 209  ALA D CB  1 
ATOM   6158  N  N   . LEU D  2  98  ? 10.247  17.698  50.640  1.00 19.35 ? 210  LEU D N   1 
ATOM   6159  C  CA  . LEU D  2  98  ? 11.337  16.771  50.393  1.00 20.60 ? 210  LEU D CA  1 
ATOM   6160  C  C   . LEU D  2  98  ? 10.857  15.727  49.379  1.00 21.33 ? 210  LEU D C   1 
ATOM   6161  O  O   . LEU D  2  98  ? 9.647   15.655  49.052  1.00 20.81 ? 210  LEU D O   1 
ATOM   6162  C  CB  . LEU D  2  98  ? 11.784  16.103  51.705  1.00 18.50 ? 210  LEU D CB  1 
ATOM   6163  C  CG  . LEU D  2  98  ? 12.582  17.018  52.638  1.00 18.81 ? 210  LEU D CG  1 
ATOM   6164  C  CD1 . LEU D  2  98  ? 12.849  16.341  53.970  1.00 17.77 ? 210  LEU D CD1 1 
ATOM   6165  C  CD2 . LEU D  2  98  ? 13.886  17.406  51.952  1.00 20.27 ? 210  LEU D CD2 1 
ATOM   6166  N  N   . LEU D  2  99  ? 11.784  14.959  48.844  1.00 19.87 ? 211  LEU D N   1 
ATOM   6167  C  CA  . LEU D  2  99  ? 11.414  13.882  47.955  1.00 19.10 ? 211  LEU D CA  1 
ATOM   6168  C  C   . LEU D  2  99  ? 10.719  12.791  48.776  1.00 19.18 ? 211  LEU D C   1 
ATOM   6169  O  O   . LEU D  2  99  ? 11.026  12.599  49.949  1.00 17.89 ? 211  LEU D O   1 
ATOM   6170  C  CB  . LEU D  2  99  ? 12.667  13.292  47.303  1.00 17.03 ? 211  LEU D CB  1 
ATOM   6171  C  CG  . LEU D  2  99  ? 13.499  14.230  46.429  1.00 15.84 ? 211  LEU D CG  1 
ATOM   6172  C  CD1 . LEU D  2  99  ? 14.937  13.751  46.400  1.00 15.39 ? 211  LEU D CD1 1 
ATOM   6173  C  CD2 . LEU D  2  99  ? 12.908  14.303  45.021  1.00 13.71 ? 211  LEU D CD2 1 
ATOM   6174  N  N   . PRO D  2  100 ? 9.722   12.104  48.224  1.00 19.83 ? 212  PRO D N   1 
ATOM   6175  C  CA  . PRO D  2  100 ? 9.078   11.031  48.954  1.00 19.72 ? 212  PRO D CA  1 
ATOM   6176  C  C   . PRO D  2  100 ? 10.129  9.956   49.191  1.00 20.25 ? 212  PRO D C   1 
ATOM   6177  O  O   . PRO D  2  100 ? 11.158  9.919   48.476  1.00 18.06 ? 212  PRO D O   1 
ATOM   6178  C  CB  . PRO D  2  100 ? 7.962   10.568  48.013  1.00 21.48 ? 212  PRO D CB  1 
ATOM   6179  C  CG  . PRO D  2  100 ? 8.454   10.997  46.672  1.00 22.49 ? 212  PRO D CG  1 
ATOM   6180  C  CD  . PRO D  2  100 ? 9.102   12.328  46.911  1.00 20.89 ? 212  PRO D CD  1 
ATOM   6181  N  N   . PHE D  2  101 ? 9.922   9.140   50.212  1.00 18.71 ? 213  PHE D N   1 
ATOM   6182  C  CA  . PHE D  2  101 ? 10.843  8.066   50.488  1.00 19.46 ? 213  PHE D CA  1 
ATOM   6183  C  C   . PHE D  2  101 ? 10.582  6.945   49.541  1.00 20.65 ? 213  PHE D C   1 
ATOM   6184  O  O   . PHE D  2  101 ? 9.443   6.746   49.108  1.00 21.83 ? 213  PHE D O   1 
ATOM   6185  C  CB  . PHE D  2  101 ? 10.687  7.569   51.911  1.00 18.90 ? 213  PHE D CB  1 
ATOM   6186  C  CG  . PHE D  2  101 ? 11.312  8.474   52.922  1.00 19.36 ? 213  PHE D CG  1 
ATOM   6187  C  CD1 . PHE D  2  101 ? 10.632  8.804   54.098  1.00 19.70 ? 213  PHE D CD1 1 
ATOM   6188  C  CD2 . PHE D  2  101 ? 12.588  8.987   52.715  1.00 19.01 ? 213  PHE D CD2 1 
ATOM   6189  C  CE1 . PHE D  2  101 ? 11.219  9.629   55.044  1.00 17.46 ? 213  PHE D CE1 1 
ATOM   6190  C  CE2 . PHE D  2  101 ? 13.175  9.821   53.662  1.00 18.73 ? 213  PHE D CE2 1 
ATOM   6191  C  CZ  . PHE D  2  101 ? 12.489  10.138  54.824  1.00 19.81 ? 213  PHE D CZ  1 
ATOM   6192  N  N   . ASP D  2  102 ? 11.626  6.229   49.177  1.00 21.91 ? 214  ASP D N   1 
ATOM   6193  C  CA  . ASP D  2  102 ? 11.477  5.101   48.291  1.00 23.72 ? 214  ASP D CA  1 
ATOM   6194  C  C   . ASP D  2  102 ? 11.278  3.844   49.114  1.00 26.28 ? 214  ASP D C   1 
ATOM   6195  O  O   . ASP D  2  102 ? 11.574  3.835   50.315  1.00 24.12 ? 214  ASP D O   1 
ATOM   6196  C  CB  . ASP D  2  102 ? 12.720  4.966   47.441  1.00 25.78 ? 214  ASP D CB  1 
ATOM   6197  C  CG  . ASP D  2  102 ? 12.477  4.213   46.170  1.00 28.62 ? 214  ASP D CG  1 
ATOM   6198  O  OD1 . ASP D  2  102 ? 12.918  4.701   45.122  1.00 33.82 ? 214  ASP D OD1 1 
ATOM   6199  O  OD2 . ASP D  2  102 ? 11.851  3.129   46.206  1.00 32.29 ? 214  ASP D OD2 1 
ATOM   6200  N  N   . ASN D  2  103 ? 10.741  2.787   48.493  1.00 29.28 ? 215  ASN D N   1 
ATOM   6201  C  CA  . ASN D  2  103 ? 10.604  1.520   49.206  1.00 32.85 ? 215  ASN D CA  1 
ATOM   6202  C  C   . ASN D  2  103 ? 11.532  0.460   48.612  1.00 33.28 ? 215  ASN D C   1 
ATOM   6203  O  O   . ASN D  2  103 ? 11.143  -0.346  47.755  1.00 35.01 ? 215  ASN D O   1 
ATOM   6204  C  CB  . ASN D  2  103 ? 9.145   1.011   49.219  1.00 34.56 ? 215  ASN D CB  1 
ATOM   6205  C  CG  . ASN D  2  103 ? 8.946   -0.149  50.212  1.00 36.74 ? 215  ASN D CG  1 
ATOM   6206  O  OD1 . ASN D  2  103 ? 9.604   -1.200  50.109  1.00 36.81 ? 215  ASN D OD1 1 
ATOM   6207  N  ND2 . ASN D  2  103 ? 8.045   0.039   51.183  1.00 36.31 ? 215  ASN D ND2 1 
ATOM   6208  N  N   . LEU D  2  104 ? 12.771  0.478   49.061  1.00 33.77 ? 216  LEU D N   1 
ATOM   6209  C  CA  . LEU D  2  104 ? 13.735  -0.488  48.600  1.00 35.19 ? 216  LEU D CA  1 
ATOM   6210  C  C   . LEU D  2  104 ? 13.784  -1.661  49.571  1.00 38.06 ? 216  LEU D C   1 
ATOM   6211  O  O   . LEU D  2  104 ? 13.465  -1.523  50.759  1.00 38.10 ? 216  LEU D O   1 
ATOM   6212  C  CB  . LEU D  2  104 ? 15.114  0.156   48.466  1.00 32.80 ? 216  LEU D CB  1 
ATOM   6213  C  CG  . LEU D  2  104 ? 15.210  1.412   47.587  1.00 31.67 ? 216  LEU D CG  1 
ATOM   6214  C  CD1 . LEU D  2  104 ? 16.625  1.986   47.664  1.00 29.08 ? 216  LEU D CD1 1 
ATOM   6215  C  CD2 . LEU D  2  104 ? 14.829  1.085   46.147  1.00 27.96 ? 216  LEU D CD2 1 
ATOM   6216  N  N   . HIS D  2  105 ? 14.169  -2.816  49.059  1.00 40.63 ? 217  HIS D N   1 
ATOM   6217  C  CA  . HIS D  2  105 ? 14.203  -4.017  49.861  1.00 43.47 ? 217  HIS D CA  1 
ATOM   6218  C  C   . HIS D  2  105 ? 15.305  -3.921  50.907  1.00 43.76 ? 217  HIS D C   1 
ATOM   6219  O  O   . HIS D  2  105 ? 15.016  -3.766  52.106  1.00 45.11 ? 217  HIS D O   1 
ATOM   6220  C  CB  . HIS D  2  105 ? 14.428  -5.252  48.971  1.00 47.36 ? 217  HIS D CB  1 
ATOM   6221  C  CG  . HIS D  2  105 ? 13.597  -5.287  47.719  1.00 51.64 ? 217  HIS D CG  1 
ATOM   6222  N  ND1 . HIS D  2  105 ? 13.035  -4.153  47.155  1.00 53.35 ? 217  HIS D ND1 1 
ATOM   6223  C  CD2 . HIS D  2  105 ? 13.293  -6.306  46.880  1.00 53.84 ? 217  HIS D CD2 1 
ATOM   6224  C  CE1 . HIS D  2  105 ? 12.428  -4.474  46.026  1.00 54.76 ? 217  HIS D CE1 1 
ATOM   6225  N  NE2 . HIS D  2  105 ? 12.568  -5.775  45.834  1.00 54.85 ? 217  HIS D NE2 1 
ATOM   6226  N  N   . ASP D  2  106 ? 16.564  -3.986  50.441  1.00 41.79 ? 218  ASP D N   1 
ATOM   6227  C  CA  . ASP D  2  106 ? 17.736  -3.977  51.325  1.00 39.57 ? 218  ASP D CA  1 
ATOM   6228  C  C   . ASP D  2  106 ? 18.343  -2.588  51.432  1.00 36.35 ? 218  ASP D C   1 
ATOM   6229  O  O   . ASP D  2  106 ? 19.558  -2.450  51.603  1.00 36.74 ? 218  ASP D O   1 
ATOM   6230  C  CB  . ASP D  2  106 ? 18.785  -4.963  50.797  1.00 43.17 ? 218  ASP D CB  1 
ATOM   6231  C  CG  . ASP D  2  106 ? 18.264  -6.386  50.722  1.00 44.62 ? 218  ASP D CG  1 
ATOM   6232  O  OD1 . ASP D  2  106 ? 17.715  -6.781  49.660  1.00 44.72 ? 218  ASP D OD1 1 
ATOM   6233  O  OD2 . ASP D  2  106 ? 18.395  -7.107  51.731  1.00 47.32 ? 218  ASP D OD2 1 
ATOM   6234  N  N   . ASP D  2  107 ? 17.464  -1.583  51.345  1.00 32.05 ? 219  ASP D N   1 
ATOM   6235  C  CA  . ASP D  2  107 ? 17.772  -0.144  51.379  1.00 29.08 ? 219  ASP D CA  1 
ATOM   6236  C  C   . ASP D  2  107 ? 19.134  0.206   51.991  1.00 27.21 ? 219  ASP D C   1 
ATOM   6237  O  O   . ASP D  2  107 ? 19.321  0.117   53.206  1.00 25.60 ? 219  ASP D O   1 
ATOM   6238  C  CB  . ASP D  2  107 ? 16.669  0.586   52.134  1.00 27.99 ? 219  ASP D CB  1 
ATOM   6239  C  CG  . ASP D  2  107 ? 16.777  2.075   51.972  1.00 26.85 ? 219  ASP D CG  1 
ATOM   6240  O  OD1 . ASP D  2  107 ? 16.163  2.615   51.039  1.00 26.61 ? 219  ASP D OD1 1 
ATOM   6241  O  OD2 . ASP D  2  107 ? 17.483  2.702   52.776  1.00 29.36 ? 219  ASP D OD2 1 
ATOM   6242  N  N   . PRO D  2  108 ? 20.094  0.649   51.142  1.00 26.00 ? 220  PRO D N   1 
ATOM   6243  C  CA  . PRO D  2  108 ? 21.449  1.014   51.583  1.00 24.09 ? 220  PRO D CA  1 
ATOM   6244  C  C   . PRO D  2  108 ? 21.448  2.220   52.490  1.00 22.63 ? 220  PRO D C   1 
ATOM   6245  O  O   . PRO D  2  108 ? 22.294  2.326   53.384  1.00 21.68 ? 220  PRO D O   1 
ATOM   6246  C  CB  . PRO D  2  108 ? 22.190  1.297   50.272  1.00 26.62 ? 220  PRO D CB  1 
ATOM   6247  C  CG  . PRO D  2  108 ? 21.093  1.776   49.360  1.00 27.33 ? 220  PRO D CG  1 
ATOM   6248  C  CD  . PRO D  2  108 ? 19.938  0.854   49.671  1.00 26.11 ? 220  PRO D CD  1 
ATOM   6249  N  N   . CYS D  2  109 ? 20.497  3.137   52.262  1.00 20.60 ? 221  CYS D N   1 
ATOM   6250  C  CA  . CYS D  2  109 ? 20.418  4.356   53.053  1.00 21.13 ? 221  CYS D CA  1 
ATOM   6251  C  C   . CYS D  2  109 ? 20.241  4.060   54.548  1.00 22.61 ? 221  CYS D C   1 
ATOM   6252  O  O   . CYS D  2  109 ? 20.921  4.671   55.390  1.00 25.56 ? 221  CYS D O   1 
ATOM   6253  C  CB  . CYS D  2  109 ? 19.302  5.269   52.536  1.00 19.12 ? 221  CYS D CB  1 
ATOM   6254  S  SG  . CYS D  2  109 ? 19.570  5.846   50.828  1.00 18.73 ? 221  CYS D SG  1 
ATOM   6255  N  N   . LEU D  2  110 ? 19.370  3.108   54.879  1.00 20.66 ? 222  LEU D N   1 
ATOM   6256  C  CA  . LEU D  2  110 ? 19.153  2.725   56.271  1.00 21.89 ? 222  LEU D CA  1 
ATOM   6257  C  C   . LEU D  2  110 ? 20.460  2.284   56.962  1.00 21.65 ? 222  LEU D C   1 
ATOM   6258  O  O   . LEU D  2  110 ? 20.632  2.495   58.168  1.00 21.68 ? 222  LEU D O   1 
ATOM   6259  C  CB  . LEU D  2  110 ? 18.128  1.584   56.356  1.00 21.52 ? 222  LEU D CB  1 
ATOM   6260  C  CG  . LEU D  2  110 ? 16.674  1.934   56.041  1.00 21.68 ? 222  LEU D CG  1 
ATOM   6261  C  CD1 . LEU D  2  110 ? 15.840  0.666   55.978  1.00 21.05 ? 222  LEU D CD1 1 
ATOM   6262  C  CD2 . LEU D  2  110 ? 16.125  2.895   57.078  1.00 22.09 ? 222  LEU D CD2 1 
ATOM   6263  N  N   . LEU D  2  111 ? 21.371  1.666   56.214  1.00 21.29 ? 223  LEU D N   1 
ATOM   6264  C  CA  . LEU D  2  111 ? 22.636  1.225   56.794  1.00 23.29 ? 223  LEU D CA  1 
ATOM   6265  C  C   . LEU D  2  111 ? 23.617  2.378   57.117  1.00 24.27 ? 223  LEU D C   1 
ATOM   6266  O  O   . LEU D  2  111 ? 24.563  2.170   57.880  1.00 23.90 ? 223  LEU D O   1 
ATOM   6267  C  CB  . LEU D  2  111 ? 23.339  0.246   55.872  1.00 23.63 ? 223  LEU D CB  1 
ATOM   6268  C  CG  . LEU D  2  111 ? 22.553  -0.971  55.424  1.00 23.46 ? 223  LEU D CG  1 
ATOM   6269  C  CD1 . LEU D  2  111 ? 23.481  -1.883  54.645  1.00 23.32 ? 223  LEU D CD1 1 
ATOM   6270  C  CD2 . LEU D  2  111 ? 21.949  -1.700  56.617  1.00 22.04 ? 223  LEU D CD2 1 
ATOM   6271  N  N   . THR D  2  112 ? 23.401  3.591   56.550  1.00 23.92 ? 224  THR D N   1 
ATOM   6272  C  CA  . THR D  2  112 ? 24.325  4.724   56.782  1.00 23.58 ? 224  THR D CA  1 
ATOM   6273  C  C   . THR D  2  112 ? 24.179  5.342   58.184  1.00 24.33 ? 224  THR D C   1 
ATOM   6274  O  O   . THR D  2  112 ? 25.001  6.156   58.614  1.00 22.52 ? 224  THR D O   1 
ATOM   6275  C  CB  . THR D  2  112 ? 24.138  5.821   55.714  1.00 22.99 ? 224  THR D CB  1 
ATOM   6276  O  OG1 . THR D  2  112 ? 22.817  6.378   55.803  1.00 24.37 ? 224  THR D OG1 1 
ATOM   6277  C  CG2 . THR D  2  112 ? 24.338  5.235   54.328  1.00 20.17 ? 224  THR D CG2 1 
ATOM   6278  N  N   . ASN D  2  113 ? 23.112  4.946   58.869  1.00 25.41 ? 225  ASN D N   1 
ATOM   6279  C  CA  . ASN D  2  113 ? 22.798  5.344   60.237  1.00 27.96 ? 225  ASN D CA  1 
ATOM   6280  C  C   . ASN D  2  113 ? 21.606  4.496   60.698  1.00 28.84 ? 225  ASN D C   1 
ATOM   6281  O  O   . ASN D  2  113 ? 20.457  4.793   60.367  1.00 29.92 ? 225  ASN D O   1 
ATOM   6282  C  CB  . ASN D  2  113 ? 22.453  6.850   60.326  1.00 27.19 ? 225  ASN D CB  1 
ATOM   6283  C  CG  . ASN D  2  113 ? 22.243  7.314   61.768  1.00 28.72 ? 225  ASN D CG  1 
ATOM   6284  O  OD1 . ASN D  2  113 ? 21.972  6.497   62.652  1.00 26.35 ? 225  ASN D OD1 1 
ATOM   6285  N  ND2 . ASN D  2  113 ? 22.357  8.625   62.015  1.00 29.57 ? 225  ASN D ND2 1 
ATOM   6286  N  N   . ARG D  2  114 ? 21.893  3.445   61.462  1.00 30.76 ? 226  ARG D N   1 
ATOM   6287  C  CA  . ARG D  2  114 ? 20.876  2.460   61.866  1.00 32.02 ? 226  ARG D CA  1 
ATOM   6288  C  C   . ARG D  2  114 ? 19.720  3.028   62.698  1.00 30.66 ? 226  ARG D C   1 
ATOM   6289  O  O   . ARG D  2  114 ? 18.565  2.636   62.495  1.00 30.17 ? 226  ARG D O   1 
ATOM   6290  C  CB  . ARG D  2  114 ? 21.537  1.283   62.617  1.00 32.84 ? 226  ARG D CB  1 
ATOM   6291  C  CG  . ARG D  2  114 ? 22.736  0.680   61.896  1.00 37.86 ? 226  ARG D CG  1 
ATOM   6292  C  CD  . ARG D  2  114 ? 22.423  0.332   60.442  1.00 40.57 ? 226  ARG D CD  1 
ATOM   6293  N  NE  . ARG D  2  114 ? 21.722  -0.943  60.305  1.00 45.86 ? 226  ARG D NE  1 
ATOM   6294  C  CZ  . ARG D  2  114 ? 22.326  -2.143  60.175  1.00 48.68 ? 226  ARG D CZ  1 
ATOM   6295  N  NH1 . ARG D  2  114 ? 23.642  -2.243  60.175  1.00 50.17 ? 226  ARG D NH1 1 
ATOM   6296  N  NH2 . ARG D  2  114 ? 21.604  -3.245  60.043  1.00 49.49 ? 226  ARG D NH2 1 
ATOM   6297  N  N   . SER D  2  115 ? 20.007  3.953   63.614  1.00 29.55 ? 227  SER D N   1 
ATOM   6298  C  CA  . SER D  2  115 ? 18.954  4.434   64.508  1.00 29.09 ? 227  SER D CA  1 
ATOM   6299  C  C   . SER D  2  115 ? 18.052  5.514   63.896  1.00 28.68 ? 227  SER D C   1 
ATOM   6300  O  O   . SER D  2  115 ? 16.883  5.611   64.261  1.00 28.59 ? 227  SER D O   1 
ATOM   6301  C  CB  . SER D  2  115 ? 19.549  4.914   65.840  1.00 28.84 ? 227  SER D CB  1 
ATOM   6302  O  OG  . SER D  2  115 ? 20.245  6.139   65.696  1.00 30.16 ? 227  SER D OG  1 
ATOM   6303  N  N   . ALA D  2  116 ? 18.587  6.330   62.976  1.00 28.40 ? 228  ALA D N   1 
ATOM   6304  C  CA  . ALA D  2  116 ? 17.787  7.379   62.328  1.00 26.53 ? 228  ALA D CA  1 
ATOM   6305  C  C   . ALA D  2  116 ? 16.632  6.750   61.556  1.00 25.92 ? 228  ALA D C   1 
ATOM   6306  O  O   . ALA D  2  116 ? 15.500  7.261   61.565  1.00 25.59 ? 228  ALA D O   1 
ATOM   6307  C  CB  . ALA D  2  116 ? 18.654  8.199   61.388  1.00 25.21 ? 228  ALA D CB  1 
ATOM   6308  N  N   . ARG D  2  117 ? 16.922  5.618   60.920  1.00 24.66 ? 229  ARG D N   1 
ATOM   6309  C  CA  . ARG D  2  117 ? 15.924  4.877   60.156  1.00 26.35 ? 229  ARG D CA  1 
ATOM   6310  C  C   . ARG D  2  117 ? 15.296  5.747   59.057  1.00 24.63 ? 229  ARG D C   1 
ATOM   6311  O  O   . ARG D  2  117 ? 14.073  5.828   58.913  1.00 25.06 ? 229  ARG D O   1 
ATOM   6312  C  CB  . ARG D  2  117 ? 14.851  4.275   61.108  1.00 28.74 ? 229  ARG D CB  1 
ATOM   6313  C  CG  . ARG D  2  117 ? 15.413  3.206   62.049  1.00 30.60 ? 229  ARG D CG  1 
ATOM   6314  C  CD  . ARG D  2  117 ? 14.490  2.894   63.223  1.00 34.42 ? 229  ARG D CD  1 
ATOM   6315  N  NE  . ARG D  2  117 ? 15.174  2.058   64.220  1.00 40.03 ? 229  ARG D NE  1 
ATOM   6316  C  CZ  . ARG D  2  117 ? 14.586  1.428   65.239  1.00 40.65 ? 229  ARG D CZ  1 
ATOM   6317  N  NH1 . ARG D  2  117 ? 13.282  1.537   65.427  1.00 43.57 ? 229  ARG D NH1 1 
ATOM   6318  N  NH2 . ARG D  2  117 ? 15.308  0.685   66.071  1.00 40.01 ? 229  ARG D NH2 1 
ATOM   6319  N  N   . ILE D  2  118 ? 16.160  6.420   58.301  1.00 22.38 ? 230  ILE D N   1 
ATOM   6320  C  CA  . ILE D  2  118 ? 15.737  7.220   57.160  1.00 20.62 ? 230  ILE D CA  1 
ATOM   6321  C  C   . ILE D  2  118 ? 16.065  6.413   55.908  1.00 20.75 ? 230  ILE D C   1 
ATOM   6322  O  O   . ILE D  2  118 ? 17.215  6.024   55.700  1.00 20.47 ? 230  ILE D O   1 
ATOM   6323  C  CB  . ILE D  2  118 ? 16.461  8.611   57.090  1.00 18.62 ? 230  ILE D CB  1 
ATOM   6324  C  CG1 . ILE D  2  118 ? 16.202  9.422   58.369  1.00 18.44 ? 230  ILE D CG1 1 
ATOM   6325  C  CG2 . ILE D  2  118 ? 16.000  9.403   55.879  1.00 13.59 ? 230  ILE D CG2 1 
ATOM   6326  C  CD1 . ILE D  2  118 ? 14.756  9.804   58.589  1.00 16.64 ? 230  ILE D CD1 1 
ATOM   6327  N  N   . PRO D  2  119 ? 15.037  6.073   55.111  1.00 20.04 ? 231  PRO D N   1 
ATOM   6328  C  CA  . PRO D  2  119 ? 15.200  5.311   53.873  1.00 18.62 ? 231  PRO D CA  1 
ATOM   6329  C  C   . PRO D  2  119 ? 15.658  6.180   52.704  1.00 16.85 ? 231  PRO D C   1 
ATOM   6330  O  O   . PRO D  2  119 ? 15.706  7.403   52.805  1.00 16.59 ? 231  PRO D O   1 
ATOM   6331  C  CB  . PRO D  2  119 ? 13.800  4.755   53.656  1.00 20.56 ? 231  PRO D CB  1 
ATOM   6332  C  CG  . PRO D  2  119 ? 12.949  5.882   54.121  1.00 19.67 ? 231  PRO D CG  1 
ATOM   6333  C  CD  . PRO D  2  119 ? 13.599  6.324   55.397  1.00 19.77 ? 231  PRO D CD  1 
ATOM   6334  N  N   . CYS D  2  120 ? 16.007  5.534   51.604  1.00 18.36 ? 232  CYS D N   1 
ATOM   6335  C  CA  . CYS D  2  120 ? 16.379  6.242   50.379  1.00 17.92 ? 232  CYS D CA  1 
ATOM   6336  C  C   . CYS D  2  120 ? 15.169  6.948   49.784  1.00 19.09 ? 232  CYS D C   1 
ATOM   6337  O  O   . CYS D  2  120 ? 14.031  6.527   49.987  1.00 16.82 ? 232  CYS D O   1 
ATOM   6338  C  CB  . CYS D  2  120 ? 16.949  5.281   49.321  1.00 18.36 ? 232  CYS D CB  1 
ATOM   6339  S  SG  . CYS D  2  120 ? 18.556  4.488   49.706  1.00 19.33 ? 232  CYS D SG  1 
ATOM   6340  N  N   . PHE D  2  121 ? 15.442  8.014   49.038  1.00 20.21 ? 233  PHE D N   1 
ATOM   6341  C  CA  . PHE D  2  121 ? 14.409  8.823   48.402  1.00 19.96 ? 233  PHE D CA  1 
ATOM   6342  C  C   . PHE D  2  121 ? 13.952  8.235   47.048  1.00 19.28 ? 233  PHE D C   1 
ATOM   6343  O  O   . PHE D  2  121 ? 14.733  7.599   46.313  1.00 18.72 ? 233  PHE D O   1 
ATOM   6344  C  CB  . PHE D  2  121 ? 14.925  10.266  48.206  1.00 18.78 ? 233  PHE D CB  1 
ATOM   6345  C  CG  . PHE D  2  121 ? 15.067  11.070  49.478  1.00 19.33 ? 233  PHE D CG  1 
ATOM   6346  C  CD1 . PHE D  2  121 ? 13.936  11.563  50.140  1.00 16.15 ? 233  PHE D CD1 1 
ATOM   6347  C  CD2 . PHE D  2  121 ? 16.327  11.325  50.035  1.00 20.52 ? 233  PHE D CD2 1 
ATOM   6348  C  CE1 . PHE D  2  121 ? 14.052  12.281  51.321  1.00 17.09 ? 233  PHE D CE1 1 
ATOM   6349  C  CE2 . PHE D  2  121 ? 16.445  12.049  51.225  1.00 20.80 ? 233  PHE D CE2 1 
ATOM   6350  C  CZ  . PHE D  2  121 ? 15.304  12.526  51.867  1.00 19.07 ? 233  PHE D CZ  1 
ATOM   6351  N  N   . LEU D  2  122 ? 12.680  8.437   46.740  1.00 16.14 ? 234  LEU D N   1 
ATOM   6352  C  CA  . LEU D  2  122 ? 12.123  8.024   45.484  1.00 14.61 ? 234  LEU D CA  1 
ATOM   6353  C  C   . LEU D  2  122 ? 12.170  9.213   44.520  1.00 13.26 ? 234  LEU D C   1 
ATOM   6354  O  O   . LEU D  2  122 ? 11.686  10.301  44.843  1.00 14.67 ? 234  LEU D O   1 
ATOM   6355  C  CB  . LEU D  2  122 ? 10.678  7.535   45.709  1.00 15.52 ? 234  LEU D CB  1 
ATOM   6356  C  CG  . LEU D  2  122 ? 9.835   7.124   44.471  1.00 18.89 ? 234  LEU D CG  1 
ATOM   6357  C  CD1 . LEU D  2  122 ? 10.483  5.968   43.708  1.00 17.16 ? 234  LEU D CD1 1 
ATOM   6358  C  CD2 . LEU D  2  122 ? 8.430   6.734   44.921  1.00 18.30 ? 234  LEU D CD2 1 
ATOM   6359  N  N   . ALA D  2  123 ? 12.806  9.015   43.356  1.00 10.42 ? 235  ALA D N   1 
ATOM   6360  C  CA  . ALA D  2  123 ? 12.887  10.044  42.325  1.00 9.12  ? 235  ALA D CA  1 
ATOM   6361  C  C   . ALA D  2  123 ? 12.829  9.406   40.943  1.00 8.51  ? 235  ALA D C   1 
ATOM   6362  O  O   . ALA D  2  123 ? 12.712  8.175   40.833  1.00 10.77 ? 235  ALA D O   1 
ATOM   6363  C  CB  . ALA D  2  123 ? 14.178  10.857  42.472  1.00 8.63  ? 235  ALA D CB  1 
ATOM   6364  N  N   . GLY D  2  124 ? 12.924  10.248  39.890  1.00 9.97  ? 236  GLY D N   1 
ATOM   6365  C  CA  . GLY D  2  124 ? 12.905  9.784   38.496  1.00 9.44  ? 236  GLY D CA  1 
ATOM   6366  C  C   . GLY D  2  124 ? 14.055  8.828   38.141  1.00 11.02 ? 236  GLY D C   1 
ATOM   6367  O  O   . GLY D  2  124 ? 13.948  8.043   37.205  1.00 10.99 ? 236  GLY D O   1 
ATOM   6368  N  N   . ASP D  2  125 ? 15.166  8.924   38.885  1.00 11.02 ? 237  ASP D N   1 
ATOM   6369  C  CA  . ASP D  2  125 ? 16.329  8.050   38.734  1.00 11.52 ? 237  ASP D CA  1 
ATOM   6370  C  C   . ASP D  2  125 ? 16.642  7.384   40.085  1.00 10.12 ? 237  ASP D C   1 
ATOM   6371  O  O   . ASP D  2  125 ? 16.430  7.978   41.141  1.00 10.40 ? 237  ASP D O   1 
ATOM   6372  C  CB  . ASP D  2  125 ? 17.543  8.860   38.234  1.00 14.08 ? 237  ASP D CB  1 
ATOM   6373  C  CG  . ASP D  2  125 ? 18.822  8.022   38.160  1.00 13.13 ? 237  ASP D CG  1 
ATOM   6374  O  OD1 . ASP D  2  125 ? 19.076  7.408   37.093  1.00 11.44 ? 237  ASP D OD1 1 
ATOM   6375  O  OD2 . ASP D  2  125 ? 19.553  7.970   39.179  1.00 11.80 ? 237  ASP D OD2 1 
ATOM   6376  N  N   . THR D  2  126 ? 17.142  6.172   40.027  1.00 8.02  ? 238  THR D N   1 
ATOM   6377  C  CA  . THR D  2  126 ? 17.398  5.348   41.191  1.00 10.09 ? 238  THR D CA  1 
ATOM   6378  C  C   . THR D  2  126 ? 18.573  5.796   42.088  1.00 9.13  ? 238  THR D C   1 
ATOM   6379  O  O   . THR D  2  126 ? 18.775  5.230   43.159  1.00 8.15  ? 238  THR D O   1 
ATOM   6380  C  CB  . THR D  2  126 ? 17.651  3.892   40.745  1.00 11.84 ? 238  THR D CB  1 
ATOM   6381  O  OG1 . THR D  2  126 ? 18.768  3.851   39.811  1.00 14.38 ? 238  THR D OG1 1 
ATOM   6382  C  CG2 . THR D  2  126 ? 16.401  3.300   40.097  1.00 9.35  ? 238  THR D CG2 1 
ATOM   6383  N  N   . ARG D  2  127 ? 19.324  6.811   41.695  1.00 10.35 ? 239  ARG D N   1 
ATOM   6384  C  CA  . ARG D  2  127 ? 20.544  7.136   42.448  1.00 10.59 ? 239  ARG D CA  1 
ATOM   6385  C  C   . ARG D  2  127 ? 20.464  8.447   43.264  1.00 12.10 ? 239  ARG D C   1 
ATOM   6386  O  O   . ARG D  2  127 ? 21.480  8.893   43.820  1.00 11.39 ? 239  ARG D O   1 
ATOM   6387  C  CB  . ARG D  2  127 ? 21.733  7.196   41.452  1.00 11.39 ? 239  ARG D CB  1 
ATOM   6388  C  CG  . ARG D  2  127 ? 22.039  5.879   40.725  1.00 8.24  ? 239  ARG D CG  1 
ATOM   6389  C  CD  . ARG D  2  127 ? 22.818  6.101   39.424  1.00 8.01  ? 239  ARG D CD  1 
ATOM   6390  N  NE  . ARG D  2  127 ? 22.015  6.728   38.355  1.00 6.26  ? 239  ARG D NE  1 
ATOM   6391  C  CZ  . ARG D  2  127 ? 22.444  6.943   37.084  1.00 8.96  ? 239  ARG D CZ  1 
ATOM   6392  N  NH1 . ARG D  2  127 ? 23.672  6.573   36.693  1.00 9.67  ? 239  ARG D NH1 1 
ATOM   6393  N  NH2 . ARG D  2  127 ? 21.649  7.526   36.194  1.00 6.36  ? 239  ARG D NH2 1 
ATOM   6394  N  N   . SER D  2  128 ? 19.248  9.037   43.364  1.00 10.25 ? 240  SER D N   1 
ATOM   6395  C  CA  . SER D  2  128 ? 19.049  10.366  43.971  1.00 11.01 ? 240  SER D CA  1 
ATOM   6396  C  C   . SER D  2  128 ? 19.650  10.528  45.359  1.00 9.29  ? 240  SER D C   1 
ATOM   6397  O  O   . SER D  2  128 ? 19.968  11.638  45.748  1.00 8.20  ? 240  SER D O   1 
ATOM   6398  C  CB  . SER D  2  128 ? 17.559  10.734  44.035  1.00 9.51  ? 240  SER D CB  1 
ATOM   6399  O  OG  . SER D  2  128 ? 16.895  9.962   45.019  1.00 13.06 ? 240  SER D OG  1 
ATOM   6400  N  N   . SER D  2  129 ? 19.793  9.427   46.095  1.00 10.29 ? 241  SER D N   1 
ATOM   6401  C  CA  . SER D  2  129 ? 20.333  9.473   47.470  1.00 11.70 ? 241  SER D CA  1 
ATOM   6402  C  C   . SER D  2  129 ? 21.863  9.130   47.547  1.00 11.59 ? 241  SER D C   1 
ATOM   6403  O  O   . SER D  2  129 ? 22.446  9.127   48.639  1.00 10.13 ? 241  SER D O   1 
ATOM   6404  C  CB  . SER D  2  129 ? 19.535  8.506   48.362  1.00 12.13 ? 241  SER D CB  1 
ATOM   6405  O  OG  . SER D  2  129 ? 18.148  8.820   48.388  1.00 13.86 ? 241  SER D OG  1 
ATOM   6406  N  N   . GLU D  2  130 ? 22.494  8.850   46.398  1.00 10.19 ? 242  GLU D N   1 
ATOM   6407  C  CA  . GLU D  2  130 ? 23.905  8.453   46.360  1.00 10.34 ? 242  GLU D CA  1 
ATOM   6408  C  C   . GLU D  2  130 ? 24.791  9.433   47.142  1.00 11.73 ? 242  GLU D C   1 
ATOM   6409  O  O   . GLU D  2  130 ? 25.673  8.997   47.888  1.00 13.72 ? 242  GLU D O   1 
ATOM   6410  C  CB  . GLU D  2  130 ? 24.373  8.292   44.909  1.00 8.07  ? 242  GLU D CB  1 
ATOM   6411  C  CG  . GLU D  2  130 ? 25.734  7.618   44.737  1.00 10.54 ? 242  GLU D CG  1 
ATOM   6412  C  CD  . GLU D  2  130 ? 26.926  8.573   44.755  1.00 10.02 ? 242  GLU D CD  1 
ATOM   6413  O  OE1 . GLU D  2  130 ? 26.737  9.811   44.681  1.00 9.16  ? 242  GLU D OE1 1 
ATOM   6414  O  OE2 . GLU D  2  130 ? 28.065  8.081   44.832  1.00 11.12 ? 242  GLU D OE2 1 
ATOM   6415  N  N   . MET D  2  131 ? 24.585  10.745  46.943  1.00 12.06 ? 243  MET D N   1 
ATOM   6416  C  CA  . MET D  2  131 ? 25.231  11.768  47.781  1.00 13.10 ? 243  MET D CA  1 
ATOM   6417  C  C   . MET D  2  131 ? 24.246  12.909  48.062  1.00 11.58 ? 243  MET D C   1 
ATOM   6418  O  O   . MET D  2  131 ? 23.429  13.252  47.197  1.00 11.90 ? 243  MET D O   1 
ATOM   6419  C  CB  . MET D  2  131 ? 26.601  12.260  47.218  1.00 14.28 ? 243  MET D CB  1 
ATOM   6420  C  CG  . MET D  2  131 ? 26.621  13.174  45.985  1.00 15.31 ? 243  MET D CG  1 
ATOM   6421  S  SD  . MET D  2  131 ? 28.309  13.406  45.299  1.00 15.34 ? 243  MET D SD  1 
ATOM   6422  C  CE  . MET D  2  131 ? 29.339  13.558  46.763  1.00 13.04 ? 243  MET D CE  1 
ATOM   6423  N  N   . PRO D  2  132 ? 24.278  13.459  49.315  1.00 10.80 ? 244  PRO D N   1 
ATOM   6424  C  CA  . PRO D  2  132 ? 23.368  14.540  49.784  1.00 9.87  ? 244  PRO D CA  1 
ATOM   6425  C  C   . PRO D  2  132 ? 23.260  15.763  48.892  1.00 9.04  ? 244  PRO D C   1 
ATOM   6426  O  O   . PRO D  2  132 ? 22.202  16.388  48.819  1.00 8.71  ? 244  PRO D O   1 
ATOM   6427  C  CB  . PRO D  2  132 ? 23.915  14.861  51.173  1.00 11.82 ? 244  PRO D CB  1 
ATOM   6428  C  CG  . PRO D  2  132 ? 24.439  13.538  51.621  1.00 8.94  ? 244  PRO D CG  1 
ATOM   6429  C  CD  . PRO D  2  132 ? 25.182  13.038  50.421  1.00 7.29  ? 244  PRO D CD  1 
ATOM   6430  N  N   . GLU D  2  133 ? 24.347  16.086  48.225  1.00 7.93  ? 245  GLU D N   1 
ATOM   6431  C  CA  . GLU D  2  133 ? 24.422  17.197  47.289  1.00 8.49  ? 245  GLU D CA  1 
ATOM   6432  C  C   . GLU D  2  133 ? 23.574  16.926  46.001  1.00 8.95  ? 245  GLU D C   1 
ATOM   6433  O  O   . GLU D  2  133 ? 23.009  17.851  45.411  1.00 9.45  ? 245  GLU D O   1 
ATOM   6434  C  CB  . GLU D  2  133 ? 25.896  17.451  46.921  1.00 8.83  ? 245  GLU D CB  1 
ATOM   6435  C  CG  . GLU D  2  133 ? 26.861  17.552  48.100  1.00 8.51  ? 245  GLU D CG  1 
ATOM   6436  C  CD  . GLU D  2  133 ? 27.537  16.235  48.478  1.00 11.10 ? 245  GLU D CD  1 
ATOM   6437  O  OE1 . GLU D  2  133 ? 28.740  16.247  48.763  1.00 13.13 ? 245  GLU D OE1 1 
ATOM   6438  O  OE2 . GLU D  2  133 ? 26.875  15.189  48.511  1.00 12.25 ? 245  GLU D OE2 1 
ATOM   6439  N  N   . LEU D  2  134 ? 23.546  15.665  45.550  1.00 8.72  ? 246  LEU D N   1 
ATOM   6440  C  CA  . LEU D  2  134 ? 22.715  15.254  44.431  1.00 9.78  ? 246  LEU D CA  1 
ATOM   6441  C  C   . LEU D  2  134 ? 21.227  15.296  44.864  1.00 10.58 ? 246  LEU D C   1 
ATOM   6442  O  O   . LEU D  2  134 ? 20.362  15.827  44.156  1.00 9.92  ? 246  LEU D O   1 
ATOM   6443  C  CB  . LEU D  2  134 ? 23.095  13.823  44.015  1.00 10.96 ? 246  LEU D CB  1 
ATOM   6444  C  CG  . LEU D  2  134 ? 22.269  13.146  42.880  1.00 12.26 ? 246  LEU D CG  1 
ATOM   6445  C  CD1 . LEU D  2  134 ? 22.540  13.832  41.546  1.00 10.08 ? 246  LEU D CD1 1 
ATOM   6446  C  CD2 . LEU D  2  134 ? 22.609  11.658  42.798  1.00 8.13  ? 246  LEU D CD2 1 
ATOM   6447  N  N   . THR D  2  135 ? 20.940  14.726  46.034  1.00 11.80 ? 247  THR D N   1 
ATOM   6448  C  CA  . THR D  2  135 ? 19.580  14.728  46.555  1.00 12.23 ? 247  THR D CA  1 
ATOM   6449  C  C   . THR D  2  135 ? 19.056  16.167  46.604  1.00 13.21 ? 247  THR D C   1 
ATOM   6450  O  O   . THR D  2  135 ? 17.881  16.436  46.317  1.00 12.48 ? 247  THR D O   1 
ATOM   6451  C  CB  . THR D  2  135 ? 19.485  14.093  47.971  1.00 12.44 ? 247  THR D CB  1 
ATOM   6452  O  OG1 . THR D  2  135 ? 20.023  12.757  47.962  1.00 9.16  ? 247  THR D OG1 1 
ATOM   6453  C  CG2 . THR D  2  135 ? 18.022  14.013  48.435  1.00 9.26  ? 247  THR D CG2 1 
ATOM   6454  N  N   . SER D  2  136 ? 19.947  17.097  46.945  1.00 12.34 ? 248  SER D N   1 
ATOM   6455  C  CA  . SER D  2  136 ? 19.561  18.494  47.057  1.00 13.19 ? 248  SER D CA  1 
ATOM   6456  C  C   . SER D  2  136 ? 19.188  19.056  45.718  1.00 12.37 ? 248  SER D C   1 
ATOM   6457  O  O   . SER D  2  136 ? 18.334  19.936  45.637  1.00 12.91 ? 248  SER D O   1 
ATOM   6458  C  CB  . SER D  2  136 ? 20.687  19.327  47.656  1.00 11.04 ? 248  SER D CB  1 
ATOM   6459  O  OG  . SER D  2  136 ? 21.020  18.836  48.931  1.00 11.65 ? 248  SER D OG  1 
ATOM   6460  N  N   . MET D  2  137 ? 19.825  18.560  44.669  1.00 10.31 ? 249  MET D N   1 
ATOM   6461  C  CA  . MET D  2  137 ? 19.503  19.043  43.329  1.00 11.68 ? 249  MET D CA  1 
ATOM   6462  C  C   . MET D  2  137 ? 18.174  18.463  42.821  1.00 10.60 ? 249  MET D C   1 
ATOM   6463  O  O   . MET D  2  137 ? 17.423  19.154  42.142  1.00 10.28 ? 249  MET D O   1 
ATOM   6464  C  CB  . MET D  2  137 ? 20.649  18.742  42.354  1.00 10.61 ? 249  MET D CB  1 
ATOM   6465  C  CG  . MET D  2  137 ? 21.964  19.478  42.680  1.00 12.80 ? 249  MET D CG  1 
ATOM   6466  S  SD  . MET D  2  137 ? 21.769  21.270  42.867  1.00 11.99 ? 249  MET D SD  1 
ATOM   6467  C  CE  . MET D  2  137 ? 21.397  21.767  41.196  1.00 7.69  ? 249  MET D CE  1 
ATOM   6468  N  N   . HIS D  2  138 ? 17.916  17.187  43.169  1.00 11.62 ? 250  HIS D N   1 
ATOM   6469  C  CA  . HIS D  2  138 ? 16.653  16.470  42.866  1.00 12.23 ? 250  HIS D CA  1 
ATOM   6470  C  C   . HIS D  2  138 ? 15.448  17.124  43.585  1.00 12.53 ? 250  HIS D C   1 
ATOM   6471  O  O   . HIS D  2  138 ? 14.352  17.219  43.035  1.00 12.06 ? 250  HIS D O   1 
ATOM   6472  C  CB  . HIS D  2  138 ? 16.749  15.015  43.338  1.00 10.97 ? 250  HIS D CB  1 
ATOM   6473  C  CG  . HIS D  2  138 ? 17.356  14.083  42.362  1.00 12.74 ? 250  HIS D CG  1 
ATOM   6474  N  ND1 . HIS D  2  138 ? 16.638  13.553  41.309  1.00 13.57 ? 250  HIS D ND1 1 
ATOM   6475  C  CD2 . HIS D  2  138 ? 18.596  13.580  42.268  1.00 11.89 ? 250  HIS D CD2 1 
ATOM   6476  C  CE1 . HIS D  2  138 ? 17.422  12.757  40.607  1.00 14.27 ? 250  HIS D CE1 1 
ATOM   6477  N  NE2 . HIS D  2  138 ? 18.613  12.758  41.170  1.00 13.68 ? 250  HIS D NE2 1 
ATOM   6478  N  N   . THR D  2  139 ? 15.680  17.543  44.830  1.00 11.83 ? 251  THR D N   1 
ATOM   6479  C  CA  . THR D  2  139 ? 14.686  18.190  45.656  1.00 11.85 ? 251  THR D CA  1 
ATOM   6480  C  C   . THR D  2  139 ? 14.385  19.565  45.122  1.00 10.81 ? 251  THR D C   1 
ATOM   6481  O  O   . THR D  2  139 ? 13.233  19.958  45.060  1.00 12.37 ? 251  THR D O   1 
ATOM   6482  C  CB  . THR D  2  139 ? 15.197  18.300  47.114  1.00 13.85 ? 251  THR D CB  1 
ATOM   6483  O  OG1 . THR D  2  139 ? 15.681  17.000  47.531  1.00 13.52 ? 251  THR D OG1 1 
ATOM   6484  C  CG2 . THR D  2  139 ? 14.076  18.770  48.064  1.00 11.83 ? 251  THR D CG2 1 
ATOM   6485  N  N   . LEU D  2  140 ? 15.433  20.283  44.728  1.00 12.36 ? 252  LEU D N   1 
ATOM   6486  C  CA  . LEU D  2  140 ? 15.307  21.632  44.151  1.00 12.80 ? 252  LEU D CA  1 
ATOM   6487  C  C   . LEU D  2  140 ? 14.489  21.635  42.862  1.00 12.57 ? 252  LEU D C   1 
ATOM   6488  O  O   . LEU D  2  140 ? 13.616  22.481  42.696  1.00 12.71 ? 252  LEU D O   1 
ATOM   6489  C  CB  . LEU D  2  140 ? 16.681  22.217  43.872  1.00 14.36 ? 252  LEU D CB  1 
ATOM   6490  C  CG  . LEU D  2  140 ? 16.740  23.649  43.318  1.00 18.79 ? 252  LEU D CG  1 
ATOM   6491  C  CD1 . LEU D  2  140 ? 16.355  24.667  44.392  1.00 15.76 ? 252  LEU D CD1 1 
ATOM   6492  C  CD2 . LEU D  2  140 ? 18.152  23.931  42.807  1.00 18.82 ? 252  LEU D CD2 1 
ATOM   6493  N  N   . LEU D  2  141 ? 14.770  20.695  41.953  1.00 11.02 ? 253  LEU D N   1 
ATOM   6494  C  CA  . LEU D  2  141 ? 14.028  20.587  40.703  1.00 11.84 ? 253  LEU D CA  1 
ATOM   6495  C  C   . LEU D  2  141 ? 12.557  20.159  40.936  1.00 13.92 ? 253  LEU D C   1 
ATOM   6496  O  O   . LEU D  2  141 ? 11.650  20.700  40.296  1.00 12.16 ? 253  LEU D O   1 
ATOM   6497  C  CB  . LEU D  2  141 ? 14.744  19.633  39.729  1.00 11.00 ? 253  LEU D CB  1 
ATOM   6498  C  CG  . LEU D  2  141 ? 16.042  20.180  39.050  1.00 10.79 ? 253  LEU D CG  1 
ATOM   6499  C  CD1 . LEU D  2  141 ? 16.529  19.217  37.971  1.00 8.94  ? 253  LEU D CD1 1 
ATOM   6500  C  CD2 . LEU D  2  141 ? 15.782  21.530  38.411  1.00 10.77 ? 253  LEU D CD2 1 
ATOM   6501  N  N   . LEU D  2  142 ? 12.327  19.194  41.866  1.00 15.28 ? 254  LEU D N   1 
ATOM   6502  C  CA  . LEU D  2  142 ? 10.967  18.741  42.223  1.00 14.62 ? 254  LEU D CA  1 
ATOM   6503  C  C   . LEU D  2  142 ? 10.134  19.908  42.751  1.00 13.77 ? 254  LEU D C   1 
ATOM   6504  O  O   . LEU D  2  142 ? 8.940   19.992  42.476  1.00 12.41 ? 254  LEU D O   1 
ATOM   6505  C  CB  . LEU D  2  142 ? 11.019  17.623  43.273  1.00 15.10 ? 254  LEU D CB  1 
ATOM   6506  C  CG  . LEU D  2  142 ? 9.666   17.160  43.839  1.00 16.57 ? 254  LEU D CG  1 
ATOM   6507  C  CD1 . LEU D  2  142 ? 9.423   15.701  43.521  1.00 15.52 ? 254  LEU D CD1 1 
ATOM   6508  C  CD2 . LEU D  2  142 ? 9.650   17.366  45.342  1.00 20.63 ? 254  LEU D CD2 1 
ATOM   6509  N  N   . ARG D  2  143 ? 10.775  20.805  43.511  1.00 13.41 ? 255  ARG D N   1 
ATOM   6510  C  CA  . ARG D  2  143 ? 10.103  22.005  44.028  1.00 12.82 ? 255  ARG D CA  1 
ATOM   6511  C  C   . ARG D  2  143 ? 9.761   22.977  42.900  1.00 12.23 ? 255  ARG D C   1 
ATOM   6512  O  O   . ARG D  2  143 ? 8.647   23.521  42.855  1.00 10.35 ? 255  ARG D O   1 
ATOM   6513  C  CB  . ARG D  2  143 ? 10.971  22.719  45.083  1.00 10.35 ? 255  ARG D CB  1 
ATOM   6514  C  CG  . ARG D  2  143 ? 11.086  21.978  46.399  1.00 12.52 ? 255  ARG D CG  1 
ATOM   6515  C  CD  . ARG D  2  143 ? 11.958  22.745  47.388  1.00 10.48 ? 255  ARG D CD  1 
ATOM   6516  N  NE  . ARG D  2  143 ? 12.230  21.957  48.586  1.00 12.00 ? 255  ARG D NE  1 
ATOM   6517  C  CZ  . ARG D  2  143 ? 13.158  22.251  49.494  1.00 11.08 ? 255  ARG D CZ  1 
ATOM   6518  N  NH1 . ARG D  2  143 ? 13.909  23.340  49.360  1.00 13.77 ? 255  ARG D NH1 1 
ATOM   6519  N  NH2 . ARG D  2  143 ? 13.333  21.456  50.532  1.00 10.52 ? 255  ARG D NH2 1 
ATOM   6520  N  N   . GLU D  2  144 ? 10.715  23.190  41.982  1.00 11.36 ? 256  GLU D N   1 
ATOM   6521  C  CA  . GLU D  2  144 ? 10.504  24.072  40.844  1.00 13.87 ? 256  GLU D CA  1 
ATOM   6522  C  C   . GLU D  2  144 ? 9.322   23.596  39.990  1.00 15.22 ? 256  GLU D C   1 
ATOM   6523  O  O   . GLU D  2  144 ? 8.562   24.413  39.489  1.00 13.76 ? 256  GLU D O   1 
ATOM   6524  C  CB  . GLU D  2  144 ? 11.774  24.138  39.990  1.00 14.24 ? 256  GLU D CB  1 
ATOM   6525  C  CG  . GLU D  2  144 ? 11.669  24.952  38.693  1.00 14.34 ? 256  GLU D CG  1 
ATOM   6526  C  CD  . GLU D  2  144 ? 11.319  26.425  38.893  1.00 14.33 ? 256  GLU D CD  1 
ATOM   6527  O  OE1 . GLU D  2  144 ? 11.150  27.120  37.871  1.00 12.88 ? 256  GLU D OE1 1 
ATOM   6528  O  OE2 . GLU D  2  144 ? 11.210  26.885  40.068  1.00 16.23 ? 256  GLU D OE2 1 
ATOM   6529  N  N   . HIS D  2  145 ? 9.196   22.259  39.819  1.00 16.03 ? 257  HIS D N   1 
ATOM   6530  C  CA  . HIS D  2  145 ? 8.068   21.663  39.090  1.00 15.99 ? 257  HIS D CA  1 
ATOM   6531  C  C   . HIS D  2  145 ? 6.740   22.073  39.720  1.00 14.53 ? 257  HIS D C   1 
ATOM   6532  O  O   . HIS D  2  145 ? 5.858   22.534  39.019  1.00 14.80 ? 257  HIS D O   1 
ATOM   6533  C  CB  . HIS D  2  145 ? 8.137   20.123  39.079  1.00 14.86 ? 257  HIS D CB  1 
ATOM   6534  C  CG  . HIS D  2  145 ? 6.859   19.489  38.574  1.00 19.66 ? 257  HIS D CG  1 
ATOM   6535  N  ND1 . HIS D  2  145 ? 6.616   19.248  37.237  1.00 20.94 ? 257  HIS D ND1 1 
ATOM   6536  C  CD2 . HIS D  2  145 ? 5.720   19.107  39.224  1.00 21.10 ? 257  HIS D CD2 1 
ATOM   6537  C  CE1 . HIS D  2  145 ? 5.384   18.746  37.087  1.00 21.82 ? 257  HIS D CE1 1 
ATOM   6538  N  NE2 . HIS D  2  145 ? 4.822   18.653  38.277  1.00 19.81 ? 257  HIS D NE2 1 
ATOM   6539  N  N   . ASN D  2  146 ? 6.607   21.887  41.042  1.00 13.28 ? 258  ASN D N   1 
ATOM   6540  C  CA  . ASN D  2  146 ? 5.354   22.216  41.748  1.00 14.64 ? 258  ASN D CA  1 
ATOM   6541  C  C   . ASN D  2  146 ? 5.088   23.719  41.816  1.00 15.05 ? 258  ASN D C   1 
ATOM   6542  O  O   . ASN D  2  146 ? 3.929   24.135  41.880  1.00 13.50 ? 258  ASN D O   1 
ATOM   6543  C  CB  . ASN D  2  146 ? 5.339   21.604  43.171  1.00 14.85 ? 258  ASN D CB  1 
ATOM   6544  C  CG  . ASN D  2  146 ? 5.240   20.093  43.156  1.00 13.50 ? 258  ASN D CG  1 
ATOM   6545  O  OD1 . ASN D  2  146 ? 5.073   19.484  42.091  1.00 16.04 ? 258  ASN D OD1 1 
ATOM   6546  N  ND2 . ASN D  2  146 ? 5.328   19.471  44.329  1.00 13.69 ? 258  ASN D ND2 1 
ATOM   6547  N  N   . ARG D  2  147 ? 6.154   24.534  41.801  1.00 13.43 ? 259  ARG D N   1 
ATOM   6548  C  CA  . ARG D  2  147 ? 5.987   25.986  41.772  1.00 15.14 ? 259  ARG D CA  1 
ATOM   6549  C  C   . ARG D  2  147 ? 5.421   26.412  40.416  1.00 15.65 ? 259  ARG D C   1 
ATOM   6550  O  O   . ARG D  2  147 ? 4.486   27.211  40.342  1.00 15.99 ? 259  ARG D O   1 
ATOM   6551  C  CB  . ARG D  2  147 ? 7.337   26.699  42.039  1.00 13.50 ? 259  ARG D CB  1 
ATOM   6552  C  CG  . ARG D  2  147 ? 7.318   28.214  41.843  1.00 14.15 ? 259  ARG D CG  1 
ATOM   6553  C  CD  . ARG D  2  147 ? 8.679   28.832  42.150  1.00 17.84 ? 259  ARG D CD  1 
ATOM   6554  N  NE  . ARG D  2  147 ? 8.739   30.251  41.768  1.00 20.29 ? 259  ARG D NE  1 
ATOM   6555  C  CZ  . ARG D  2  147 ? 8.876   31.290  42.610  1.00 20.59 ? 259  ARG D CZ  1 
ATOM   6556  N  NH1 . ARG D  2  147 ? 8.980   31.091  43.921  1.00 18.02 ? 259  ARG D NH1 1 
ATOM   6557  N  NH2 . ARG D  2  147 ? 8.919   32.529  42.131  1.00 20.56 ? 259  ARG D NH2 1 
ATOM   6558  N  N   . LEU D  2  148 ? 5.995   25.851  39.350  1.00 14.78 ? 260  LEU D N   1 
ATOM   6559  C  CA  . LEU D  2  148 ? 5.562   26.117  37.993  1.00 15.01 ? 260  LEU D CA  1 
ATOM   6560  C  C   . LEU D  2  148 ? 4.112   25.703  37.785  1.00 14.16 ? 260  LEU D C   1 
ATOM   6561  O  O   . LEU D  2  148 ? 3.341   26.435  37.178  1.00 14.12 ? 260  LEU D O   1 
ATOM   6562  C  CB  . LEU D  2  148 ? 6.466   25.378  36.985  1.00 16.42 ? 260  LEU D CB  1 
ATOM   6563  C  CG  . LEU D  2  148 ? 7.858   25.991  36.709  1.00 19.61 ? 260  LEU D CG  1 
ATOM   6564  C  CD1 . LEU D  2  148 ? 8.716   24.997  35.939  1.00 17.50 ? 260  LEU D CD1 1 
ATOM   6565  C  CD2 . LEU D  2  148 ? 7.735   27.307  35.929  1.00 16.32 ? 260  LEU D CD2 1 
ATOM   6566  N  N   . ALA D  2  149 ? 3.759   24.527  38.279  1.00 14.78 ? 261  ALA D N   1 
ATOM   6567  C  CA  . ALA D  2  149 ? 2.410   24.010  38.130  1.00 16.09 ? 261  ALA D CA  1 
ATOM   6568  C  C   . ALA D  2  149 ? 1.414   24.897  38.831  1.00 16.22 ? 261  ALA D C   1 
ATOM   6569  O  O   . ALA D  2  149 ? 0.297   25.039  38.335  1.00 18.83 ? 261  ALA D O   1 
ATOM   6570  C  CB  . ALA D  2  149 ? 2.307   22.592  38.661  1.00 15.76 ? 261  ALA D CB  1 
ATOM   6571  N  N   . THR D  2  150 ? 1.825   25.496  39.973  1.00 16.98 ? 262  THR D N   1 
ATOM   6572  C  CA  . THR D  2  150 ? 0.970   26.413  40.771  1.00 17.94 ? 262  THR D CA  1 
ATOM   6573  C  C   . THR D  2  150 ? 0.672   27.718  40.017  1.00 19.13 ? 262  THR D C   1 
ATOM   6574  O  O   . THR D  2  150 ? -0.499  28.127  39.849  1.00 18.79 ? 262  THR D O   1 
ATOM   6575  C  CB  . THR D  2  150 ? 1.645   26.752  42.124  1.00 18.88 ? 262  THR D CB  1 
ATOM   6576  O  OG1 . THR D  2  150 ? 1.621   25.592  42.957  1.00 20.33 ? 262  THR D OG1 1 
ATOM   6577  C  CG2 . THR D  2  150 ? 0.928   27.879  42.846  1.00 18.07 ? 262  THR D CG2 1 
ATOM   6578  N  N   . GLU D  2  151 ? 1.747   28.356  39.561  1.00 19.51 ? 263  GLU D N   1 
ATOM   6579  C  CA  . GLU D  2  151 ? 1.685   29.599  38.801  1.00 19.26 ? 263  GLU D CA  1 
ATOM   6580  C  C   . GLU D  2  151 ? 0.888   29.418  37.533  1.00 18.78 ? 263  GLU D C   1 
ATOM   6581  O  O   . GLU D  2  151 ? 0.079   30.267  37.195  1.00 19.25 ? 263  GLU D O   1 
ATOM   6582  C  CB  . GLU D  2  151 ? 3.112   30.073  38.487  1.00 18.14 ? 263  GLU D CB  1 
ATOM   6583  C  CG  . GLU D  2  151 ? 3.802   30.647  39.718  1.00 18.42 ? 263  GLU D CG  1 
ATOM   6584  C  CD  . GLU D  2  151 ? 5.313   30.584  39.684  1.00 18.28 ? 263  GLU D CD  1 
ATOM   6585  O  OE1 . GLU D  2  151 ? 5.882   30.247  38.637  1.00 19.55 ? 263  GLU D OE1 1 
ATOM   6586  O  OE2 . GLU D  2  151 ? 5.937   30.859  40.725  1.00 18.72 ? 263  GLU D OE2 1 
ATOM   6587  N  N   . LEU D  2  152 ? 1.125   28.299  36.853  1.00 19.67 ? 264  LEU D N   1 
ATOM   6588  C  CA  . LEU D  2  152 ? 0.432   27.966  35.628  1.00 20.47 ? 264  LEU D CA  1 
ATOM   6589  C  C   . LEU D  2  152 ? -1.045  27.738  35.898  1.00 22.57 ? 264  LEU D C   1 
ATOM   6590  O  O   . LEU D  2  152 ? -1.872  28.041  35.041  1.00 24.16 ? 264  LEU D O   1 
ATOM   6591  C  CB  . LEU D  2  152 ? 1.055   26.729  34.979  1.00 19.46 ? 264  LEU D CB  1 
ATOM   6592  C  CG  . LEU D  2  152 ? 2.457   26.917  34.359  1.00 19.78 ? 264  LEU D CG  1 
ATOM   6593  C  CD1 . LEU D  2  152 ? 3.010   25.569  33.885  1.00 18.79 ? 264  LEU D CD1 1 
ATOM   6594  C  CD2 . LEU D  2  152 ? 2.400   27.928  33.211  1.00 16.71 ? 264  LEU D CD2 1 
ATOM   6595  N  N   . LYS D  2  153 ? -1.370  27.233  37.096  1.00 23.29 ? 265  LYS D N   1 
ATOM   6596  C  CA  . LYS D  2  153 ? -2.758  27.028  37.499  1.00 24.36 ? 265  LYS D CA  1 
ATOM   6597  C  C   . LYS D  2  153 ? -3.492  28.385  37.681  1.00 26.29 ? 265  LYS D C   1 
ATOM   6598  O  O   . LYS D  2  153 ? -4.676  28.513  37.320  1.00 24.78 ? 265  LYS D O   1 
ATOM   6599  C  CB  . LYS D  2  153 ? -2.795  26.202  38.775  1.00 24.08 ? 265  LYS D CB  1 
ATOM   6600  C  CG  . LYS D  2  153 ? -4.157  26.096  39.454  1.00 27.39 ? 265  LYS D CG  1 
ATOM   6601  C  CD  . LYS D  2  153 ? -5.179  25.321  38.648  1.00 29.74 ? 265  LYS D CD  1 
ATOM   6602  C  CE  . LYS D  2  153 ? -6.334  24.896  39.541  1.00 29.81 ? 265  LYS D CE  1 
ATOM   6603  N  NZ  . LYS D  2  153 ? -7.410  24.213  38.782  1.00 31.87 ? 265  LYS D NZ  1 
ATOM   6604  N  N   . SER D  2  154 ? -2.783  29.397  38.227  1.00 25.90 ? 266  SER D N   1 
ATOM   6605  C  CA  . SER D  2  154 ? -3.352  30.754  38.386  1.00 26.32 ? 266  SER D CA  1 
ATOM   6606  C  C   . SER D  2  154 ? -3.453  31.444  37.024  1.00 27.15 ? 266  SER D C   1 
ATOM   6607  O  O   . SER D  2  154 ? -4.332  32.270  36.799  1.00 28.58 ? 266  SER D O   1 
ATOM   6608  C  CB  . SER D  2  154 ? -2.473  31.630  39.304  1.00 23.47 ? 266  SER D CB  1 
ATOM   6609  O  OG  . SER D  2  154 ? -2.108  30.951  40.483  1.00 23.48 ? 266  SER D OG  1 
ATOM   6610  N  N   . LEU D  2  155 ? -2.525  31.099  36.127  1.00 27.05 ? 267  LEU D N   1 
ATOM   6611  C  CA  . LEU D  2  155 ? -2.439  31.676  34.793  1.00 26.14 ? 267  LEU D CA  1 
ATOM   6612  C  C   . LEU D  2  155 ? -3.483  31.130  33.845  1.00 25.29 ? 267  LEU D C   1 
ATOM   6613  O  O   . LEU D  2  155 ? -3.994  31.872  33.014  1.00 26.06 ? 267  LEU D O   1 
ATOM   6614  C  CB  . LEU D  2  155 ? -1.069  31.402  34.205  1.00 27.59 ? 267  LEU D CB  1 
ATOM   6615  C  CG  . LEU D  2  155 ? -0.092  32.567  34.184  1.00 32.95 ? 267  LEU D CG  1 
ATOM   6616  C  CD1 . LEU D  2  155 ? -0.612  33.640  33.239  1.00 33.26 ? 267  LEU D CD1 1 
ATOM   6617  C  CD2 . LEU D  2  155 ? 0.126   33.124  35.592  1.00 33.13 ? 267  LEU D CD2 1 
ATOM   6618  N  N   . ASN D  2  156 ? -3.761  29.827  33.948  1.00 23.47 ? 268  ASN D N   1 
ATOM   6619  C  CA  . ASN D  2  156 ? -4.720  29.139  33.073  1.00 25.12 ? 268  ASN D CA  1 
ATOM   6620  C  C   . ASN D  2  156 ? -5.621  28.196  33.883  1.00 26.07 ? 268  ASN D C   1 
ATOM   6621  O  O   . ASN D  2  156 ? -5.441  26.979  33.865  1.00 28.23 ? 268  ASN D O   1 
ATOM   6622  C  CB  . ASN D  2  156 ? -3.968  28.339  32.008  1.00 24.98 ? 268  ASN D CB  1 
ATOM   6623  C  CG  . ASN D  2  156 ? -3.086  29.200  31.132  1.00 26.10 ? 268  ASN D CG  1 
ATOM   6624  O  OD1 . ASN D  2  156 ? -3.536  30.220  30.592  1.00 25.95 ? 268  ASN D OD1 1 
ATOM   6625  N  ND2 . ASN D  2  156 ? -1.823  28.799  30.985  1.00 20.68 ? 268  ASN D ND2 1 
ATOM   6626  N  N   . PRO D  2  157 ? -6.645  28.746  34.559  1.00 26.87 ? 269  PRO D N   1 
ATOM   6627  C  CA  . PRO D  2  157 ? -7.577  27.970  35.415  1.00 27.99 ? 269  PRO D CA  1 
ATOM   6628  C  C   . PRO D  2  157 ? -8.223  26.727  34.767  1.00 27.73 ? 269  PRO D C   1 
ATOM   6629  O  O   . PRO D  2  157 ? -8.386  25.700  35.433  1.00 27.67 ? 269  PRO D O   1 
ATOM   6630  C  CB  . PRO D  2  157 ? -8.612  29.028  35.839  1.00 29.72 ? 269  PRO D CB  1 
ATOM   6631  C  CG  . PRO D  2  157 ? -7.807  30.289  35.821  1.00 28.93 ? 269  PRO D CG  1 
ATOM   6632  C  CD  . PRO D  2  157 ? -7.017  30.180  34.543  1.00 26.71 ? 269  PRO D CD  1 
ATOM   6633  N  N   . ARG D  2  158 ? -8.568  26.814  33.475  1.00 27.87 ? 270  ARG D N   1 
ATOM   6634  C  CA  . ARG D  2  158 ? -9.236  25.705  32.758  1.00 27.48 ? 270  ARG D CA  1 
ATOM   6635  C  C   . ARG D  2  158 ? -8.326  24.485  32.619  1.00 27.34 ? 270  ARG D C   1 
ATOM   6636  O  O   . ARG D  2  158 ? -8.823  23.378  32.418  1.00 28.85 ? 270  ARG D O   1 
ATOM   6637  C  CB  . ARG D  2  158 ? -9.692  26.157  31.365  1.00 26.02 ? 270  ARG D CB  1 
ATOM   6638  C  CG  . ARG D  2  158 ? -10.490 27.447  31.389  1.00 29.76 ? 270  ARG D CG  1 
ATOM   6639  C  CD  . ARG D  2  158 ? -10.841 27.923  29.994  1.00 34.02 ? 270  ARG D CD  1 
ATOM   6640  N  NE  . ARG D  2  158 ? -12.183 27.510  29.580  1.00 38.52 ? 270  ARG D NE  1 
ATOM   6641  C  CZ  . ARG D  2  158 ? -13.161 28.348  29.218  1.00 39.58 ? 270  ARG D CZ  1 
ATOM   6642  N  NH1 . ARG D  2  158 ? -12.963 29.666  29.225  1.00 39.72 ? 270  ARG D NH1 1 
ATOM   6643  N  NH2 . ARG D  2  158 ? -14.341 27.863  28.853  1.00 39.82 ? 270  ARG D NH2 1 
ATOM   6644  N  N   . TRP D  2  159 ? -6.998  24.697  32.730  1.00 26.33 ? 271  TRP D N   1 
ATOM   6645  C  CA  . TRP D  2  159 ? -5.994  23.615  32.598  1.00 23.56 ? 271  TRP D CA  1 
ATOM   6646  C  C   . TRP D  2  159 ? -6.136  22.550  33.668  1.00 23.27 ? 271  TRP D C   1 
ATOM   6647  O  O   . TRP D  2  159 ? -5.937  22.828  34.852  1.00 24.58 ? 271  TRP D O   1 
ATOM   6648  C  CB  . TRP D  2  159 ? -4.584  24.180  32.696  1.00 19.99 ? 271  TRP D CB  1 
ATOM   6649  C  CG  . TRP D  2  159 ? -4.080  24.766  31.442  1.00 16.94 ? 271  TRP D CG  1 
ATOM   6650  C  CD1 . TRP D  2  159 ? -4.759  24.918  30.280  1.00 16.64 ? 271  TRP D CD1 1 
ATOM   6651  C  CD2 . TRP D  2  159 ? -2.753  25.211  31.208  1.00 19.31 ? 271  TRP D CD2 1 
ATOM   6652  N  NE1 . TRP D  2  159 ? -3.938  25.423  29.320  1.00 18.82 ? 271  TRP D NE1 1 
ATOM   6653  C  CE2 . TRP D  2  159 ? -2.686  25.615  29.860  1.00 19.72 ? 271  TRP D CE2 1 
ATOM   6654  C  CE3 . TRP D  2  159 ? -1.601  25.300  32.011  1.00 19.43 ? 271  TRP D CE3 1 
ATOM   6655  C  CZ2 . TRP D  2  159 ? -1.495  26.111  29.279  1.00 21.57 ? 271  TRP D CZ2 1 
ATOM   6656  C  CZ3 . TRP D  2  159 ? -0.425  25.788  31.445  1.00 22.91 ? 271  TRP D CZ3 1 
ATOM   6657  C  CH2 . TRP D  2  159 ? -0.375  26.187  30.089  1.00 22.51 ? 271  TRP D CH2 1 
ATOM   6658  N  N   . ASP D  2  160 ? -6.454  21.331  33.248  1.00 21.53 ? 272  ASP D N   1 
ATOM   6659  C  CA  . ASP D  2  160 ? -6.571  20.222  34.183  1.00 22.97 ? 272  ASP D CA  1 
ATOM   6660  C  C   . ASP D  2  160 ? -5.192  19.838  34.750  1.00 24.03 ? 272  ASP D C   1 
ATOM   6661  O  O   . ASP D  2  160 ? -4.175  20.480  34.433  1.00 24.30 ? 272  ASP D O   1 
ATOM   6662  C  CB  . ASP D  2  160 ? -7.205  19.021  33.480  1.00 23.93 ? 272  ASP D CB  1 
ATOM   6663  C  CG  . ASP D  2  160 ? -6.663  18.786  32.068  1.00 28.52 ? 272  ASP D CG  1 
ATOM   6664  O  OD1 . ASP D  2  160 ? -7.483  18.773  31.115  1.00 31.27 ? 272  ASP D OD1 1 
ATOM   6665  O  OD2 . ASP D  2  160 ? -5.421  18.609  31.904  1.00 27.02 ? 272  ASP D OD2 1 
ATOM   6666  N  N   . GLY D  2  161 ? -5.161  18.801  35.588  1.00 22.66 ? 273  GLY D N   1 
ATOM   6667  C  CA  . GLY D  2  161 ? -3.905  18.362  36.170  1.00 21.52 ? 273  GLY D CA  1 
ATOM   6668  C  C   . GLY D  2  161 ? -2.879  17.944  35.123  1.00 19.38 ? 273  GLY D C   1 
ATOM   6669  O  O   . GLY D  2  161 ? -1.741  18.413  35.145  1.00 17.22 ? 273  GLY D O   1 
ATOM   6670  N  N   . GLU D  2  162 ? -3.303  17.081  34.191  1.00 17.65 ? 274  GLU D N   1 
ATOM   6671  C  CA  . GLU D  2  162 ? -2.441  16.555  33.135  1.00 17.52 ? 274  GLU D CA  1 
ATOM   6672  C  C   . GLU D  2  162 ? -1.766  17.676  32.337  1.00 18.52 ? 274  GLU D C   1 
ATOM   6673  O  O   . GLU D  2  162 ? -0.556  17.610  32.057  1.00 17.19 ? 274  GLU D O   1 
ATOM   6674  C  CB  . GLU D  2  162 ? -3.260  15.618  32.220  1.00 16.69 ? 274  GLU D CB  1 
ATOM   6675  C  CG  . GLU D  2  162 ? -2.528  15.026  31.019  1.00 17.91 ? 274  GLU D CG  1 
ATOM   6676  C  CD  . GLU D  2  162 ? -1.313  14.174  31.357  1.00 17.90 ? 274  GLU D CD  1 
ATOM   6677  O  OE1 . GLU D  2  162 ? -0.510  13.897  30.418  1.00 18.15 ? 274  GLU D OE1 1 
ATOM   6678  O  OE2 . GLU D  2  162 ? -1.151  13.783  32.541  1.00 17.39 ? 274  GLU D OE2 1 
ATOM   6679  N  N   . ARG D  2  163 ? -2.538  18.717  32.001  1.00 17.61 ? 275  ARG D N   1 
ATOM   6680  C  CA  . ARG D  2  163 ? -2.027  19.867  31.249  1.00 17.21 ? 275  ARG D CA  1 
ATOM   6681  C  C   . ARG D  2  163 ? -0.957  20.615  32.068  1.00 15.87 ? 275  ARG D C   1 
ATOM   6682  O  O   . ARG D  2  163 ? 0.088   21.030  31.545  1.00 13.81 ? 275  ARG D O   1 
ATOM   6683  C  CB  . ARG D  2  163 ? -3.202  20.817  30.920  1.00 18.38 ? 275  ARG D CB  1 
ATOM   6684  C  CG  . ARG D  2  163 ? -2.918  21.798  29.805  1.00 21.16 ? 275  ARG D CG  1 
ATOM   6685  C  CD  . ARG D  2  163 ? -2.703  21.076  28.491  1.00 24.40 ? 275  ARG D CD  1 
ATOM   6686  N  NE  . ARG D  2  163 ? -1.987  21.911  27.552  1.00 30.07 ? 275  ARG D NE  1 
ATOM   6687  C  CZ  . ARG D  2  163 ? -2.509  22.943  26.921  1.00 32.55 ? 275  ARG D CZ  1 
ATOM   6688  N  NH1 . ARG D  2  163 ? -3.782  23.256  27.110  1.00 34.85 ? 275  ARG D NH1 1 
ATOM   6689  N  NH2 . ARG D  2  163 ? -1.763  23.659  26.087  1.00 34.78 ? 275  ARG D NH2 1 
ATOM   6690  N  N   . LEU D  2  164 ? -1.237  20.778  33.353  1.00 15.07 ? 276  LEU D N   1 
ATOM   6691  C  CA  . LEU D  2  164 ? -0.341  21.462  34.276  1.00 15.72 ? 276  LEU D CA  1 
ATOM   6692  C  C   . LEU D  2  164 ? 0.954   20.661  34.485  1.00 15.55 ? 276  LEU D C   1 
ATOM   6693  O  O   . LEU D  2  164 ? 2.053   21.236  34.479  1.00 16.88 ? 276  LEU D O   1 
ATOM   6694  C  CB  . LEU D  2  164 ? -1.051  21.697  35.614  1.00 13.21 ? 276  LEU D CB  1 
ATOM   6695  C  CG  . LEU D  2  164 ? -2.207  22.706  35.575  1.00 14.97 ? 276  LEU D CG  1 
ATOM   6696  C  CD1 . LEU D  2  164 ? -3.112  22.523  36.779  1.00 13.26 ? 276  LEU D CD1 1 
ATOM   6697  C  CD2 . LEU D  2  164 ? -1.652  24.134  35.504  1.00 14.48 ? 276  LEU D CD2 1 
ATOM   6698  N  N   . TYR D  2  165 ? 0.812   19.338  34.656  1.00 14.35 ? 277  TYR D N   1 
ATOM   6699  C  CA  . TYR D  2  165 ? 1.955   18.454  34.846  1.00 11.67 ? 277  TYR D CA  1 
ATOM   6700  C  C   . TYR D  2  165 ? 2.876   18.540  33.656  1.00 10.88 ? 277  TYR D C   1 
ATOM   6701  O  O   . TYR D  2  165 ? 4.050   18.843  33.794  1.00 10.96 ? 277  TYR D O   1 
ATOM   6702  C  CB  . TYR D  2  165 ? 1.486   17.012  35.036  1.00 13.27 ? 277  TYR D CB  1 
ATOM   6703  C  CG  . TYR D  2  165 ? 2.587   15.970  34.882  1.00 14.48 ? 277  TYR D CG  1 
ATOM   6704  C  CD1 . TYR D  2  165 ? 2.774   15.319  33.652  1.00 13.15 ? 277  TYR D CD1 1 
ATOM   6705  C  CD2 . TYR D  2  165 ? 3.472   15.670  35.942  1.00 14.53 ? 277  TYR D CD2 1 
ATOM   6706  C  CE1 . TYR D  2  165 ? 3.792   14.400  33.465  1.00 13.74 ? 277  TYR D CE1 1 
ATOM   6707  C  CE2 . TYR D  2  165 ? 4.504   14.743  35.766  1.00 14.15 ? 277  TYR D CE2 1 
ATOM   6708  C  CZ  . TYR D  2  165 ? 4.655   14.106  34.524  1.00 16.36 ? 277  TYR D CZ  1 
ATOM   6709  O  OH  . TYR D  2  165 ? 5.627   13.136  34.355  1.00 17.07 ? 277  TYR D OH  1 
ATOM   6710  N  N   . GLN D  2  166 ? 2.327   18.300  32.498  1.00 10.26 ? 278  GLN D N   1 
ATOM   6711  C  CA  . GLN D  2  166 ? 3.076   18.340  31.247  1.00 11.59 ? 278  GLN D CA  1 
ATOM   6712  C  C   . GLN D  2  166 ? 3.666   19.715  30.893  1.00 12.70 ? 278  GLN D C   1 
ATOM   6713  O  O   . GLN D  2  166 ? 4.768   19.793  30.329  1.00 12.46 ? 278  GLN D O   1 
ATOM   6714  C  CB  . GLN D  2  166 ? 2.182   17.863  30.101  1.00 13.23 ? 278  GLN D CB  1 
ATOM   6715  C  CG  . GLN D  2  166 ? 1.736   16.421  30.228  1.00 16.37 ? 278  GLN D CG  1 
ATOM   6716  C  CD  . GLN D  2  166 ? 2.840   15.434  29.907  1.00 19.91 ? 278  GLN D CD  1 
ATOM   6717  O  OE1 . GLN D  2  166 ? 3.935   15.811  29.456  1.00 20.52 ? 278  GLN D OE1 1 
ATOM   6718  N  NE2 . GLN D  2  166 ? 2.553   14.159  30.129  1.00 22.95 ? 278  GLN D NE2 1 
ATOM   6719  N  N   . GLU D  2  167 ? 2.938   20.808  31.173  1.00 12.31 ? 279  GLU D N   1 
ATOM   6720  C  CA  . GLU D  2  167 ? 3.475   22.145  30.860  1.00 11.54 ? 279  GLU D CA  1 
ATOM   6721  C  C   . GLU D  2  167 ? 4.609   22.528  31.817  1.00 10.21 ? 279  GLU D C   1 
ATOM   6722  O  O   . GLU D  2  167 ? 5.567   23.188  31.401  1.00 9.17  ? 279  GLU D O   1 
ATOM   6723  C  CB  . GLU D  2  167 ? 2.357   23.204  30.879  1.00 13.57 ? 279  GLU D CB  1 
ATOM   6724  C  CG  . GLU D  2  167 ? 1.332   23.059  29.743  1.00 14.53 ? 279  GLU D CG  1 
ATOM   6725  C  CD  . GLU D  2  167 ? 1.839   23.525  28.394  1.00 15.33 ? 279  GLU D CD  1 
ATOM   6726  O  OE1 . GLU D  2  167 ? 2.619   24.514  28.335  1.00 18.80 ? 279  GLU D OE1 1 
ATOM   6727  O  OE2 . GLU D  2  167 ? 1.454   22.922  27.386  1.00 17.88 ? 279  GLU D OE2 1 
ATOM   6728  N  N   . ALA D  2  168 ? 4.479   22.091  33.089  1.00 10.07 ? 280  ALA D N   1 
ATOM   6729  C  CA  . ALA D  2  168 ? 5.502   22.284  34.130  1.00 10.57 ? 280  ALA D CA  1 
ATOM   6730  C  C   . ALA D  2  168 ? 6.752   21.454  33.822  1.00 11.22 ? 280  ALA D C   1 
ATOM   6731  O  O   . ALA D  2  168 ? 7.864   22.002  33.841  1.00 11.16 ? 280  ALA D O   1 
ATOM   6732  C  CB  . ALA D  2  168 ? 4.967   21.899  35.501  1.00 6.56  ? 280  ALA D CB  1 
ATOM   6733  N  N   . ARG D  2  169 ? 6.556   20.142  33.532  1.00 10.36 ? 281  ARG D N   1 
ATOM   6734  C  CA  . ARG D  2  169 ? 7.636   19.205  33.158  1.00 11.43 ? 281  ARG D CA  1 
ATOM   6735  C  C   . ARG D  2  169 ? 8.396   19.696  31.911  1.00 11.70 ? 281  ARG D C   1 
ATOM   6736  O  O   . ARG D  2  169 ? 9.614   19.495  31.799  1.00 12.64 ? 281  ARG D O   1 
ATOM   6737  C  CB  . ARG D  2  169 ? 7.054   17.805  32.893  1.00 12.09 ? 281  ARG D CB  1 
ATOM   6738  C  CG  . ARG D  2  169 ? 7.990   16.822  32.165  1.00 12.60 ? 281  ARG D CG  1 
ATOM   6739  C  CD  . ARG D  2  169 ? 7.283   15.502  31.828  1.00 10.91 ? 281  ARG D CD  1 
ATOM   6740  N  NE  . ARG D  2  169 ? 8.116   14.602  31.015  1.00 11.94 ? 281  ARG D NE  1 
ATOM   6741  C  CZ  . ARG D  2  169 ? 7.715   13.857  29.962  1.00 9.91  ? 281  ARG D CZ  1 
ATOM   6742  N  NH1 . ARG D  2  169 ? 6.444   13.855  29.546  1.00 8.03  ? 281  ARG D NH1 1 
ATOM   6743  N  NH2 . ARG D  2  169 ? 8.599   13.101  29.335  1.00 8.77  ? 281  ARG D NH2 1 
ATOM   6744  N  N   . LYS D  2  170 ? 7.659   20.357  30.988  1.00 12.07 ? 282  LYS D N   1 
ATOM   6745  C  CA  . LYS D  2  170 ? 8.222   20.913  29.752  1.00 10.51 ? 282  LYS D CA  1 
ATOM   6746  C  C   . LYS D  2  170 ? 9.075   22.150  30.019  1.00 10.20 ? 282  LYS D C   1 
ATOM   6747  O  O   . LYS D  2  170 ? 10.098  22.344  29.379  1.00 11.99 ? 282  LYS D O   1 
ATOM   6748  C  CB  . LYS D  2  170 ? 7.103   21.222  28.750  1.00 10.77 ? 282  LYS D CB  1 
ATOM   6749  C  CG  . LYS D  2  170 ? 7.574   21.840  27.449  1.00 10.79 ? 282  LYS D CG  1 
ATOM   6750  C  CD  . LYS D  2  170 ? 6.435   21.894  26.438  1.00 11.93 ? 282  LYS D CD  1 
ATOM   6751  C  CE  . LYS D  2  170 ? 6.807   22.654  25.182  1.00 10.91 ? 282  LYS D CE  1 
ATOM   6752  N  NZ  . LYS D  2  170 ? 5.724   22.567  24.146  1.00 9.72  ? 282  LYS D NZ  1 
ATOM   6753  N  N   . ILE D  2  171 ? 8.670   22.983  30.960  1.00 11.71 ? 283  ILE D N   1 
ATOM   6754  C  CA  . ILE D  2  171 ? 9.513   24.126  31.331  1.00 12.97 ? 283  ILE D CA  1 
ATOM   6755  C  C   . ILE D  2  171 ? 10.761  23.618  32.068  1.00 13.85 ? 283  ILE D C   1 
ATOM   6756  O  O   . ILE D  2  171 ? 11.860  24.083  31.793  1.00 13.02 ? 283  ILE D O   1 
ATOM   6757  C  CB  . ILE D  2  171 ? 8.779   25.171  32.243  1.00 12.60 ? 283  ILE D CB  1 
ATOM   6758  C  CG1 . ILE D  2  171 ? 7.641   25.839  31.460  1.00 11.99 ? 283  ILE D CG1 1 
ATOM   6759  C  CG2 . ILE D  2  171 ? 9.764   26.243  32.734  1.00 7.83  ? 283  ILE D CG2 1 
ATOM   6760  C  CD1 . ILE D  2  171 ? 6.661   26.596  32.334  1.00 13.11 ? 283  ILE D CD1 1 
ATOM   6761  N  N   . VAL D  2  172 ? 10.578  22.651  32.994  1.00 12.46 ? 284  VAL D N   1 
ATOM   6762  C  CA  . VAL D  2  172 ? 11.694  22.097  33.751  1.00 12.60 ? 284  VAL D CA  1 
ATOM   6763  C  C   . VAL D  2  172 ? 12.714  21.505  32.800  1.00 13.07 ? 284  VAL D C   1 
ATOM   6764  O  O   . VAL D  2  172 ? 13.936  21.772  32.924  1.00 11.96 ? 284  VAL D O   1 
ATOM   6765  C  CB  . VAL D  2  172 ? 11.218  21.030  34.743  1.00 12.99 ? 284  VAL D CB  1 
ATOM   6766  C  CG1 . VAL D  2  172 ? 12.413  20.275  35.357  1.00 11.46 ? 284  VAL D CG1 1 
ATOM   6767  C  CG2 . VAL D  2  172 ? 10.420  21.712  35.840  1.00 11.71 ? 284  VAL D CG2 1 
ATOM   6768  N  N   . GLY D  2  173 ? 12.197  20.736  31.826  1.00 12.59 ? 285  GLY D N   1 
ATOM   6769  C  CA  . GLY D  2  173 ? 13.033  20.162  30.772  1.00 11.73 ? 285  GLY D CA  1 
ATOM   6770  C  C   . GLY D  2  173 ? 13.908  21.216  30.085  1.00 13.28 ? 285  GLY D C   1 
ATOM   6771  O  O   . GLY D  2  173 ? 15.139  21.040  29.961  1.00 11.55 ? 285  GLY D O   1 
ATOM   6772  N  N   . ALA D  2  174 ? 13.285  22.325  29.640  1.00 10.72 ? 286  ALA D N   1 
ATOM   6773  C  CA  . ALA D  2  174 ? 14.042  23.403  29.018  1.00 11.01 ? 286  ALA D CA  1 
ATOM   6774  C  C   . ALA D  2  174 ? 15.069  23.948  29.995  1.00 9.46  ? 286  ALA D C   1 
ATOM   6775  O  O   . ALA D  2  174 ? 16.171  24.292  29.585  1.00 11.94 ? 286  ALA D O   1 
ATOM   6776  C  CB  . ALA D  2  174 ? 13.140  24.546  28.545  1.00 7.60  ? 286  ALA D CB  1 
ATOM   6777  N  N   . MET D  2  175 ? 14.710  24.021  31.276  1.00 9.28  ? 287  MET D N   1 
ATOM   6778  C  CA  . MET D  2  175 ? 15.618  24.544  32.264  1.00 10.67 ? 287  MET D CA  1 
ATOM   6779  C  C   . MET D  2  175 ? 16.883  23.722  32.321  1.00 11.48 ? 287  MET D C   1 
ATOM   6780  O  O   . MET D  2  175 ? 17.987  24.289  32.307  1.00 11.65 ? 287  MET D O   1 
ATOM   6781  C  CB  . MET D  2  175 ? 14.956  24.617  33.638  1.00 10.13 ? 287  MET D CB  1 
ATOM   6782  C  CG  . MET D  2  175 ? 14.010  25.812  33.764  1.00 14.13 ? 287  MET D CG  1 
ATOM   6783  S  SD  . MET D  2  175 ? 13.090  25.873  35.320  1.00 13.34 ? 287  MET D SD  1 
ATOM   6784  C  CE  . MET D  2  175 ? 12.318  27.471  35.129  1.00 13.00 ? 287  MET D CE  1 
ATOM   6785  N  N   . VAL D  2  176 ? 16.732  22.387  32.349  1.00 11.46 ? 288  VAL D N   1 
ATOM   6786  C  CA  . VAL D  2  176 ? 17.903  21.489  32.383  1.00 10.24 ? 288  VAL D CA  1 
ATOM   6787  C  C   . VAL D  2  176 ? 18.776  21.665  31.121  1.00 10.14 ? 288  VAL D C   1 
ATOM   6788  O  O   . VAL D  2  176 ? 19.998  21.705  31.212  1.00 7.70  ? 288  VAL D O   1 
ATOM   6789  C  CB  . VAL D  2  176 ? 17.492  19.998  32.540  1.00 8.88  ? 288  VAL D CB  1 
ATOM   6790  C  CG1 . VAL D  2  176 ? 18.746  19.127  32.539  1.00 8.54  ? 288  VAL D CG1 1 
ATOM   6791  C  CG2 . VAL D  2  176 ? 16.704  19.788  33.824  1.00 6.87  ? 288  VAL D CG2 1 
ATOM   6792  N  N   . GLN D  2  177 ? 18.127  21.803  29.942  1.00 8.55  ? 289  GLN D N   1 
ATOM   6793  C  CA  . GLN D  2  177 ? 18.824  22.017  28.681  1.00 8.47  ? 289  GLN D CA  1 
ATOM   6794  C  C   . GLN D  2  177 ? 19.559  23.355  28.652  1.00 9.33  ? 289  GLN D C   1 
ATOM   6795  O  O   . GLN D  2  177 ? 20.732  23.409  28.241  1.00 8.07  ? 289  GLN D O   1 
ATOM   6796  C  CB  . GLN D  2  177 ? 17.863  21.938  27.484  1.00 7.21  ? 289  GLN D CB  1 
ATOM   6797  C  CG  . GLN D  2  177 ? 17.245  20.551  27.297  1.00 9.10  ? 289  GLN D CG  1 
ATOM   6798  C  CD  . GLN D  2  177 ? 16.346  20.424  26.069  1.00 9.93  ? 289  GLN D CD  1 
ATOM   6799  O  OE1 . GLN D  2  177 ? 15.869  21.419  25.522  1.00 10.49 ? 289  GLN D OE1 1 
ATOM   6800  N  NE2 . GLN D  2  177 ? 16.128  19.198  25.630  1.00 8.86  ? 289  GLN D NE2 1 
ATOM   6801  N  N   . ILE D  2  178 ? 18.886  24.432  29.082  1.00 7.47  ? 290  ILE D N   1 
ATOM   6802  C  CA  . ILE D  2  178 ? 19.497  25.761  29.065  1.00 8.65  ? 290  ILE D CA  1 
ATOM   6803  C  C   . ILE D  2  178 ? 20.741  25.847  29.991  1.00 7.25  ? 290  ILE D C   1 
ATOM   6804  O  O   . ILE D  2  178 ? 21.826  26.272  29.560  1.00 6.56  ? 290  ILE D O   1 
ATOM   6805  C  CB  . ILE D  2  178 ? 18.460  26.846  29.447  1.00 7.71  ? 290  ILE D CB  1 
ATOM   6806  C  CG1 . ILE D  2  178 ? 17.398  26.914  28.341  1.00 8.57  ? 290  ILE D CG1 1 
ATOM   6807  C  CG2 . ILE D  2  178 ? 19.140  28.209  29.601  1.00 7.70  ? 290  ILE D CG2 1 
ATOM   6808  C  CD1 . ILE D  2  178 ? 16.266  27.882  28.608  1.00 5.68  ? 290  ILE D CD1 1 
ATOM   6809  N  N   . ILE D  2  179 ? 20.583  25.430  31.230  1.00 7.99  ? 291  ILE D N   1 
ATOM   6810  C  CA  . ILE D  2  179 ? 21.695  25.465  32.182  1.00 10.77 ? 291  ILE D CA  1 
ATOM   6811  C  C   . ILE D  2  179 ? 22.882  24.620  31.676  1.00 11.33 ? 291  ILE D C   1 
ATOM   6812  O  O   . ILE D  2  179 ? 24.027  25.072  31.693  1.00 10.77 ? 291  ILE D O   1 
ATOM   6813  C  CB  . ILE D  2  179 ? 21.221  24.989  33.587  1.00 11.11 ? 291  ILE D CB  1 
ATOM   6814  C  CG1 . ILE D  2  179 ? 20.198  26.014  34.134  1.00 12.14 ? 291  ILE D CG1 1 
ATOM   6815  C  CG2 . ILE D  2  179 ? 22.406  24.843  34.545  1.00 9.67  ? 291  ILE D CG2 1 
ATOM   6816  C  CD1 . ILE D  2  179 ? 19.550  25.639  35.435  1.00 8.47  ? 291  ILE D CD1 1 
ATOM   6817  N  N   . THR D  2  180 ? 22.582  23.419  31.158  1.00 10.73 ? 292  THR D N   1 
ATOM   6818  C  CA  . THR D  2  180 ? 23.589  22.488  30.636  1.00 10.91 ? 292  THR D CA  1 
ATOM   6819  C  C   . THR D  2  180 ? 24.373  23.050  29.417  1.00 11.25 ? 292  THR D C   1 
ATOM   6820  O  O   . THR D  2  180 ? 25.602  23.105  29.438  1.00 8.70  ? 292  THR D O   1 
ATOM   6821  C  CB  . THR D  2  180 ? 22.912  21.144  30.261  1.00 7.53  ? 292  THR D CB  1 
ATOM   6822  O  OG1 . THR D  2  180 ? 22.452  20.522  31.473  1.00 7.95  ? 292  THR D OG1 1 
ATOM   6823  C  CG2 . THR D  2  180 ? 23.862  20.203  29.507  1.00 7.17  ? 292  THR D CG2 1 
ATOM   6824  N  N   . TYR D  2  181 ? 23.664  23.494  28.364  1.00 9.94  ? 293  TYR D N   1 
ATOM   6825  C  CA  . TYR D  2  181 ? 24.358  23.949  27.154  1.00 9.89  ? 293  TYR D CA  1 
ATOM   6826  C  C   . TYR D  2  181 ? 24.832  25.404  27.244  1.00 11.01 ? 293  TYR D C   1 
ATOM   6827  O  O   . TYR D  2  181 ? 25.842  25.770  26.628  1.00 9.60  ? 293  TYR D O   1 
ATOM   6828  C  CB  . TYR D  2  181 ? 23.477  23.716  25.891  1.00 9.37  ? 293  TYR D CB  1 
ATOM   6829  C  CG  . TYR D  2  181 ? 23.341  22.240  25.474  1.00 6.66  ? 293  TYR D CG  1 
ATOM   6830  C  CD1 . TYR D  2  181 ? 23.947  21.747  24.310  1.00 4.07  ? 293  TYR D CD1 1 
ATOM   6831  C  CD2 . TYR D  2  181 ? 22.584  21.347  26.237  1.00 7.41  ? 293  TYR D CD2 1 
ATOM   6832  C  CE1 . TYR D  2  181 ? 23.798  20.414  23.919  1.00 7.34  ? 293  TYR D CE1 1 
ATOM   6833  C  CE2 . TYR D  2  181 ? 22.424  20.012  25.861  1.00 9.65  ? 293  TYR D CE2 1 
ATOM   6834  C  CZ  . TYR D  2  181 ? 23.028  19.539  24.697  1.00 7.41  ? 293  TYR D CZ  1 
ATOM   6835  O  OH  . TYR D  2  181 ? 22.838  18.205  24.309  1.00 4.86  ? 293  TYR D OH  1 
ATOM   6836  N  N   . ARG D  2  182 ? 24.142  26.240  28.025  1.00 10.79 ? 294  ARG D N   1 
ATOM   6837  C  CA  . ARG D  2  182 ? 24.580  27.619  28.091  1.00 11.98 ? 294  ARG D CA  1 
ATOM   6838  C  C   . ARG D  2  182 ? 25.689  27.839  29.119  1.00 11.59 ? 294  ARG D C   1 
ATOM   6839  O  O   . ARG D  2  182 ? 26.656  28.525  28.832  1.00 10.88 ? 294  ARG D O   1 
ATOM   6840  C  CB  . ARG D  2  182 ? 23.432  28.568  28.401  1.00 14.46 ? 294  ARG D CB  1 
ATOM   6841  C  CG  . ARG D  2  182 ? 23.832  30.042  28.324  1.00 12.57 ? 294  ARG D CG  1 
ATOM   6842  C  CD  . ARG D  2  182 ? 22.763  30.925  28.927  1.00 12.48 ? 294  ARG D CD  1 
ATOM   6843  N  NE  . ARG D  2  182 ? 22.529  30.577  30.317  1.00 9.06  ? 294  ARG D NE  1 
ATOM   6844  C  CZ  . ARG D  2  182 ? 21.433  30.841  30.973  1.00 9.23  ? 294  ARG D CZ  1 
ATOM   6845  N  NH1 . ARG D  2  182 ? 20.428  31.465  30.363  1.00 8.16  ? 294  ARG D NH1 1 
ATOM   6846  N  NH2 . ARG D  2  182 ? 21.329  30.491  32.247  1.00 10.80 ? 294  ARG D NH2 1 
ATOM   6847  N  N   . ASP D  2  183 ? 25.551  27.244  30.294  1.00 10.64 ? 295  ASP D N   1 
ATOM   6848  C  CA  . ASP D  2  183 ? 26.501  27.538  31.379  1.00 12.13 ? 295  ASP D CA  1 
ATOM   6849  C  C   . ASP D  2  183 ? 27.540  26.439  31.630  1.00 12.02 ? 295  ASP D C   1 
ATOM   6850  O  O   . ASP D  2  183 ? 28.743  26.715  31.752  1.00 12.83 ? 295  ASP D O   1 
ATOM   6851  C  CB  . ASP D  2  183 ? 25.734  27.819  32.682  1.00 9.21  ? 295  ASP D CB  1 
ATOM   6852  C  CG  . ASP D  2  183 ? 24.654  28.858  32.522  1.00 10.62 ? 295  ASP D CG  1 
ATOM   6853  O  OD1 . ASP D  2  183 ? 23.572  28.666  33.085  1.00 14.54 ? 295  ASP D OD1 1 
ATOM   6854  O  OD2 . ASP D  2  183 ? 24.873  29.864  31.825  1.00 10.87 ? 295  ASP D OD2 1 
ATOM   6855  N  N   . TYR D  2  184 ? 27.053  25.203  31.728  1.00 11.63 ? 296  TYR D N   1 
ATOM   6856  C  CA  . TYR D  2  184 ? 27.857  24.053  32.091  1.00 11.53 ? 296  TYR D CA  1 
ATOM   6857  C  C   . TYR D  2  184 ? 28.839  23.613  31.023  1.00 12.66 ? 296  TYR D C   1 
ATOM   6858  O  O   . TYR D  2  184 ? 30.051  23.727  31.251  1.00 10.97 ? 296  TYR D O   1 
ATOM   6859  C  CB  . TYR D  2  184 ? 26.962  22.896  32.469  1.00 9.65  ? 296  TYR D CB  1 
ATOM   6860  C  CG  . TYR D  2  184 ? 27.724  21.639  32.780  1.00 8.68  ? 296  TYR D CG  1 
ATOM   6861  C  CD1 . TYR D  2  184 ? 28.323  21.445  34.042  1.00 10.19 ? 296  TYR D CD1 1 
ATOM   6862  C  CD2 . TYR D  2  184 ? 27.818  20.609  31.832  1.00 6.99  ? 296  TYR D CD2 1 
ATOM   6863  C  CE1 . TYR D  2  184 ? 28.987  20.253  34.341  1.00 5.97  ? 296  TYR D CE1 1 
ATOM   6864  C  CE2 . TYR D  2  184 ? 28.477  19.422  32.125  1.00 7.95  ? 296  TYR D CE2 1 
ATOM   6865  C  CZ  . TYR D  2  184 ? 29.058  19.252  33.386  1.00 6.27  ? 296  TYR D CZ  1 
ATOM   6866  O  OH  . TYR D  2  184 ? 29.713  18.083  33.671  1.00 6.18  ? 296  TYR D OH  1 
ATOM   6867  N  N   . LEU D  2  185 ? 28.310  23.113  29.860  1.00 11.85 ? 297  LEU D N   1 
ATOM   6868  C  CA  . LEU D  2  185 ? 29.128  22.579  28.738  1.00 12.07 ? 297  LEU D CA  1 
ATOM   6869  C  C   . LEU D  2  185 ? 30.303  23.465  28.249  1.00 12.13 ? 297  LEU D C   1 
ATOM   6870  O  O   . LEU D  2  185 ? 31.400  22.936  27.979  1.00 11.33 ? 297  LEU D O   1 
ATOM   6871  C  CB  . LEU D  2  185 ? 28.239  22.168  27.552  1.00 10.20 ? 297  LEU D CB  1 
ATOM   6872  C  CG  . LEU D  2  185 ? 27.463  20.859  27.750  1.00 8.77  ? 297  LEU D CG  1 
ATOM   6873  C  CD1 . LEU D  2  185 ? 26.585  20.578  26.540  1.00 8.37  ? 297  LEU D CD1 1 
ATOM   6874  C  CD2 . LEU D  2  185 ? 28.422  19.700  28.026  1.00 6.21  ? 297  LEU D CD2 1 
ATOM   6875  N  N   . PRO D  2  186 ? 30.123  24.800  28.089  1.00 11.32 ? 298  PRO D N   1 
ATOM   6876  C  CA  . PRO D  2  186 ? 31.221  25.660  27.651  1.00 11.16 ? 298  PRO D CA  1 
ATOM   6877  C  C   . PRO D  2  186 ? 32.396  25.587  28.662  1.00 10.55 ? 298  PRO D C   1 
ATOM   6878  O  O   . PRO D  2  186 ? 33.542  25.742  28.274  1.00 13.36 ? 298  PRO D O   1 
ATOM   6879  C  CB  . PRO D  2  186 ? 30.585  27.060  27.616  1.00 12.65 ? 298  PRO D CB  1 
ATOM   6880  C  CG  . PRO D  2  186 ? 29.121  26.784  27.426  1.00 12.01 ? 298  PRO D CG  1 
ATOM   6881  C  CD  . PRO D  2  186 ? 28.865  25.589  28.309  1.00 12.37 ? 298  PRO D CD  1 
ATOM   6882  N  N   . LEU D  2  187 ? 32.096  25.325  29.961  1.00 7.03  ? 299  LEU D N   1 
ATOM   6883  C  CA  . LEU D  2  187 ? 33.139  25.230  31.002  1.00 9.47  ? 299  LEU D CA  1 
ATOM   6884  C  C   . LEU D  2  187 ? 33.713  23.826  31.121  1.00 8.33  ? 299  LEU D C   1 
ATOM   6885  O  O   . LEU D  2  187 ? 34.728  23.600  31.781  1.00 6.29  ? 299  LEU D O   1 
ATOM   6886  C  CB  . LEU D  2  187 ? 32.605  25.695  32.360  1.00 11.76 ? 299  LEU D CB  1 
ATOM   6887  C  CG  . LEU D  2  187 ? 32.638  27.219  32.626  1.00 14.48 ? 299  LEU D CG  1 
ATOM   6888  C  CD1 . LEU D  2  187 ? 31.927  27.985  31.501  1.00 11.89 ? 299  LEU D CD1 1 
ATOM   6889  C  CD2 . LEU D  2  187 ? 32.007  27.520  33.990  1.00 14.89 ? 299  LEU D CD2 1 
ATOM   6890  N  N   . VAL D  2  188 ? 33.053  22.880  30.503  1.00 6.25  ? 300  VAL D N   1 
ATOM   6891  C  CA  . VAL D  2  188 ? 33.581  21.544  30.442  1.00 9.13  ? 300  VAL D CA  1 
ATOM   6892  C  C   . VAL D  2  188 ? 34.617  21.472  29.316  1.00 8.04  ? 300  VAL D C   1 
ATOM   6893  O  O   . VAL D  2  188 ? 35.787  21.090  29.507  1.00 5.36  ? 300  VAL D O   1 
ATOM   6894  C  CB  . VAL D  2  188 ? 32.445  20.512  30.158  1.00 9.02  ? 300  VAL D CB  1 
ATOM   6895  C  CG1 . VAL D  2  188 ? 33.047  19.114  29.972  1.00 8.40  ? 300  VAL D CG1 1 
ATOM   6896  C  CG2 . VAL D  2  188 ? 31.429  20.510  31.306  1.00 4.16  ? 300  VAL D CG2 1 
ATOM   6897  N  N   . LEU D  2  189 ? 34.157  21.885  28.152  1.00 8.19  ? 301  LEU D N   1 
ATOM   6898  C  CA  . LEU D  2  189 ? 34.893  21.802  26.921  1.00 5.25  ? 301  LEU D CA  1 
ATOM   6899  C  C   . LEU D  2  189 ? 35.931  22.911  26.722  1.00 6.95  ? 301  LEU D C   1 
ATOM   6900  O  O   . LEU D  2  189 ? 36.948  22.665  26.104  1.00 7.68  ? 301  LEU D O   1 
ATOM   6901  C  CB  . LEU D  2  189 ? 33.895  21.834  25.767  1.00 7.53  ? 301  LEU D CB  1 
ATOM   6902  C  CG  . LEU D  2  189 ? 32.942  20.645  25.681  1.00 9.22  ? 301  LEU D CG  1 
ATOM   6903  C  CD1 . LEU D  2  189 ? 31.964  20.843  24.531  1.00 8.48  ? 301  LEU D CD1 1 
ATOM   6904  C  CD2 . LEU D  2  189 ? 33.741  19.360  25.504  1.00 10.00 ? 301  LEU D CD2 1 
ATOM   6905  N  N   . GLY D  2  190 ? 35.683  24.112  27.242  1.00 7.97  ? 302  GLY D N   1 
ATOM   6906  C  CA  . GLY D  2  190 ? 36.533  25.234  26.903  1.00 8.04  ? 302  GLY D CA  1 
ATOM   6907  C  C   . GLY D  2  190 ? 36.056  25.861  25.596  1.00 9.99  ? 302  GLY D C   1 
ATOM   6908  O  O   . GLY D  2  190 ? 35.341  25.232  24.829  1.00 9.82  ? 302  GLY D O   1 
ATOM   6909  N  N   . PRO D  2  191 ? 36.439  27.084  25.289  1.00 11.33 ? 303  PRO D N   1 
ATOM   6910  C  CA  . PRO D  2  191 ? 36.006  27.782  24.063  1.00 11.21 ? 303  PRO D CA  1 
ATOM   6911  C  C   . PRO D  2  191 ? 36.249  27.048  22.725  1.00 9.56  ? 303  PRO D C   1 
ATOM   6912  O  O   . PRO D  2  191 ? 35.359  26.961  21.892  1.00 6.51  ? 303  PRO D O   1 
ATOM   6913  C  CB  . PRO D  2  191 ? 36.785  29.091  24.135  1.00 15.00 ? 303  PRO D CB  1 
ATOM   6914  C  CG  . PRO D  2  191 ? 36.967  29.297  25.598  1.00 15.45 ? 303  PRO D CG  1 
ATOM   6915  C  CD  . PRO D  2  191 ? 37.314  27.937  26.111  1.00 12.50 ? 303  PRO D CD  1 
ATOM   6916  N  N   . THR D  2  192 ? 37.451  26.546  22.506  1.00 8.67  ? 304  THR D N   1 
ATOM   6917  C  CA  . THR D  2  192 ? 37.792  25.908  21.232  1.00 9.58  ? 304  THR D CA  1 
ATOM   6918  C  C   . THR D  2  192 ? 37.016  24.620  20.987  1.00 8.95  ? 304  THR D C   1 
ATOM   6919  O  O   . THR D  2  192 ? 36.510  24.426  19.885  1.00 11.16 ? 304  THR D O   1 
ATOM   6920  C  CB  . THR D  2  192 ? 39.322  25.648  21.109  1.00 12.54 ? 304  THR D CB  1 
ATOM   6921  O  OG1 . THR D  2  192 ? 39.997  26.909  21.170  1.00 17.20 ? 304  THR D OG1 1 
ATOM   6922  C  CG2 . THR D  2  192 ? 39.676  24.995  19.778  1.00 13.90 ? 304  THR D CG2 1 
ATOM   6923  N  N   . ALA D  2  193 ? 36.896  23.760  21.999  1.00 8.88  ? 305  ALA D N   1 
ATOM   6924  C  CA  . ALA D  2  193 ? 36.135  22.512  21.842  1.00 8.68  ? 305  ALA D CA  1 
ATOM   6925  C  C   . ALA D  2  193 ? 34.617  22.796  21.703  1.00 9.20  ? 305  ALA D C   1 
ATOM   6926  O  O   . ALA D  2  193 ? 33.905  22.102  20.960  1.00 8.56  ? 305  ALA D O   1 
ATOM   6927  C  CB  . ALA D  2  193 ? 36.405  21.582  23.009  1.00 6.32  ? 305  ALA D CB  1 
ATOM   6928  N  N   . MET D  2  194 ? 34.140  23.825  22.402  1.00 10.27 ? 306  MET D N   1 
ATOM   6929  C  CA  . MET D  2  194 ? 32.744  24.235  22.324  1.00 12.28 ? 306  MET D CA  1 
ATOM   6930  C  C   . MET D  2  194 ? 32.362  24.582  20.873  1.00 13.63 ? 306  MET D C   1 
ATOM   6931  O  O   . MET D  2  194 ? 31.416  24.013  20.332  1.00 15.16 ? 306  MET D O   1 
ATOM   6932  C  CB  . MET D  2  194 ? 32.501  25.426  23.266  1.00 13.40 ? 306  MET D CB  1 
ATOM   6933  C  CG  . MET D  2  194 ? 31.107  26.052  23.257  1.00 18.60 ? 306  MET D CG  1 
ATOM   6934  S  SD  . MET D  2  194 ? 29.840  25.088  24.102  1.00 24.29 ? 306  MET D SD  1 
ATOM   6935  C  CE  . MET D  2  194 ? 28.388  25.575  23.164  1.00 24.73 ? 306  MET D CE  1 
ATOM   6936  N  N   . ARG D  2  195 ? 33.121  25.476  20.225  1.00 12.97 ? 307  ARG D N   1 
ATOM   6937  C  CA  . ARG D  2  195 ? 32.828  25.876  18.841  1.00 13.32 ? 307  ARG D CA  1 
ATOM   6938  C  C   . ARG D  2  195 ? 32.900  24.713  17.842  1.00 11.35 ? 307  ARG D C   1 
ATOM   6939  O  O   . ARG D  2  195 ? 32.116  24.654  16.900  1.00 11.95 ? 307  ARG D O   1 
ATOM   6940  C  CB  . ARG D  2  195 ? 33.799  26.977  18.387  1.00 15.47 ? 307  ARG D CB  1 
ATOM   6941  C  CG  . ARG D  2  195 ? 33.483  28.357  18.928  1.00 22.24 ? 307  ARG D CG  1 
ATOM   6942  C  CD  . ARG D  2  195 ? 34.491  29.405  18.447  1.00 28.97 ? 307  ARG D CD  1 
ATOM   6943  N  NE  . ARG D  2  195 ? 35.830  29.280  19.069  1.00 33.15 ? 307  ARG D NE  1 
ATOM   6944  C  CZ  . ARG D  2  195 ? 36.224  29.916  20.192  1.00 34.52 ? 307  ARG D CZ  1 
ATOM   6945  N  NH1 . ARG D  2  195 ? 35.369  30.692  20.855  1.00 35.56 ? 307  ARG D NH1 1 
ATOM   6946  N  NH2 . ARG D  2  195 ? 37.466  29.756  20.658  1.00 32.62 ? 307  ARG D NH2 1 
ATOM   6947  N  N   . LYS D  2  196 ? 33.866  23.810  18.039  1.00 10.06 ? 308  LYS D N   1 
ATOM   6948  C  CA  . LYS D  2  196 ? 34.101  22.684  17.142  1.00 10.00 ? 308  LYS D CA  1 
ATOM   6949  C  C   . LYS D  2  196 ? 33.012  21.604  17.251  1.00 11.24 ? 308  LYS D C   1 
ATOM   6950  O  O   . LYS D  2  196 ? 32.501  21.131  16.246  1.00 12.21 ? 308  LYS D O   1 
ATOM   6951  C  CB  . LYS D  2  196 ? 35.472  22.056  17.447  1.00 9.84  ? 308  LYS D CB  1 
ATOM   6952  C  CG  . LYS D  2  196 ? 35.838  20.838  16.598  1.00 12.38 ? 308  LYS D CG  1 
ATOM   6953  C  CD  . LYS D  2  196 ? 37.145  20.211  17.080  1.00 13.20 ? 308  LYS D CD  1 
ATOM   6954  C  CE  . LYS D  2  196 ? 37.600  19.062  16.193  1.00 12.32 ? 308  LYS D CE  1 
ATOM   6955  N  NZ  . LYS D  2  196 ? 37.937  19.519  14.818  1.00 16.75 ? 308  LYS D NZ  1 
ATOM   6956  N  N   . TYR D  2  197 ? 32.653  21.231  18.457  1.00 10.06 ? 309  TYR D N   1 
ATOM   6957  C  CA  . TYR D  2  197 ? 31.732  20.129  18.652  1.00 11.71 ? 309  TYR D CA  1 
ATOM   6958  C  C   . TYR D  2  197 ? 30.273  20.563  18.840  1.00 13.17 ? 309  TYR D C   1 
ATOM   6959  O  O   . TYR D  2  197 ? 29.334  19.775  18.616  1.00 10.46 ? 309  TYR D O   1 
ATOM   6960  C  CB  . TYR D  2  197 ? 32.222  19.315  19.838  1.00 12.55 ? 309  TYR D CB  1 
ATOM   6961  C  CG  . TYR D  2  197 ? 33.551  18.644  19.564  1.00 10.77 ? 309  TYR D CG  1 
ATOM   6962  C  CD1 . TYR D  2  197 ? 33.683  17.778  18.472  1.00 12.45 ? 309  TYR D CD1 1 
ATOM   6963  C  CD2 . TYR D  2  197 ? 34.695  18.894  20.369  1.00 11.43 ? 309  TYR D CD2 1 
ATOM   6964  C  CE1 . TYR D  2  197 ? 34.903  17.174  18.166  1.00 15.80 ? 309  TYR D CE1 1 
ATOM   6965  C  CE2 . TYR D  2  197 ? 35.929  18.297  20.072  1.00 11.52 ? 309  TYR D CE2 1 
ATOM   6966  C  CZ  . TYR D  2  197 ? 36.027  17.440  18.964  1.00 13.53 ? 309  TYR D CZ  1 
ATOM   6967  O  OH  . TYR D  2  197 ? 37.240  16.895  18.604  1.00 14.21 ? 309  TYR D OH  1 
ATOM   6968  N  N   . LEU D  2  198 ? 30.076  21.824  19.232  1.00 13.25 ? 310  LEU D N   1 
ATOM   6969  C  CA  . LEU D  2  198 ? 28.732  22.362  19.435  1.00 12.69 ? 310  LEU D CA  1 
ATOM   6970  C  C   . LEU D  2  198 ? 28.483  23.676  18.681  1.00 13.52 ? 310  LEU D C   1 
ATOM   6971  O  O   . LEU D  2  198 ? 28.255  24.707  19.309  1.00 15.36 ? 310  LEU D O   1 
ATOM   6972  C  CB  . LEU D  2  198 ? 28.489  22.556  20.925  1.00 9.69  ? 310  LEU D CB  1 
ATOM   6973  C  CG  . LEU D  2  198 ? 28.167  21.279  21.688  1.00 11.70 ? 310  LEU D CG  1 
ATOM   6974  C  CD1 . LEU D  2  198 ? 28.241  21.530  23.185  1.00 8.86  ? 310  LEU D CD1 1 
ATOM   6975  C  CD2 . LEU D  2  198 ? 26.789  20.761  21.268  1.00 8.85  ? 310  LEU D CD2 1 
ATOM   6976  N  N   . PRO D  2  199 ? 28.519  23.697  17.326  1.00 11.95 ? 311  PRO D N   1 
ATOM   6977  C  CA  . PRO D  2  199 ? 28.262  24.941  16.586  1.00 13.08 ? 311  PRO D CA  1 
ATOM   6978  C  C   . PRO D  2  199 ? 26.880  25.503  16.964  1.00 11.76 ? 311  PRO D C   1 
ATOM   6979  O  O   . PRO D  2  199 ? 26.078  24.802  17.606  1.00 11.13 ? 311  PRO D O   1 
ATOM   6980  C  CB  . PRO D  2  199 ? 28.358  24.515  15.099  1.00 10.09 ? 311  PRO D CB  1 
ATOM   6981  C  CG  . PRO D  2  199 ? 28.130  23.046  15.129  1.00 10.53 ? 311  PRO D CG  1 
ATOM   6982  C  CD  . PRO D  2  199 ? 28.791  22.575  16.400  1.00 10.46 ? 311  PRO D CD  1 
ATOM   6983  N  N   . THR D  2  200 ? 26.610  26.755  16.588  1.00 11.81 ? 312  THR D N   1 
ATOM   6984  C  CA  . THR D  2  200 ? 25.293  27.384  16.843  1.00 12.48 ? 312  THR D CA  1 
ATOM   6985  C  C   . THR D  2  200 ? 24.150  26.488  16.361  1.00 10.82 ? 312  THR D C   1 
ATOM   6986  O  O   . THR D  2  200 ? 24.161  25.981  15.229  1.00 9.95  ? 312  THR D O   1 
ATOM   6987  C  CB  . THR D  2  200 ? 25.151  28.733  16.098  1.00 13.59 ? 312  THR D CB  1 
ATOM   6988  O  OG1 . THR D  2  200 ? 26.201  29.604  16.502  1.00 16.79 ? 312  THR D OG1 1 
ATOM   6989  C  CG2 . THR D  2  200 ? 23.801  29.381  16.395  1.00 12.99 ? 312  THR D CG2 1 
ATOM   6990  N  N   . TYR D  2  201 ? 23.173  26.314  17.221  1.00 11.19 ? 313  TYR D N   1 
ATOM   6991  C  CA  . TYR D  2  201 ? 22.004  25.529  16.883  1.00 12.93 ? 313  TYR D CA  1 
ATOM   6992  C  C   . TYR D  2  201 ? 21.299  26.118  15.655  1.00 12.95 ? 313  TYR D C   1 
ATOM   6993  O  O   . TYR D  2  201 ? 21.192  27.333  15.529  1.00 11.85 ? 313  TYR D O   1 
ATOM   6994  C  CB  . TYR D  2  201 ? 21.030  25.502  18.068  1.00 12.15 ? 313  TYR D CB  1 
ATOM   6995  C  CG  . TYR D  2  201 ? 19.781  24.656  17.843  1.00 11.33 ? 313  TYR D CG  1 
ATOM   6996  C  CD1 . TYR D  2  201 ? 19.853  23.264  17.862  1.00 10.69 ? 313  TYR D CD1 1 
ATOM   6997  C  CD2 . TYR D  2  201 ? 18.536  25.241  17.619  1.00 8.73  ? 313  TYR D CD2 1 
ATOM   6998  C  CE1 . TYR D  2  201 ? 18.732  22.472  17.664  1.00 10.38 ? 313  TYR D CE1 1 
ATOM   6999  C  CE2 . TYR D  2  201 ? 17.401  24.460  17.421  1.00 9.74  ? 313  TYR D CE2 1 
ATOM   7000  C  CZ  . TYR D  2  201 ? 17.498  23.067  17.444  1.00 9.24  ? 313  TYR D CZ  1 
ATOM   7001  O  OH  . TYR D  2  201 ? 16.367  22.267  17.253  1.00 6.01  ? 313  TYR D OH  1 
ATOM   7002  N  N   . ARG D  2  202 ? 20.888  25.230  14.731  1.00 13.95 ? 314  ARG D N   1 
ATOM   7003  C  CA  . ARG D  2  202 ? 20.069  25.586  13.561  1.00 12.59 ? 314  ARG D CA  1 
ATOM   7004  C  C   . ARG D  2  202 ? 18.627  25.085  13.810  1.00 11.72 ? 314  ARG D C   1 
ATOM   7005  O  O   . ARG D  2  202 ? 17.747  25.877  14.109  1.00 11.67 ? 314  ARG D O   1 
ATOM   7006  C  CB  . ARG D  2  202 ? 20.686  25.007  12.289  1.00 9.93  ? 314  ARG D CB  1 
ATOM   7007  C  CG  . ARG D  2  202 ? 22.062  25.591  11.999  1.00 13.57 ? 314  ARG D CG  1 
ATOM   7008  C  CD  . ARG D  2  202 ? 22.783  24.915  10.842  1.00 14.56 ? 314  ARG D CD  1 
ATOM   7009  N  NE  . ARG D  2  202 ? 23.036  23.502  11.118  1.00 22.14 ? 314  ARG D NE  1 
ATOM   7010  C  CZ  . ARG D  2  202 ? 24.235  22.926  11.210  1.00 23.93 ? 314  ARG D CZ  1 
ATOM   7011  N  NH1 . ARG D  2  202 ? 25.349  23.632  11.025  1.00 22.57 ? 314  ARG D NH1 1 
ATOM   7012  N  NH2 . ARG D  2  202 ? 24.312  21.628  11.485  1.00 25.79 ? 314  ARG D NH2 1 
ATOM   7013  N  N   . SER D  2  203 ? 18.395  23.777  13.716  1.00 12.28 ? 315  SER D N   1 
ATOM   7014  C  CA  . SER D  2  203 ? 17.100  23.170  14.110  1.00 14.22 ? 315  SER D CA  1 
ATOM   7015  C  C   . SER D  2  203 ? 17.165  21.639  14.118  1.00 13.22 ? 315  SER D C   1 
ATOM   7016  O  O   . SER D  2  203 ? 18.221  21.037  13.850  1.00 12.48 ? 315  SER D O   1 
ATOM   7017  C  CB  . SER D  2  203 ? 15.909  23.640  13.249  1.00 14.87 ? 315  SER D CB  1 
ATOM   7018  O  OG  . SER D  2  203 ? 16.150  23.420  11.890  1.00 17.61 ? 315  SER D OG  1 
ATOM   7019  N  N   . TYR D  2  204 ? 16.035  21.025  14.466  1.00 13.94 ? 316  TYR D N   1 
ATOM   7020  C  CA  . TYR D  2  204 ? 15.923  19.575  14.565  1.00 11.33 ? 316  TYR D CA  1 
ATOM   7021  C  C   . TYR D  2  204 ? 16.253  18.868  13.274  1.00 10.20 ? 316  TYR D C   1 
ATOM   7022  O  O   . TYR D  2  204 ? 15.699  19.157  12.223  1.00 8.14  ? 316  TYR D O   1 
ATOM   7023  C  CB  . TYR D  2  204 ? 14.509  19.182  15.032  1.00 10.77 ? 316  TYR D CB  1 
ATOM   7024  C  CG  . TYR D  2  204 ? 14.248  17.694  15.073  1.00 11.01 ? 316  TYR D CG  1 
ATOM   7025  C  CD1 . TYR D  2  204 ? 15.134  16.801  15.725  1.00 8.20  ? 316  TYR D CD1 1 
ATOM   7026  C  CD2 . TYR D  2  204 ? 13.098  17.167  14.454  1.00 8.68  ? 316  TYR D CD2 1 
ATOM   7027  C  CE1 . TYR D  2  204 ? 14.859  15.425  15.748  1.00 8.69  ? 316  TYR D CE1 1 
ATOM   7028  C  CE2 . TYR D  2  204 ? 12.822  15.805  14.477  1.00 10.12 ? 316  TYR D CE2 1 
ATOM   7029  C  CZ  . TYR D  2  204 ? 13.696  14.932  15.121  1.00 7.52  ? 316  TYR D CZ  1 
ATOM   7030  O  OH  . TYR D  2  204 ? 13.409  13.583  15.134  1.00 5.87  ? 316  TYR D OH  1 
ATOM   7031  N  N   . ASN D  2  205 ? 17.173  17.929  13.386  1.00 10.25 ? 317  ASN D N   1 
ATOM   7032  C  CA  . ASN D  2  205 ? 17.559  17.063  12.290  1.00 10.15 ? 317  ASN D CA  1 
ATOM   7033  C  C   . ASN D  2  205 ? 17.259  15.612  12.709  1.00 10.42 ? 317  ASN D C   1 
ATOM   7034  O  O   . ASN D  2  205 ? 17.915  15.055  13.614  1.00 7.29  ? 317  ASN D O   1 
ATOM   7035  C  CB  . ASN D  2  205 ? 19.047  17.278  11.990  1.00 11.09 ? 317  ASN D CB  1 
ATOM   7036  C  CG  . ASN D  2  205 ? 19.572  16.434  10.854  1.00 11.95 ? 317  ASN D CG  1 
ATOM   7037  O  OD1 . ASN D  2  205 ? 18.951  15.437  10.468  1.00 9.70  ? 317  ASN D OD1 1 
ATOM   7038  N  ND2 . ASN D  2  205 ? 20.742  16.819  10.312  1.00 11.46 ? 317  ASN D ND2 1 
ATOM   7039  N  N   . ASP D  2  206 ? 16.257  14.997  12.046  1.00 8.09  ? 318  ASP D N   1 
ATOM   7040  C  CA  . ASP D  2  206 ? 15.836  13.635  12.401  1.00 9.47  ? 318  ASP D CA  1 
ATOM   7041  C  C   . ASP D  2  206 ? 16.767  12.517  11.919  1.00 8.47  ? 318  ASP D C   1 
ATOM   7042  O  O   . ASP D  2  206 ? 16.526  11.341  12.197  1.00 9.09  ? 318  ASP D O   1 
ATOM   7043  C  CB  . ASP D  2  206 ? 14.393  13.373  11.964  1.00 9.64  ? 318  ASP D CB  1 
ATOM   7044  C  CG  . ASP D  2  206 ? 14.130  13.327  10.462  1.00 13.97 ? 318  ASP D CG  1 
ATOM   7045  O  OD1 . ASP D  2  206 ? 15.056  13.069  9.661   1.00 10.31 ? 318  ASP D OD1 1 
ATOM   7046  O  OD2 . ASP D  2  206 ? 12.957  13.534  10.084  1.00 19.42 ? 318  ASP D OD2 1 
ATOM   7047  N  N   . SER D  2  207 ? 17.823  12.881  11.206  1.00 8.46  ? 319  SER D N   1 
ATOM   7048  C  CA  . SER D  2  207 ? 18.832  11.914  10.768  1.00 7.79  ? 319  SER D CA  1 
ATOM   7049  C  C   . SER D  2  207 ? 20.014  11.903  11.745  1.00 6.74  ? 319  SER D C   1 
ATOM   7050  O  O   . SER D  2  207 ? 21.018  11.227  11.502  1.00 8.09  ? 319  SER D O   1 
ATOM   7051  C  CB  . SER D  2  207 ? 19.331  12.228  9.351   1.00 6.69  ? 319  SER D CB  1 
ATOM   7052  O  OG  . SER D  2  207 ? 18.335  11.971  8.385   1.00 6.57  ? 319  SER D OG  1 
ATOM   7053  N  N   . VAL D  2  208 ? 19.891  12.666  12.838  1.00 6.86  ? 320  VAL D N   1 
ATOM   7054  C  CA  . VAL D  2  208 ? 20.911  12.716  13.887  1.00 6.30  ? 320  VAL D CA  1 
ATOM   7055  C  C   . VAL D  2  208 ? 20.578  11.717  14.975  1.00 6.37  ? 320  VAL D C   1 
ATOM   7056  O  O   . VAL D  2  208 ? 19.589  11.897  15.685  1.00 9.39  ? 320  VAL D O   1 
ATOM   7057  C  CB  . VAL D  2  208 ? 21.005  14.122  14.503  1.00 6.13  ? 320  VAL D CB  1 
ATOM   7058  C  CG1 . VAL D  2  208 ? 21.884  14.095  15.760  1.00 10.38 ? 320  VAL D CG1 1 
ATOM   7059  C  CG2 . VAL D  2  208 ? 21.588  15.093  13.478  1.00 4.02  ? 320  VAL D CG2 1 
ATOM   7060  N  N   . ASP D  2  209 ? 21.390  10.646  15.089  1.00 6.27  ? 321  ASP D N   1 
ATOM   7061  C  CA  . ASP D  2  209 ? 21.151  9.598   16.107  1.00 6.76  ? 321  ASP D CA  1 
ATOM   7062  C  C   . ASP D  2  209 ? 21.394  10.143  17.521  1.00 7.53  ? 321  ASP D C   1 
ATOM   7063  O  O   . ASP D  2  209 ? 22.529  10.454  17.896  1.00 6.71  ? 321  ASP D O   1 
ATOM   7064  C  CB  . ASP D  2  209 ? 22.035  8.365   15.822  1.00 8.59  ? 321  ASP D CB  1 
ATOM   7065  C  CG  . ASP D  2  209 ? 21.831  7.149   16.756  1.00 8.56  ? 321  ASP D CG  1 
ATOM   7066  O  OD1 . ASP D  2  209 ? 22.469  6.106   16.502  1.00 15.05 ? 321  ASP D OD1 1 
ATOM   7067  O  OD2 . ASP D  2  209 ? 21.056  7.221   17.730  1.00 8.30  ? 321  ASP D OD2 1 
ATOM   7068  N  N   . PRO D  2  210 ? 20.320  10.269  18.325  1.00 6.32  ? 322  PRO D N   1 
ATOM   7069  C  CA  . PRO D  2  210 ? 20.405  10.797  19.691  1.00 6.00  ? 322  PRO D CA  1 
ATOM   7070  C  C   . PRO D  2  210 ? 20.736  9.757   20.767  1.00 4.35  ? 322  PRO D C   1 
ATOM   7071  O  O   . PRO D  2  210 ? 20.643  10.060  21.941  1.00 7.63  ? 322  PRO D O   1 
ATOM   7072  C  CB  . PRO D  2  210 ? 19.015  11.389  19.860  1.00 4.96  ? 322  PRO D CB  1 
ATOM   7073  C  CG  . PRO D  2  210 ? 18.171  10.338  19.232  1.00 2.55  ? 322  PRO D CG  1 
ATOM   7074  C  CD  . PRO D  2  210 ? 18.898  10.003  17.956  1.00 5.08  ? 322  PRO D CD  1 
ATOM   7075  N  N   . ARG D  2  211 ? 21.113  8.537   20.386  1.00 5.44  ? 323  ARG D N   1 
ATOM   7076  C  CA  . ARG D  2  211 ? 21.374  7.514   21.416  1.00 5.95  ? 323  ARG D CA  1 
ATOM   7077  C  C   . ARG D  2  211 ? 22.656  7.797   22.188  1.00 7.69  ? 323  ARG D C   1 
ATOM   7078  O  O   . ARG D  2  211 ? 23.582  8.406   21.652  1.00 5.63  ? 323  ARG D O   1 
ATOM   7079  C  CB  . ARG D  2  211 ? 21.493  6.127   20.805  1.00 6.40  ? 323  ARG D CB  1 
ATOM   7080  C  CG  . ARG D  2  211 ? 20.167  5.470   20.424  1.00 4.84  ? 323  ARG D CG  1 
ATOM   7081  C  CD  . ARG D  2  211 ? 20.447  4.100   19.844  1.00 2.00  ? 323  ARG D CD  1 
ATOM   7082  N  NE  . ARG D  2  211 ? 21.016  4.212   18.507  1.00 4.31  ? 323  ARG D NE  1 
ATOM   7083  C  CZ  . ARG D  2  211 ? 21.212  3.194   17.675  1.00 2.70  ? 323  ARG D CZ  1 
ATOM   7084  N  NH1 . ARG D  2  211 ? 20.947  1.958   18.063  1.00 3.61  ? 323  ARG D NH1 1 
ATOM   7085  N  NH2 . ARG D  2  211 ? 21.686  3.420   16.463  1.00 2.50  ? 323  ARG D NH2 1 
ATOM   7086  N  N   . ILE D  2  212 ? 22.694  7.399   23.459  1.00 6.81  ? 324  ILE D N   1 
ATOM   7087  C  CA  . ILE D  2  212 ? 23.952  7.525   24.199  1.00 7.11  ? 324  ILE D CA  1 
ATOM   7088  C  C   . ILE D  2  212 ? 24.882  6.462   23.666  1.00 5.73  ? 324  ILE D C   1 
ATOM   7089  O  O   . ILE D  2  212 ? 24.459  5.327   23.481  1.00 6.06  ? 324  ILE D O   1 
ATOM   7090  C  CB  . ILE D  2  212 ? 23.756  7.318   25.731  1.00 6.39  ? 324  ILE D CB  1 
ATOM   7091  C  CG1 . ILE D  2  212 ? 22.868  8.448   26.312  1.00 8.03  ? 324  ILE D CG1 1 
ATOM   7092  C  CG2 . ILE D  2  212 ? 25.099  7.238   26.453  1.00 2.63  ? 324  ILE D CG2 1 
ATOM   7093  C  CD1 . ILE D  2  212 ? 23.417  9.861   26.136  1.00 7.25  ? 324  ILE D CD1 1 
ATOM   7094  N  N   . ALA D  2  213 ? 26.110  6.839   23.339  1.00 6.51  ? 325  ALA D N   1 
ATOM   7095  C  CA  . ALA D  2  213 ? 27.121  5.863   22.888  1.00 7.27  ? 325  ALA D CA  1 
ATOM   7096  C  C   . ALA D  2  213 ? 27.683  5.110   24.102  1.00 6.27  ? 325  ALA D C   1 
ATOM   7097  O  O   . ALA D  2  213 ? 27.833  5.713   25.180  1.00 9.00  ? 325  ALA D O   1 
ATOM   7098  C  CB  . ALA D  2  213 ? 28.254  6.587   22.154  1.00 5.27  ? 325  ALA D CB  1 
ATOM   7099  N  N   . ASN D  2  214 ? 28.001  3.808   23.945  1.00 4.42  ? 326  ASN D N   1 
ATOM   7100  C  CA  . ASN D  2  214 ? 28.537  3.030   25.064  1.00 3.09  ? 326  ASN D CA  1 
ATOM   7101  C  C   . ASN D  2  214 ? 29.771  3.719   25.711  1.00 4.05  ? 326  ASN D C   1 
ATOM   7102  O  O   . ASN D  2  214 ? 29.842  3.831   26.931  1.00 3.59  ? 326  ASN D O   1 
ATOM   7103  C  CB  . ASN D  2  214 ? 28.872  1.593   24.622  1.00 3.78  ? 326  ASN D CB  1 
ATOM   7104  C  CG  . ASN D  2  214 ? 28.983  0.639   25.813  1.00 3.64  ? 326  ASN D CG  1 
ATOM   7105  O  OD1 . ASN D  2  214 ? 29.576  0.964   26.823  1.00 3.45  ? 326  ASN D OD1 1 
ATOM   7106  N  ND2 . ASN D  2  214 ? 28.394  -0.536  25.696  1.00 6.09  ? 326  ASN D ND2 1 
ATOM   7107  N  N   . VAL D  2  215 ? 30.684  4.242   24.894  1.00 4.67  ? 327  VAL D N   1 
ATOM   7108  C  CA  . VAL D  2  215 ? 31.888  4.939   25.401  1.00 7.26  ? 327  VAL D CA  1 
ATOM   7109  C  C   . VAL D  2  215 ? 31.540  6.150   26.317  1.00 8.94  ? 327  VAL D C   1 
ATOM   7110  O  O   . VAL D  2  215 ? 32.241  6.420   27.329  1.00 9.36  ? 327  VAL D O   1 
ATOM   7111  C  CB  . VAL D  2  215 ? 32.836  5.394   24.227  1.00 3.51  ? 327  VAL D CB  1 
ATOM   7112  C  CG1 . VAL D  2  215 ? 32.208  6.517   23.401  1.00 4.00  ? 327  VAL D CG1 1 
ATOM   7113  C  CG2 . VAL D  2  215 ? 34.205  5.817   24.763  1.00 2.00  ? 327  VAL D CG2 1 
ATOM   7114  N  N   . PHE D  2  216 ? 30.439  6.860   26.001  1.00 9.17  ? 328  PHE D N   1 
ATOM   7115  C  CA  . PHE D  2  216 ? 30.046  8.027   26.798  1.00 6.86  ? 328  PHE D CA  1 
ATOM   7116  C  C   . PHE D  2  216 ? 29.865  7.675   28.257  1.00 4.38  ? 328  PHE D C   1 
ATOM   7117  O  O   . PHE D  2  216 ? 30.311  8.424   29.128  1.00 3.99  ? 328  PHE D O   1 
ATOM   7118  C  CB  . PHE D  2  216 ? 28.762  8.709   26.258  1.00 5.79  ? 328  PHE D CB  1 
ATOM   7119  C  CG  . PHE D  2  216 ? 28.377  9.963   27.018  1.00 5.22  ? 328  PHE D CG  1 
ATOM   7120  C  CD1 . PHE D  2  216 ? 29.067  11.168  26.811  1.00 2.41  ? 328  PHE D CD1 1 
ATOM   7121  C  CD2 . PHE D  2  216 ? 27.339  9.948   27.947  1.00 2.00  ? 328  PHE D CD2 1 
ATOM   7122  C  CE1 . PHE D  2  216 ? 28.716  12.317  27.521  1.00 2.46  ? 328  PHE D CE1 1 
ATOM   7123  C  CE2 . PHE D  2  216 ? 26.992  11.093  28.649  1.00 2.61  ? 328  PHE D CE2 1 
ATOM   7124  C  CZ  . PHE D  2  216 ? 27.684  12.280  28.434  1.00 2.00  ? 328  PHE D CZ  1 
ATOM   7125  N  N   . THR D  2  217 ? 29.229  6.534   28.521  1.00 3.53  ? 329  THR D N   1 
ATOM   7126  C  CA  . THR D  2  217 ? 28.973  6.095   29.904  1.00 5.53  ? 329  THR D CA  1 
ATOM   7127  C  C   . THR D  2  217 ? 30.277  6.004   30.745  1.00 5.54  ? 329  THR D C   1 
ATOM   7128  O  O   . THR D  2  217 ? 30.241  6.024   31.967  1.00 3.07  ? 329  THR D O   1 
ATOM   7129  C  CB  . THR D  2  217 ? 28.223  4.730   29.935  1.00 5.19  ? 329  THR D CB  1 
ATOM   7130  O  OG1 . THR D  2  217 ? 29.076  3.662   29.524  1.00 7.26  ? 329  THR D OG1 1 
ATOM   7131  C  CG2 . THR D  2  217 ? 27.041  4.774   28.970  1.00 4.40  ? 329  THR D CG2 1 
ATOM   7132  N  N   . ASN D  2  218 ? 31.408  5.908   30.074  1.00 5.39  ? 330  ASN D N   1 
ATOM   7133  C  CA  . ASN D  2  218 ? 32.671  5.799   30.789  1.00 6.47  ? 330  ASN D CA  1 
ATOM   7134  C  C   . ASN D  2  218 ? 33.465  7.130   30.729  1.00 6.79  ? 330  ASN D C   1 
ATOM   7135  O  O   . ASN D  2  218 ? 34.026  7.570   31.752  1.00 8.55  ? 330  ASN D O   1 
ATOM   7136  C  CB  . ASN D  2  218 ? 33.471  4.617   30.235  1.00 5.41  ? 330  ASN D CB  1 
ATOM   7137  C  CG  . ASN D  2  218 ? 34.475  4.076   31.252  1.00 10.89 ? 330  ASN D CG  1 
ATOM   7138  O  OD1 . ASN D  2  218 ? 35.646  4.394   31.167  1.00 9.46  ? 330  ASN D OD1 1 
ATOM   7139  N  ND2 . ASN D  2  218 ? 34.011  3.279   32.230  1.00 8.21  ? 330  ASN D ND2 1 
ATOM   7140  N  N   . ALA D  2  219 ? 33.449  7.797   29.555  1.00 5.77  ? 331  ALA D N   1 
ATOM   7141  C  CA  . ALA D  2  219 ? 34.170  9.072   29.354  1.00 5.17  ? 331  ALA D CA  1 
ATOM   7142  C  C   . ALA D  2  219 ? 33.623  10.214  30.199  1.00 6.56  ? 331  ALA D C   1 
ATOM   7143  O  O   . ALA D  2  219 ? 34.410  10.995  30.751  1.00 3.46  ? 331  ALA D O   1 
ATOM   7144  C  CB  . ALA D  2  219 ? 34.144  9.468   27.891  1.00 4.80  ? 331  ALA D CB  1 
ATOM   7145  N  N   . PHE D  2  220 ? 32.268  10.325  30.298  1.00 6.73  ? 332  PHE D N   1 
ATOM   7146  C  CA  . PHE D  2  220 ? 31.655  11.396  31.106  1.00 6.93  ? 332  PHE D CA  1 
ATOM   7147  C  C   . PHE D  2  220 ? 31.938  11.239  32.617  1.00 6.76  ? 332  PHE D C   1 
ATOM   7148  O  O   . PHE D  2  220 ? 31.625  12.142  33.416  1.00 6.95  ? 332  PHE D O   1 
ATOM   7149  C  CB  . PHE D  2  220 ? 30.138  11.501  30.854  1.00 6.27  ? 332  PHE D CB  1 
ATOM   7150  C  CG  . PHE D  2  220 ? 29.577  12.860  31.222  1.00 5.87  ? 332  PHE D CG  1 
ATOM   7151  C  CD1 . PHE D  2  220 ? 30.065  14.011  30.615  1.00 5.20  ? 332  PHE D CD1 1 
ATOM   7152  C  CD2 . PHE D  2  220 ? 28.592  12.987  32.207  1.00 3.88  ? 332  PHE D CD2 1 
ATOM   7153  C  CE1 . PHE D  2  220 ? 29.583  15.267  30.984  1.00 5.86  ? 332  PHE D CE1 1 
ATOM   7154  C  CE2 . PHE D  2  220 ? 28.104  14.233  32.585  1.00 4.12  ? 332  PHE D CE2 1 
ATOM   7155  C  CZ  . PHE D  2  220 ? 28.599  15.381  31.972  1.00 5.09  ? 332  PHE D CZ  1 
ATOM   7156  N  N   . ARG D  2  221 ? 32.542  10.100  33.005  1.00 6.84  ? 333  ARG D N   1 
ATOM   7157  C  CA  . ARG D  2  221 ? 32.935  9.840   34.398  1.00 6.88  ? 333  ARG D CA  1 
ATOM   7158  C  C   . ARG D  2  221 ? 34.132  10.681  34.747  1.00 7.13  ? 333  ARG D C   1 
ATOM   7159  O  O   . ARG D  2  221 ? 34.726  10.561  35.827  1.00 5.12  ? 333  ARG D O   1 
ATOM   7160  C  CB  . ARG D  2  221 ? 33.272  8.363   34.612  1.00 8.96  ? 333  ARG D CB  1 
ATOM   7161  C  CG  . ARG D  2  221 ? 32.078  7.428   34.435  1.00 6.24  ? 333  ARG D CG  1 
ATOM   7162  C  CD  . ARG D  2  221 ? 32.497  5.986   34.580  1.00 9.73  ? 333  ARG D CD  1 
ATOM   7163  N  NE  . ARG D  2  221 ? 31.408  5.067   34.262  1.00 10.22 ? 333  ARG D NE  1 
ATOM   7164  C  CZ  . ARG D  2  221 ? 31.124  3.946   34.935  1.00 9.87  ? 333  ARG D CZ  1 
ATOM   7165  N  NH1 . ARG D  2  221 ? 31.859  3.592   35.971  1.00 8.14  ? 333  ARG D NH1 1 
ATOM   7166  N  NH2 . ARG D  2  221 ? 30.102  3.171   34.559  1.00 9.04  ? 333  ARG D NH2 1 
ATOM   7167  N  N   . TYR D  2  222 ? 34.486  11.539  33.801  1.00 6.69  ? 334  TYR D N   1 
ATOM   7168  C  CA  . TYR D  2  222 ? 35.553  12.497  33.976  1.00 9.26  ? 334  TYR D CA  1 
ATOM   7169  C  C   . TYR D  2  222 ? 35.288  13.298  35.251  1.00 9.84  ? 334  TYR D C   1 
ATOM   7170  O  O   . TYR D  2  222 ? 36.223  13.759  35.949  1.00 8.92  ? 334  TYR D O   1 
ATOM   7171  C  CB  . TYR D  2  222 ? 35.596  13.432  32.748  1.00 10.82 ? 334  TYR D CB  1 
ATOM   7172  C  CG  . TYR D  2  222 ? 34.802  14.709  32.907  1.00 10.60 ? 334  TYR D CG  1 
ATOM   7173  C  CD1 . TYR D  2  222 ? 33.448  14.776  32.596  1.00 10.66 ? 334  TYR D CD1 1 
ATOM   7174  C  CD2 . TYR D  2  222 ? 35.405  15.839  33.461  1.00 10.98 ? 334  TYR D CD2 1 
ATOM   7175  C  CE1 . TYR D  2  222 ? 32.733  15.935  32.843  1.00 12.08 ? 334  TYR D CE1 1 
ATOM   7176  C  CE2 . TYR D  2  222 ? 34.700  17.001  33.711  1.00 11.33 ? 334  TYR D CE2 1 
ATOM   7177  C  CZ  . TYR D  2  222 ? 33.373  17.049  33.403  1.00 10.81 ? 334  TYR D CZ  1 
ATOM   7178  O  OH  . TYR D  2  222 ? 32.682  18.212  33.625  1.00 10.62 ? 334  TYR D OH  1 
ATOM   7179  N  N   . GLY D  2  223 ? 33.984  13.454  35.527  1.00 9.55  ? 335  GLY D N   1 
ATOM   7180  C  CA  . GLY D  2  223 ? 33.503  14.219  36.650  1.00 10.30 ? 335  GLY D CA  1 
ATOM   7181  C  C   . GLY D  2  223 ? 34.042  13.766  37.976  1.00 10.48 ? 335  GLY D C   1 
ATOM   7182  O  O   . GLY D  2  223 ? 34.121  14.581  38.898  1.00 9.28  ? 335  GLY D O   1 
ATOM   7183  N  N   . HIS D  2  224 ? 34.410  12.465  38.058  1.00 10.32 ? 336  HIS D N   1 
ATOM   7184  C  CA  . HIS D  2  224 ? 34.975  11.854  39.271  1.00 8.43  ? 336  HIS D CA  1 
ATOM   7185  C  C   . HIS D  2  224 ? 36.268  12.554  39.708  1.00 6.60  ? 336  HIS D C   1 
ATOM   7186  O  O   . HIS D  2  224 ? 36.617  12.512  40.874  1.00 6.97  ? 336  HIS D O   1 
ATOM   7187  C  CB  . HIS D  2  224 ? 35.231  10.345  39.059  1.00 10.31 ? 336  HIS D CB  1 
ATOM   7188  C  CG  . HIS D  2  224 ? 33.944  9.550   38.799  1.00 10.18 ? 336  HIS D CG  1 
ATOM   7189  N  ND1 . HIS D  2  224 ? 33.978  8.266   38.238  1.00 11.35 ? 336  HIS D ND1 1 
ATOM   7190  C  CD2 . HIS D  2  224 ? 32.661  9.943   39.098  1.00 8.83  ? 336  HIS D CD2 1 
ATOM   7191  C  CE1 . HIS D  2  224 ? 32.680  7.890   38.210  1.00 8.08  ? 336  HIS D CE1 1 
ATOM   7192  N  NE2 . HIS D  2  224 ? 31.943  8.826   38.689  1.00 10.53 ? 336  HIS D NE2 1 
ATOM   7193  N  N   . THR D  2  225 ? 36.918  13.253  38.783  1.00 7.57  ? 337  THR D N   1 
ATOM   7194  C  CA  . THR D  2  225 ? 38.147  13.999  39.080  1.00 9.89  ? 337  THR D CA  1 
ATOM   7195  C  C   . THR D  2  225 ? 37.890  15.347  39.782  1.00 9.56  ? 337  THR D C   1 
ATOM   7196  O  O   . THR D  2  225 ? 38.816  15.956  40.339  1.00 6.13  ? 337  THR D O   1 
ATOM   7197  C  CB  . THR D  2  225 ? 38.945  14.293  37.795  1.00 9.28  ? 337  THR D CB  1 
ATOM   7198  O  OG1 . THR D  2  225 ? 38.180  15.163  36.954  1.00 10.22 ? 337  THR D OG1 1 
ATOM   7199  C  CG2 . THR D  2  225 ? 39.319  13.001  37.063  1.00 9.91  ? 337  THR D CG2 1 
ATOM   7200  N  N   . LEU D  2  226 ? 36.642  15.813  39.752  1.00 9.38  ? 338  LEU D N   1 
ATOM   7201  C  CA  . LEU D  2  226 ? 36.289  17.114  40.321  1.00 8.86  ? 338  LEU D CA  1 
ATOM   7202  C  C   . LEU D  2  226 ? 35.796  16.993  41.747  1.00 7.23  ? 338  LEU D C   1 
ATOM   7203  O  O   . LEU D  2  226 ? 35.576  18.019  42.413  1.00 9.02  ? 338  LEU D O   1 
ATOM   7204  C  CB  . LEU D  2  226 ? 35.190  17.777  39.484  1.00 10.57 ? 338  LEU D CB  1 
ATOM   7205  C  CG  . LEU D  2  226 ? 35.360  17.773  37.956  1.00 13.17 ? 338  LEU D CG  1 
ATOM   7206  C  CD1 . LEU D  2  226 ? 33.982  17.853  37.278  1.00 12.59 ? 338  LEU D CD1 1 
ATOM   7207  C  CD2 . LEU D  2  226 ? 36.255  18.921  37.521  1.00 8.39  ? 338  LEU D CD2 1 
ATOM   7208  N  N   . ILE D  2  227 ? 35.624  15.753  42.207  1.00 5.82  ? 339  ILE D N   1 
ATOM   7209  C  CA  . ILE D  2  227 ? 35.081  15.447  43.545  1.00 7.88  ? 339  ILE D CA  1 
ATOM   7210  C  C   . ILE D  2  227 ? 36.027  15.815  44.715  1.00 9.53  ? 339  ILE D C   1 
ATOM   7211  O  O   . ILE D  2  227 ? 37.204  15.430  44.743  1.00 6.90  ? 339  ILE D O   1 
ATOM   7212  C  CB  . ILE D  2  227 ? 34.744  13.952  43.665  1.00 8.14  ? 339  ILE D CB  1 
ATOM   7213  C  CG1 . ILE D  2  227 ? 33.721  13.578  42.587  1.00 10.23 ? 339  ILE D CG1 1 
ATOM   7214  C  CG2 . ILE D  2  227 ? 34.226  13.625  45.071  1.00 4.88  ? 339  ILE D CG2 1 
ATOM   7215  C  CD1 . ILE D  2  227 ? 33.420  12.096  42.528  1.00 11.09 ? 339  ILE D CD1 1 
ATOM   7216  N  N   . GLN D  2  228 ? 35.481  16.562  45.667  1.00 10.53 ? 340  GLN D N   1 
ATOM   7217  C  CA  . GLN D  2  228 ? 36.191  16.932  46.897  1.00 12.61 ? 340  GLN D CA  1 
ATOM   7218  C  C   . GLN D  2  228 ? 35.969  15.844  47.954  1.00 12.70 ? 340  GLN D C   1 
ATOM   7219  O  O   . GLN D  2  228 ? 34.911  15.199  47.985  1.00 13.00 ? 340  GLN D O   1 
ATOM   7220  C  CB  . GLN D  2  228 ? 35.663  18.281  47.424  1.00 11.12 ? 340  GLN D CB  1 
ATOM   7221  C  CG  . GLN D  2  228 ? 36.131  19.492  46.640  1.00 11.49 ? 340  GLN D CG  1 
ATOM   7222  C  CD  . GLN D  2  228 ? 37.352  20.138  47.282  1.00 14.87 ? 340  GLN D CD  1 
ATOM   7223  O  OE1 . GLN D  2  228 ? 38.112  19.476  47.970  1.00 15.95 ? 340  GLN D OE1 1 
ATOM   7224  N  NE2 . GLN D  2  228 ? 37.535  21.435  47.074  1.00 12.72 ? 340  GLN D NE2 1 
ATOM   7225  N  N   . PRO D  2  229 ? 36.960  15.615  48.834  1.00 12.90 ? 341  PRO D N   1 
ATOM   7226  C  CA  . PRO D  2  229 ? 36.871  14.595  49.901  1.00 12.24 ? 341  PRO D CA  1 
ATOM   7227  C  C   . PRO D  2  229 ? 35.829  14.867  51.019  1.00 10.85 ? 341  PRO D C   1 
ATOM   7228  O  O   . PRO D  2  229 ? 35.635  14.014  51.889  1.00 7.47  ? 341  PRO D O   1 
ATOM   7229  C  CB  . PRO D  2  229 ? 38.312  14.529  50.431  1.00 12.77 ? 341  PRO D CB  1 
ATOM   7230  C  CG  . PRO D  2  229 ? 38.810  15.909  50.182  1.00 11.94 ? 341  PRO D CG  1 
ATOM   7231  C  CD  . PRO D  2  229 ? 38.284  16.261  48.823  1.00 10.69 ? 341  PRO D CD  1 
ATOM   7232  N  N   . PHE D  2  230 ? 35.165  16.045  50.981  1.00 12.16 ? 342  PHE D N   1 
ATOM   7233  C  CA  . PHE D  2  230 ? 34.109  16.419  51.953  1.00 13.63 ? 342  PHE D CA  1 
ATOM   7234  C  C   . PHE D  2  230 ? 32.833  16.931  51.307  1.00 12.78 ? 342  PHE D C   1 
ATOM   7235  O  O   . PHE D  2  230 ? 32.849  17.448  50.170  1.00 11.63 ? 342  PHE D O   1 
ATOM   7236  C  CB  . PHE D  2  230 ? 34.575  17.540  52.886  1.00 12.78 ? 342  PHE D CB  1 
ATOM   7237  C  CG  . PHE D  2  230 ? 35.703  17.135  53.742  1.00 14.45 ? 342  PHE D CG  1 
ATOM   7238  C  CD1 . PHE D  2  230 ? 35.483  16.299  54.827  1.00 17.49 ? 342  PHE D CD1 1 
ATOM   7239  C  CD2 . PHE D  2  230 ? 36.988  17.529  53.426  1.00 17.86 ? 342  PHE D CD2 1 
ATOM   7240  C  CE1 . PHE D  2  230 ? 36.535  15.846  55.588  1.00 18.80 ? 342  PHE D CE1 1 
ATOM   7241  C  CE2 . PHE D  2  230 ? 38.058  17.083  54.183  1.00 20.57 ? 342  PHE D CE2 1 
ATOM   7242  C  CZ  . PHE D  2  230 ? 37.833  16.238  55.263  1.00 19.91 ? 342  PHE D CZ  1 
ATOM   7243  N  N   . MET D  2  231 ? 31.727  16.758  52.060  1.00 15.99 ? 343  MET D N   1 
ATOM   7244  C  CA  . MET D  2  231 ? 30.455  17.462  51.799  1.00 15.95 ? 343  MET D CA  1 
ATOM   7245  C  C   . MET D  2  231 ? 30.474  18.707  52.690  1.00 16.03 ? 343  MET D C   1 
ATOM   7246  O  O   . MET D  2  231 ? 30.560  18.591  53.927  1.00 15.25 ? 343  MET D O   1 
ATOM   7247  C  CB  . MET D  2  231 ? 29.238  16.629  52.162  1.00 15.03 ? 343  MET D CB  1 
ATOM   7248  C  CG  . MET D  2  231 ? 27.952  17.439  52.063  1.00 16.96 ? 343  MET D CG  1 
ATOM   7249  S  SD  . MET D  2  231 ? 26.486  16.471  52.417  1.00 19.49 ? 343  MET D SD  1 
ATOM   7250  C  CE  . MET D  2  231 ? 26.514  16.454  54.206  1.00 13.89 ? 343  MET D CE  1 
ATOM   7251  N  N   . PHE D  2  232 ? 30.440  19.879  52.065  1.00 15.32 ? 344  PHE D N   1 
ATOM   7252  C  CA  . PHE D  2  232 ? 30.591  21.140  52.782  1.00 16.65 ? 344  PHE D CA  1 
ATOM   7253  C  C   . PHE D  2  232 ? 29.261  21.814  53.040  1.00 16.33 ? 344  PHE D C   1 
ATOM   7254  O  O   . PHE D  2  232 ? 28.511  22.069  52.119  1.00 15.43 ? 344  PHE D O   1 
ATOM   7255  C  CB  . PHE D  2  232 ? 31.490  22.085  51.996  1.00 15.73 ? 344  PHE D CB  1 
ATOM   7256  C  CG  . PHE D  2  232 ? 32.874  21.569  51.727  1.00 17.32 ? 344  PHE D CG  1 
ATOM   7257  C  CD1 . PHE D  2  232 ? 33.090  20.586  50.755  1.00 17.55 ? 344  PHE D CD1 1 
ATOM   7258  C  CD2 . PHE D  2  232 ? 33.980  22.154  52.346  1.00 19.80 ? 344  PHE D CD2 1 
ATOM   7259  C  CE1 . PHE D  2  232 ? 34.379  20.206  50.391  1.00 19.99 ? 344  PHE D CE1 1 
ATOM   7260  C  CE2 . PHE D  2  232 ? 35.282  21.781  51.986  1.00 19.50 ? 344  PHE D CE2 1 
ATOM   7261  C  CZ  . PHE D  2  232 ? 35.481  20.808  51.004  1.00 19.76 ? 344  PHE D CZ  1 
ATOM   7262  N  N   . ARG D  2  233 ? 28.973  22.112  54.285  1.00 17.13 ? 345  ARG D N   1 
ATOM   7263  C  CA  . ARG D  2  233 ? 27.692  22.763  54.578  1.00 19.92 ? 345  ARG D CA  1 
ATOM   7264  C  C   . ARG D  2  233 ? 27.876  24.121  55.261  1.00 20.51 ? 345  ARG D C   1 
ATOM   7265  O  O   . ARG D  2  233 ? 28.617  24.249  56.246  1.00 21.75 ? 345  ARG D O   1 
ATOM   7266  C  CB  . ARG D  2  233 ? 26.783  21.806  55.387  1.00 19.79 ? 345  ARG D CB  1 
ATOM   7267  C  CG  . ARG D  2  233 ? 26.342  20.568  54.572  1.00 18.13 ? 345  ARG D CG  1 
ATOM   7268  C  CD  . ARG D  2  233 ? 25.639  19.506  55.411  1.00 20.10 ? 345  ARG D CD  1 
ATOM   7269  N  NE  . ARG D  2  233 ? 26.474  18.990  56.496  1.00 20.21 ? 345  ARG D NE  1 
ATOM   7270  C  CZ  . ARG D  2  233 ? 26.017  18.328  57.555  1.00 20.69 ? 345  ARG D CZ  1 
ATOM   7271  N  NH1 . ARG D  2  233 ? 24.724  18.078  57.683  1.00 23.93 ? 345  ARG D NH1 1 
ATOM   7272  N  NH2 . ARG D  2  233 ? 26.857  17.914  58.499  1.00 24.17 ? 345  ARG D NH2 1 
ATOM   7273  N  N   . LEU D  2  234 ? 27.213  25.132  54.696  1.00 20.75 ? 346  LEU D N   1 
ATOM   7274  C  CA  . LEU D  2  234 ? 27.279  26.507  55.183  1.00 20.94 ? 346  LEU D CA  1 
ATOM   7275  C  C   . LEU D  2  234 ? 25.906  27.053  55.628  1.00 22.38 ? 346  LEU D C   1 
ATOM   7276  O  O   . LEU D  2  234 ? 24.877  26.799  54.987  1.00 21.34 ? 346  LEU D O   1 
ATOM   7277  C  CB  . LEU D  2  234 ? 27.850  27.402  54.089  1.00 18.16 ? 346  LEU D CB  1 
ATOM   7278  C  CG  . LEU D  2  234 ? 29.224  27.015  53.563  1.00 17.80 ? 346  LEU D CG  1 
ATOM   7279  C  CD1 . LEU D  2  234 ? 29.501  27.756  52.268  1.00 16.76 ? 346  LEU D CD1 1 
ATOM   7280  C  CD2 . LEU D  2  234 ? 30.294  27.302  54.615  1.00 17.14 ? 346  LEU D CD2 1 
ATOM   7281  N  N   . ASP D  2  235 ? 25.916  27.835  56.722  1.00 23.20 ? 347  ASP D N   1 
ATOM   7282  C  CA  . ASP D  2  235 ? 24.707  28.498  57.242  1.00 24.09 ? 347  ASP D CA  1 
ATOM   7283  C  C   . ASP D  2  235 ? 24.331  29.756  56.417  1.00 24.75 ? 347  ASP D C   1 
ATOM   7284  O  O   . ASP D  2  235 ? 24.950  30.050  55.376  1.00 23.97 ? 347  ASP D O   1 
ATOM   7285  C  CB  . ASP D  2  235 ? 24.914  28.878  58.723  1.00 23.50 ? 347  ASP D CB  1 
ATOM   7286  C  CG  . ASP D  2  235 ? 26.075  29.838  58.962  1.00 20.44 ? 347  ASP D CG  1 
ATOM   7287  O  OD1 . ASP D  2  235 ? 26.701  30.299  57.996  1.00 20.46 ? 347  ASP D OD1 1 
ATOM   7288  O  OD2 . ASP D  2  235 ? 26.360  30.130  60.133  1.00 25.23 ? 347  ASP D OD2 1 
ATOM   7289  N  N   . ASN D  2  236 ? 23.334  30.515  56.903  1.00 26.73 ? 348  ASN D N   1 
ATOM   7290  C  CA  . ASN D  2  236 ? 22.833  31.698  56.187  1.00 28.69 ? 348  ASN D CA  1 
ATOM   7291  C  C   . ASN D  2  236 ? 23.876  32.789  55.939  1.00 29.27 ? 348  ASN D C   1 
ATOM   7292  O  O   . ASN D  2  236 ? 23.752  33.533  54.968  1.00 31.53 ? 348  ASN D O   1 
ATOM   7293  C  CB  . ASN D  2  236 ? 21.610  32.279  56.896  1.00 30.12 ? 348  ASN D CB  1 
ATOM   7294  C  CG  . ASN D  2  236 ? 21.765  32.300  58.398  1.00 32.28 ? 348  ASN D CG  1 
ATOM   7295  O  OD1 . ASN D  2  236 ? 22.878  32.441  58.921  1.00 34.78 ? 348  ASN D OD1 1 
ATOM   7296  N  ND2 . ASN D  2  236 ? 20.651  32.151  59.104  1.00 31.61 ? 348  ASN D ND2 1 
ATOM   7297  N  N   . ARG D  2  237 ? 24.900  32.912  56.783  1.00 29.56 ? 349  ARG D N   1 
ATOM   7298  C  CA  . ARG D  2  237 ? 25.942  33.886  56.460  1.00 29.42 ? 349  ARG D CA  1 
ATOM   7299  C  C   . ARG D  2  237 ? 27.127  33.221  55.777  1.00 28.06 ? 349  ARG D C   1 
ATOM   7300  O  O   . ARG D  2  237 ? 28.216  33.797  55.680  1.00 26.92 ? 349  ARG D O   1 
ATOM   7301  C  CB  . ARG D  2  237 ? 26.384  34.710  57.683  1.00 33.64 ? 349  ARG D CB  1 
ATOM   7302  C  CG  . ARG D  2  237 ? 27.056  33.958  58.818  1.00 37.87 ? 349  ARG D CG  1 
ATOM   7303  C  CD  . ARG D  2  237 ? 27.238  34.874  60.026  1.00 42.92 ? 349  ARG D CD  1 
ATOM   7304  N  NE  . ARG D  2  237 ? 28.611  34.875  60.537  1.00 46.40 ? 349  ARG D NE  1 
ATOM   7305  C  CZ  . ARG D  2  237 ? 28.942  34.701  61.817  1.00 48.13 ? 349  ARG D CZ  1 
ATOM   7306  N  NH1 . ARG D  2  237 ? 28.011  34.489  62.728  1.00 50.54 ? 349  ARG D NH1 1 
ATOM   7307  N  NH2 . ARG D  2  237 ? 30.207  34.729  62.187  1.00 50.59 ? 349  ARG D NH2 1 
ATOM   7308  N  N   . TYR D  2  238 ? 26.884  32.008  55.270  1.00 26.38 ? 350  TYR D N   1 
ATOM   7309  C  CA  . TYR D  2  238 ? 27.861  31.243  54.517  1.00 24.81 ? 350  TYR D CA  1 
ATOM   7310  C  C   . TYR D  2  238 ? 29.121  30.886  55.326  1.00 26.21 ? 350  TYR D C   1 
ATOM   7311  O  O   . TYR D  2  238 ? 30.246  30.873  54.800  1.00 27.24 ? 350  TYR D O   1 
ATOM   7312  C  CB  . TYR D  2  238 ? 28.229  32.004  53.239  1.00 23.68 ? 350  TYR D CB  1 
ATOM   7313  C  CG  . TYR D  2  238 ? 27.265  31.791  52.078  1.00 21.82 ? 350  TYR D CG  1 
ATOM   7314  C  CD1 . TYR D  2  238 ? 26.035  32.444  52.024  1.00 19.98 ? 350  TYR D CD1 1 
ATOM   7315  C  CD2 . TYR D  2  238 ? 27.604  30.932  51.025  1.00 20.47 ? 350  TYR D CD2 1 
ATOM   7316  C  CE1 . TYR D  2  238 ? 25.176  32.244  50.957  1.00 17.60 ? 350  TYR D CE1 1 
ATOM   7317  C  CE2 . TYR D  2  238 ? 26.752  30.727  49.957  1.00 19.46 ? 350  TYR D CE2 1 
ATOM   7318  C  CZ  . TYR D  2  238 ? 25.539  31.382  49.923  1.00 19.74 ? 350  TYR D CZ  1 
ATOM   7319  O  OH  . TYR D  2  238 ? 24.680  31.160  48.865  1.00 18.66 ? 350  TYR D OH  1 
ATOM   7320  N  N   . GLN D  2  239 ? 28.932  30.585  56.606  1.00 25.36 ? 351  GLN D N   1 
ATOM   7321  C  CA  . GLN D  2  239 ? 30.038  30.167  57.470  1.00 26.59 ? 351  GLN D CA  1 
ATOM   7322  C  C   . GLN D  2  239 ? 29.865  28.711  57.811  1.00 26.35 ? 351  GLN D C   1 
ATOM   7323  O  O   . GLN D  2  239 ? 28.766  28.178  57.664  1.00 26.34 ? 351  GLN D O   1 
ATOM   7324  C  CB  . GLN D  2  239 ? 30.065  30.961  58.787  1.00 27.16 ? 351  GLN D CB  1 
ATOM   7325  C  CG  . GLN D  2  239 ? 30.162  32.469  58.636  1.00 33.63 ? 351  GLN D CG  1 
ATOM   7326  C  CD  . GLN D  2  239 ? 31.341  32.909  57.798  1.00 36.79 ? 351  GLN D CD  1 
ATOM   7327  O  OE1 . GLN D  2  239 ? 32.479  32.508  58.059  1.00 41.82 ? 351  GLN D OE1 1 
ATOM   7328  N  NE2 . GLN D  2  239 ? 31.077  33.736  56.781  1.00 37.72 ? 351  GLN D NE2 1 
ATOM   7329  N  N   . PRO D  2  240 ? 30.941  28.042  58.273  1.00 25.95 ? 352  PRO D N   1 
ATOM   7330  C  CA  . PRO D  2  240 ? 30.889  26.631  58.647  1.00 27.08 ? 352  PRO D CA  1 
ATOM   7331  C  C   . PRO D  2  240 ? 29.732  26.359  59.606  1.00 28.64 ? 352  PRO D C   1 
ATOM   7332  O  O   . PRO D  2  240 ? 29.618  26.986  60.671  1.00 28.04 ? 352  PRO D O   1 
ATOM   7333  C  CB  . PRO D  2  240 ? 32.258  26.394  59.288  1.00 25.81 ? 352  PRO D CB  1 
ATOM   7334  C  CG  . PRO D  2  240 ? 33.120  27.301  58.483  1.00 24.72 ? 352  PRO D CG  1 
ATOM   7335  C  CD  . PRO D  2  240 ? 32.318  28.571  58.424  1.00 25.36 ? 352  PRO D CD  1 
ATOM   7336  N  N   . MET D  2  241 ? 28.858  25.449  59.170  1.00 29.04 ? 353  MET D N   1 
ATOM   7337  C  CA  . MET D  2  241 ? 27.677  25.042  59.915  1.00 30.63 ? 353  MET D CA  1 
ATOM   7338  C  C   . MET D  2  241 ? 28.060  23.991  60.950  1.00 30.26 ? 353  MET D C   1 
ATOM   7339  O  O   . MET D  2  241 ? 28.097  22.803  60.645  1.00 28.83 ? 353  MET D O   1 
ATOM   7340  C  CB  . MET D  2  241 ? 26.634  24.484  58.925  1.00 33.44 ? 353  MET D CB  1 
ATOM   7341  C  CG  . MET D  2  241 ? 25.314  24.023  59.532  1.00 36.47 ? 353  MET D CG  1 
ATOM   7342  S  SD  . MET D  2  241 ? 24.699  22.495  58.767  1.00 40.23 ? 353  MET D SD  1 
ATOM   7343  C  CE  . MET D  2  241 ? 24.947  21.327  60.113  1.00 36.40 ? 353  MET D CE  1 
ATOM   7344  N  N   . GLU D  2  242 ? 28.367  24.442  62.175  1.00 30.94 ? 354  GLU D N   1 
ATOM   7345  C  CA  . GLU D  2  242 ? 28.748  23.532  63.264  1.00 31.57 ? 354  GLU D CA  1 
ATOM   7346  C  C   . GLU D  2  242 ? 27.556  22.649  63.694  1.00 32.07 ? 354  GLU D C   1 
ATOM   7347  O  O   . GLU D  2  242 ? 26.389  23.017  63.455  1.00 35.38 ? 354  GLU D O   1 
ATOM   7348  C  CB  . GLU D  2  242 ? 29.300  24.322  64.460  1.00 29.49 ? 354  GLU D CB  1 
ATOM   7349  C  CG  . GLU D  2  242 ? 30.546  25.132  64.150  1.00 28.84 ? 354  GLU D CG  1 
ATOM   7350  C  CD  . GLU D  2  242 ? 31.715  24.306  63.620  1.00 29.81 ? 354  GLU D CD  1 
ATOM   7351  O  OE1 . GLU D  2  242 ? 31.817  23.107  63.959  1.00 29.11 ? 354  GLU D OE1 1 
ATOM   7352  O  OE2 . GLU D  2  242 ? 32.543  24.868  62.862  1.00 30.91 ? 354  GLU D OE2 1 
ATOM   7353  N  N   . PRO D  2  243 ? 27.813  21.486  64.355  1.00 29.46 ? 355  PRO D N   1 
ATOM   7354  C  CA  . PRO D  2  243 ? 29.150  21.008  64.706  1.00 29.11 ? 355  PRO D CA  1 
ATOM   7355  C  C   . PRO D  2  243 ? 29.941  20.319  63.590  1.00 29.60 ? 355  PRO D C   1 
ATOM   7356  O  O   . PRO D  2  243 ? 31.143  20.064  63.755  1.00 32.48 ? 355  PRO D O   1 
ATOM   7357  C  CB  . PRO D  2  243 ? 28.856  20.059  65.845  1.00 27.98 ? 355  PRO D CB  1 
ATOM   7358  C  CG  . PRO D  2  243 ? 27.612  19.413  65.369  1.00 27.03 ? 355  PRO D CG  1 
ATOM   7359  C  CD  . PRO D  2  243 ? 26.786  20.549  64.842  1.00 27.94 ? 355  PRO D CD  1 
ATOM   7360  N  N   . ASN D  2  244 ? 29.329  20.024  62.449  1.00 28.24 ? 356  ASN D N   1 
ATOM   7361  C  CA  . ASN D  2  244 ? 30.072  19.275  61.436  1.00 26.00 ? 356  ASN D CA  1 
ATOM   7362  C  C   . ASN D  2  244 ? 29.962  19.874  60.039  1.00 24.21 ? 356  ASN D C   1 
ATOM   7363  O  O   . ASN D  2  244 ? 29.122  19.458  59.226  1.00 21.87 ? 356  ASN D O   1 
ATOM   7364  C  CB  . ASN D  2  244 ? 29.615  17.806  61.438  1.00 29.29 ? 356  ASN D CB  1 
ATOM   7365  C  CG  . ASN D  2  244 ? 29.718  17.127  62.808  1.00 31.07 ? 356  ASN D CG  1 
ATOM   7366  O  OD1 . ASN D  2  244 ? 30.786  17.090  63.431  1.00 32.53 ? 356  ASN D OD1 1 
ATOM   7367  N  ND2 . ASN D  2  244 ? 28.600  16.584  63.283  1.00 32.25 ? 356  ASN D ND2 1 
ATOM   7368  N  N   . PRO D  2  245 ? 30.839  20.870  59.738  1.00 23.31 ? 357  PRO D N   1 
ATOM   7369  C  CA  . PRO D  2  245 ? 30.878  21.572  58.431  1.00 23.97 ? 357  PRO D CA  1 
ATOM   7370  C  C   . PRO D  2  245 ? 31.549  20.791  57.284  1.00 22.78 ? 357  PRO D C   1 
ATOM   7371  O  O   . PRO D  2  245 ? 31.226  20.994  56.103  1.00 21.78 ? 357  PRO D O   1 
ATOM   7372  C  CB  . PRO D  2  245 ? 31.624  22.869  58.763  1.00 22.34 ? 357  PRO D CB  1 
ATOM   7373  C  CG  . PRO D  2  245 ? 32.588  22.415  59.803  1.00 23.02 ? 357  PRO D CG  1 
ATOM   7374  C  CD  . PRO D  2  245 ? 31.798  21.475  60.680  1.00 21.52 ? 357  PRO D CD  1 
ATOM   7375  N  N   . ARG D  2  246 ? 32.463  19.913  57.637  1.00 21.15 ? 358  ARG D N   1 
ATOM   7376  C  CA  . ARG D  2  246 ? 33.178  19.169  56.654  1.00 21.08 ? 358  ARG D CA  1 
ATOM   7377  C  C   . ARG D  2  246 ? 33.080  17.689  56.930  1.00 20.52 ? 358  ARG D C   1 
ATOM   7378  O  O   . ARG D  2  246 ? 33.900  17.131  57.662  1.00 22.97 ? 358  ARG D O   1 
ATOM   7379  C  CB  . ARG D  2  246 ? 34.631  19.640  56.647  1.00 24.78 ? 358  ARG D CB  1 
ATOM   7380  C  CG  . ARG D  2  246 ? 34.858  20.917  55.841  1.00 28.53 ? 358  ARG D CG  1 
ATOM   7381  C  CD  . ARG D  2  246 ? 36.021  21.718  56.388  1.00 30.47 ? 358  ARG D CD  1 
ATOM   7382  N  NE  . ARG D  2  246 ? 37.145  20.861  56.718  1.00 35.68 ? 358  ARG D NE  1 
ATOM   7383  C  CZ  . ARG D  2  246 ? 38.109  20.509  55.865  1.00 39.22 ? 358  ARG D CZ  1 
ATOM   7384  N  NH1 . ARG D  2  246 ? 38.095  20.966  54.613  1.00 40.44 ? 358  ARG D NH1 1 
ATOM   7385  N  NH2 . ARG D  2  246 ? 39.093  19.702  56.271  1.00 37.84 ? 358  ARG D NH2 1 
ATOM   7386  N  N   . VAL D  2  247 ? 32.080  17.041  56.329  1.00 18.78 ? 359  VAL D N   1 
ATOM   7387  C  CA  . VAL D  2  247 ? 31.889  15.608  56.527  1.00 18.61 ? 359  VAL D CA  1 
ATOM   7388  C  C   . VAL D  2  247 ? 32.547  14.762  55.436  1.00 15.76 ? 359  VAL D C   1 
ATOM   7389  O  O   . VAL D  2  247 ? 32.358  15.012  54.255  1.00 12.96 ? 359  VAL D O   1 
ATOM   7390  C  CB  . VAL D  2  247 ? 30.392  15.227  56.613  1.00 18.74 ? 359  VAL D CB  1 
ATOM   7391  C  CG1 . VAL D  2  247 ? 30.264  13.732  56.945  1.00 16.71 ? 359  VAL D CG1 1 
ATOM   7392  C  CG2 . VAL D  2  247 ? 29.702  16.068  57.671  1.00 17.35 ? 359  VAL D CG2 1 
ATOM   7393  N  N   . PRO D  2  248 ? 33.367  13.772  55.855  1.00 16.82 ? 360  PRO D N   1 
ATOM   7394  C  CA  . PRO D  2  248 ? 34.069  12.829  54.940  1.00 17.36 ? 360  PRO D CA  1 
ATOM   7395  C  C   . PRO D  2  248 ? 33.058  12.194  53.999  1.00 15.40 ? 360  PRO D C   1 
ATOM   7396  O  O   . PRO D  2  248 ? 31.995  11.786  54.433  1.00 14.17 ? 360  PRO D O   1 
ATOM   7397  C  CB  . PRO D  2  248 ? 34.679  11.806  55.903  1.00 16.39 ? 360  PRO D CB  1 
ATOM   7398  C  CG  . PRO D  2  248 ? 35.003  12.668  57.083  1.00 17.72 ? 360  PRO D CG  1 
ATOM   7399  C  CD  . PRO D  2  248 ? 33.759  13.510  57.262  1.00 17.98 ? 360  PRO D CD  1 
ATOM   7400  N  N   . LEU D  2  249 ? 33.392  12.131  52.724  1.00 15.02 ? 361  LEU D N   1 
ATOM   7401  C  CA  . LEU D  2  249 ? 32.450  11.647  51.735  1.00 14.41 ? 361  LEU D CA  1 
ATOM   7402  C  C   . LEU D  2  249 ? 32.091  10.198  51.984  1.00 15.02 ? 361  LEU D C   1 
ATOM   7403  O  O   . LEU D  2  249 ? 30.960  9.787   51.718  1.00 13.28 ? 361  LEU D O   1 
ATOM   7404  C  CB  . LEU D  2  249 ? 33.021  11.841  50.332  1.00 13.77 ? 361  LEU D CB  1 
ATOM   7405  C  CG  . LEU D  2  249 ? 32.071  12.438  49.303  1.00 12.21 ? 361  LEU D CG  1 
ATOM   7406  C  CD1 . LEU D  2  249 ? 31.515  13.767  49.797  1.00 11.24 ? 361  LEU D CD1 1 
ATOM   7407  C  CD2 . LEU D  2  249 ? 32.800  12.623  47.996  1.00 10.30 ? 361  LEU D CD2 1 
ATOM   7408  N  N   . SER D  2  250 ? 33.041  9.437   52.545  1.00 14.49 ? 362  SER D N   1 
ATOM   7409  C  CA  . SER D  2  250 ? 32.814  8.023   52.864  1.00 16.11 ? 362  SER D CA  1 
ATOM   7410  C  C   . SER D  2  250 ? 31.727  7.857   53.921  1.00 15.44 ? 362  SER D C   1 
ATOM   7411  O  O   . SER D  2  250 ? 31.336  6.750   54.241  1.00 17.45 ? 362  SER D O   1 
ATOM   7412  C  CB  . SER D  2  250 ? 34.104  7.357   53.357  1.00 15.83 ? 362  SER D CB  1 
ATOM   7413  O  OG  . SER D  2  250 ? 34.497  7.882   54.608  1.00 18.65 ? 362  SER D OG  1 
ATOM   7414  N  N   . ARG D  2  251 ? 31.258  8.964   54.478  1.00 15.31 ? 363  ARG D N   1 
ATOM   7415  C  CA  . ARG D  2  251 ? 30.153  8.926   55.426  1.00 16.34 ? 363  ARG D CA  1 
ATOM   7416  C  C   . ARG D  2  251 ? 28.973  9.790   54.963  1.00 16.11 ? 363  ARG D C   1 
ATOM   7417  O  O   . ARG D  2  251 ? 28.184  10.240  55.785  1.00 18.11 ? 363  ARG D O   1 
ATOM   7418  C  CB  . ARG D  2  251 ? 30.635  9.364   56.811  1.00 18.01 ? 363  ARG D CB  1 
ATOM   7419  C  CG  . ARG D  2  251 ? 31.084  8.205   57.695  1.00 22.55 ? 363  ARG D CG  1 
ATOM   7420  C  CD  . ARG D  2  251 ? 32.243  8.570   58.612  1.00 26.04 ? 363  ARG D CD  1 
ATOM   7421  N  NE  . ARG D  2  251 ? 32.007  9.789   59.394  1.00 25.08 ? 363  ARG D NE  1 
ATOM   7422  C  CZ  . ARG D  2  251 ? 32.961  10.677  59.656  1.00 26.61 ? 363  ARG D CZ  1 
ATOM   7423  N  NH1 . ARG D  2  251 ? 34.202  10.466  59.219  1.00 27.65 ? 363  ARG D NH1 1 
ATOM   7424  N  NH2 . ARG D  2  251 ? 32.682  11.765  60.354  1.00 26.99 ? 363  ARG D NH2 1 
ATOM   7425  N  N   . VAL D  2  252 ? 28.857  10.054  53.645  1.00 14.19 ? 364  VAL D N   1 
ATOM   7426  C  CA  . VAL D  2  252 ? 27.697  10.794  53.154  1.00 13.99 ? 364  VAL D CA  1 
ATOM   7427  C  C   . VAL D  2  252 ? 26.945  10.007  52.081  1.00 15.77 ? 364  VAL D C   1 
ATOM   7428  O  O   . VAL D  2  252 ? 25.746  10.236  51.852  1.00 15.80 ? 364  VAL D O   1 
ATOM   7429  C  CB  . VAL D  2  252 ? 28.042  12.202  52.595  1.00 13.78 ? 364  VAL D CB  1 
ATOM   7430  C  CG1 . VAL D  2  252 ? 28.867  12.981  53.593  1.00 11.74 ? 364  VAL D CG1 1 
ATOM   7431  C  CG2 . VAL D  2  252 ? 28.734  12.113  51.240  1.00 11.34 ? 364  VAL D CG2 1 
ATOM   7432  N  N   . PHE D  2  253 ? 27.647  9.075   51.430  1.00 15.56 ? 365  PHE D N   1 
ATOM   7433  C  CA  . PHE D  2  253 ? 27.053  8.257   50.365  1.00 16.61 ? 365  PHE D CA  1 
ATOM   7434  C  C   . PHE D  2  253 ? 25.786  7.543   50.860  1.00 16.51 ? 365  PHE D C   1 
ATOM   7435  O  O   . PHE D  2  253 ? 25.815  6.822   51.854  1.00 17.90 ? 365  PHE D O   1 
ATOM   7436  C  CB  . PHE D  2  253 ? 28.076  7.231   49.865  1.00 17.21 ? 365  PHE D CB  1 
ATOM   7437  C  CG  . PHE D  2  253 ? 29.427  7.794   49.426  1.00 16.74 ? 365  PHE D CG  1 
ATOM   7438  C  CD1 . PHE D  2  253 ? 30.629  7.193   49.852  1.00 16.98 ? 365  PHE D CD1 1 
ATOM   7439  C  CD2 . PHE D  2  253 ? 29.506  8.846   48.514  1.00 16.01 ? 365  PHE D CD2 1 
ATOM   7440  C  CE1 . PHE D  2  253 ? 31.858  7.626   49.370  1.00 14.32 ? 365  PHE D CE1 1 
ATOM   7441  C  CE2 . PHE D  2  253 ? 30.742  9.278   48.032  1.00 13.57 ? 365  PHE D CE2 1 
ATOM   7442  C  CZ  . PHE D  2  253 ? 31.913  8.667   48.458  1.00 14.40 ? 365  PHE D CZ  1 
ATOM   7443  N  N   . PHE D  2  254 ? 24.668  7.776   50.181  1.00 16.93 ? 366  PHE D N   1 
ATOM   7444  C  CA  . PHE D  2  254 ? 23.364  7.212   50.552  1.00 15.76 ? 366  PHE D CA  1 
ATOM   7445  C  C   . PHE D  2  254 ? 22.899  7.677   51.951  1.00 16.29 ? 366  PHE D C   1 
ATOM   7446  O  O   . PHE D  2  254 ? 21.936  7.130   52.496  1.00 17.52 ? 366  PHE D O   1 
ATOM   7447  C  CB  . PHE D  2  254 ? 23.384  5.659   50.485  1.00 14.19 ? 366  PHE D CB  1 
ATOM   7448  C  CG  . PHE D  2  254 ? 23.834  5.111   49.156  1.00 15.43 ? 366  PHE D CG  1 
ATOM   7449  C  CD1 . PHE D  2  254 ? 23.006  5.184   48.031  1.00 15.97 ? 366  PHE D CD1 1 
ATOM   7450  C  CD2 . PHE D  2  254 ? 25.114  4.576   49.004  1.00 16.36 ? 366  PHE D CD2 1 
ATOM   7451  C  CE1 . PHE D  2  254 ? 23.444  4.739   46.780  1.00 13.99 ? 366  PHE D CE1 1 
ATOM   7452  C  CE2 . PHE D  2  254 ? 25.551  4.133   47.752  1.00 16.67 ? 366  PHE D CE2 1 
ATOM   7453  C  CZ  . PHE D  2  254 ? 24.717  4.216   46.645  1.00 13.78 ? 366  PHE D CZ  1 
ATOM   7454  N  N   . ALA D  2  255 ? 23.548  8.697   52.541  1.00 13.69 ? 367  ALA D N   1 
ATOM   7455  C  CA  . ALA D  2  255 ? 23.146  9.154   53.883  1.00 14.57 ? 367  ALA D CA  1 
ATOM   7456  C  C   . ALA D  2  255 ? 21.921  10.093  53.836  1.00 15.60 ? 367  ALA D C   1 
ATOM   7457  O  O   . ALA D  2  255 ? 21.997  11.273  54.217  1.00 16.72 ? 367  ALA D O   1 
ATOM   7458  C  CB  . ALA D  2  255 ? 24.320  9.843   54.575  1.00 14.94 ? 367  ALA D CB  1 
ATOM   7459  N  N   . SER D  2  256 ? 20.789  9.565   53.369  1.00 13.07 ? 368  SER D N   1 
ATOM   7460  C  CA  . SER D  2  256 ? 19.575  10.354  53.248  1.00 14.78 ? 368  SER D CA  1 
ATOM   7461  C  C   . SER D  2  256 ? 19.185  11.005  54.562  1.00 13.47 ? 368  SER D C   1 
ATOM   7462  O  O   . SER D  2  256 ? 18.679  12.098  54.546  1.00 13.32 ? 368  SER D O   1 
ATOM   7463  C  CB  . SER D  2  256 ? 18.428  9.475   52.731  1.00 15.07 ? 368  SER D CB  1 
ATOM   7464  O  OG  . SER D  2  256 ? 18.327  8.293   53.493  1.00 17.85 ? 368  SER D OG  1 
ATOM   7465  N  N   . TRP D  2  257 ? 19.455  10.332  55.684  1.00 14.78 ? 369  TRP D N   1 
ATOM   7466  C  CA  . TRP D  2  257 ? 19.153  10.859  57.025  1.00 16.55 ? 369  TRP D CA  1 
ATOM   7467  C  C   . TRP D  2  257 ? 19.773  12.229  57.249  1.00 17.33 ? 369  TRP D C   1 
ATOM   7468  O  O   . TRP D  2  257 ? 19.280  13.016  58.055  1.00 18.78 ? 369  TRP D O   1 
ATOM   7469  C  CB  . TRP D  2  257 ? 19.649  9.900   58.135  1.00 19.21 ? 369  TRP D CB  1 
ATOM   7470  C  CG  . TRP D  2  257 ? 21.151  9.885   58.346  1.00 21.62 ? 369  TRP D CG  1 
ATOM   7471  C  CD1 . TRP D  2  257 ? 22.071  9.195   57.600  1.00 21.31 ? 369  TRP D CD1 1 
ATOM   7472  C  CD2 . TRP D  2  257 ? 21.906  10.620  59.340  1.00 22.07 ? 369  TRP D CD2 1 
ATOM   7473  N  NE1 . TRP D  2  257 ? 23.350  9.446   58.048  1.00 22.05 ? 369  TRP D NE1 1 
ATOM   7474  C  CE2 . TRP D  2  257 ? 23.289  10.318  59.119  1.00 24.60 ? 369  TRP D CE2 1 
ATOM   7475  C  CE3 . TRP D  2  257 ? 21.566  11.504  60.400  1.00 20.87 ? 369  TRP D CE3 1 
ATOM   7476  C  CZ2 . TRP D  2  257 ? 24.325  10.866  59.922  1.00 21.79 ? 369  TRP D CZ2 1 
ATOM   7477  C  CZ3 . TRP D  2  257 ? 22.586  12.040  61.190  1.00 20.29 ? 369  TRP D CZ3 1 
ATOM   7478  C  CH2 . TRP D  2  257 ? 23.949  11.721  60.949  1.00 23.06 ? 369  TRP D CH2 1 
ATOM   7479  N  N   . ARG D  2  258 ? 20.851  12.531  56.532  1.00 15.62 ? 370  ARG D N   1 
ATOM   7480  C  CA  . ARG D  2  258 ? 21.487  13.802  56.749  1.00 15.65 ? 370  ARG D CA  1 
ATOM   7481  C  C   . ARG D  2  258 ? 20.710  14.955  56.160  1.00 15.36 ? 370  ARG D C   1 
ATOM   7482  O  O   . ARG D  2  258 ? 20.806  16.063  56.671  1.00 16.47 ? 370  ARG D O   1 
ATOM   7483  C  CB  . ARG D  2  258 ? 22.888  13.803  56.202  1.00 16.26 ? 370  ARG D CB  1 
ATOM   7484  C  CG  . ARG D  2  258 ? 23.851  12.889  56.931  1.00 18.25 ? 370  ARG D CG  1 
ATOM   7485  C  CD  . ARG D  2  258 ? 25.218  12.973  56.253  1.00 19.61 ? 370  ARG D CD  1 
ATOM   7486  N  NE  . ARG D  2  258 ? 26.229  12.125  56.873  1.00 20.29 ? 370  ARG D NE  1 
ATOM   7487  C  CZ  . ARG D  2  258 ? 26.986  12.499  57.894  1.00 19.44 ? 370  ARG D CZ  1 
ATOM   7488  N  NH1 . ARG D  2  258 ? 26.835  13.707  58.448  1.00 14.72 ? 370  ARG D NH1 1 
ATOM   7489  N  NH2 . ARG D  2  258 ? 27.880  11.661  58.365  1.00 16.25 ? 370  ARG D NH2 1 
ATOM   7490  N  N   . VAL D  2  259 ? 19.958  14.715  55.093  1.00 14.25 ? 371  VAL D N   1 
ATOM   7491  C  CA  . VAL D  2  259 ? 19.162  15.764  54.487  1.00 14.80 ? 371  VAL D CA  1 
ATOM   7492  C  C   . VAL D  2  259 ? 17.947  16.090  55.372  1.00 16.73 ? 371  VAL D C   1 
ATOM   7493  O  O   . VAL D  2  259 ? 17.634  17.265  55.628  1.00 16.40 ? 371  VAL D O   1 
ATOM   7494  C  CB  . VAL D  2  259 ? 18.666  15.346  53.085  1.00 15.33 ? 371  VAL D CB  1 
ATOM   7495  C  CG1 . VAL D  2  259 ? 17.712  16.407  52.537  1.00 16.72 ? 371  VAL D CG1 1 
ATOM   7496  C  CG2 . VAL D  2  259 ? 19.848  15.133  52.127  1.00 14.37 ? 371  VAL D CG2 1 
ATOM   7497  N  N   . VAL D  2  260 ? 17.301  15.014  55.832  1.00 18.53 ? 372  VAL D N   1 
ATOM   7498  C  CA  . VAL D  2  260 ? 16.111  15.016  56.690  1.00 19.44 ? 372  VAL D CA  1 
ATOM   7499  C  C   . VAL D  2  260 ? 16.370  15.542  58.115  1.00 21.31 ? 372  VAL D C   1 
ATOM   7500  O  O   . VAL D  2  260 ? 15.559  16.312  58.641  1.00 20.83 ? 372  VAL D O   1 
ATOM   7501  C  CB  . VAL D  2  260 ? 15.585  13.580  56.815  1.00 18.46 ? 372  VAL D CB  1 
ATOM   7502  C  CG1 . VAL D  2  260 ? 14.488  13.496  57.864  1.00 19.43 ? 372  VAL D CG1 1 
ATOM   7503  C  CG2 . VAL D  2  260 ? 15.096  13.092  55.460  1.00 20.75 ? 372  VAL D CG2 1 
ATOM   7504  N  N   . LEU D  2  261 ? 17.485  15.109  58.746  1.00 20.96 ? 373  LEU D N   1 
ATOM   7505  C  CA  . LEU D  2  261 ? 17.758  15.461  60.142  1.00 19.98 ? 373  LEU D CA  1 
ATOM   7506  C  C   . LEU D  2  261 ? 18.814  16.555  60.355  1.00 22.25 ? 373  LEU D C   1 
ATOM   7507  O  O   . LEU D  2  261 ? 18.897  17.117  61.467  1.00 23.47 ? 373  LEU D O   1 
ATOM   7508  C  CB  . LEU D  2  261 ? 18.186  14.208  60.925  1.00 19.58 ? 373  LEU D CB  1 
ATOM   7509  C  CG  . LEU D  2  261 ? 17.145  13.100  61.121  1.00 20.96 ? 373  LEU D CG  1 
ATOM   7510  C  CD1 . LEU D  2  261 ? 17.804  11.877  61.728  1.00 18.90 ? 373  LEU D CD1 1 
ATOM   7511  C  CD2 . LEU D  2  261 ? 16.014  13.583  62.014  1.00 21.14 ? 373  LEU D CD2 1 
ATOM   7512  N  N   . GLU D  2  262 ? 19.625  16.883  59.332  1.00 20.62 ? 374  GLU D N   1 
ATOM   7513  C  CA  . GLU D  2  262 ? 20.717  17.822  59.568  1.00 20.09 ? 374  GLU D CA  1 
ATOM   7514  C  C   . GLU D  2  262 ? 20.638  19.162  58.818  1.00 20.20 ? 374  GLU D C   1 
ATOM   7515  O  O   . GLU D  2  262 ? 21.662  19.685  58.351  1.00 19.24 ? 374  GLU D O   1 
ATOM   7516  C  CB  . GLU D  2  262 ? 22.073  17.147  59.320  1.00 20.64 ? 374  GLU D CB  1 
ATOM   7517  C  CG  . GLU D  2  262 ? 22.441  16.077  60.347  1.00 23.54 ? 374  GLU D CG  1 
ATOM   7518  C  CD  . GLU D  2  262 ? 23.925  15.709  60.313  1.00 25.18 ? 374  GLU D CD  1 
ATOM   7519  O  OE1 . GLU D  2  262 ? 24.692  16.230  61.153  1.00 29.91 ? 374  GLU D OE1 1 
ATOM   7520  O  OE2 . GLU D  2  262 ? 24.327  14.911  59.450  1.00 22.36 ? 374  GLU D OE2 1 
ATOM   7521  N  N   . GLY D  2  263 ? 19.426  19.728  58.717  1.00 18.34 ? 375  GLY D N   1 
ATOM   7522  C  CA  . GLY D  2  263 ? 19.303  21.074  58.168  1.00 17.71 ? 375  GLY D CA  1 
ATOM   7523  C  C   . GLY D  2  263 ? 18.611  21.195  56.830  1.00 17.05 ? 375  GLY D C   1 
ATOM   7524  O  O   . GLY D  2  263 ? 18.359  22.318  56.389  1.00 16.75 ? 375  GLY D O   1 
ATOM   7525  N  N   . GLY D  2  264 ? 18.303  20.063  56.181  1.00 17.93 ? 376  GLY D N   1 
ATOM   7526  C  CA  . GLY D  2  264 ? 17.668  20.113  54.862  1.00 18.80 ? 376  GLY D CA  1 
ATOM   7527  C  C   . GLY D  2  264 ? 18.645  20.365  53.700  1.00 19.03 ? 376  GLY D C   1 
ATOM   7528  O  O   . GLY D  2  264 ? 19.841  20.003  53.774  1.00 20.21 ? 376  GLY D O   1 
ATOM   7529  N  N   . ILE D  2  265 ? 18.162  21.014  52.624  1.00 16.74 ? 377  ILE D N   1 
ATOM   7530  C  CA  . ILE D  2  265 ? 19.017  21.205  51.457  1.00 14.76 ? 377  ILE D CA  1 
ATOM   7531  C  C   . ILE D  2  265 ? 19.707  22.557  51.380  1.00 14.03 ? 377  ILE D C   1 
ATOM   7532  O  O   . ILE D  2  265 ? 20.622  22.726  50.560  1.00 12.81 ? 377  ILE D O   1 
ATOM   7533  C  CB  . ILE D  2  265 ? 18.263  20.943  50.120  1.00 17.43 ? 377  ILE D CB  1 
ATOM   7534  C  CG1 . ILE D  2  265 ? 17.196  22.021  49.843  1.00 17.24 ? 377  ILE D CG1 1 
ATOM   7535  C  CG2 . ILE D  2  265 ? 17.628  19.556  50.156  1.00 15.72 ? 377  ILE D CG2 1 
ATOM   7536  C  CD1 . ILE D  2  265 ? 16.703  22.066  48.395  1.00 16.09 ? 377  ILE D CD1 1 
ATOM   7537  N  N   . ASP D  2  266 ? 19.323  23.513  52.235  1.00 13.37 ? 378  ASP D N   1 
ATOM   7538  C  CA  . ASP D  2  266 ? 19.949  24.843  52.181  1.00 15.39 ? 378  ASP D CA  1 
ATOM   7539  C  C   . ASP D  2  266 ? 21.448  24.836  52.534  1.00 14.41 ? 378  ASP D C   1 
ATOM   7540  O  O   . ASP D  2  266 ? 22.237  25.468  51.818  1.00 12.76 ? 378  ASP D O   1 
ATOM   7541  C  CB  . ASP D  2  266 ? 19.198  25.860  53.035  1.00 18.93 ? 378  ASP D CB  1 
ATOM   7542  C  CG  . ASP D  2  266 ? 17.897  26.358  52.382  1.00 23.69 ? 378  ASP D CG  1 
ATOM   7543  O  OD1 . ASP D  2  266 ? 17.465  25.767  51.354  1.00 22.06 ? 378  ASP D OD1 1 
ATOM   7544  O  OD2 . ASP D  2  266 ? 17.311  27.349  52.906  1.00 24.90 ? 378  ASP D OD2 1 
ATOM   7545  N  N   . PRO D  2  267 ? 21.868  24.190  53.656  1.00 14.16 ? 379  PRO D N   1 
ATOM   7546  C  CA  . PRO D  2  267 ? 23.303  24.101  54.036  1.00 14.99 ? 379  PRO D CA  1 
ATOM   7547  C  C   . PRO D  2  267 ? 24.152  23.419  52.928  1.00 15.26 ? 379  PRO D C   1 
ATOM   7548  O  O   . PRO D  2  267 ? 25.291  23.841  52.653  1.00 15.07 ? 379  PRO D O   1 
ATOM   7549  C  CB  . PRO D  2  267 ? 23.262  23.295  55.343  1.00 13.63 ? 379  PRO D CB  1 
ATOM   7550  C  CG  . PRO D  2  267 ? 21.955  23.724  55.916  1.00 11.63 ? 379  PRO D CG  1 
ATOM   7551  C  CD  . PRO D  2  267 ? 21.021  23.639  54.743  1.00 13.65 ? 379  PRO D CD  1 
ATOM   7552  N  N   . ILE D  2  268 ? 23.560  22.399  52.276  1.00 15.12 ? 380  ILE D N   1 
ATOM   7553  C  CA  . ILE D  2  268 ? 24.178  21.672  51.162  1.00 13.31 ? 380  ILE D CA  1 
ATOM   7554  C  C   . ILE D  2  268 ? 24.334  22.556  49.894  1.00 13.76 ? 380  ILE D C   1 
ATOM   7555  O  O   . ILE D  2  268 ? 25.452  22.696  49.355  1.00 11.58 ? 380  ILE D O   1 
ATOM   7556  C  CB  . ILE D  2  268 ? 23.363  20.406  50.830  1.00 11.94 ? 380  ILE D CB  1 
ATOM   7557  C  CG1 . ILE D  2  268 ? 23.270  19.535  52.068  1.00 12.49 ? 380  ILE D CG1 1 
ATOM   7558  C  CG2 . ILE D  2  268 ? 24.016  19.620  49.706  1.00 9.79  ? 380  ILE D CG2 1 
ATOM   7559  C  CD1 . ILE D  2  268 ? 22.327  18.366  51.914  1.00 16.73 ? 380  ILE D CD1 1 
ATOM   7560  N  N   . LEU D  2  269 ? 23.229  23.176  49.423  1.00 11.68 ? 381  LEU D N   1 
ATOM   7561  C  CA  . LEU D  2  269 ? 23.298  24.036  48.249  1.00 11.11 ? 381  LEU D CA  1 
ATOM   7562  C  C   . LEU D  2  269 ? 24.310  25.191  48.437  1.00 13.02 ? 381  LEU D C   1 
ATOM   7563  O  O   . LEU D  2  269 ? 25.100  25.493  47.535  1.00 11.01 ? 381  LEU D O   1 
ATOM   7564  C  CB  . LEU D  2  269 ? 21.899  24.587  47.914  1.00 13.26 ? 381  LEU D CB  1 
ATOM   7565  C  CG  . LEU D  2  269 ? 20.837  23.574  47.408  1.00 13.59 ? 381  LEU D CG  1 
ATOM   7566  C  CD1 . LEU D  2  269 ? 19.486  24.270  47.238  1.00 14.21 ? 381  LEU D CD1 1 
ATOM   7567  C  CD2 . LEU D  2  269 ? 21.268  22.955  46.089  1.00 13.10 ? 381  LEU D CD2 1 
ATOM   7568  N  N   . ARG D  2  270 ? 24.294  25.845  49.604  1.00 14.01 ? 382  ARG D N   1 
ATOM   7569  C  CA  . ARG D  2  270 ? 25.251  26.917  49.856  1.00 14.94 ? 382  ARG D CA  1 
ATOM   7570  C  C   . ARG D  2  270 ? 26.686  26.368  49.782  1.00 14.08 ? 382  ARG D C   1 
ATOM   7571  O  O   . ARG D  2  270 ? 27.555  27.027  49.244  1.00 13.96 ? 382  ARG D O   1 
ATOM   7572  C  CB  . ARG D  2  270 ? 24.976  27.585  51.210  1.00 18.22 ? 382  ARG D CB  1 
ATOM   7573  C  CG  . ARG D  2  270 ? 23.774  28.543  51.208  1.00 17.26 ? 382  ARG D CG  1 
ATOM   7574  C  CD  . ARG D  2  270 ? 23.616  29.288  52.543  1.00 19.57 ? 382  ARG D CD  1 
ATOM   7575  N  NE  . ARG D  2  270 ? 23.278  28.382  53.656  1.00 19.91 ? 382  ARG D NE  1 
ATOM   7576  C  CZ  . ARG D  2  270 ? 22.236  28.518  54.455  1.00 16.01 ? 382  ARG D CZ  1 
ATOM   7577  N  NH1 . ARG D  2  270 ? 21.414  29.545  54.313  1.00 20.68 ? 382  ARG D NH1 1 
ATOM   7578  N  NH2 . ARG D  2  270 ? 22.023  27.641  55.414  1.00 19.03 ? 382  ARG D NH2 1 
ATOM   7579  N  N   . GLY D  2  271 ? 26.894  25.128  50.275  1.00 14.53 ? 383  GLY D N   1 
ATOM   7580  C  CA  . GLY D  2  271 ? 28.219  24.457  50.203  1.00 15.65 ? 383  GLY D CA  1 
ATOM   7581  C  C   . GLY D  2  271 ? 28.726  24.248  48.765  1.00 15.12 ? 383  GLY D C   1 
ATOM   7582  O  O   . GLY D  2  271 ? 29.910  24.476  48.469  1.00 12.68 ? 383  GLY D O   1 
ATOM   7583  N  N   . LEU D  2  272 ? 27.831  23.806  47.870  1.00 13.20 ? 384  LEU D N   1 
ATOM   7584  C  CA  . LEU D  2  272 ? 28.170  23.645  46.443  1.00 12.23 ? 384  LEU D CA  1 
ATOM   7585  C  C   . LEU D  2  272 ? 28.526  24.985  45.798  1.00 11.46 ? 384  LEU D C   1 
ATOM   7586  O  O   . LEU D  2  272 ? 29.384  25.069  44.916  1.00 10.66 ? 384  LEU D O   1 
ATOM   7587  C  CB  . LEU D  2  272 ? 26.988  23.022  45.684  1.00 10.85 ? 384  LEU D CB  1 
ATOM   7588  C  CG  . LEU D  2  272 ? 26.581  21.621  46.134  1.00 11.88 ? 384  LEU D CG  1 
ATOM   7589  C  CD1 . LEU D  2  272 ? 25.317  21.182  45.408  1.00 12.20 ? 384  LEU D CD1 1 
ATOM   7590  C  CD2 . LEU D  2  272 ? 27.726  20.647  45.901  1.00 9.43  ? 384  LEU D CD2 1 
ATOM   7591  N  N   . MET D  2  273 ? 27.866  26.042  46.239  1.00 11.60 ? 385  MET D N   1 
ATOM   7592  C  CA  . MET D  2  273 ? 28.097  27.340  45.650  1.00 13.28 ? 385  MET D CA  1 
ATOM   7593  C  C   . MET D  2  273 ? 29.398  27.991  46.121  1.00 12.25 ? 385  MET D C   1 
ATOM   7594  O  O   . MET D  2  273 ? 30.139  28.558  45.315  1.00 13.94 ? 385  MET D O   1 
ATOM   7595  C  CB  . MET D  2  273 ? 26.882  28.278  45.910  1.00 12.75 ? 385  MET D CB  1 
ATOM   7596  C  CG  . MET D  2  273 ? 25.659  27.981  45.021  1.00 15.06 ? 385  MET D CG  1 
ATOM   7597  S  SD  . MET D  2  273 ? 24.260  29.102  45.272  1.00 13.89 ? 385  MET D SD  1 
ATOM   7598  C  CE  . MET D  2  273 ? 23.563  28.462  46.783  1.00 8.87  ? 385  MET D CE  1 
ATOM   7599  N  N   . ALA D  2  274 ? 29.699  27.881  47.407  1.00 13.18 ? 386  ALA D N   1 
ATOM   7600  C  CA  . ALA D  2  274 ? 30.802  28.676  47.966  1.00 12.56 ? 386  ALA D CA  1 
ATOM   7601  C  C   . ALA D  2  274 ? 32.039  27.871  48.293  1.00 14.29 ? 386  ALA D C   1 
ATOM   7602  O  O   . ALA D  2  274 ? 32.849  28.294  49.118  1.00 14.35 ? 386  ALA D O   1 
ATOM   7603  C  CB  . ALA D  2  274 ? 30.324  29.407  49.207  1.00 11.26 ? 386  ALA D CB  1 
ATOM   7604  N  N   . THR D  2  275 ? 32.181  26.732  47.649  1.00 15.65 ? 387  THR D N   1 
ATOM   7605  C  CA  . THR D  2  275 ? 33.357  25.866  47.822  1.00 15.88 ? 387  THR D CA  1 
ATOM   7606  C  C   . THR D  2  275 ? 33.892  25.520  46.454  1.00 14.53 ? 387  THR D C   1 
ATOM   7607  O  O   . THR D  2  275 ? 33.135  25.182  45.560  1.00 13.97 ? 387  THR D O   1 
ATOM   7608  C  CB  . THR D  2  275 ? 32.996  24.536  48.560  1.00 15.20 ? 387  THR D CB  1 
ATOM   7609  O  OG1 . THR D  2  275 ? 32.474  24.840  49.850  1.00 14.63 ? 387  THR D OG1 1 
ATOM   7610  C  CG2 . THR D  2  275 ? 34.203  23.627  48.725  1.00 14.77 ? 387  THR D CG2 1 
ATOM   7611  N  N   . PRO D  2  276 ? 35.184  25.635  46.247  1.00 14.30 ? 388  PRO D N   1 
ATOM   7612  C  CA  . PRO D  2  276 ? 35.768  25.282  44.968  1.00 13.15 ? 388  PRO D CA  1 
ATOM   7613  C  C   . PRO D  2  276 ? 35.595  23.764  44.689  1.00 12.03 ? 388  PRO D C   1 
ATOM   7614  O  O   . PRO D  2  276 ? 35.541  22.930  45.603  1.00 9.67  ? 388  PRO D O   1 
ATOM   7615  C  CB  . PRO D  2  276 ? 37.268  25.635  45.132  1.00 15.47 ? 388  PRO D CB  1 
ATOM   7616  C  CG  . PRO D  2  276 ? 37.287  26.614  46.269  1.00 16.99 ? 388  PRO D CG  1 
ATOM   7617  C  CD  . PRO D  2  276 ? 36.216  26.115  47.212  1.00 15.13 ? 388  PRO D CD  1 
ATOM   7618  N  N   . ALA D  2  277 ? 35.437  23.424  43.430  1.00 12.81 ? 389  ALA D N   1 
ATOM   7619  C  CA  . ALA D  2  277 ? 35.543  22.026  43.034  1.00 12.79 ? 389  ALA D CA  1 
ATOM   7620  C  C   . ALA D  2  277 ? 37.051  21.635  43.147  1.00 10.69 ? 389  ALA D C   1 
ATOM   7621  O  O   . ALA D  2  277 ? 37.933  22.501  43.296  1.00 9.20  ? 389  ALA D O   1 
ATOM   7622  C  CB  . ALA D  2  277 ? 35.083  21.867  41.590  1.00 8.94  ? 389  ALA D CB  1 
ATOM   7623  N  N   . LYS D  2  278 ? 37.345  20.349  43.118  1.00 10.94 ? 390  LYS D N   1 
ATOM   7624  C  CA  . LYS D  2  278 ? 38.738  19.914  43.059  1.00 10.62 ? 390  LYS D CA  1 
ATOM   7625  C  C   . LYS D  2  278 ? 39.182  20.022  41.593  1.00 12.29 ? 390  LYS D C   1 
ATOM   7626  O  O   . LYS D  2  278 ? 38.388  19.728  40.659  1.00 9.62  ? 390  LYS D O   1 
ATOM   7627  C  CB  . LYS D  2  278 ? 38.864  18.456  43.543  1.00 10.21 ? 390  LYS D CB  1 
ATOM   7628  C  CG  . LYS D  2  278 ? 40.205  17.825  43.252  1.00 6.88  ? 390  LYS D CG  1 
ATOM   7629  C  CD  . LYS D  2  278 ? 40.155  16.326  43.414  1.00 6.82  ? 390  LYS D CD  1 
ATOM   7630  C  CE  . LYS D  2  278 ? 41.411  15.659  42.860  1.00 4.21  ? 390  LYS D CE  1 
ATOM   7631  N  NZ  . LYS D  2  278 ? 41.551  15.867  41.389  1.00 7.38  ? 390  LYS D NZ  1 
ATOM   7632  N  N   . LEU D  2  279 ? 40.408  20.484  41.355  1.00 8.74  ? 391  LEU D N   1 
ATOM   7633  C  CA  . LEU D  2  279 ? 40.865  20.536  39.996  1.00 6.86  ? 391  LEU D CA  1 
ATOM   7634  C  C   . LEU D  2  279 ? 41.544  19.218  39.643  1.00 8.76  ? 391  LEU D C   1 
ATOM   7635  O  O   . LEU D  2  279 ? 42.184  18.596  40.499  1.00 10.22 ? 391  LEU D O   1 
ATOM   7636  C  CB  . LEU D  2  279 ? 41.839  21.684  39.817  1.00 6.76  ? 391  LEU D CB  1 
ATOM   7637  C  CG  . LEU D  2  279 ? 42.463  21.824  38.435  1.00 7.74  ? 391  LEU D CG  1 
ATOM   7638  C  CD1 . LEU D  2  279 ? 41.460  22.409  37.447  1.00 6.42  ? 391  LEU D CD1 1 
ATOM   7639  C  CD2 . LEU D  2  279 ? 43.705  22.695  38.529  1.00 10.43 ? 391  LEU D CD2 1 
ATOM   7640  N  N   . ASN D  2  280 ? 41.357  18.763  38.421  1.00 6.17  ? 392  ASN D N   1 
ATOM   7641  C  CA  . ASN D  2  280 ? 42.054  17.589  37.933  1.00 7.32  ? 392  ASN D CA  1 
ATOM   7642  C  C   . ASN D  2  280 ? 43.498  17.984  37.529  1.00 5.95  ? 392  ASN D C   1 
ATOM   7643  O  O   . ASN D  2  280 ? 43.692  18.841  36.675  1.00 6.50  ? 392  ASN D O   1 
ATOM   7644  C  CB  . ASN D  2  280 ? 41.305  16.974  36.716  1.00 6.32  ? 392  ASN D CB  1 
ATOM   7645  C  CG  . ASN D  2  280 ? 42.018  15.752  36.113  1.00 9.05  ? 392  ASN D CG  1 
ATOM   7646  O  OD1 . ASN D  2  280 ? 42.869  15.120  36.781  1.00 9.10  ? 392  ASN D OD1 1 
ATOM   7647  N  ND2 . ASN D  2  280 ? 41.697  15.413  34.853  1.00 5.26  ? 392  ASN D ND2 1 
ATOM   7648  N  N   . ARG D  2  281 ? 44.488  17.384  38.188  1.00 6.17  ? 393  ARG D N   1 
ATOM   7649  C  CA  . ARG D  2  281 ? 45.915  17.570  37.851  1.00 7.75  ? 393  ARG D CA  1 
ATOM   7650  C  C   . ARG D  2  281 ? 46.489  16.201  37.518  1.00 6.91  ? 393  ARG D C   1 
ATOM   7651  O  O   . ARG D  2  281 ? 46.019  15.222  38.065  1.00 5.98  ? 393  ARG D O   1 
ATOM   7652  C  CB  . ARG D  2  281 ? 46.684  18.183  39.040  1.00 11.46 ? 393  ARG D CB  1 
ATOM   7653  C  CG  . ARG D  2  281 ? 46.525  19.688  39.251  1.00 13.14 ? 393  ARG D CG  1 
ATOM   7654  C  CD  . ARG D  2  281 ? 47.923  20.324  39.315  1.00 22.11 ? 393  ARG D CD  1 
ATOM   7655  N  NE  . ARG D  2  281 ? 47.960  21.659  39.926  1.00 24.35 ? 393  ARG D NE  1 
ATOM   7656  C  CZ  . ARG D  2  281 ? 47.801  22.812  39.269  1.00 25.73 ? 393  ARG D CZ  1 
ATOM   7657  N  NH1 . ARG D  2  281 ? 47.576  22.824  37.947  1.00 24.03 ? 393  ARG D NH1 1 
ATOM   7658  N  NH2 . ARG D  2  281 ? 47.863  23.956  39.939  1.00 23.86 ? 393  ARG D NH2 1 
ATOM   7659  N  N   . GLN D  2  282 ? 47.492  16.108  36.632  1.00 7.25  ? 394  GLN D N   1 
ATOM   7660  C  CA  . GLN D  2  282 ? 48.005  14.780  36.222  1.00 11.10 ? 394  GLN D CA  1 
ATOM   7661  C  C   . GLN D  2  282 ? 48.569  13.904  37.381  1.00 12.35 ? 394  GLN D C   1 
ATOM   7662  O  O   . GLN D  2  282 ? 48.624  12.690  37.257  1.00 9.68  ? 394  GLN D O   1 
ATOM   7663  C  CB  . GLN D  2  282 ? 49.022  14.918  35.089  1.00 11.89 ? 394  GLN D CB  1 
ATOM   7664  C  CG  . GLN D  2  282 ? 48.383  15.385  33.780  1.00 13.95 ? 394  GLN D CG  1 
ATOM   7665  C  CD  . GLN D  2  282 ? 49.392  15.809  32.708  1.00 12.08 ? 394  GLN D CD  1 
ATOM   7666  O  OE1 . GLN D  2  282 ? 50.384  16.491  32.996  1.00 12.70 ? 394  GLN D OE1 1 
ATOM   7667  N  NE2 . GLN D  2  282 ? 49.137  15.418  31.458  1.00 8.47  ? 394  GLN D NE2 1 
ATOM   7668  N  N   . ASN D  2  283 ? 48.922  14.528  38.511  1.00 12.90 ? 395  ASN D N   1 
ATOM   7669  C  CA  . ASN D  2  283 ? 49.427  13.817  39.686  1.00 13.33 ? 395  ASN D CA  1 
ATOM   7670  C  C   . ASN D  2  283 ? 48.428  13.873  40.824  1.00 10.91 ? 395  ASN D C   1 
ATOM   7671  O  O   . ASN D  2  283 ? 48.723  13.437  41.917  1.00 9.67  ? 395  ASN D O   1 
ATOM   7672  C  CB  . ASN D  2  283 ? 50.749  14.452  40.143  1.00 18.84 ? 395  ASN D CB  1 
ATOM   7673  C  CG  . ASN D  2  283 ? 50.648  15.965  40.262  1.00 21.70 ? 395  ASN D CG  1 
ATOM   7674  O  OD1 . ASN D  2  283 ? 49.565  16.524  40.455  1.00 26.12 ? 395  ASN D OD1 1 
ATOM   7675  N  ND2 . ASN D  2  283 ? 51.780  16.643  40.133  1.00 28.98 ? 395  ASN D ND2 1 
ATOM   7676  N  N   . GLN D  2  284 ? 47.262  14.453  40.567  1.00 10.61 ? 396  GLN D N   1 
ATOM   7677  C  CA  . GLN D  2  284 ? 46.192  14.586  41.577  1.00 11.37 ? 396  GLN D CA  1 
ATOM   7678  C  C   . GLN D  2  284 ? 44.844  14.285  40.922  1.00 11.11 ? 396  GLN D C   1 
ATOM   7679  O  O   . GLN D  2  284 ? 43.941  15.112  40.932  1.00 10.06 ? 396  GLN D O   1 
ATOM   7680  C  CB  . GLN D  2  284 ? 46.152  16.020  42.107  1.00 11.09 ? 396  GLN D CB  1 
ATOM   7681  C  CG  . GLN D  2  284 ? 47.438  16.497  42.758  1.00 16.12 ? 396  GLN D CG  1 
ATOM   7682  C  CD  . GLN D  2  284 ? 47.476  18.013  42.911  1.00 17.67 ? 396  GLN D CD  1 
ATOM   7683  O  OE1 . GLN D  2  284 ? 46.497  18.714  42.643  1.00 12.57 ? 396  GLN D OE1 1 
ATOM   7684  N  NE2 . GLN D  2  284 ? 48.630  18.527  43.345  1.00 19.41 ? 396  GLN D NE2 1 
ATOM   7685  N  N   . ILE D  2  285 ? 44.728  13.104  40.346  1.00 12.02 ? 397  ILE D N   1 
ATOM   7686  C  CA  . ILE D  2  285 ? 43.575  12.740  39.513  1.00 11.05 ? 397  ILE D CA  1 
ATOM   7687  C  C   . ILE D  2  285 ? 42.233  12.597  40.283  1.00 12.04 ? 397  ILE D C   1 
ATOM   7688  O  O   . ILE D  2  285 ? 41.256  13.288  39.935  1.00 10.20 ? 397  ILE D O   1 
ATOM   7689  C  CB  . ILE D  2  285 ? 43.938  11.478  38.679  1.00 8.91  ? 397  ILE D CB  1 
ATOM   7690  C  CG1 . ILE D  2  285 ? 45.051  11.873  37.688  1.00 8.45  ? 397  ILE D CG1 1 
ATOM   7691  C  CG2 . ILE D  2  285 ? 42.730  10.924  37.928  1.00 11.11 ? 397  ILE D CG2 1 
ATOM   7692  C  CD1 . ILE D  2  285 ? 45.680  10.724  36.921  1.00 5.17  ? 397  ILE D CD1 1 
ATOM   7693  N  N   . ALA D  2  286 ? 42.201  11.746  41.330  1.00 11.13 ? 398  ALA D N   1 
ATOM   7694  C  CA  . ALA D  2  286 ? 40.979  11.485  42.113  1.00 11.56 ? 398  ALA D CA  1 
ATOM   7695  C  C   . ALA D  2  286 ? 41.268  11.116  43.567  1.00 10.91 ? 398  ALA D C   1 
ATOM   7696  O  O   . ALA D  2  286 ? 42.122  10.274  43.852  1.00 11.89 ? 398  ALA D O   1 
ATOM   7697  C  CB  . ALA D  2  286 ? 40.170  10.386  41.458  1.00 11.86 ? 398  ALA D CB  1 
ATOM   7698  N  N   . VAL D  2  287 ? 40.508  11.698  44.477  1.00 10.51 ? 399  VAL D N   1 
ATOM   7699  C  CA  . VAL D  2  287 ? 40.784  11.553  45.914  1.00 13.39 ? 399  VAL D CA  1 
ATOM   7700  C  C   . VAL D  2  287 ? 40.454  10.163  46.496  1.00 14.09 ? 399  VAL D C   1 
ATOM   7701  O  O   . VAL D  2  287 ? 39.629  9.398   45.949  1.00 14.18 ? 399  VAL D O   1 
ATOM   7702  C  CB  . VAL D  2  287 ? 40.082  12.668  46.742  1.00 13.14 ? 399  VAL D CB  1 
ATOM   7703  C  CG1 . VAL D  2  287 ? 40.439  14.030  46.154  1.00 10.56 ? 399  VAL D CG1 1 
ATOM   7704  C  CG2 . VAL D  2  287 ? 38.564  12.467  46.808  1.00 10.49 ? 399  VAL D CG2 1 
ATOM   7705  N  N   . ASP D  2  288 ? 41.118  9.839   47.615  1.00 12.83 ? 400  ASP D N   1 
ATOM   7706  C  CA  . ASP D  2  288 ? 40.949  8.548   48.259  1.00 13.36 ? 400  ASP D CA  1 
ATOM   7707  C  C   . ASP D  2  288 ? 39.571  8.356   48.872  1.00 14.42 ? 400  ASP D C   1 
ATOM   7708  O  O   . ASP D  2  288 ? 39.149  7.221   49.068  1.00 14.52 ? 400  ASP D O   1 
ATOM   7709  C  CB  . ASP D  2  288 ? 42.047  8.307   49.299  1.00 13.95 ? 400  ASP D CB  1 
ATOM   7710  C  CG  . ASP D  2  288 ? 43.262  7.647   48.682  1.00 15.69 ? 400  ASP D CG  1 
ATOM   7711  O  OD1 . ASP D  2  288 ? 43.231  7.325   47.485  1.00 15.19 ? 400  ASP D OD1 1 
ATOM   7712  O  OD2 . ASP D  2  288 ? 44.242  7.428   49.393  1.00 18.48 ? 400  ASP D OD2 1 
ATOM   7713  N  N   . GLU D  2  289 ? 38.856  9.444   49.165  1.00 14.12 ? 401  GLU D N   1 
ATOM   7714  C  CA  . GLU D  2  289 ? 37.496  9.268   49.687  1.00 15.99 ? 401  GLU D CA  1 
ATOM   7715  C  C   . GLU D  2  289 ? 36.634  8.407   48.734  1.00 15.62 ? 401  GLU D C   1 
ATOM   7716  O  O   . GLU D  2  289 ? 35.708  7.707   49.165  1.00 14.54 ? 401  GLU D O   1 
ATOM   7717  C  CB  . GLU D  2  289 ? 36.819  10.623  49.930  1.00 17.15 ? 401  GLU D CB  1 
ATOM   7718  C  CG  . GLU D  2  289 ? 37.157  11.279  51.276  1.00 18.63 ? 401  GLU D CG  1 
ATOM   7719  C  CD  . GLU D  2  289 ? 36.920  10.408  52.513  1.00 18.63 ? 401  GLU D CD  1 
ATOM   7720  O  OE1 . GLU D  2  289 ? 37.903  10.133  53.233  1.00 21.04 ? 401  GLU D OE1 1 
ATOM   7721  O  OE2 . GLU D  2  289 ? 35.761  10.020  52.788  1.00 17.52 ? 401  GLU D OE2 1 
ATOM   7722  N  N   . ILE D  2  290 ? 36.971  8.440   47.443  1.00 14.87 ? 402  ILE D N   1 
ATOM   7723  C  CA  . ILE D  2  290 ? 36.272  7.639   46.448  1.00 15.03 ? 402  ILE D CA  1 
ATOM   7724  C  C   . ILE D  2  290 ? 37.179  6.533   45.879  1.00 15.86 ? 402  ILE D C   1 
ATOM   7725  O  O   . ILE D  2  290 ? 36.704  5.570   45.247  1.00 15.98 ? 402  ILE D O   1 
ATOM   7726  C  CB  . ILE D  2  290 ? 35.768  8.507   45.278  1.00 14.06 ? 402  ILE D CB  1 
ATOM   7727  C  CG1 . ILE D  2  290 ? 36.952  9.210   44.594  1.00 10.96 ? 402  ILE D CG1 1 
ATOM   7728  C  CG2 . ILE D  2  290 ? 34.735  9.505   45.779  1.00 12.90 ? 402  ILE D CG2 1 
ATOM   7729  C  CD1 . ILE D  2  290 ? 36.601  9.787   43.237  1.00 11.37 ? 402  ILE D CD1 1 
ATOM   7730  N  N   . ARG D  2  291 ? 38.483  6.663   46.094  1.00 15.82 ? 403  ARG D N   1 
ATOM   7731  C  CA  . ARG D  2  291 ? 39.407  5.657   45.584  1.00 16.19 ? 403  ARG D CA  1 
ATOM   7732  C  C   . ARG D  2  291 ? 39.634  4.544   46.613  1.00 15.66 ? 403  ARG D C   1 
ATOM   7733  O  O   . ARG D  2  291 ? 39.916  3.400   46.245  1.00 15.92 ? 403  ARG D O   1 
ATOM   7734  C  CB  . ARG D  2  291 ? 40.759  6.288   45.196  1.00 14.97 ? 403  ARG D CB  1 
ATOM   7735  C  CG  . ARG D  2  291 ? 41.517  5.505   44.139  1.00 12.68 ? 403  ARG D CG  1 
ATOM   7736  C  CD  . ARG D  2  291 ? 42.993  5.829   44.172  1.00 14.01 ? 403  ARG D CD  1 
ATOM   7737  N  NE  . ARG D  2  291 ? 43.637  5.280   45.374  1.00 14.94 ? 403  ARG D NE  1 
ATOM   7738  C  CZ  . ARG D  2  291 ? 44.258  4.112   45.421  1.00 14.32 ? 403  ARG D CZ  1 
ATOM   7739  N  NH1 . ARG D  2  291 ? 44.293  3.362   44.339  1.00 11.91 ? 403  ARG D NH1 1 
ATOM   7740  N  NH2 . ARG D  2  291 ? 44.847  3.700   46.552  1.00 11.35 ? 403  ARG D NH2 1 
ATOM   7741  N  N   . GLU D  2  292 ? 39.495  4.883   47.906  1.00 15.42 ? 404  GLU D N   1 
ATOM   7742  C  CA  . GLU D  2  292 ? 39.738  3.910   48.968  1.00 13.20 ? 404  GLU D CA  1 
ATOM   7743  C  C   . GLU D  2  292 ? 38.500  3.553   49.734  1.00 11.97 ? 404  GLU D C   1 
ATOM   7744  O  O   . GLU D  2  292 ? 38.301  2.394   50.061  1.00 12.39 ? 404  GLU D O   1 
ATOM   7745  C  CB  . GLU D  2  292 ? 40.788  4.438   49.965  1.00 13.63 ? 404  GLU D CB  1 
ATOM   7746  C  CG  . GLU D  2  292 ? 42.194  4.583   49.405  1.00 13.32 ? 404  GLU D CG  1 
ATOM   7747  C  CD  . GLU D  2  292 ? 42.908  3.263   49.287  1.00 14.80 ? 404  GLU D CD  1 
ATOM   7748  O  OE1 . GLU D  2  292 ? 44.045  3.146   49.806  1.00 13.41 ? 404  GLU D OE1 1 
ATOM   7749  O  OE2 . GLU D  2  292 ? 42.339  2.334   48.671  1.00 15.65 ? 404  GLU D OE2 1 
ATOM   7750  N  N   . ARG D  2  293 ? 37.666  4.552   50.003  1.00 12.60 ? 405  ARG D N   1 
ATOM   7751  C  CA  . ARG D  2  293 ? 36.548  4.380   50.911  1.00 14.39 ? 405  ARG D CA  1 
ATOM   7752  C  C   . ARG D  2  293 ? 35.160  4.459   50.249  1.00 16.45 ? 405  ARG D C   1 
ATOM   7753  O  O   . ARG D  2  293 ? 34.162  4.650   50.951  1.00 15.51 ? 405  ARG D O   1 
ATOM   7754  C  CB  . ARG D  2  293 ? 36.715  5.424   52.042  1.00 16.44 ? 405  ARG D CB  1 
ATOM   7755  C  CG  . ARG D  2  293 ? 38.064  5.286   52.795  1.00 17.32 ? 405  ARG D CG  1 
ATOM   7756  C  CD  . ARG D  2  293 ? 38.336  6.422   53.781  1.00 17.18 ? 405  ARG D CD  1 
ATOM   7757  N  NE  . ARG D  2  293 ? 38.754  7.684   53.124  1.00 18.46 ? 405  ARG D NE  1 
ATOM   7758  C  CZ  . ARG D  2  293 ? 40.014  8.020   52.789  1.00 17.63 ? 405  ARG D CZ  1 
ATOM   7759  N  NH1 . ARG D  2  293 ? 41.007  7.168   52.999  1.00 17.97 ? 405  ARG D NH1 1 
ATOM   7760  N  NH2 . ARG D  2  293 ? 40.268  9.194   52.221  1.00 14.02 ? 405  ARG D NH2 1 
ATOM   7761  N  N   . LEU D  2  294 ? 35.087  4.251   48.901  1.00 16.59 ? 406  LEU D N   1 
ATOM   7762  C  CA  . LEU D  2  294 ? 33.806  4.348   48.180  1.00 18.36 ? 406  LEU D CA  1 
ATOM   7763  C  C   . LEU D  2  294 ? 32.720  3.362   48.700  1.00 18.20 ? 406  LEU D C   1 
ATOM   7764  O  O   . LEU D  2  294 ? 32.874  2.124   48.621  1.00 14.68 ? 406  LEU D O   1 
ATOM   7765  C  CB  . LEU D  2  294 ? 33.994  4.148   46.658  1.00 18.46 ? 406  LEU D CB  1 
ATOM   7766  C  CG  . LEU D  2  294 ? 32.714  4.315   45.785  1.00 21.59 ? 406  LEU D CG  1 
ATOM   7767  C  CD1 . LEU D  2  294 ? 32.237  5.781   45.760  1.00 17.11 ? 406  LEU D CD1 1 
ATOM   7768  C  CD2 . LEU D  2  294 ? 32.994  3.834   44.369  1.00 22.27 ? 406  LEU D CD2 1 
ATOM   7769  N  N   . PHE D  2  295 ? 31.612  3.958   49.230  1.00 17.79 ? 407  PHE D N   1 
ATOM   7770  C  CA  . PHE D  2  295 ? 30.438  3.225   49.722  1.00 16.12 ? 407  PHE D CA  1 
ATOM   7771  C  C   . PHE D  2  295 ? 30.770  2.333   50.925  1.00 17.83 ? 407  PHE D C   1 
ATOM   7772  O  O   . PHE D  2  295 ? 30.120  1.297   51.122  1.00 18.46 ? 407  PHE D O   1 
ATOM   7773  C  CB  . PHE D  2  295 ? 29.846  2.393   48.574  1.00 13.65 ? 407  PHE D CB  1 
ATOM   7774  C  CG  . PHE D  2  295 ? 29.346  3.225   47.418  1.00 14.46 ? 407  PHE D CG  1 
ATOM   7775  C  CD1 . PHE D  2  295 ? 28.954  2.621   46.222  1.00 16.06 ? 407  PHE D CD1 1 
ATOM   7776  C  CD2 . PHE D  2  295 ? 29.208  4.619   47.540  1.00 15.38 ? 407  PHE D CD2 1 
ATOM   7777  C  CE1 . PHE D  2  295 ? 28.432  3.389   45.170  1.00 15.42 ? 407  PHE D CE1 1 
ATOM   7778  C  CE2 . PHE D  2  295 ? 28.687  5.393   46.498  1.00 13.30 ? 407  PHE D CE2 1 
ATOM   7779  C  CZ  . PHE D  2  295 ? 28.298  4.776   45.309  1.00 16.05 ? 407  PHE D CZ  1 
ATOM   7780  N  N   . GLU D  2  296 ? 31.770  2.761   51.747  1.00 17.64 ? 408  GLU D N   1 
ATOM   7781  C  CA  . GLU D  2  296 ? 32.243  1.985   52.904  1.00 18.29 ? 408  GLU D CA  1 
ATOM   7782  C  C   . GLU D  2  296 ? 31.130  1.560   53.832  1.00 17.71 ? 408  GLU D C   1 
ATOM   7783  O  O   . GLU D  2  296 ? 30.973  0.390   54.109  1.00 20.74 ? 408  GLU D O   1 
ATOM   7784  C  CB  . GLU D  2  296 ? 33.273  2.760   53.721  1.00 18.94 ? 408  GLU D CB  1 
ATOM   7785  C  CG  . GLU D  2  296 ? 34.666  2.166   53.651  1.00 21.54 ? 408  GLU D CG  1 
ATOM   7786  C  CD  . GLU D  2  296 ? 35.574  2.637   54.769  1.00 23.63 ? 408  GLU D CD  1 
ATOM   7787  O  OE1 . GLU D  2  296 ? 35.700  3.870   54.988  1.00 23.16 ? 408  GLU D OE1 1 
ATOM   7788  O  OE2 . GLU D  2  296 ? 36.172  1.767   55.438  1.00 27.43 ? 408  GLU D OE2 1 
ATOM   7789  N  N   . GLN D  2  297 ? 30.355  2.509   54.307  1.00 19.09 ? 409  GLN D N   1 
ATOM   7790  C  CA  . GLN D  2  297 ? 29.283  2.189   55.251  1.00 20.16 ? 409  GLN D CA  1 
ATOM   7791  C  C   . GLN D  2  297 ? 28.178  1.279   54.671  1.00 22.05 ? 409  GLN D C   1 
ATOM   7792  O  O   . GLN D  2  297 ? 27.431  0.668   55.434  1.00 23.11 ? 409  GLN D O   1 
ATOM   7793  C  CB  . GLN D  2  297 ? 28.630  3.466   55.762  1.00 20.70 ? 409  GLN D CB  1 
ATOM   7794  C  CG  . GLN D  2  297 ? 29.550  4.454   56.447  1.00 19.25 ? 409  GLN D CG  1 
ATOM   7795  C  CD  . GLN D  2  297 ? 28.761  5.631   56.982  1.00 24.34 ? 409  GLN D CD  1 
ATOM   7796  O  OE1 . GLN D  2  297 ? 27.864  6.164   56.292  1.00 23.19 ? 409  GLN D OE1 1 
ATOM   7797  N  NE2 . GLN D  2  297 ? 29.064  6.038   58.219  1.00 22.30 ? 409  GLN D NE2 1 
ATOM   7798  N  N   . VAL D  2  298 ? 28.041  1.181   53.345  1.00 22.87 ? 410  VAL D N   1 
ATOM   7799  C  CA  . VAL D  2  298 ? 26.906  0.413   52.814  1.00 25.72 ? 410  VAL D CA  1 
ATOM   7800  C  C   . VAL D  2  298 ? 27.290  -0.890  52.115  1.00 26.03 ? 410  VAL D C   1 
ATOM   7801  O  O   . VAL D  2  298 ? 26.609  -1.327  51.180  1.00 25.53 ? 410  VAL D O   1 
ATOM   7802  C  CB  . VAL D  2  298 ? 25.993  1.257   51.870  1.00 25.90 ? 410  VAL D CB  1 
ATOM   7803  C  CG1 . VAL D  2  298 ? 25.451  2.452   52.623  1.00 25.95 ? 410  VAL D CG1 1 
ATOM   7804  C  CG2 . VAL D  2  298 ? 26.746  1.710   50.631  1.00 29.93 ? 410  VAL D CG2 1 
ATOM   7805  N  N   . MET D  2  299 ? 28.398  -1.490  52.556  1.00 26.64 ? 411  MET D N   1 
ATOM   7806  C  CA  . MET D  2  299 ? 28.805  -2.809  52.084  1.00 25.37 ? 411  MET D CA  1 
ATOM   7807  C  C   . MET D  2  299 ? 30.048  -3.331  52.797  1.00 24.00 ? 411  MET D C   1 
ATOM   7808  O  O   . MET D  2  299 ? 30.670  -2.616  53.585  1.00 22.87 ? 411  MET D O   1 
ATOM   7809  C  CB  . MET D  2  299 ? 28.948  -2.887  50.541  1.00 28.49 ? 411  MET D CB  1 
ATOM   7810  C  CG  . MET D  2  299 ? 29.393  -1.642  49.787  1.00 31.66 ? 411  MET D CG  1 
ATOM   7811  S  SD  . MET D  2  299 ? 28.904  -1.740  48.043  1.00 32.78 ? 411  MET D SD  1 
ATOM   7812  C  CE  . MET D  2  299 ? 30.184  -2.814  47.415  1.00 30.59 ? 411  MET D CE  1 
ATOM   7813  N  N   . ARG D  2  300 ? 30.387  -4.593  52.515  1.00 22.89 ? 412  ARG D N   1 
ATOM   7814  C  CA  . ARG D  2  300 ? 31.486  -5.298  53.186  1.00 20.84 ? 412  ARG D CA  1 
ATOM   7815  C  C   . ARG D  2  300 ? 32.841  -4.625  53.057  1.00 19.99 ? 412  ARG D C   1 
ATOM   7816  O  O   . ARG D  2  300 ? 33.671  -4.755  53.955  1.00 17.61 ? 412  ARG D O   1 
ATOM   7817  C  CB  . ARG D  2  300 ? 31.595  -6.733  52.676  1.00 19.66 ? 412  ARG D CB  1 
ATOM   7818  C  CG  . ARG D  2  300 ? 32.216  -6.880  51.303  1.00 18.49 ? 412  ARG D CG  1 
ATOM   7819  C  CD  . ARG D  2  300 ? 32.534  -8.337  51.028  1.00 20.43 ? 412  ARG D CD  1 
ATOM   7820  N  NE  . ARG D  2  300 ? 33.303  -8.530  49.791  1.00 20.88 ? 412  ARG D NE  1 
ATOM   7821  C  CZ  . ARG D  2  300 ? 34.636  -8.400  49.682  1.00 19.10 ? 412  ARG D CZ  1 
ATOM   7822  N  NH1 . ARG D  2  300 ? 35.383  -8.052  50.735  1.00 19.08 ? 412  ARG D NH1 1 
ATOM   7823  N  NH2 . ARG D  2  300 ? 35.214  -8.606  48.521  1.00 17.10 ? 412  ARG D NH2 1 
ATOM   7824  N  N   . ILE D  2  301 ? 33.074  -3.920  51.949  1.00 18.13 ? 413  ILE D N   1 
ATOM   7825  C  CA  . ILE D  2  301 ? 34.362  -3.274  51.735  1.00 19.38 ? 413  ILE D CA  1 
ATOM   7826  C  C   . ILE D  2  301 ? 34.207  -1.987  50.963  1.00 18.47 ? 413  ILE D C   1 
ATOM   7827  O  O   . ILE D  2  301 ? 33.221  -1.817  50.238  1.00 18.04 ? 413  ILE D O   1 
ATOM   7828  C  CB  . ILE D  2  301 ? 35.355  -4.203  50.950  1.00 20.75 ? 413  ILE D CB  1 
ATOM   7829  C  CG1 . ILE D  2  301 ? 36.767  -3.580  50.949  1.00 17.23 ? 413  ILE D CG1 1 
ATOM   7830  C  CG2 . ILE D  2  301 ? 34.854  -4.422  49.519  1.00 17.39 ? 413  ILE D CG2 1 
ATOM   7831  C  CD1 . ILE D  2  301 ? 37.768  -4.335  50.086  1.00 21.29 ? 413  ILE D CD1 1 
ATOM   7832  N  N   . GLY D  2  302 ? 35.194  -1.085  51.149  1.00 18.77 ? 414  GLY D N   1 
ATOM   7833  C  CA  . GLY D  2  302 ? 35.250  0.165   50.398  1.00 16.77 ? 414  GLY D CA  1 
ATOM   7834  C  C   . GLY D  2  302 ? 35.672  -0.106  48.957  1.00 16.62 ? 414  GLY D C   1 
ATOM   7835  O  O   . GLY D  2  302 ? 36.603  -0.882  48.698  1.00 14.32 ? 414  GLY D O   1 
ATOM   7836  N  N   . LEU D  2  303 ? 34.964  0.492   48.009  1.00 16.08 ? 415  LEU D N   1 
ATOM   7837  C  CA  . LEU D  2  303 ? 35.303  0.315   46.591  1.00 16.28 ? 415  LEU D CA  1 
ATOM   7838  C  C   . LEU D  2  303 ? 36.318  1.389   46.140  1.00 16.31 ? 415  LEU D C   1 
ATOM   7839  O  O   . LEU D  2  303 ? 36.672  2.306   46.906  1.00 19.01 ? 415  LEU D O   1 
ATOM   7840  C  CB  . LEU D  2  303 ? 34.024  0.425   45.737  1.00 15.02 ? 415  LEU D CB  1 
ATOM   7841  C  CG  . LEU D  2  303 ? 32.765  -0.263  46.284  1.00 13.91 ? 415  LEU D CG  1 
ATOM   7842  C  CD1 . LEU D  2  303 ? 31.612  -0.133  45.290  1.00 12.17 ? 415  LEU D CD1 1 
ATOM   7843  C  CD2 . LEU D  2  303 ? 33.076  -1.727  46.585  1.00 12.50 ? 415  LEU D CD2 1 
ATOM   7844  N  N   . ASP D  2  304 ? 36.774  1.279   44.906  1.00 12.37 ? 416  ASP D N   1 
ATOM   7845  C  CA  . ASP D  2  304 ? 37.681  2.249   44.307  1.00 10.88 ? 416  ASP D CA  1 
ATOM   7846  C  C   . ASP D  2  304 ? 37.019  2.702   43.007  1.00 9.96  ? 416  ASP D C   1 
ATOM   7847  O  O   . ASP D  2  304 ? 36.969  1.929   42.064  1.00 7.91  ? 416  ASP D O   1 
ATOM   7848  C  CB  . ASP D  2  304 ? 39.028  1.531   44.037  1.00 12.28 ? 416  ASP D CB  1 
ATOM   7849  C  CG  . ASP D  2  304 ? 40.127  2.303   43.260  1.00 14.77 ? 416  ASP D CG  1 
ATOM   7850  O  OD1 . ASP D  2  304 ? 41.291  1.871   43.359  1.00 12.53 ? 416  ASP D OD1 1 
ATOM   7851  O  OD2 . ASP D  2  304 ? 39.844  3.297   42.541  1.00 9.83  ? 416  ASP D OD2 1 
ATOM   7852  N  N   . LEU D  2  305 ? 36.507  3.948   42.976  1.00 10.97 ? 417  LEU D N   1 
ATOM   7853  C  CA  . LEU D  2  305 ? 35.778  4.459   41.804  1.00 11.40 ? 417  LEU D CA  1 
ATOM   7854  C  C   . LEU D  2  305 ? 36.626  4.432   40.501  1.00 10.07 ? 417  LEU D C   1 
ATOM   7855  O  O   . LEU D  2  305 ? 36.185  3.889   39.492  1.00 6.89  ? 417  LEU D O   1 
ATOM   7856  C  CB  . LEU D  2  305 ? 35.222  5.866   42.087  1.00 9.37  ? 417  LEU D CB  1 
ATOM   7857  C  CG  . LEU D  2  305 ? 34.193  6.394   41.065  1.00 13.50 ? 417  LEU D CG  1 
ATOM   7858  C  CD1 . LEU D  2  305 ? 33.192  5.285   40.668  1.00 13.19 ? 417  LEU D CD1 1 
ATOM   7859  C  CD2 . LEU D  2  305 ? 33.440  7.588   41.659  1.00 11.42 ? 417  LEU D CD2 1 
ATOM   7860  N  N   . PRO D  2  306 ? 37.843  5.044   40.490  1.00 10.75 ? 418  PRO D N   1 
ATOM   7861  C  CA  . PRO D  2  306 ? 38.721  5.033   39.300  1.00 9.81  ? 418  PRO D CA  1 
ATOM   7862  C  C   . PRO D  2  306 ? 38.937  3.603   38.798  1.00 8.73  ? 418  PRO D C   1 
ATOM   7863  O  O   . PRO D  2  306 ? 38.874  3.344   37.585  1.00 5.40  ? 418  PRO D O   1 
ATOM   7864  C  CB  . PRO D  2  306 ? 40.020  5.643   39.818  1.00 8.50  ? 418  PRO D CB  1 
ATOM   7865  C  CG  . PRO D  2  306 ? 39.513  6.622   40.818  1.00 7.66  ? 418  PRO D CG  1 
ATOM   7866  C  CD  . PRO D  2  306 ? 38.448  5.864   41.575  1.00 9.32  ? 418  PRO D CD  1 
ATOM   7867  N  N   . ALA D  2  307 ? 39.200  2.679   39.744  1.00 8.19  ? 419  ALA D N   1 
ATOM   7868  C  CA  . ALA D  2  307 ? 39.405  1.276   39.385  1.00 8.39  ? 419  ALA D CA  1 
ATOM   7869  C  C   . ALA D  2  307 ? 38.093  0.644   38.836  1.00 7.92  ? 419  ALA D C   1 
ATOM   7870  O  O   . ALA D  2  307 ? 38.122  -0.129  37.869  1.00 5.12  ? 419  ALA D O   1 
ATOM   7871  C  CB  . ALA D  2  307 ? 39.926  0.491   40.585  1.00 7.21  ? 419  ALA D CB  1 
ATOM   7872  N  N   . LEU D  2  308 ? 36.947  0.978   39.452  1.00 8.79  ? 420  LEU D N   1 
ATOM   7873  C  CA  . LEU D  2  308 ? 35.653  0.464   38.946  1.00 9.12  ? 420  LEU D CA  1 
ATOM   7874  C  C   . LEU D  2  308 ? 35.421  0.939   37.512  1.00 6.97  ? 420  LEU D C   1 
ATOM   7875  O  O   . LEU D  2  308 ? 34.963  0.159   36.677  1.00 4.24  ? 420  LEU D O   1 
ATOM   7876  C  CB  . LEU D  2  308 ? 34.453  0.912   39.816  1.00 8.34  ? 420  LEU D CB  1 
ATOM   7877  C  CG  . LEU D  2  308 ? 34.318  0.317   41.213  1.00 7.86  ? 420  LEU D CG  1 
ATOM   7878  C  CD1 . LEU D  2  308 ? 33.134  0.946   41.917  1.00 9.26  ? 420  LEU D CD1 1 
ATOM   7879  C  CD2 . LEU D  2  308 ? 34.122  -1.177  41.136  1.00 8.98  ? 420  LEU D CD2 1 
ATOM   7880  N  N   . ASN D  2  309 ? 35.773  2.221   37.240  1.00 6.74  ? 421  ASN D N   1 
ATOM   7881  C  CA  . ASN D  2  309 ? 35.613  2.821   35.899  1.00 7.49  ? 421  ASN D CA  1 
ATOM   7882  C  C   . ASN D  2  309 ? 36.395  2.059   34.841  1.00 6.81  ? 421  ASN D C   1 
ATOM   7883  O  O   . ASN D  2  309 ? 35.883  1.853   33.732  1.00 6.90  ? 421  ASN D O   1 
ATOM   7884  C  CB  . ASN D  2  309 ? 36.084  4.281   35.872  1.00 7.56  ? 421  ASN D CB  1 
ATOM   7885  C  CG  . ASN D  2  309 ? 35.262  5.226   36.723  1.00 8.50  ? 421  ASN D CG  1 
ATOM   7886  O  OD1 . ASN D  2  309 ? 35.627  6.402   36.886  1.00 8.64  ? 421  ASN D OD1 1 
ATOM   7887  N  ND2 . ASN D  2  309 ? 34.167  4.727   37.260  1.00 2.81  ? 421  ASN D ND2 1 
ATOM   7888  N  N   . MET D  2  310 ? 37.641  1.631   35.181  1.00 6.84  ? 422  MET D N   1 
ATOM   7889  C  CA  . MET D  2  310 ? 38.495  0.870   34.252  1.00 5.20  ? 422  MET D CA  1 
ATOM   7890  C  C   . MET D  2  310 ? 37.981  -0.563  34.072  1.00 4.26  ? 422  MET D C   1 
ATOM   7891  O  O   . MET D  2  310 ? 37.975  -1.084  32.962  1.00 2.61  ? 422  MET D O   1 
ATOM   7892  C  CB  . MET D  2  310 ? 39.980  0.903   34.723  1.00 5.53  ? 422  MET D CB  1 
ATOM   7893  C  CG  . MET D  2  310 ? 40.579  2.313   34.671  1.00 3.55  ? 422  MET D CG  1 
ATOM   7894  S  SD  . MET D  2  310 ? 42.330  2.434   35.142  1.00 6.63  ? 422  MET D SD  1 
ATOM   7895  C  CE  . MET D  2  310 ? 42.218  2.929   36.853  1.00 3.29  ? 422  MET D CE  1 
ATOM   7896  N  N   . GLN D  2  311 ? 37.521  -1.191  35.174  1.00 4.74  ? 423  GLN D N   1 
ATOM   7897  C  CA  . GLN D  2  311 ? 36.912  -2.532  35.107  1.00 5.92  ? 423  GLN D CA  1 
ATOM   7898  C  C   . GLN D  2  311 ? 35.594  -2.467  34.284  1.00 7.12  ? 423  GLN D C   1 
ATOM   7899  O  O   . GLN D  2  311 ? 35.268  -3.402  33.527  1.00 7.77  ? 423  GLN D O   1 
ATOM   7900  C  CB  . GLN D  2  311 ? 36.628  -3.074  36.528  1.00 3.24  ? 423  GLN D CB  1 
ATOM   7901  C  CG  . GLN D  2  311 ? 36.326  -4.570  36.606  1.00 3.59  ? 423  GLN D CG  1 
ATOM   7902  C  CD  . GLN D  2  311 ? 37.567  -5.485  36.466  1.00 5.89  ? 423  GLN D CD  1 
ATOM   7903  O  OE1 . GLN D  2  311 ? 38.529  -5.173  35.766  1.00 7.00  ? 423  GLN D OE1 1 
ATOM   7904  N  NE2 . GLN D  2  311 ? 37.539  -6.630  37.131  1.00 3.27  ? 423  GLN D NE2 1 
ATOM   7905  N  N   . ARG D  2  312 ? 34.859  -1.344  34.406  1.00 5.91  ? 424  ARG D N   1 
ATOM   7906  C  CA  . ARG D  2  312 ? 33.602  -1.161  33.696  1.00 6.27  ? 424  ARG D CA  1 
ATOM   7907  C  C   . ARG D  2  312 ? 33.819  -1.041  32.186  1.00 5.98  ? 424  ARG D C   1 
ATOM   7908  O  O   . ARG D  2  312 ? 33.067  -1.631  31.397  1.00 5.74  ? 424  ARG D O   1 
ATOM   7909  C  CB  . ARG D  2  312 ? 32.856  0.077   34.230  1.00 6.79  ? 424  ARG D CB  1 
ATOM   7910  C  CG  . ARG D  2  312 ? 31.416  0.220   33.727  1.00 7.21  ? 424  ARG D CG  1 
ATOM   7911  C  CD  . ARG D  2  312 ? 30.554  -0.974  34.120  1.00 4.28  ? 424  ARG D CD  1 
ATOM   7912  N  NE  . ARG D  2  312 ? 30.487  -1.117  35.564  1.00 4.12  ? 424  ARG D NE  1 
ATOM   7913  C  CZ  . ARG D  2  312 ? 29.927  -2.122  36.219  1.00 2.98  ? 424  ARG D CZ  1 
ATOM   7914  N  NH1 . ARG D  2  312 ? 29.353  -3.132  35.557  1.00 8.17  ? 424  ARG D NH1 1 
ATOM   7915  N  NH2 . ARG D  2  312 ? 29.939  -2.127  37.545  1.00 2.78  ? 424  ARG D NH2 1 
ATOM   7916  N  N   . SER D  2  313 ? 34.857  -0.284  31.780  1.00 6.54  ? 425  SER D N   1 
ATOM   7917  C  CA  . SER D  2  313 ? 35.158  -0.118  30.350  1.00 5.13  ? 425  SER D CA  1 
ATOM   7918  C  C   . SER D  2  313 ? 35.586  -1.433  29.691  1.00 5.07  ? 425  SER D C   1 
ATOM   7919  O  O   . SER D  2  313 ? 35.345  -1.641  28.498  1.00 5.31  ? 425  SER D O   1 
ATOM   7920  C  CB  . SER D  2  313 ? 36.193  1.016   30.095  1.00 3.86  ? 425  SER D CB  1 
ATOM   7921  O  OG  . SER D  2  313 ? 37.443  0.802   30.745  1.00 7.30  ? 425  SER D OG  1 
ATOM   7922  N  N   . ARG D  2  314 ? 36.191  -2.330  30.466  1.00 2.23  ? 426  ARG D N   1 
ATOM   7923  C  CA  . ARG D  2  314 ? 36.544  -3.647  29.954  1.00 3.63  ? 426  ARG D CA  1 
ATOM   7924  C  C   . ARG D  2  314 ? 35.310  -4.549  29.910  1.00 3.15  ? 426  ARG D C   1 
ATOM   7925  O  O   . ARG D  2  314 ? 35.114  -5.305  28.953  1.00 7.06  ? 426  ARG D O   1 
ATOM   7926  C  CB  . ARG D  2  314 ? 37.647  -4.263  30.819  1.00 4.33  ? 426  ARG D CB  1 
ATOM   7927  C  CG  . ARG D  2  314 ? 38.815  -3.323  31.020  1.00 2.91  ? 426  ARG D CG  1 
ATOM   7928  C  CD  . ARG D  2  314 ? 39.804  -3.891  32.011  1.00 3.48  ? 426  ARG D CD  1 
ATOM   7929  N  NE  . ARG D  2  314 ? 40.926  -3.009  32.182  1.00 3.55  ? 426  ARG D NE  1 
ATOM   7930  C  CZ  . ARG D  2  314 ? 41.898  -3.203  33.067  1.00 6.30  ? 426  ARG D CZ  1 
ATOM   7931  N  NH1 . ARG D  2  314 ? 41.905  -4.295  33.835  1.00 4.15  ? 426  ARG D NH1 1 
ATOM   7932  N  NH2 . ARG D  2  314 ? 42.879  -2.304  33.171  1.00 5.23  ? 426  ARG D NH2 1 
ATOM   7933  N  N   . ASP D  2  315 ? 34.480  -4.465  30.949  1.00 4.81  ? 427  ASP D N   1 
ATOM   7934  C  CA  . ASP D  2  315 ? 33.187  -5.172  31.002  1.00 7.32  ? 427  ASP D CA  1 
ATOM   7935  C  C   . ASP D  2  315 ? 32.359  -4.842  29.750  1.00 5.62  ? 427  ASP D C   1 
ATOM   7936  O  O   . ASP D  2  315 ? 31.732  -5.715  29.156  1.00 2.94  ? 427  ASP D O   1 
ATOM   7937  C  CB  . ASP D  2  315 ? 32.411  -4.733  32.284  1.00 9.45  ? 427  ASP D CB  1 
ATOM   7938  C  CG  . ASP D  2  315 ? 30.967  -5.256  32.374  1.00 6.96  ? 427  ASP D CG  1 
ATOM   7939  O  OD1 . ASP D  2  315 ? 30.687  -6.321  31.800  1.00 8.40  ? 427  ASP D OD1 1 
ATOM   7940  O  OD2 . ASP D  2  315 ? 30.125  -4.594  33.011  1.00 7.42  ? 427  ASP D OD2 1 
ATOM   7941  N  N   . HIS D  2  316 ? 32.416  -3.573  29.346  1.00 4.97  ? 428  HIS D N   1 
ATOM   7942  C  CA  . HIS D  2  316 ? 31.675  -3.071  28.209  1.00 3.64  ? 428  HIS D CA  1 
ATOM   7943  C  C   . HIS D  2  316 ? 32.390  -3.255  26.888  1.00 3.88  ? 428  HIS D C   1 
ATOM   7944  O  O   . HIS D  2  316 ? 31.883  -2.796  25.862  1.00 6.08  ? 428  HIS D O   1 
ATOM   7945  C  CB  . HIS D  2  316 ? 31.337  -1.603  28.433  1.00 3.73  ? 428  HIS D CB  1 
ATOM   7946  C  CG  . HIS D  2  316 ? 30.258  -1.395  29.441  1.00 7.03  ? 428  HIS D CG  1 
ATOM   7947  N  ND1 . HIS D  2  316 ? 29.324  -0.373  29.330  1.00 7.28  ? 428  HIS D ND1 1 
ATOM   7948  C  CD2 . HIS D  2  316 ? 29.977  -2.030  30.603  1.00 3.04  ? 428  HIS D CD2 1 
ATOM   7949  C  CE1 . HIS D  2  316 ? 28.525  -0.385  30.389  1.00 4.66  ? 428  HIS D CE1 1 
ATOM   7950  N  NE2 . HIS D  2  316 ? 28.903  -1.376  31.171  1.00 5.93  ? 428  HIS D NE2 1 
ATOM   7951  N  N   . GLY D  2  317 ? 33.571  -3.904  26.895  1.00 2.00  ? 429  GLY D N   1 
ATOM   7952  C  CA  . GLY D  2  317 ? 34.274  -4.185  25.643  1.00 2.00  ? 429  GLY D CA  1 
ATOM   7953  C  C   . GLY D  2  317 ? 34.713  -2.946  24.898  1.00 2.00  ? 429  GLY D C   1 
ATOM   7954  O  O   . GLY D  2  317 ? 34.859  -2.952  23.677  1.00 4.31  ? 429  GLY D O   1 
ATOM   7955  N  N   . LEU D  2  318 ? 34.954  -1.885  25.635  1.00 3.32  ? 430  LEU D N   1 
ATOM   7956  C  CA  . LEU D  2  318 ? 35.336  -0.629  25.042  1.00 4.61  ? 430  LEU D CA  1 
ATOM   7957  C  C   . LEU D  2  318 ? 36.798  -0.585  24.552  1.00 5.52  ? 430  LEU D C   1 
ATOM   7958  O  O   . LEU D  2  318 ? 37.735  -1.016  25.262  1.00 5.42  ? 430  LEU D O   1 
ATOM   7959  C  CB  . LEU D  2  318 ? 35.106  0.493   26.056  1.00 6.04  ? 430  LEU D CB  1 
ATOM   7960  C  CG  . LEU D  2  318 ? 33.655  0.835   26.445  1.00 8.12  ? 430  LEU D CG  1 
ATOM   7961  C  CD1 . LEU D  2  318 ? 33.678  1.994   27.430  1.00 7.15  ? 430  LEU D CD1 1 
ATOM   7962  C  CD2 . LEU D  2  318 ? 32.816  1.217   25.212  1.00 3.20  ? 430  LEU D CD2 1 
ATOM   7963  N  N   . PRO D  2  319 ? 37.018  -0.091  23.309  1.00 3.44  ? 431  PRO D N   1 
ATOM   7964  C  CA  . PRO D  2  319 ? 38.370  0.060   22.727  1.00 4.36  ? 431  PRO D CA  1 
ATOM   7965  C  C   . PRO D  2  319 ? 39.284  0.917   23.642  1.00 2.72  ? 431  PRO D C   1 
ATOM   7966  O  O   . PRO D  2  319 ? 38.781  1.704   24.471  1.00 2.93  ? 431  PRO D O   1 
ATOM   7967  C  CB  . PRO D  2  319 ? 38.079  0.745   21.398  1.00 3.75  ? 431  PRO D CB  1 
ATOM   7968  C  CG  . PRO D  2  319 ? 36.763  0.167   21.040  1.00 3.46  ? 431  PRO D CG  1 
ATOM   7969  C  CD  . PRO D  2  319 ? 35.980  0.254   22.313  1.00 3.15  ? 431  PRO D CD  1 
ATOM   7970  N  N   . GLY D  2  320 ? 40.611  0.726   23.490  1.00 4.23  ? 432  GLY D N   1 
ATOM   7971  C  CA  . GLY D  2  320 ? 41.634  1.426   24.288  1.00 3.17  ? 432  GLY D CA  1 
ATOM   7972  C  C   . GLY D  2  320 ? 41.909  2.837   23.815  1.00 3.96  ? 432  GLY D C   1 
ATOM   7973  O  O   . GLY D  2  320 ? 41.370  3.271   22.801  1.00 6.72  ? 432  GLY D O   1 
ATOM   7974  N  N   . TYR D  2  321 ? 42.784  3.535   24.538  1.00 3.99  ? 433  TYR D N   1 
ATOM   7975  C  CA  . TYR D  2  321 ? 43.098  4.942   24.292  1.00 3.97  ? 433  TYR D CA  1 
ATOM   7976  C  C   . TYR D  2  321 ? 43.343  5.337   22.810  1.00 4.30  ? 433  TYR D C   1 
ATOM   7977  O  O   . TYR D  2  321 ? 42.725  6.293   22.312  1.00 5.23  ? 433  TYR D O   1 
ATOM   7978  C  CB  . TYR D  2  321 ? 44.317  5.342   25.154  1.00 4.61  ? 433  TYR D CB  1 
ATOM   7979  C  CG  . TYR D  2  321 ? 44.793  6.766   24.962  1.00 3.97  ? 433  TYR D CG  1 
ATOM   7980  C  CD1 . TYR D  2  321 ? 44.104  7.829   25.534  1.00 3.85  ? 433  TYR D CD1 1 
ATOM   7981  C  CD2 . TYR D  2  321 ? 45.959  7.041   24.269  1.00 3.50  ? 433  TYR D CD2 1 
ATOM   7982  C  CE1 . TYR D  2  321 ? 44.555  9.131   25.442  1.00 5.91  ? 433  TYR D CE1 1 
ATOM   7983  C  CE2 . TYR D  2  321 ? 46.433  8.350   24.164  1.00 5.44  ? 433  TYR D CE2 1 
ATOM   7984  C  CZ  . TYR D  2  321 ? 45.728  9.387   24.757  1.00 5.98  ? 433  TYR D CZ  1 
ATOM   7985  O  OH  . TYR D  2  321 ? 46.186  10.667  24.669  1.00 5.78  ? 433  TYR D OH  1 
ATOM   7986  N  N   . ASN D  2  322 ? 44.250  4.633   22.119  1.00 3.84  ? 434  ASN D N   1 
ATOM   7987  C  CA  . ASN D  2  322 ? 44.611  5.027   20.767  1.00 4.10  ? 434  ASN D CA  1 
ATOM   7988  C  C   . ASN D  2  322 ? 43.494  4.835   19.768  1.00 5.82  ? 434  ASN D C   1 
ATOM   7989  O  O   . ASN D  2  322 ? 43.416  5.581   18.786  1.00 3.74  ? 434  ASN D O   1 
ATOM   7990  C  CB  . ASN D  2  322 ? 45.869  4.302   20.300  1.00 7.04  ? 434  ASN D CB  1 
ATOM   7991  C  CG  . ASN D  2  322 ? 47.122  5.070   20.709  1.00 12.86 ? 434  ASN D CG  1 
ATOM   7992  O  OD1 . ASN D  2  322 ? 47.043  6.246   21.088  1.00 14.67 ? 434  ASN D OD1 1 
ATOM   7993  N  ND2 . ASN D  2  322 ? 48.284  4.425   20.646  1.00 12.14 ? 434  ASN D ND2 1 
ATOM   7994  N  N   . ALA D  2  323 ? 42.640  3.828   20.005  1.00 5.06  ? 435  ALA D N   1 
ATOM   7995  C  CA  . ALA D  2  323 ? 41.505  3.589   19.122  1.00 8.56  ? 435  ALA D CA  1 
ATOM   7996  C  C   . ALA D  2  323 ? 40.531  4.787   19.171  1.00 8.60  ? 435  ALA D C   1 
ATOM   7997  O  O   . ALA D  2  323 ? 40.015  5.226   18.106  1.00 7.43  ? 435  ALA D O   1 
ATOM   7998  C  CB  . ALA D  2  323 ? 40.797  2.289   19.510  1.00 9.72  ? 435  ALA D CB  1 
ATOM   7999  N  N   . TRP D  2  324 ? 40.322  5.322   20.400  1.00 7.11  ? 436  TRP D N   1 
ATOM   8000  C  CA  . TRP D  2  324 ? 39.476  6.488   20.609  1.00 5.52  ? 436  TRP D CA  1 
ATOM   8001  C  C   . TRP D  2  324 ? 40.115  7.764   20.096  1.00 4.98  ? 436  TRP D C   1 
ATOM   8002  O  O   . TRP D  2  324 ? 39.433  8.602   19.514  1.00 4.37  ? 436  TRP D O   1 
ATOM   8003  C  CB  . TRP D  2  324 ? 39.067  6.597   22.070  1.00 4.72  ? 436  TRP D CB  1 
ATOM   8004  C  CG  . TRP D  2  324 ? 37.998  5.600   22.405  1.00 8.37  ? 436  TRP D CG  1 
ATOM   8005  C  CD1 . TRP D  2  324 ? 38.109  4.529   23.255  1.00 10.29 ? 436  TRP D CD1 1 
ATOM   8006  C  CD2 . TRP D  2  324 ? 36.703  5.496   21.802  1.00 6.94  ? 436  TRP D CD2 1 
ATOM   8007  N  NE1 . TRP D  2  324 ? 36.974  3.759   23.217  1.00 8.07  ? 436  TRP D NE1 1 
ATOM   8008  C  CE2 . TRP D  2  324 ? 36.090  4.324   22.331  1.00 7.50  ? 436  TRP D CE2 1 
ATOM   8009  C  CE3 . TRP D  2  324 ? 35.988  6.279   20.860  1.00 3.02  ? 436  TRP D CE3 1 
ATOM   8010  C  CZ2 . TRP D  2  324 ? 34.790  3.903   21.947  1.00 6.23  ? 436  TRP D CZ2 1 
ATOM   8011  C  CZ3 . TRP D  2  324 ? 34.709  5.859   20.480  1.00 8.35  ? 436  TRP D CZ3 1 
ATOM   8012  C  CH2 . TRP D  2  324 ? 34.125  4.679   21.025  1.00 5.30  ? 436  TRP D CH2 1 
ATOM   8013  N  N   . ARG D  2  325 ? 41.407  7.915   20.278  1.00 3.60  ? 437  ARG D N   1 
ATOM   8014  C  CA  . ARG D  2  325 ? 42.103  9.057   19.690  1.00 5.12  ? 437  ARG D CA  1 
ATOM   8015  C  C   . ARG D  2  325 ? 41.915  9.078   18.155  1.00 5.86  ? 437  ARG D C   1 
ATOM   8016  O  O   . ARG D  2  325 ? 41.624  10.113  17.565  1.00 6.68  ? 437  ARG D O   1 
ATOM   8017  C  CB  . ARG D  2  325 ? 43.611  8.979   20.030  1.00 8.63  ? 437  ARG D CB  1 
ATOM   8018  C  CG  . ARG D  2  325 ? 43.940  9.147   21.513  1.00 5.66  ? 437  ARG D CG  1 
ATOM   8019  C  CD  . ARG D  2  325 ? 44.074  10.607  21.885  1.00 6.10  ? 437  ARG D CD  1 
ATOM   8020  N  NE  . ARG D  2  325 ? 45.152  11.225  21.113  1.00 6.40  ? 437  ARG D NE  1 
ATOM   8021  C  CZ  . ARG D  2  325 ? 45.589  12.454  21.272  1.00 7.36  ? 437  ARG D CZ  1 
ATOM   8022  N  NH1 . ARG D  2  325 ? 45.031  13.245  22.181  1.00 6.36  ? 437  ARG D NH1 1 
ATOM   8023  N  NH2 . ARG D  2  325 ? 46.589  12.894  20.514  1.00 6.56  ? 437  ARG D NH2 1 
ATOM   8024  N  N   . ARG D  2  326 ? 42.078  7.917   17.521  1.00 6.25  ? 438  ARG D N   1 
ATOM   8025  C  CA  . ARG D  2  326 ? 41.924  7.785   16.087  1.00 5.62  ? 438  ARG D CA  1 
ATOM   8026  C  C   . ARG D  2  326 ? 40.469  8.088   15.672  1.00 6.51  ? 438  ARG D C   1 
ATOM   8027  O  O   . ARG D  2  326 ? 40.214  8.799   14.696  1.00 5.69  ? 438  ARG D O   1 
ATOM   8028  C  CB  . ARG D  2  326 ? 42.327  6.368   15.660  1.00 4.91  ? 438  ARG D CB  1 
ATOM   8029  C  CG  . ARG D  2  326 ? 42.312  6.110   14.157  1.00 5.18  ? 438  ARG D CG  1 
ATOM   8030  C  CD  . ARG D  2  326 ? 42.765  4.687   13.838  1.00 8.84  ? 438  ARG D CD  1 
ATOM   8031  N  NE  . ARG D  2  326 ? 44.045  4.371   14.504  1.00 10.07 ? 438  ARG D NE  1 
ATOM   8032  C  CZ  . ARG D  2  326 ? 44.202  3.499   15.508  1.00 9.11  ? 438  ARG D CZ  1 
ATOM   8033  N  NH1 . ARG D  2  326 ? 43.175  2.752   15.952  1.00 10.96 ? 438  ARG D NH1 1 
ATOM   8034  N  NH2 . ARG D  2  326 ? 45.382  3.362   16.058  1.00 8.26  ? 438  ARG D NH2 1 
ATOM   8035  N  N   . PHE D  2  327 ? 39.523  7.552   16.412  1.00 7.25  ? 439  PHE D N   1 
ATOM   8036  C  CA  . PHE D  2  327 ? 38.111  7.836   16.142  1.00 9.22  ? 439  PHE D CA  1 
ATOM   8037  C  C   . PHE D  2  327 ? 37.891  9.366   16.138  1.00 7.31  ? 439  PHE D C   1 
ATOM   8038  O  O   . PHE D  2  327 ? 37.216  9.918   15.275  1.00 5.47  ? 439  PHE D O   1 
ATOM   8039  C  CB  . PHE D  2  327 ? 37.227  7.119   17.196  1.00 8.84  ? 439  PHE D CB  1 
ATOM   8040  C  CG  . PHE D  2  327 ? 35.796  7.587   17.237  1.00 11.39 ? 439  PHE D CG  1 
ATOM   8041  C  CD1 . PHE D  2  327 ? 34.857  7.113   16.301  1.00 11.68 ? 439  PHE D CD1 1 
ATOM   8042  C  CD2 . PHE D  2  327 ? 35.380  8.512   18.199  1.00 11.73 ? 439  PHE D CD2 1 
ATOM   8043  C  CE1 . PHE D  2  327 ? 33.525  7.554   16.327  1.00 11.12 ? 439  PHE D CE1 1 
ATOM   8044  C  CE2 . PHE D  2  327 ? 34.045  8.958   18.230  1.00 14.49 ? 439  PHE D CE2 1 
ATOM   8045  C  CZ  . PHE D  2  327 ? 33.116  8.476   17.290  1.00 11.19 ? 439  PHE D CZ  1 
ATOM   8046  N  N   . CYS D  2  328 ? 38.549  10.034  17.069  1.00 7.86  ? 440  CYS D N   1 
ATOM   8047  C  CA  . CYS D  2  328 ? 38.489  11.482  17.217  1.00 8.00  ? 440  CYS D CA  1 
ATOM   8048  C  C   . CYS D  2  328 ? 39.417  12.270  16.271  1.00 9.53  ? 440  CYS D C   1 
ATOM   8049  O  O   . CYS D  2  328 ? 39.438  13.505  16.334  1.00 10.52 ? 440  CYS D O   1 
ATOM   8050  C  CB  . CYS D  2  328 ? 38.824  11.832  18.647  1.00 6.68  ? 440  CYS D CB  1 
ATOM   8051  S  SG  . CYS D  2  328 ? 37.477  11.449  19.772  1.00 8.27  ? 440  CYS D SG  1 
ATOM   8052  N  N   . GLY D  2  329 ? 40.170  11.583  15.400  1.00 8.47  ? 441  GLY D N   1 
ATOM   8053  C  CA  . GLY D  2  329 ? 41.086  12.282  14.509  1.00 8.41  ? 441  GLY D CA  1 
ATOM   8054  C  C   . GLY D  2  329 ? 42.313  12.829  15.250  1.00 9.43  ? 441  GLY D C   1 
ATOM   8055  O  O   . GLY D  2  329 ? 43.025  13.684  14.737  1.00 9.97  ? 441  GLY D O   1 
ATOM   8056  N  N   . LEU D  2  330 ? 42.537  12.347  16.470  1.00 8.33  ? 442  LEU D N   1 
ATOM   8057  C  CA  . LEU D  2  330 ? 43.715  12.747  17.239  1.00 9.41  ? 442  LEU D CA  1 
ATOM   8058  C  C   . LEU D  2  330 ? 44.882  11.797  16.995  1.00 6.98  ? 442  LEU D C   1 
ATOM   8059  O  O   . LEU D  2  330 ? 44.684  10.596  16.852  1.00 7.75  ? 442  LEU D O   1 
ATOM   8060  C  CB  . LEU D  2  330 ? 43.370  12.779  18.701  1.00 8.79  ? 442  LEU D CB  1 
ATOM   8061  C  CG  . LEU D  2  330 ? 42.113  13.581  19.019  1.00 14.10 ? 442  LEU D CG  1 
ATOM   8062  C  CD1 . LEU D  2  330 ? 41.792  13.492  20.502  1.00 13.23 ? 442  LEU D CD1 1 
ATOM   8063  C  CD2 . LEU D  2  330 ? 42.275  15.028  18.562  1.00 11.86 ? 442  LEU D CD2 1 
ATOM   8064  N  N   . PRO D  2  331 ? 46.129  12.330  16.977  1.00 8.54  ? 443  PRO D N   1 
ATOM   8065  C  CA  . PRO D  2  331 ? 47.351  11.529  16.739  1.00 7.96  ? 443  PRO D CA  1 
ATOM   8066  C  C   . PRO D  2  331 ? 47.447  10.418  17.761  1.00 4.12  ? 443  PRO D C   1 
ATOM   8067  O  O   . PRO D  2  331 ? 47.059  10.615  18.904  1.00 6.11  ? 443  PRO D O   1 
ATOM   8068  C  CB  . PRO D  2  331 ? 48.483  12.550  16.926  1.00 12.16 ? 443  PRO D CB  1 
ATOM   8069  C  CG  . PRO D  2  331 ? 47.822  13.865  16.655  1.00 10.58 ? 443  PRO D CG  1 
ATOM   8070  C  CD  . PRO D  2  331 ? 46.472  13.738  17.280  1.00 8.84  ? 443  PRO D CD  1 
ATOM   8071  N  N   . GLN D  2  332 ? 47.950  9.263   17.355  1.00 3.34  ? 444  GLN D N   1 
ATOM   8072  C  CA  . GLN D  2  332 ? 48.032  8.119   18.256  1.00 4.60  ? 444  GLN D CA  1 
ATOM   8073  C  C   . GLN D  2  332 ? 49.457  7.823   18.712  1.00 7.19  ? 444  GLN D C   1 
ATOM   8074  O  O   . GLN D  2  332 ? 50.252  7.266   17.954  1.00 6.52  ? 444  GLN D O   1 
ATOM   8075  C  CB  . GLN D  2  332 ? 47.449  6.875   17.585  1.00 4.58  ? 444  GLN D CB  1 
ATOM   8076  C  CG  . GLN D  2  332 ? 45.959  7.017   17.201  1.00 8.23  ? 444  GLN D CG  1 
ATOM   8077  C  CD  . GLN D  2  332 ? 45.740  7.253   15.713  1.00 7.40  ? 444  GLN D CD  1 
ATOM   8078  O  OE1 . GLN D  2  332 ? 46.004  6.363   14.906  1.00 9.22  ? 444  GLN D OE1 1 
ATOM   8079  N  NE2 . GLN D  2  332 ? 45.255  8.454   15.340  1.00 6.99  ? 444  GLN D NE2 1 
ATOM   8080  N  N   . PRO D  2  333 ? 49.808  8.189   19.962  1.00 8.72  ? 445  PRO D N   1 
ATOM   8081  C  CA  . PRO D  2  333 ? 51.159  7.936   20.518  1.00 11.35 ? 445  PRO D CA  1 
ATOM   8082  C  C   . PRO D  2  333 ? 51.461  6.423   20.632  1.00 10.47 ? 445  PRO D C   1 
ATOM   8083  O  O   . PRO D  2  333 ? 50.678  5.667   21.209  1.00 10.16 ? 445  PRO D O   1 
ATOM   8084  C  CB  . PRO D  2  333 ? 51.096  8.639   21.892  1.00 10.72 ? 445  PRO D CB  1 
ATOM   8085  C  CG  . PRO D  2  333 ? 49.652  8.576   22.243  1.00 8.16  ? 445  PRO D CG  1 
ATOM   8086  C  CD  . PRO D  2  333 ? 48.958  8.899   20.943  1.00 5.85  ? 445  PRO D CD  1 
ATOM   8087  N  N   . GLU D  2  334 ? 52.596  5.990   20.083  1.00 9.60  ? 446  GLU D N   1 
ATOM   8088  C  CA  . GLU D  2  334 ? 52.951  4.567   20.107  1.00 12.01 ? 446  GLU D CA  1 
ATOM   8089  C  C   . GLU D  2  334 ? 54.167  4.279   20.981  1.00 11.94 ? 446  GLU D C   1 
ATOM   8090  O  O   . GLU D  2  334 ? 54.383  3.138   21.374  1.00 14.16 ? 446  GLU D O   1 
ATOM   8091  C  CB  . GLU D  2  334 ? 53.232  4.046   18.699  1.00 12.52 ? 446  GLU D CB  1 
ATOM   8092  C  CG  . GLU D  2  334 ? 52.122  4.285   17.692  1.00 13.52 ? 446  GLU D CG  1 
ATOM   8093  C  CD  . GLU D  2  334 ? 50.830  3.539   18.006  1.00 16.04 ? 446  GLU D CD  1 
ATOM   8094  O  OE1 . GLU D  2  334 ? 49.824  3.777   17.301  1.00 15.85 ? 446  GLU D OE1 1 
ATOM   8095  O  OE2 . GLU D  2  334 ? 50.815  2.716   18.940  1.00 13.47 ? 446  GLU D OE2 1 
ATOM   8096  N  N   . THR D  2  335 ? 54.970  5.295   21.263  1.00 9.75  ? 447  THR D N   1 
ATOM   8097  C  CA  . THR D  2  335 ? 56.145  5.122   22.124  1.00 9.94  ? 447  THR D CA  1 
ATOM   8098  C  C   . THR D  2  335 ? 55.921  5.865   23.398  1.00 10.68 ? 447  THR D C   1 
ATOM   8099  O  O   . THR D  2  335 ? 55.024  6.721   23.479  1.00 10.48 ? 447  THR D O   1 
ATOM   8100  C  CB  . THR D  2  335 ? 57.453  5.696   21.510  1.00 9.72  ? 447  THR D CB  1 
ATOM   8101  O  OG1 . THR D  2  335 ? 57.304  7.100   21.283  1.00 8.54  ? 447  THR D OG1 1 
ATOM   8102  C  CG2 . THR D  2  335 ? 57.820  5.002   20.211  1.00 9.51  ? 447  THR D CG2 1 
ATOM   8103  N  N   . VAL D  2  336 ? 56.730  5.575   24.401  1.00 10.79 ? 448  VAL D N   1 
ATOM   8104  C  CA  . VAL D  2  336 ? 56.610  6.321   25.651  1.00 11.74 ? 448  VAL D CA  1 
ATOM   8105  C  C   . VAL D  2  336 ? 56.950  7.799   25.412  1.00 10.62 ? 448  VAL D C   1 
ATOM   8106  O  O   . VAL D  2  336 ? 56.322  8.679   25.994  1.00 10.86 ? 448  VAL D O   1 
ATOM   8107  C  CB  . VAL D  2  336 ? 57.502  5.735   26.787  1.00 10.41 ? 448  VAL D CB  1 
ATOM   8108  C  CG1 . VAL D  2  336 ? 58.982  5.896   26.466  1.00 9.01  ? 448  VAL D CG1 1 
ATOM   8109  C  CG2 . VAL D  2  336 ? 57.131  6.388   28.112  1.00 8.95  ? 448  VAL D CG2 1 
ATOM   8110  N  N   . GLY D  2  337 ? 57.912  8.057   24.519  1.00 9.36  ? 449  GLY D N   1 
ATOM   8111  C  CA  . GLY D  2  337 ? 58.259  9.429   24.179  1.00 7.29  ? 449  GLY D CA  1 
ATOM   8112  C  C   . GLY D  2  337 ? 57.094  10.189  23.558  1.00 6.77  ? 449  GLY D C   1 
ATOM   8113  O  O   . GLY D  2  337 ? 56.864  11.364  23.899  1.00 5.99  ? 449  GLY D O   1 
ATOM   8114  N  N   . GLN D  2  338 ? 56.383  9.523   22.634  1.00 7.61  ? 450  GLN D N   1 
ATOM   8115  C  CA  . GLN D  2  338 ? 55.178  10.097  22.000  1.00 9.30  ? 450  GLN D CA  1 
ATOM   8116  C  C   . GLN D  2  338 ? 54.091  10.367  23.041  1.00 7.42  ? 450  GLN D C   1 
ATOM   8117  O  O   . GLN D  2  338 ? 53.501  11.447  23.071  1.00 8.14  ? 450  GLN D O   1 
ATOM   8118  C  CB  . GLN D  2  338 ? 54.619  9.174   20.893  1.00 9.38  ? 450  GLN D CB  1 
ATOM   8119  C  CG  . GLN D  2  338 ? 55.386  9.247   19.575  1.00 17.55 ? 450  GLN D CG  1 
ATOM   8120  C  CD  . GLN D  2  338 ? 54.977  8.181   18.543  1.00 20.57 ? 450  GLN D CD  1 
ATOM   8121  O  OE1 . GLN D  2  338 ? 54.241  7.258   18.834  1.00 22.21 ? 450  GLN D OE1 1 
ATOM   8122  N  NE2 . GLN D  2  338 ? 55.473  8.311   17.327  1.00 26.35 ? 450  GLN D NE2 1 
ATOM   8123  N  N   . LEU D  2  339 ? 53.851  9.401   23.905  1.00 6.30  ? 451  LEU D N   1 
ATOM   8124  C  CA  . LEU D  2  339 ? 52.832  9.569   24.918  1.00 8.63  ? 451  LEU D CA  1 
ATOM   8125  C  C   . LEU D  2  339 ? 53.127  10.773  25.814  1.00 8.84  ? 451  LEU D C   1 
ATOM   8126  O  O   . LEU D  2  339 ? 52.215  11.522  26.192  1.00 9.01  ? 451  LEU D O   1 
ATOM   8127  C  CB  . LEU D  2  339 ? 52.717  8.283   25.750  1.00 9.58  ? 451  LEU D CB  1 
ATOM   8128  C  CG  . LEU D  2  339 ? 51.557  8.227   26.767  1.00 12.55 ? 451  LEU D CG  1 
ATOM   8129  C  CD1 . LEU D  2  339 ? 50.198  8.417   26.055  1.00 9.49  ? 451  LEU D CD1 1 
ATOM   8130  C  CD2 . LEU D  2  339 ? 51.609  6.911   27.545  1.00 9.40  ? 451  LEU D CD2 1 
ATOM   8131  N  N   . GLY D  2  340 ? 54.420  10.960  26.149  1.00 8.99  ? 452  GLY D N   1 
ATOM   8132  C  CA  . GLY D  2  340 ? 54.836  12.055  27.015  1.00 6.83  ? 452  GLY D CA  1 
ATOM   8133  C  C   . GLY D  2  340 ? 54.563  13.395  26.370  1.00 5.76  ? 452  GLY D C   1 
ATOM   8134  O  O   . GLY D  2  340 ? 54.157  14.337  27.034  1.00 5.86  ? 452  GLY D O   1 
ATOM   8135  N  N   . THR D  2  341 ? 54.804  13.458  25.053  1.00 8.31  ? 453  THR D N   1 
ATOM   8136  C  CA  . THR D  2  341 ? 54.505  14.635  24.251  1.00 9.85  ? 453  THR D CA  1 
ATOM   8137  C  C   . THR D  2  341 ? 52.986  14.940  24.230  1.00 9.09  ? 453  THR D C   1 
ATOM   8138  O  O   . THR D  2  341 ? 52.571  16.091  24.454  1.00 8.65  ? 453  THR D O   1 
ATOM   8139  C  CB  . THR D  2  341 ? 55.012  14.429  22.823  1.00 9.38  ? 453  THR D CB  1 
ATOM   8140  O  OG1 . THR D  2  341 ? 56.433  14.392  22.874  1.00 14.96 ? 453  THR D OG1 1 
ATOM   8141  C  CG2 . THR D  2  341 ? 54.568  15.555  21.890  1.00 9.19  ? 453  THR D CG2 1 
ATOM   8142  N  N   . VAL D  2  342 ? 52.164  13.912  23.983  1.00 7.14  ? 454  VAL D N   1 
ATOM   8143  C  CA  . VAL D  2  342 ? 50.715  14.109  23.960  1.00 8.59  ? 454  VAL D CA  1 
ATOM   8144  C  C   . VAL D  2  342 ? 50.212  14.535  25.330  1.00 6.90  ? 454  VAL D C   1 
ATOM   8145  O  O   . VAL D  2  342 ? 49.408  15.444  25.457  1.00 4.74  ? 454  VAL D O   1 
ATOM   8146  C  CB  . VAL D  2  342 ? 49.998  12.826  23.461  1.00 8.36  ? 454  VAL D CB  1 
ATOM   8147  C  CG1 . VAL D  2  342 ? 48.477  12.946  23.606  1.00 7.71  ? 454  VAL D CG1 1 
ATOM   8148  C  CG2 . VAL D  2  342 ? 50.359  12.602  21.997  1.00 6.84  ? 454  VAL D CG2 1 
ATOM   8149  N  N   . LEU D  2  343 ? 50.748  13.917  26.357  1.00 7.10  ? 455  LEU D N   1 
ATOM   8150  C  CA  . LEU D  2  343 ? 50.370  14.231  27.728  1.00 9.08  ? 455  LEU D CA  1 
ATOM   8151  C  C   . LEU D  2  343 ? 51.136  15.449  28.306  1.00 11.26 ? 455  LEU D C   1 
ATOM   8152  O  O   . LEU D  2  343 ? 50.806  15.954  29.406  1.00 8.35  ? 455  LEU D O   1 
ATOM   8153  C  CB  . LEU D  2  343 ? 50.627  13.009  28.612  1.00 9.51  ? 455  LEU D CB  1 
ATOM   8154  C  CG  . LEU D  2  343 ? 49.839  11.745  28.284  1.00 9.60  ? 455  LEU D CG  1 
ATOM   8155  C  CD1 . LEU D  2  343 ? 50.132  10.696  29.339  1.00 6.54  ? 455  LEU D CD1 1 
ATOM   8156  C  CD2 . LEU D  2  343 ? 48.334  12.061  28.208  1.00 6.76  ? 455  LEU D CD2 1 
ATOM   8157  N  N   . ARG D  2  344 ? 52.150  15.927  27.561  1.00 12.89 ? 456  ARG D N   1 
ATOM   8158  C  CA  . ARG D  2  344 ? 53.023  17.005  28.045  1.00 13.77 ? 456  ARG D CA  1 
ATOM   8159  C  C   . ARG D  2  344 ? 53.470  16.655  29.447  1.00 13.15 ? 456  ARG D C   1 
ATOM   8160  O  O   . ARG D  2  344 ? 53.506  17.501  30.350  1.00 12.27 ? 456  ARG D O   1 
ATOM   8161  C  CB  . ARG D  2  344 ? 52.321  18.375  28.023  1.00 14.71 ? 456  ARG D CB  1 
ATOM   8162  C  CG  . ARG D  2  344 ? 51.900  18.790  26.625  1.00 17.87 ? 456  ARG D CG  1 
ATOM   8163  C  CD  . ARG D  2  344 ? 51.690  20.280  26.507  1.00 21.08 ? 456  ARG D CD  1 
ATOM   8164  N  NE  . ARG D  2  344 ? 50.454  20.747  27.130  1.00 21.84 ? 456  ARG D NE  1 
ATOM   8165  C  CZ  . ARG D  2  344 ? 49.268  20.762  26.528  1.00 21.66 ? 456  ARG D CZ  1 
ATOM   8166  N  NH1 . ARG D  2  344 ? 49.133  20.273  25.304  1.00 20.63 ? 456  ARG D NH1 1 
ATOM   8167  N  NH2 . ARG D  2  344 ? 48.213  21.252  27.164  1.00 23.47 ? 456  ARG D NH2 1 
ATOM   8168  N  N   . ASN D  2  345 ? 53.803  15.380  29.623  1.00 11.98 ? 457  ASN D N   1 
ATOM   8169  C  CA  . ASN D  2  345 ? 54.190  14.881  30.929  1.00 13.45 ? 457  ASN D CA  1 
ATOM   8170  C  C   . ASN D  2  345 ? 54.854  13.523  30.780  1.00 11.95 ? 457  ASN D C   1 
ATOM   8171  O  O   . ASN D  2  345 ? 54.183  12.500  30.723  1.00 11.72 ? 457  ASN D O   1 
ATOM   8172  C  CB  . ASN D  2  345 ? 52.927  14.785  31.810  1.00 11.46 ? 457  ASN D CB  1 
ATOM   8173  C  CG  . ASN D  2  345 ? 53.224  14.474  33.263  1.00 10.53 ? 457  ASN D CG  1 
ATOM   8174  O  OD1 . ASN D  2  345 ? 54.230  13.834  33.590  1.00 8.52  ? 457  ASN D OD1 1 
ATOM   8175  N  ND2 . ASN D  2  345 ? 52.334  14.928  34.142  1.00 10.72 ? 457  ASN D ND2 1 
ATOM   8176  N  N   . LEU D  2  346 ? 56.168  13.509  30.719  1.00 10.66 ? 458  LEU D N   1 
ATOM   8177  C  CA  . LEU D  2  346 ? 56.884  12.249  30.498  1.00 10.95 ? 458  LEU D CA  1 
ATOM   8178  C  C   . LEU D  2  346 ? 56.772  11.293  31.709  1.00 9.74  ? 458  LEU D C   1 
ATOM   8179  O  O   . LEU D  2  346 ? 56.650  10.059  31.550  1.00 5.99  ? 458  LEU D O   1 
ATOM   8180  C  CB  . LEU D  2  346 ? 58.357  12.550  30.130  1.00 11.60 ? 458  LEU D CB  1 
ATOM   8181  C  CG  . LEU D  2  346 ? 59.268  11.339  29.899  1.00 14.90 ? 458  LEU D CG  1 
ATOM   8182  C  CD1 . LEU D  2  346 ? 58.761  10.498  28.732  1.00 16.13 ? 458  LEU D CD1 1 
ATOM   8183  C  CD2 . LEU D  2  346 ? 60.685  11.807  29.639  1.00 15.61 ? 458  LEU D CD2 1 
ATOM   8184  N  N   . LYS D  2  347 ? 56.810  11.870  32.910  1.00 8.84  ? 459  LYS D N   1 
ATOM   8185  C  CA  . LYS D  2  347 ? 56.691  11.104  34.123  1.00 10.94 ? 459  LYS D CA  1 
ATOM   8186  C  C   . LYS D  2  347 ? 55.383  10.267  34.111  1.00 11.39 ? 459  LYS D C   1 
ATOM   8187  O  O   . LYS D  2  347 ? 55.392  9.075   34.427  1.00 9.05  ? 459  LYS D O   1 
ATOM   8188  C  CB  . LYS D  2  347 ? 56.729  12.078  35.309  1.00 14.82 ? 459  LYS D CB  1 
ATOM   8189  C  CG  . LYS D  2  347 ? 56.348  11.480  36.658  1.00 20.94 ? 459  LYS D CG  1 
ATOM   8190  C  CD  . LYS D  2  347 ? 55.565  12.500  37.495  1.00 24.88 ? 459  LYS D CD  1 
ATOM   8191  C  CE  . LYS D  2  347 ? 54.894  11.858  38.715  1.00 25.59 ? 459  LYS D CE  1 
ATOM   8192  N  NZ  . LYS D  2  347 ? 55.870  11.157  39.599  1.00 25.71 ? 459  LYS D NZ  1 
ATOM   8193  N  N   . LEU D  2  348 ? 54.256  10.911  33.724  1.00 11.44 ? 460  LEU D N   1 
ATOM   8194  C  CA  . LEU D  2  348 ? 52.954  10.233  33.652  1.00 7.09  ? 460  LEU D CA  1 
ATOM   8195  C  C   . LEU D  2  348 ? 52.940  9.174   32.550  1.00 5.46  ? 460  LEU D C   1 
ATOM   8196  O  O   . LEU D  2  348 ? 52.438  8.079   32.765  1.00 4.85  ? 460  LEU D O   1 
ATOM   8197  C  CB  . LEU D  2  348 ? 51.834  11.259  33.412  1.00 7.74  ? 460  LEU D CB  1 
ATOM   8198  C  CG  . LEU D  2  348 ? 50.428  10.681  33.132  1.00 5.98  ? 460  LEU D CG  1 
ATOM   8199  C  CD1 . LEU D  2  348 ? 50.030  9.730   34.239  1.00 8.65  ? 460  LEU D CD1 1 
ATOM   8200  C  CD2 . LEU D  2  348 ? 49.407  11.802  33.015  1.00 9.70  ? 460  LEU D CD2 1 
ATOM   8201  N  N   . ALA D  2  349 ? 53.486  9.509   31.378  1.00 5.57  ? 461  ALA D N   1 
ATOM   8202  C  CA  . ALA D  2  349 ? 53.545  8.577   30.277  1.00 6.92  ? 461  ALA D CA  1 
ATOM   8203  C  C   . ALA D  2  349 ? 54.316  7.331   30.676  1.00 9.05  ? 461  ALA D C   1 
ATOM   8204  O  O   . ALA D  2  349 ? 53.926  6.231   30.317  1.00 10.19 ? 461  ALA D O   1 
ATOM   8205  C  CB  . ALA D  2  349 ? 54.187  9.211   29.069  1.00 5.00  ? 461  ALA D CB  1 
ATOM   8206  N  N   . ARG D  2  350 ? 55.405  7.497   31.442  1.00 9.61  ? 462  ARG D N   1 
ATOM   8207  C  CA  . ARG D  2  350 ? 56.195  6.332   31.891  1.00 12.73 ? 462  ARG D CA  1 
ATOM   8208  C  C   . ARG D  2  350 ? 55.356  5.389   32.778  1.00 9.34  ? 462  ARG D C   1 
ATOM   8209  O  O   . ARG D  2  350 ? 55.373  4.170   32.587  1.00 6.73  ? 462  ARG D O   1 
ATOM   8210  C  CB  . ARG D  2  350 ? 57.451  6.794   32.659  1.00 15.82 ? 462  ARG D CB  1 
ATOM   8211  C  CG  . ARG D  2  350 ? 58.569  7.367   31.783  1.00 24.45 ? 462  ARG D CG  1 
ATOM   8212  C  CD  . ARG D  2  350 ? 59.779  7.840   32.625  1.00 30.37 ? 462  ARG D CD  1 
ATOM   8213  N  NE  . ARG D  2  350 ? 60.955  8.158   31.788  1.00 35.33 ? 462  ARG D NE  1 
ATOM   8214  C  CZ  . ARG D  2  350 ? 61.892  9.080   32.073  1.00 37.61 ? 462  ARG D CZ  1 
ATOM   8215  N  NH1 . ARG D  2  350 ? 61.807  9.813   33.178  1.00 40.34 ? 462  ARG D NH1 1 
ATOM   8216  N  NH2 . ARG D  2  350 ? 62.914  9.273   31.238  1.00 37.76 ? 462  ARG D NH2 1 
ATOM   8217  N  N   . LYS D  2  351 ? 54.636  5.983   33.750  1.00 10.57 ? 463  LYS D N   1 
ATOM   8218  C  CA  . LYS D  2  351 ? 53.728  5.255   34.650  1.00 12.24 ? 463  LYS D CA  1 
ATOM   8219  C  C   . LYS D  2  351 ? 52.669  4.491   33.835  1.00 12.15 ? 463  LYS D C   1 
ATOM   8220  O  O   . LYS D  2  351 ? 52.400  3.307   34.095  1.00 11.41 ? 463  LYS D O   1 
ATOM   8221  C  CB  . LYS D  2  351 ? 53.038  6.227   35.632  1.00 13.33 ? 463  LYS D CB  1 
ATOM   8222  C  CG  . LYS D  2  351 ? 53.940  6.791   36.748  1.00 16.12 ? 463  LYS D CG  1 
ATOM   8223  C  CD  . LYS D  2  351 ? 53.241  7.941   37.487  1.00 18.32 ? 463  LYS D CD  1 
ATOM   8224  C  CE  . LYS D  2  351 ? 53.922  8.316   38.803  1.00 19.37 ? 463  LYS D CE  1 
ATOM   8225  N  NZ  . LYS D  2  351 ? 53.483  7.454   39.942  1.00 21.04 ? 463  LYS D NZ  1 
ATOM   8226  N  N   . LEU D  2  352 ? 52.090  5.178   32.840  1.00 11.66 ? 464  LEU D N   1 
ATOM   8227  C  CA  . LEU D  2  352 ? 51.123  4.568   31.939  1.00 10.21 ? 464  LEU D CA  1 
ATOM   8228  C  C   . LEU D  2  352 ? 51.768  3.447   31.124  1.00 10.89 ? 464  LEU D C   1 
ATOM   8229  O  O   . LEU D  2  352 ? 51.220  2.350   31.076  1.00 11.13 ? 464  LEU D O   1 
ATOM   8230  C  CB  . LEU D  2  352 ? 50.502  5.641   31.034  1.00 8.76  ? 464  LEU D CB  1 
ATOM   8231  C  CG  . LEU D  2  352 ? 49.495  6.582   31.739  1.00 7.72  ? 464  LEU D CG  1 
ATOM   8232  C  CD1 . LEU D  2  352 ? 49.259  7.829   30.904  1.00 6.73  ? 464  LEU D CD1 1 
ATOM   8233  C  CD2 . LEU D  2  352 ? 48.176  5.864   32.013  1.00 6.05  ? 464  LEU D CD2 1 
ATOM   8234  N  N   . MET D  2  353 ? 52.948  3.691   30.519  1.00 10.86 ? 465  MET D N   1 
ATOM   8235  C  CA  . MET D  2  353 ? 53.652  2.609   29.787  1.00 14.15 ? 465  MET D CA  1 
ATOM   8236  C  C   . MET D  2  353 ? 53.929  1.409   30.701  1.00 13.25 ? 465  MET D C   1 
ATOM   8237  O  O   . MET D  2  353 ? 53.727  0.267   30.317  1.00 12.92 ? 465  MET D O   1 
ATOM   8238  C  CB  . MET D  2  353 ? 54.993  3.082   29.151  1.00 11.29 ? 465  MET D CB  1 
ATOM   8239  C  CG  . MET D  2  353 ? 54.880  3.608   27.724  1.00 18.81 ? 465  MET D CG  1 
ATOM   8240  S  SD  . MET D  2  353 ? 54.150  2.420   26.558  1.00 22.21 ? 465  MET D SD  1 
ATOM   8241  C  CE  . MET D  2  353 ? 55.188  2.565   25.117  1.00 22.46 ? 465  MET D CE  1 
ATOM   8242  N  N   . GLU D  2  354 ? 54.361  1.681   31.922  1.00 15.64 ? 466  GLU D N   1 
ATOM   8243  C  CA  . GLU D  2  354 ? 54.695  0.618   32.883  1.00 16.89 ? 466  GLU D CA  1 
ATOM   8244  C  C   . GLU D  2  354 ? 53.463  -0.182  33.337  1.00 15.38 ? 466  GLU D C   1 
ATOM   8245  O  O   . GLU D  2  354 ? 53.563  -1.346  33.709  1.00 16.20 ? 466  GLU D O   1 
ATOM   8246  C  CB  . GLU D  2  354 ? 55.407  1.254   34.069  1.00 19.72 ? 466  GLU D CB  1 
ATOM   8247  C  CG  . GLU D  2  354 ? 55.578  0.412   35.309  1.00 24.16 ? 466  GLU D CG  1 
ATOM   8248  C  CD  . GLU D  2  354 ? 55.909  1.325   36.471  1.00 30.05 ? 466  GLU D CD  1 
ATOM   8249  O  OE1 . GLU D  2  354 ? 55.043  1.511   37.361  1.00 33.64 ? 466  GLU D OE1 1 
ATOM   8250  O  OE2 . GLU D  2  354 ? 57.022  1.896   36.470  1.00 32.97 ? 466  GLU D OE2 1 
ATOM   8251  N  N   . GLN D  2  355 ? 52.316  0.429   33.312  1.00 12.65 ? 467  GLN D N   1 
ATOM   8252  C  CA  . GLN D  2  355 ? 51.143  -0.295  33.678  1.00 12.32 ? 467  GLN D CA  1 
ATOM   8253  C  C   . GLN D  2  355 ? 50.598  -1.071  32.506  1.00 10.25 ? 467  GLN D C   1 
ATOM   8254  O  O   . GLN D  2  355 ? 50.270  -2.245  32.640  1.00 10.91 ? 467  GLN D O   1 
ATOM   8255  C  CB  . GLN D  2  355 ? 50.073  0.664   34.197  1.00 14.61 ? 467  GLN D CB  1 
ATOM   8256  C  CG  . GLN D  2  355 ? 50.264  1.093   35.646  1.00 17.26 ? 467  GLN D CG  1 
ATOM   8257  C  CD  . GLN D  2  355 ? 50.236  -0.084  36.628  1.00 15.62 ? 467  GLN D CD  1 
ATOM   8258  O  OE1 . GLN D  2  355 ? 49.250  -0.810  36.740  1.00 13.57 ? 467  GLN D OE1 1 
ATOM   8259  N  NE2 . GLN D  2  355 ? 51.315  -0.264  37.345  1.00 15.03 ? 467  GLN D NE2 1 
ATOM   8260  N  N   . TYR D  2  356 ? 50.557  -0.426  31.351  1.00 10.55 ? 468  TYR D N   1 
ATOM   8261  C  CA  . TYR D  2  356 ? 49.849  -0.975  30.186  1.00 12.19 ? 468  TYR D CA  1 
ATOM   8262  C  C   . TYR D  2  356 ? 50.728  -1.643  29.100  1.00 11.90 ? 468  TYR D C   1 
ATOM   8263  O  O   . TYR D  2  356 ? 50.205  -2.439  28.302  1.00 11.05 ? 468  TYR D O   1 
ATOM   8264  C  CB  . TYR D  2  356 ? 49.002  0.145   29.563  1.00 12.13 ? 468  TYR D CB  1 
ATOM   8265  C  CG  . TYR D  2  356 ? 47.825  0.576   30.411  1.00 12.48 ? 468  TYR D CG  1 
ATOM   8266  C  CD1 . TYR D  2  356 ? 46.658  -0.207  30.447  1.00 12.03 ? 468  TYR D CD1 1 
ATOM   8267  C  CD2 . TYR D  2  356 ? 47.833  1.795   31.118  1.00 9.56  ? 468  TYR D CD2 1 
ATOM   8268  C  CE1 . TYR D  2  356 ? 45.527  0.208   31.147  1.00 8.41  ? 468  TYR D CE1 1 
ATOM   8269  C  CE2 . TYR D  2  356 ? 46.706  2.214   31.827  1.00 9.93  ? 468  TYR D CE2 1 
ATOM   8270  C  CZ  . TYR D  2  356 ? 45.548  1.410   31.833  1.00 10.32 ? 468  TYR D CZ  1 
ATOM   8271  O  OH  . TYR D  2  356 ? 44.426  1.805   32.527  1.00 9.70  ? 468  TYR D OH  1 
ATOM   8272  N  N   . GLY D  2  357 ? 52.032  -1.308  29.049  1.00 11.57 ? 469  GLY D N   1 
ATOM   8273  C  CA  . GLY D  2  357 ? 52.925  -1.889  28.047  1.00 10.65 ? 469  GLY D CA  1 
ATOM   8274  C  C   . GLY D  2  357 ? 52.878  -1.182  26.693  1.00 11.49 ? 469  GLY D C   1 
ATOM   8275  O  O   . GLY D  2  357 ? 53.865  -1.153  25.974  1.00 12.80 ? 469  GLY D O   1 
ATOM   8276  N  N   . THR D  2  358 ? 51.716  -0.614  26.362  1.00 11.83 ? 470  THR D N   1 
ATOM   8277  C  CA  . THR D  2  358 ? 51.465  0.087   25.093  1.00 11.25 ? 470  THR D CA  1 
ATOM   8278  C  C   . THR D  2  358 ? 50.329  1.088   25.276  1.00 10.21 ? 470  THR D C   1 
ATOM   8279  O  O   . THR D  2  358 ? 49.365  0.797   25.993  1.00 11.11 ? 470  THR D O   1 
ATOM   8280  C  CB  . THR D  2  358 ? 51.033  -0.900  23.967  1.00 9.09  ? 470  THR D CB  1 
ATOM   8281  O  OG1 . THR D  2  358 ? 50.634  -0.149  22.821  1.00 10.25 ? 470  THR D OG1 1 
ATOM   8282  C  CG2 . THR D  2  358 ? 49.868  -1.777  24.399  1.00 8.87  ? 470  THR D CG2 1 
ATOM   8283  N  N   . PRO D  2  359 ? 50.411  2.301   24.700  1.00 9.63  ? 471  PRO D N   1 
ATOM   8284  C  CA  . PRO D  2  359 ? 49.312  3.274   24.827  1.00 8.33  ? 471  PRO D CA  1 
ATOM   8285  C  C   . PRO D  2  359 ? 47.996  2.732   24.182  1.00 7.76  ? 471  PRO D C   1 
ATOM   8286  O  O   . PRO D  2  359 ? 46.895  3.179   24.519  1.00 10.33 ? 471  PRO D O   1 
ATOM   8287  C  CB  . PRO D  2  359 ? 49.861  4.523   24.127  1.00 10.02 ? 471  PRO D CB  1 
ATOM   8288  C  CG  . PRO D  2  359 ? 51.347  4.341   24.245  1.00 9.12  ? 471  PRO D CG  1 
ATOM   8289  C  CD  . PRO D  2  359 ? 51.564  2.882   23.977  1.00 7.64  ? 471  PRO D CD  1 
ATOM   8290  N  N   . ASN D  2  360 ? 48.106  1.748   23.277  1.00 6.59  ? 472  ASN D N   1 
ATOM   8291  C  CA  . ASN D  2  360 ? 46.909  1.122   22.675  1.00 7.99  ? 472  ASN D CA  1 
ATOM   8292  C  C   . ASN D  2  360 ? 45.980  0.490   23.738  1.00 8.88  ? 472  ASN D C   1 
ATOM   8293  O  O   . ASN D  2  360 ? 44.764  0.378   23.533  1.00 7.46  ? 472  ASN D O   1 
ATOM   8294  C  CB  . ASN D  2  360 ? 47.296  0.027   21.679  1.00 8.84  ? 472  ASN D CB  1 
ATOM   8295  C  CG  . ASN D  2  360 ? 47.909  0.546   20.403  1.00 8.27  ? 472  ASN D CG  1 
ATOM   8296  O  OD1 . ASN D  2  360 ? 47.482  1.553   19.861  1.00 10.36 ? 472  ASN D OD1 1 
ATOM   8297  N  ND2 . ASN D  2  360 ? 48.900  -0.157  19.902  1.00 7.56  ? 472  ASN D ND2 1 
ATOM   8298  N  N   . ASN D  2  361 ? 46.564  0.090   24.879  1.00 10.16 ? 473  ASN D N   1 
ATOM   8299  C  CA  . ASN D  2  361 ? 45.824  -0.602  25.921  1.00 10.00 ? 473  ASN D CA  1 
ATOM   8300  C  C   . ASN D  2  361 ? 45.394  0.286   27.089  1.00 9.52  ? 473  ASN D C   1 
ATOM   8301  O  O   . ASN D  2  361 ? 44.732  -0.180  28.011  1.00 8.59  ? 473  ASN D O   1 
ATOM   8302  C  CB  . ASN D  2  361 ? 46.637  -1.791  26.446  1.00 11.80 ? 473  ASN D CB  1 
ATOM   8303  C  CG  . ASN D  2  361 ? 46.698  -2.982  25.482  1.00 11.65 ? 473  ASN D CG  1 
ATOM   8304  O  OD1 . ASN D  2  361 ? 46.273  -2.909  24.311  1.00 10.56 ? 473  ASN D OD1 1 
ATOM   8305  N  ND2 . ASN D  2  361 ? 47.233  -4.087  25.983  1.00 9.67  ? 473  ASN D ND2 1 
ATOM   8306  N  N   . ILE D  2  362 ? 45.765  1.551   27.077  1.00 10.20 ? 474  ILE D N   1 
ATOM   8307  C  CA  . ILE D  2  362 ? 45.313  2.443   28.132  1.00 8.91  ? 474  ILE D CA  1 
ATOM   8308  C  C   . ILE D  2  362 ? 43.774  2.487   28.124  1.00 9.79  ? 474  ILE D C   1 
ATOM   8309  O  O   . ILE D  2  362 ? 43.163  2.780   27.082  1.00 8.40  ? 474  ILE D O   1 
ATOM   8310  C  CB  . ILE D  2  362 ? 45.882  3.875   27.944  1.00 8.21  ? 474  ILE D CB  1 
ATOM   8311  C  CG1 . ILE D  2  362 ? 47.407  3.836   28.016  1.00 5.36  ? 474  ILE D CG1 1 
ATOM   8312  C  CG2 . ILE D  2  362 ? 45.342  4.812   29.013  1.00 7.96  ? 474  ILE D CG2 1 
ATOM   8313  C  CD1 . ILE D  2  362 ? 48.048  5.178   27.739  1.00 7.96  ? 474  ILE D CD1 1 
ATOM   8314  N  N   . ASP D  2  363 ? 43.162  2.138   29.270  1.00 8.91  ? 475  ASP D N   1 
ATOM   8315  C  CA  . ASP D  2  363 ? 41.696  2.184   29.418  1.00 8.38  ? 475  ASP D CA  1 
ATOM   8316  C  C   . ASP D  2  363 ? 41.198  3.607   29.173  1.00 7.62  ? 475  ASP D C   1 
ATOM   8317  O  O   . ASP D  2  363 ? 41.867  4.572   29.581  1.00 8.79  ? 475  ASP D O   1 
ATOM   8318  C  CB  . ASP D  2  363 ? 41.289  1.728   30.799  1.00 7.78  ? 475  ASP D CB  1 
ATOM   8319  C  CG  . ASP D  2  363 ? 41.723  0.312   31.104  1.00 10.07 ? 475  ASP D CG  1 
ATOM   8320  O  OD1 . ASP D  2  363 ? 42.482  0.138   32.078  1.00 8.36  ? 475  ASP D OD1 1 
ATOM   8321  O  OD2 . ASP D  2  363 ? 41.291  -0.631  30.383  1.00 6.87  ? 475  ASP D OD2 1 
ATOM   8322  N  N   . ILE D  2  364 ? 40.030  3.730   28.497  1.00 6.96  ? 476  ILE D N   1 
ATOM   8323  C  CA  . ILE D  2  364 ? 39.501  5.044   28.047  1.00 7.13  ? 476  ILE D CA  1 
ATOM   8324  C  C   . ILE D  2  364 ? 39.366  6.143   29.150  1.00 3.07  ? 476  ILE D C   1 
ATOM   8325  O  O   . ILE D  2  364 ? 39.774  7.282   28.932  1.00 3.55  ? 476  ILE D O   1 
ATOM   8326  C  CB  . ILE D  2  364 ? 38.169  4.881   27.250  1.00 6.02  ? 476  ILE D CB  1 
ATOM   8327  C  CG1 . ILE D  2  364 ? 37.676  6.252   26.762  1.00 8.64  ? 476  ILE D CG1 1 
ATOM   8328  C  CG2 . ILE D  2  364 ? 37.116  4.215   28.109  1.00 6.78  ? 476  ILE D CG2 1 
ATOM   8329  C  CD1 . ILE D  2  364 ? 38.643  6.939   25.809  1.00 7.45  ? 476  ILE D CD1 1 
ATOM   8330  N  N   . TRP D  2  365 ? 38.819  5.822   30.317  1.00 3.02  ? 477  TRP D N   1 
ATOM   8331  C  CA  . TRP D  2  365 ? 38.764  6.808   31.399  1.00 5.28  ? 477  TRP D CA  1 
ATOM   8332  C  C   . TRP D  2  365 ? 40.177  7.264   31.841  1.00 5.68  ? 477  TRP D C   1 
ATOM   8333  O  O   . TRP D  2  365 ? 40.430  8.456   32.015  1.00 3.09  ? 477  TRP D O   1 
ATOM   8334  C  CB  . TRP D  2  365 ? 38.036  6.250   32.626  1.00 3.86  ? 477  TRP D CB  1 
ATOM   8335  C  CG  . TRP D  2  365 ? 37.916  7.251   33.744  1.00 4.41  ? 477  TRP D CG  1 
ATOM   8336  C  CD1 . TRP D  2  365 ? 36.979  8.229   33.869  1.00 3.80  ? 477  TRP D CD1 1 
ATOM   8337  C  CD2 . TRP D  2  365 ? 38.779  7.395   34.867  1.00 6.29  ? 477  TRP D CD2 1 
ATOM   8338  N  NE1 . TRP D  2  365 ? 37.197  8.977   34.994  1.00 2.11  ? 477  TRP D NE1 1 
ATOM   8339  C  CE2 . TRP D  2  365 ? 38.298  8.489   35.623  1.00 3.87  ? 477  TRP D CE2 1 
ATOM   8340  C  CE3 . TRP D  2  365 ? 39.934  6.704   35.320  1.00 6.87  ? 477  TRP D CE3 1 
ATOM   8341  C  CZ2 . TRP D  2  365 ? 38.921  8.909   36.802  1.00 6.76  ? 477  TRP D CZ2 1 
ATOM   8342  C  CZ3 . TRP D  2  365 ? 40.547  7.134   36.492  1.00 7.45  ? 477  TRP D CZ3 1 
ATOM   8343  C  CH2 . TRP D  2  365 ? 40.042  8.223   37.217  1.00 7.10  ? 477  TRP D CH2 1 
ATOM   8344  N  N   . MET D  2  366 ? 41.084  6.304   32.054  1.00 5.95  ? 478  MET D N   1 
ATOM   8345  C  CA  . MET D  2  366 ? 42.438  6.616   32.497  1.00 4.78  ? 478  MET D CA  1 
ATOM   8346  C  C   . MET D  2  366 ? 43.137  7.538   31.496  1.00 3.99  ? 478  MET D C   1 
ATOM   8347  O  O   . MET D  2  366 ? 43.624  8.594   31.876  1.00 5.46  ? 478  MET D O   1 
ATOM   8348  C  CB  . MET D  2  366 ? 43.240  5.320   32.691  1.00 5.83  ? 478  MET D CB  1 
ATOM   8349  C  CG  . MET D  2  366 ? 44.563  5.497   33.464  1.00 3.86  ? 478  MET D CG  1 
ATOM   8350  S  SD  . MET D  2  366 ? 44.314  5.910   35.211  1.00 6.92  ? 478  MET D SD  1 
ATOM   8351  C  CE  . MET D  2  366 ? 44.590  7.669   35.220  1.00 6.25  ? 478  MET D CE  1 
ATOM   8352  N  N   . GLY D  2  367 ? 43.153  7.145   30.216  1.00 4.89  ? 479  GLY D N   1 
ATOM   8353  C  CA  . GLY D  2  367 ? 43.775  7.957   29.184  1.00 4.34  ? 479  GLY D CA  1 
ATOM   8354  C  C   . GLY D  2  367 ? 43.127  9.311   29.057  1.00 4.54  ? 479  GLY D C   1 
ATOM   8355  O  O   . GLY D  2  367 ? 43.817  10.325  28.871  1.00 2.00  ? 479  GLY D O   1 
ATOM   8356  N  N   . GLY D  2  368 ? 41.773  9.304   29.176  1.00 6.80  ? 480  GLY D N   1 
ATOM   8357  C  CA  . GLY D  2  368 ? 40.959  10.521  29.084  1.00 6.44  ? 480  GLY D CA  1 
ATOM   8358  C  C   . GLY D  2  368 ? 41.262  11.543  30.176  1.00 4.97  ? 480  GLY D C   1 
ATOM   8359  O  O   . GLY D  2  368 ? 41.478  12.718  29.892  1.00 7.29  ? 480  GLY D O   1 
ATOM   8360  N  N   . VAL D  2  369 ? 41.259  11.110  31.429  1.00 6.31  ? 481  VAL D N   1 
ATOM   8361  C  CA  . VAL D  2  369 ? 41.527  12.039  32.513  1.00 5.70  ? 481  VAL D CA  1 
ATOM   8362  C  C   . VAL D  2  369 ? 43.007  12.363  32.630  1.00 8.90  ? 481  VAL D C   1 
ATOM   8363  O  O   . VAL D  2  369 ? 43.354  13.304  33.335  1.00 8.90  ? 481  VAL D O   1 
ATOM   8364  C  CB  . VAL D  2  369 ? 40.999  11.531  33.868  1.00 5.09  ? 481  VAL D CB  1 
ATOM   8365  C  CG1 . VAL D  2  369 ? 39.479  11.380  33.761  1.00 3.59  ? 481  VAL D CG1 1 
ATOM   8366  C  CG2 . VAL D  2  369 ? 41.663  10.207  34.264  1.00 2.00  ? 481  VAL D CG2 1 
ATOM   8367  N  N   . SER D  2  370 ? 43.872  11.598  31.902  1.00 10.88 ? 482  SER D N   1 
ATOM   8368  C  CA  . SER D  2  370 ? 45.339  11.797  31.932  1.00 10.07 ? 482  SER D CA  1 
ATOM   8369  C  C   . SER D  2  370 ? 45.781  12.939  31.043  1.00 11.01 ? 482  SER D C   1 
ATOM   8370  O  O   . SER D  2  370 ? 46.804  13.571  31.318  1.00 9.87  ? 482  SER D O   1 
ATOM   8371  C  CB  . SER D  2  370 ? 46.091  10.515  31.529  1.00 10.15 ? 482  SER D CB  1 
ATOM   8372  O  OG  . SER D  2  370 ? 46.175  9.580   32.605  1.00 10.12 ? 482  SER D OG  1 
ATOM   8373  N  N   . GLU D  2  371 ? 45.005  13.217  29.982  1.00 8.77  ? 483  GLU D N   1 
ATOM   8374  C  CA  . GLU D  2  371 ? 45.348  14.309  29.077  1.00 10.21 ? 483  GLU D CA  1 
ATOM   8375  C  C   . GLU D  2  371 ? 45.229  15.684  29.744  1.00 10.88 ? 483  GLU D C   1 
ATOM   8376  O  O   . GLU D  2  371 ? 44.315  15.931  30.566  1.00 12.00 ? 483  GLU D O   1 
ATOM   8377  C  CB  . GLU D  2  371 ? 44.453  14.311  27.825  1.00 9.65  ? 483  GLU D CB  1 
ATOM   8378  C  CG  . GLU D  2  371 ? 44.742  13.166  26.859  1.00 12.48 ? 483  GLU D CG  1 
ATOM   8379  C  CD  . GLU D  2  371 ? 43.971  13.246  25.541  1.00 12.08 ? 483  GLU D CD  1 
ATOM   8380  O  OE1 . GLU D  2  371 ? 44.307  12.468  24.603  1.00 9.16  ? 483  GLU D OE1 1 
ATOM   8381  O  OE2 . GLU D  2  371 ? 43.039  14.083  25.441  1.00 11.33 ? 483  GLU D OE2 1 
ATOM   8382  N  N   . PRO D  2  372 ? 46.188  16.591  29.434  1.00 9.60  ? 484  PRO D N   1 
ATOM   8383  C  CA  . PRO D  2  372 ? 46.182  17.961  29.962  1.00 9.26  ? 484  PRO D CA  1 
ATOM   8384  C  C   . PRO D  2  372 ? 44.899  18.680  29.490  1.00 8.55  ? 484  PRO D C   1 
ATOM   8385  O  O   . PRO D  2  372 ? 44.430  18.479  28.355  1.00 6.05  ? 484  PRO D O   1 
ATOM   8386  C  CB  . PRO D  2  372 ? 47.463  18.564  29.383  1.00 9.92  ? 484  PRO D CB  1 
ATOM   8387  C  CG  . PRO D  2  372 ? 47.691  17.741  28.163  1.00 8.48  ? 484  PRO D CG  1 
ATOM   8388  C  CD  . PRO D  2  372 ? 47.356  16.346  28.583  1.00 8.43  ? 484  PRO D CD  1 
ATOM   8389  N  N   . LEU D  2  373 ? 44.340  19.504  30.372  1.00 10.77 ? 485  LEU D N   1 
ATOM   8390  C  CA  . LEU D  2  373 ? 43.055  20.165  30.152  1.00 9.87  ? 485  LEU D CA  1 
ATOM   8391  C  C   . LEU D  2  373 ? 43.129  21.277  29.165  1.00 9.49  ? 485  LEU D C   1 
ATOM   8392  O  O   . LEU D  2  373 ? 44.056  22.064  29.171  1.00 7.32  ? 485  LEU D O   1 
ATOM   8393  C  CB  . LEU D  2  373 ? 42.508  20.713  31.461  1.00 9.55  ? 485  LEU D CB  1 
ATOM   8394  C  CG  . LEU D  2  373 ? 42.552  19.765  32.661  1.00 10.75 ? 485  LEU D CG  1 
ATOM   8395  C  CD1 . LEU D  2  373 ? 41.896  20.433  33.856  1.00 12.35 ? 485  LEU D CD1 1 
ATOM   8396  C  CD2 . LEU D  2  373 ? 41.863  18.436  32.331  1.00 8.00  ? 485  LEU D CD2 1 
ATOM   8397  N  N   . LYS D  2  374 ? 42.127  21.338  28.310  1.00 10.81 ? 486  LYS D N   1 
ATOM   8398  C  CA  . LYS D  2  374 ? 42.022  22.409  27.343  1.00 12.00 ? 486  LYS D CA  1 
ATOM   8399  C  C   . LYS D  2  374 ? 41.896  23.766  28.045  1.00 11.91 ? 486  LYS D C   1 
ATOM   8400  O  O   . LYS D  2  374 ? 41.384  23.873  29.158  1.00 12.15 ? 486  LYS D O   1 
ATOM   8401  C  CB  . LYS D  2  374 ? 40.825  22.157  26.427  1.00 14.02 ? 486  LYS D CB  1 
ATOM   8402  C  CG  . LYS D  2  374 ? 41.084  21.053  25.403  1.00 17.26 ? 486  LYS D CG  1 
ATOM   8403  C  CD  . LYS D  2  374 ? 39.845  20.771  24.580  1.00 21.19 ? 486  LYS D CD  1 
ATOM   8404  C  CE  . LYS D  2  374 ? 40.159  20.791  23.088  1.00 24.51 ? 486  LYS D CE  1 
ATOM   8405  N  NZ  . LYS D  2  374 ? 40.604  22.140  22.620  1.00 22.43 ? 486  LYS D NZ  1 
ATOM   8406  N  N   . ARG D  2  375 ? 42.404  24.794  27.403  1.00 13.68 ? 487  ARG D N   1 
ATOM   8407  C  CA  . ARG D  2  375 ? 42.332  26.142  27.943  1.00 15.12 ? 487  ARG D CA  1 
ATOM   8408  C  C   . ARG D  2  375 ? 40.865  26.525  28.236  1.00 13.48 ? 487  ARG D C   1 
ATOM   8409  O  O   . ARG D  2  375 ? 40.014  26.458  27.339  1.00 13.03 ? 487  ARG D O   1 
ATOM   8410  C  CB  . ARG D  2  375 ? 42.944  27.102  26.920  1.00 18.81 ? 487  ARG D CB  1 
ATOM   8411  C  CG  . ARG D  2  375 ? 43.195  28.516  27.419  1.00 22.91 ? 487  ARG D CG  1 
ATOM   8412  C  CD  . ARG D  2  375 ? 43.712  29.384  26.275  1.00 27.66 ? 487  ARG D CD  1 
ATOM   8413  N  NE  . ARG D  2  375 ? 42.715  30.327  25.773  1.00 30.21 ? 487  ARG D NE  1 
ATOM   8414  C  CZ  . ARG D  2  375 ? 42.327  31.425  26.438  1.00 32.56 ? 487  ARG D CZ  1 
ATOM   8415  N  NH1 . ARG D  2  375 ? 42.848  31.710  27.634  1.00 30.73 ? 487  ARG D NH1 1 
ATOM   8416  N  NH2 . ARG D  2  375 ? 41.417  32.233  25.910  1.00 33.46 ? 487  ARG D NH2 1 
ATOM   8417  N  N   . LYS D  2  376 ? 40.588  26.891  29.494  1.00 11.18 ? 488  LYS D N   1 
ATOM   8418  C  CA  . LYS D  2  376 ? 39.243  27.276  29.939  1.00 14.24 ? 488  LYS D CA  1 
ATOM   8419  C  C   . LYS D  2  376 ? 38.259  26.090  29.929  1.00 12.68 ? 488  LYS D C   1 
ATOM   8420  O  O   . LYS D  2  376 ? 37.031  26.264  30.013  1.00 12.22 ? 488  LYS D O   1 
ATOM   8421  C  CB  . LYS D  2  376 ? 38.711  28.437  29.097  1.00 12.68 ? 488  LYS D CB  1 
ATOM   8422  C  CG  . LYS D  2  376 ? 39.411  29.739  29.367  1.00 14.73 ? 488  LYS D CG  1 
ATOM   8423  C  CD  . LYS D  2  376 ? 38.936  30.824  28.438  1.00 21.29 ? 488  LYS D CD  1 
ATOM   8424  C  CE  . LYS D  2  376 ? 37.526  31.287  28.776  1.00 24.74 ? 488  LYS D CE  1 
ATOM   8425  N  NZ  . LYS D  2  376 ? 37.093  32.416  27.905  1.00 27.48 ? 488  LYS D NZ  1 
ATOM   8426  N  N   . GLY D  2  377 ? 38.833  24.885  29.855  1.00 12.39 ? 489  GLY D N   1 
ATOM   8427  C  CA  . GLY D  2  377 ? 38.076  23.653  29.907  1.00 10.10 ? 489  GLY D CA  1 
ATOM   8428  C  C   . GLY D  2  377 ? 38.578  22.752  31.023  1.00 11.02 ? 489  GLY D C   1 
ATOM   8429  O  O   . GLY D  2  377 ? 39.632  23.023  31.630  1.00 11.36 ? 489  GLY D O   1 
ATOM   8430  N  N   . ARG D  2  378 ? 37.828  21.691  31.329  1.00 9.77  ? 490  ARG D N   1 
ATOM   8431  C  CA  . ARG D  2  378 ? 38.242  20.767  32.383  1.00 9.00  ? 490  ARG D CA  1 
ATOM   8432  C  C   . ARG D  2  378 ? 38.381  19.314  31.899  1.00 7.84  ? 490  ARG D C   1 
ATOM   8433  O  O   . ARG D  2  378 ? 38.325  18.376  32.679  1.00 9.13  ? 490  ARG D O   1 
ATOM   8434  C  CB  . ARG D  2  378 ? 37.324  20.875  33.597  1.00 6.64  ? 490  ARG D CB  1 
ATOM   8435  C  CG  . ARG D  2  378 ? 37.437  22.221  34.307  1.00 8.36  ? 490  ARG D CG  1 
ATOM   8436  C  CD  . ARG D  2  378 ? 38.862  22.513  34.811  1.00 8.55  ? 490  ARG D CD  1 
ATOM   8437  N  NE  . ARG D  2  378 ? 38.914  23.750  35.592  1.00 7.01  ? 490  ARG D NE  1 
ATOM   8438  C  CZ  . ARG D  2  378 ? 39.134  24.964  35.093  1.00 7.21  ? 490  ARG D CZ  1 
ATOM   8439  N  NH1 . ARG D  2  378 ? 39.336  25.139  33.787  1.00 11.01 ? 490  ARG D NH1 1 
ATOM   8440  N  NH2 . ARG D  2  378 ? 39.146  26.011  35.902  1.00 8.33  ? 490  ARG D NH2 1 
ATOM   8441  N  N   . VAL D  2  379 ? 38.561  19.160  30.596  1.00 7.00  ? 491  VAL D N   1 
ATOM   8442  C  CA  . VAL D  2  379 ? 38.913  17.897  29.993  1.00 5.39  ? 491  VAL D CA  1 
ATOM   8443  C  C   . VAL D  2  379 ? 39.896  18.194  28.892  1.00 4.80  ? 491  VAL D C   1 
ATOM   8444  O  O   . VAL D  2  379 ? 39.995  19.349  28.430  1.00 7.15  ? 491  VAL D O   1 
ATOM   8445  C  CB  . VAL D  2  379 ? 37.711  17.113  29.374  1.00 6.66  ? 491  VAL D CB  1 
ATOM   8446  C  CG1 . VAL D  2  379 ? 36.714  16.702  30.455  1.00 4.03  ? 491  VAL D CG1 1 
ATOM   8447  C  CG2 . VAL D  2  379 ? 37.020  17.943  28.289  1.00 9.72  ? 491  VAL D CG2 1 
ATOM   8448  N  N   . GLY D  2  380 ? 40.621  17.176  28.483  1.00 4.77  ? 492  GLY D N   1 
ATOM   8449  C  CA  . GLY D  2  380 ? 41.537  17.299  27.354  1.00 5.87  ? 492  GLY D CA  1 
ATOM   8450  C  C   . GLY D  2  380 ? 40.863  17.030  26.000  1.00 4.55  ? 492  GLY D C   1 
ATOM   8451  O  O   . GLY D  2  380 ? 39.641  16.814  25.955  1.00 2.91  ? 492  GLY D O   1 
ATOM   8452  N  N   . PRO D  2  381 ? 41.646  17.023  24.875  1.00 5.91  ? 493  PRO D N   1 
ATOM   8453  C  CA  . PRO D  2  381 ? 41.128  16.793  23.512  1.00 6.65  ? 493  PRO D CA  1 
ATOM   8454  C  C   . PRO D  2  381 ? 40.276  15.518  23.323  1.00 7.84  ? 493  PRO D C   1 
ATOM   8455  O  O   . PRO D  2  381 ? 39.237  15.538  22.636  1.00 6.54  ? 493  PRO D O   1 
ATOM   8456  C  CB  . PRO D  2  381 ? 42.401  16.775  22.660  1.00 6.02  ? 493  PRO D CB  1 
ATOM   8457  C  CG  . PRO D  2  381 ? 43.297  17.686  23.398  1.00 6.98  ? 493  PRO D CG  1 
ATOM   8458  C  CD  . PRO D  2  381 ? 43.110  17.282  24.824  1.00 6.57  ? 493  PRO D CD  1 
ATOM   8459  N  N   . LEU D  2  382 ? 40.709  14.404  23.900  1.00 6.88  ? 494  LEU D N   1 
ATOM   8460  C  CA  . LEU D  2  382 ? 39.974  13.169  23.704  1.00 9.63  ? 494  LEU D CA  1 
ATOM   8461  C  C   . LEU D  2  382 ? 38.577  13.226  24.366  1.00 7.31  ? 494  LEU D C   1 
ATOM   8462  O  O   . LEU D  2  382 ? 37.574  13.014  23.695  1.00 9.41  ? 494  LEU D O   1 
ATOM   8463  C  CB  . LEU D  2  382 ? 40.788  11.945  24.207  1.00 7.44  ? 494  LEU D CB  1 
ATOM   8464  C  CG  . LEU D  2  382 ? 40.142  10.553  23.971  1.00 5.54  ? 494  LEU D CG  1 
ATOM   8465  C  CD1 . LEU D  2  382 ? 39.755  10.369  22.515  1.00 2.00  ? 494  LEU D CD1 1 
ATOM   8466  C  CD2 . LEU D  2  382 ? 41.113  9.455   24.400  1.00 6.52  ? 494  LEU D CD2 1 
ATOM   8467  N  N   . LEU D  2  383 ? 38.532  13.510  25.653  1.00 6.00  ? 495  LEU D N   1 
ATOM   8468  C  CA  . LEU D  2  383 ? 37.289  13.595  26.358  1.00 7.53  ? 495  LEU D CA  1 
ATOM   8469  C  C   . LEU D  2  383 ? 36.428  14.697  25.795  1.00 9.41  ? 495  LEU D C   1 
ATOM   8470  O  O   . LEU D  2  383 ? 35.227  14.540  25.717  1.00 10.22 ? 495  LEU D O   1 
ATOM   8471  C  CB  . LEU D  2  383 ? 37.525  13.813  27.833  1.00 5.83  ? 495  LEU D CB  1 
ATOM   8472  C  CG  . LEU D  2  383 ? 38.082  12.613  28.594  1.00 7.62  ? 495  LEU D CG  1 
ATOM   8473  C  CD1 . LEU D  2  383 ? 38.217  12.938  30.080  1.00 5.70  ? 495  LEU D CD1 1 
ATOM   8474  C  CD2 . LEU D  2  383 ? 37.159  11.417  28.380  1.00 10.59 ? 495  LEU D CD2 1 
ATOM   8475  N  N   . ALA D  2  384 ? 37.048  15.811  25.385  1.00 10.56 ? 496  ALA D N   1 
ATOM   8476  C  CA  . ALA D  2  384 ? 36.307  16.909  24.719  1.00 10.27 ? 496  ALA D CA  1 
ATOM   8477  C  C   . ALA D  2  384 ? 35.611  16.403  23.461  1.00 8.44  ? 496  ALA D C   1 
ATOM   8478  O  O   . ALA D  2  384 ? 34.446  16.720  23.245  1.00 6.75  ? 496  ALA D O   1 
ATOM   8479  C  CB  . ALA D  2  384 ? 37.229  18.068  24.336  1.00 10.39 ? 496  ALA D CB  1 
ATOM   8480  N  N   . CYS D  2  385 ? 36.336  15.628  22.645  1.00 6.36  ? 497  CYS D N   1 
ATOM   8481  C  CA  . CYS D  2  385 ? 35.775  15.029  21.431  1.00 8.24  ? 497  CYS D CA  1 
ATOM   8482  C  C   . CYS D  2  385 ? 34.612  14.099  21.746  1.00 9.10  ? 497  CYS D C   1 
ATOM   8483  O  O   . CYS D  2  385 ? 33.553  14.174  21.084  1.00 7.91  ? 497  CYS D O   1 
ATOM   8484  C  CB  . CYS D  2  385 ? 36.842  14.234  20.645  1.00 9.81  ? 497  CYS D CB  1 
ATOM   8485  S  SG  . CYS D  2  385 ? 36.207  12.980  19.434  1.00 9.13  ? 497  CYS D SG  1 
ATOM   8486  N  N   . ILE D  2  386 ? 34.804  13.229  22.723  1.00 5.14  ? 498  ILE D N   1 
ATOM   8487  C  CA  . ILE D  2  386 ? 33.786  12.270  23.055  1.00 7.71  ? 498  ILE D CA  1 
ATOM   8488  C  C   . ILE D  2  386 ? 32.556  12.941  23.684  1.00 8.42  ? 498  ILE D C   1 
ATOM   8489  O  O   . ILE D  2  386 ? 31.406  12.666  23.283  1.00 6.79  ? 498  ILE D O   1 
ATOM   8490  C  CB  . ILE D  2  386 ? 34.372  11.159  23.960  1.00 6.56  ? 498  ILE D CB  1 
ATOM   8491  C  CG1 . ILE D  2  386 ? 35.396  10.370  23.130  1.00 6.51  ? 498  ILE D CG1 1 
ATOM   8492  C  CG2 . ILE D  2  386 ? 33.276  10.227  24.512  1.00 3.09  ? 498  ILE D CG2 1 
ATOM   8493  C  CD1 . ILE D  2  386 ? 36.329  9.479   23.944  1.00 7.89  ? 498  ILE D CD1 1 
ATOM   8494  N  N   . ILE D  2  387 ? 32.790  13.838  24.627  1.00 6.62  ? 499  ILE D N   1 
ATOM   8495  C  CA  . ILE D  2  387 ? 31.692  14.505  25.288  1.00 6.36  ? 499  ILE D CA  1 
ATOM   8496  C  C   . ILE D  2  387 ? 30.977  15.518  24.368  1.00 6.63  ? 499  ILE D C   1 
ATOM   8497  O  O   . ILE D  2  387 ? 29.746  15.537  24.327  1.00 5.33  ? 499  ILE D O   1 
ATOM   8498  C  CB  . ILE D  2  387 ? 32.186  15.139  26.585  1.00 3.76  ? 499  ILE D CB  1 
ATOM   8499  C  CG1 . ILE D  2  387 ? 32.631  14.014  27.511  1.00 3.98  ? 499  ILE D CG1 1 
ATOM   8500  C  CG2 . ILE D  2  387 ? 31.111  15.973  27.253  1.00 3.35  ? 499  ILE D CG2 1 
ATOM   8501  C  CD1 . ILE D  2  387 ? 33.240  14.508  28.799  1.00 8.33  ? 499  ILE D CD1 1 
ATOM   8502  N  N   . GLY D  2  388 ? 31.741  16.309  23.600  1.00 5.37  ? 500  GLY D N   1 
ATOM   8503  C  CA  . GLY D  2  388 ? 31.158  17.282  22.683  1.00 7.20  ? 500  GLY D CA  1 
ATOM   8504  C  C   . GLY D  2  388 ? 30.315  16.637  21.564  1.00 8.35  ? 500  GLY D C   1 
ATOM   8505  O  O   . GLY D  2  388 ? 29.228  17.135  21.208  1.00 5.01  ? 500  GLY D O   1 
ATOM   8506  N  N   . THR D  2  389 ? 30.820  15.532  20.996  1.00 7.85  ? 501  THR D N   1 
ATOM   8507  C  CA  . THR D  2  389 ? 30.091  14.795  19.965  1.00 9.17  ? 501  THR D CA  1 
ATOM   8508  C  C   . THR D  2  389 ? 28.737  14.257  20.525  1.00 8.57  ? 501  THR D C   1 
ATOM   8509  O  O   . THR D  2  389 ? 27.681  14.437  19.879  1.00 8.35  ? 501  THR D O   1 
ATOM   8510  C  CB  . THR D  2  389 ? 30.972  13.635  19.409  1.00 7.78  ? 501  THR D CB  1 
ATOM   8511  O  OG1 . THR D  2  389 ? 32.105  14.191  18.716  1.00 7.34  ? 501  THR D OG1 1 
ATOM   8512  C  CG2 . THR D  2  389 ? 30.194  12.756  18.432  1.00 10.13 ? 501  THR D CG2 1 
ATOM   8513  N  N   . GLN D  2  390 ? 28.769  13.654  21.755  1.00 6.92  ? 502  GLN D N   1 
ATOM   8514  C  CA  . GLN D  2  390 ? 27.559  13.145  22.409  1.00 7.77  ? 502  GLN D CA  1 
ATOM   8515  C  C   . GLN D  2  390 ? 26.504  14.231  22.624  1.00 7.13  ? 502  GLN D C   1 
ATOM   8516  O  O   . GLN D  2  390 ? 25.343  14.030  22.281  1.00 4.28  ? 502  GLN D O   1 
ATOM   8517  C  CB  . GLN D  2  390 ? 27.858  12.506  23.773  1.00 6.64  ? 502  GLN D CB  1 
ATOM   8518  C  CG  . GLN D  2  390 ? 26.616  11.885  24.422  1.00 6.05  ? 502  GLN D CG  1 
ATOM   8519  C  CD  . GLN D  2  390 ? 26.116  10.619  23.705  1.00 7.63  ? 502  GLN D CD  1 
ATOM   8520  O  OE1 . GLN D  2  390 ? 26.711  9.562   23.832  1.00 4.74  ? 502  GLN D OE1 1 
ATOM   8521  N  NE2 . GLN D  2  390 ? 25.011  10.727  22.954  1.00 4.58  ? 502  GLN D NE2 1 
ATOM   8522  N  N   . PHE D  2  391 ? 26.909  15.372  23.199  1.00 5.75  ? 503  PHE D N   1 
ATOM   8523  C  CA  . PHE D  2  391 ? 25.957  16.437  23.469  1.00 7.64  ? 503  PHE D CA  1 
ATOM   8524  C  C   . PHE D  2  391 ? 25.372  17.085  22.203  1.00 9.75  ? 503  PHE D C   1 
ATOM   8525  O  O   . PHE D  2  391 ? 24.183  17.467  22.204  1.00 9.83  ? 503  PHE D O   1 
ATOM   8526  C  CB  . PHE D  2  391 ? 26.551  17.476  24.426  1.00 4.42  ? 503  PHE D CB  1 
ATOM   8527  C  CG  . PHE D  2  391 ? 26.466  17.022  25.854  1.00 4.31  ? 503  PHE D CG  1 
ATOM   8528  C  CD1 . PHE D  2  391 ? 25.272  17.116  26.567  1.00 5.90  ? 503  PHE D CD1 1 
ATOM   8529  C  CD2 . PHE D  2  391 ? 27.567  16.455  26.493  1.00 2.42  ? 503  PHE D CD2 1 
ATOM   8530  C  CE1 . PHE D  2  391 ? 25.175  16.656  27.888  1.00 6.43  ? 503  PHE D CE1 1 
ATOM   8531  C  CE2 . PHE D  2  391 ? 27.475  15.994  27.803  1.00 3.67  ? 503  PHE D CE2 1 
ATOM   8532  C  CZ  . PHE D  2  391 ? 26.286  16.091  28.504  1.00 5.08  ? 503  PHE D CZ  1 
ATOM   8533  N  N   . ARG D  2  392 ? 26.163  17.180  21.115  1.00 7.17  ? 504  ARG D N   1 
ATOM   8534  C  CA  . ARG D  2  392 ? 25.631  17.744  19.922  1.00 7.66  ? 504  ARG D CA  1 
ATOM   8535  C  C   . ARG D  2  392 ? 24.489  16.867  19.433  1.00 8.39  ? 504  ARG D C   1 
ATOM   8536  O  O   . ARG D  2  392 ? 23.466  17.375  18.991  1.00 7.28  ? 504  ARG D O   1 
ATOM   8537  C  CB  . ARG D  2  392 ? 26.678  17.882  18.814  1.00 8.69  ? 504  ARG D CB  1 
ATOM   8538  C  CG  . ARG D  2  392 ? 26.073  18.625  17.619  1.00 13.16 ? 504  ARG D CG  1 
ATOM   8539  C  CD  . ARG D  2  392 ? 26.984  18.800  16.425  1.00 14.38 ? 504  ARG D CD  1 
ATOM   8540  N  NE  . ARG D  2  392 ? 26.248  19.514  15.369  1.00 18.32 ? 504  ARG D NE  1 
ATOM   8541  C  CZ  . ARG D  2  392 ? 26.708  19.828  14.147  1.00 20.92 ? 504  ARG D CZ  1 
ATOM   8542  N  NH1 . ARG D  2  392 ? 27.947  19.497  13.779  1.00 20.71 ? 504  ARG D NH1 1 
ATOM   8543  N  NH2 . ARG D  2  392 ? 25.913  20.480  13.295  1.00 20.04 ? 504  ARG D NH2 1 
ATOM   8544  N  N   . LYS D  2  393 ? 24.676  15.543  19.547  1.00 7.29  ? 505  LYS D N   1 
ATOM   8545  C  CA  . LYS D  2  393 ? 23.660  14.570  19.116  1.00 8.99  ? 505  LYS D CA  1 
ATOM   8546  C  C   . LYS D  2  393 ? 22.418  14.647  19.970  1.00 8.49  ? 505  LYS D C   1 
ATOM   8547  O  O   . LYS D  2  393 ? 21.303  14.510  19.462  1.00 9.81  ? 505  LYS D O   1 
ATOM   8548  C  CB  . LYS D  2  393 ? 24.224  13.139  19.142  1.00 7.55  ? 505  LYS D CB  1 
ATOM   8549  C  CG  . LYS D  2  393 ? 25.239  12.847  18.044  1.00 9.72  ? 505  LYS D CG  1 
ATOM   8550  C  CD  . LYS D  2  393 ? 26.113  11.634  18.401  1.00 9.78  ? 505  LYS D CD  1 
ATOM   8551  C  CE  . LYS D  2  393 ? 27.120  11.336  17.302  1.00 10.81 ? 505  LYS D CE  1 
ATOM   8552  N  NZ  . LYS D  2  393 ? 26.448  11.004  16.004  1.00 15.02 ? 505  LYS D NZ  1 
ATOM   8553  N  N   . LEU D  2  394 ? 22.599  14.860  21.257  1.00 7.27  ? 506  LEU D N   1 
ATOM   8554  C  CA  . LEU D  2  394 ? 21.470  14.977  22.160  1.00 8.08  ? 506  LEU D CA  1 
ATOM   8555  C  C   . LEU D  2  394 ? 20.643  16.243  21.868  1.00 8.06  ? 506  LEU D C   1 
ATOM   8556  O  O   . LEU D  2  394 ? 19.421  16.271  22.114  1.00 5.64  ? 506  LEU D O   1 
ATOM   8557  C  CB  . LEU D  2  394 ? 21.948  14.970  23.631  1.00 6.05  ? 506  LEU D CB  1 
ATOM   8558  C  CG  . LEU D  2  394 ? 22.544  13.652  24.144  1.00 5.91  ? 506  LEU D CG  1 
ATOM   8559  C  CD1 . LEU D  2  394 ? 22.863  13.765  25.615  1.00 5.22  ? 506  LEU D CD1 1 
ATOM   8560  C  CD2 . LEU D  2  394 ? 21.580  12.498  23.904  1.00 5.32  ? 506  LEU D CD2 1 
ATOM   8561  N  N   . ARG D  2  395 ? 21.317  17.271  21.324  1.00 6.13  ? 507  ARG D N   1 
ATOM   8562  C  CA  . ARG D  2  395 ? 20.664  18.540  20.997  1.00 7.77  ? 507  ARG D CA  1 
ATOM   8563  C  C   . ARG D  2  395 ? 19.958  18.516  19.641  1.00 7.41  ? 507  ARG D C   1 
ATOM   8564  O  O   . ARG D  2  395 ? 18.749  18.798  19.550  1.00 6.50  ? 507  ARG D O   1 
ATOM   8565  C  CB  . ARG D  2  395 ? 21.679  19.678  20.999  1.00 6.21  ? 507  ARG D CB  1 
ATOM   8566  C  CG  . ARG D  2  395 ? 21.071  21.037  20.626  1.00 6.93  ? 507  ARG D CG  1 
ATOM   8567  C  CD  . ARG D  2  395 ? 22.119  22.103  20.389  1.00 4.81  ? 507  ARG D CD  1 
ATOM   8568  N  NE  . ARG D  2  395 ? 22.778  21.924  19.108  1.00 6.91  ? 507  ARG D NE  1 
ATOM   8569  C  CZ  . ARG D  2  395 ? 23.768  22.677  18.664  1.00 9.29  ? 507  ARG D CZ  1 
ATOM   8570  N  NH1 . ARG D  2  395 ? 24.238  23.678  19.421  1.00 10.72 ? 507  ARG D NH1 1 
ATOM   8571  N  NH2 . ARG D  2  395 ? 24.302  22.444  17.461  1.00 9.26  ? 507  ARG D NH2 1 
ATOM   8572  N  N   . ASP D  2  396 ? 20.745  18.193  18.604  1.00 8.04  ? 508  ASP D N   1 
ATOM   8573  C  CA  . ASP D  2  396 ? 20.324  18.202  17.205  1.00 7.92  ? 508  ASP D CA  1 
ATOM   8574  C  C   . ASP D  2  396 ? 19.349  17.073  16.889  1.00 7.15  ? 508  ASP D C   1 
ATOM   8575  O  O   . ASP D  2  396 ? 18.510  17.212  16.000  1.00 6.97  ? 508  ASP D O   1 
ATOM   8576  C  CB  . ASP D  2  396 ? 21.543  18.087  16.263  1.00 9.15  ? 508  ASP D CB  1 
ATOM   8577  C  CG  . ASP D  2  396 ? 22.467  19.323  16.124  1.00 9.26  ? 508  ASP D CG  1 
ATOM   8578  O  OD1 . ASP D  2  396 ? 23.407  19.257  15.311  1.00 10.41 ? 508  ASP D OD1 1 
ATOM   8579  O  OD2 . ASP D  2  396 ? 22.260  20.351  16.814  1.00 10.65 ? 508  ASP D OD2 1 
ATOM   8580  N  N   . GLY D  2  397 ? 19.476  15.958  17.597  1.00 6.00  ? 509  GLY D N   1 
ATOM   8581  C  CA  . GLY D  2  397 ? 18.611  14.809  17.348  1.00 6.29  ? 509  GLY D CA  1 
ATOM   8582  C  C   . GLY D  2  397 ? 17.410  14.727  18.283  1.00 7.14  ? 509  GLY D C   1 
ATOM   8583  O  O   . GLY D  2  397 ? 16.820  13.662  18.453  1.00 8.04  ? 509  GLY D O   1 
ATOM   8584  N  N   . ASP D  2  398 ? 17.031  15.850  18.884  1.00 6.49  ? 510  ASP D N   1 
ATOM   8585  C  CA  . ASP D  2  398 ? 15.909  15.861  19.824  1.00 7.33  ? 510  ASP D CA  1 
ATOM   8586  C  C   . ASP D  2  398 ? 14.734  16.668  19.266  1.00 5.93  ? 510  ASP D C   1 
ATOM   8587  O  O   . ASP D  2  398 ? 14.824  17.876  19.134  1.00 7.09  ? 510  ASP D O   1 
ATOM   8588  C  CB  . ASP D  2  398 ? 16.407  16.435  21.167  1.00 5.35  ? 510  ASP D CB  1 
ATOM   8589  C  CG  . ASP D  2  398 ? 15.357  16.527  22.270  1.00 4.84  ? 510  ASP D CG  1 
ATOM   8590  O  OD1 . ASP D  2  398 ? 15.643  17.171  23.273  1.00 5.50  ? 510  ASP D OD1 1 
ATOM   8591  O  OD2 . ASP D  2  398 ? 14.250  15.965  22.127  1.00 6.81  ? 510  ASP D OD2 1 
ATOM   8592  N  N   . ARG D  2  399 ? 13.631  15.995  18.950  1.00 8.58  ? 511  ARG D N   1 
ATOM   8593  C  CA  . ARG D  2  399 ? 12.444  16.672  18.391  1.00 8.90  ? 511  ARG D CA  1 
ATOM   8594  C  C   . ARG D  2  399 ? 11.892  17.763  19.316  1.00 11.01 ? 511  ARG D C   1 
ATOM   8595  O  O   . ARG D  2  399 ? 11.307  18.760  18.846  1.00 11.22 ? 511  ARG D O   1 
ATOM   8596  C  CB  . ARG D  2  399 ? 11.321  15.676  18.072  1.00 7.25  ? 511  ARG D CB  1 
ATOM   8597  C  CG  . ARG D  2  399 ? 10.135  16.330  17.336  1.00 9.66  ? 511  ARG D CG  1 
ATOM   8598  C  CD  . ARG D  2  399 ? 9.445   15.377  16.357  1.00 11.10 ? 511  ARG D CD  1 
ATOM   8599  N  NE  . ARG D  2  399 ? 8.920   14.171  17.018  1.00 10.83 ? 511  ARG D NE  1 
ATOM   8600  C  CZ  . ARG D  2  399 ? 7.763   14.105  17.701  1.00 14.21 ? 511  ARG D CZ  1 
ATOM   8601  N  NH1 . ARG D  2  399 ? 6.970   15.172  17.796  1.00 9.87  ? 511  ARG D NH1 1 
ATOM   8602  N  NH2 . ARG D  2  399 ? 7.404   12.965  18.275  1.00 9.00  ? 511  ARG D NH2 1 
ATOM   8603  N  N   . PHE D  2  400 ? 12.110  17.589  20.622  1.00 8.61  ? 512  PHE D N   1 
ATOM   8604  C  CA  . PHE D  2  400 ? 11.588  18.500  21.606  1.00 7.95  ? 512  PHE D CA  1 
ATOM   8605  C  C   . PHE D  2  400 ? 12.635  19.412  22.193  1.00 8.00  ? 512  PHE D C   1 
ATOM   8606  O  O   . PHE D  2  400 ? 12.439  19.914  23.283  1.00 8.12  ? 512  PHE D O   1 
ATOM   8607  C  CB  . PHE D  2  400 ? 10.875  17.709  22.702  1.00 9.54  ? 512  PHE D CB  1 
ATOM   8608  C  CG  . PHE D  2  400 ? 9.690   16.942  22.181  1.00 12.28 ? 512  PHE D CG  1 
ATOM   8609  C  CD1 . PHE D  2  400 ? 9.813   15.603  21.802  1.00 11.16 ? 512  PHE D CD1 1 
ATOM   8610  C  CD2 . PHE D  2  400 ? 8.445   17.565  22.041  1.00 13.51 ? 512  PHE D CD2 1 
ATOM   8611  C  CE1 . PHE D  2  400 ? 8.723   14.896  21.294  1.00 12.17 ? 512  PHE D CE1 1 
ATOM   8612  C  CE2 . PHE D  2  400 ? 7.352   16.863  21.533  1.00 11.73 ? 512  PHE D CE2 1 
ATOM   8613  C  CZ  . PHE D  2  400 ? 7.490   15.531  21.161  1.00 10.92 ? 512  PHE D CZ  1 
ATOM   8614  N  N   . TRP D  2  401 ? 13.752  19.623  21.481  1.00 7.50  ? 513  TRP D N   1 
ATOM   8615  C  CA  . TRP D  2  401 ? 14.754  20.603  21.916  1.00 9.26  ? 513  TRP D CA  1 
ATOM   8616  C  C   . TRP D  2  401 ? 14.057  21.983  22.099  1.00 12.40 ? 513  TRP D C   1 
ATOM   8617  O  O   . TRP D  2  401 ? 13.336  22.468  21.206  1.00 12.27 ? 513  TRP D O   1 
ATOM   8618  C  CB  . TRP D  2  401 ? 15.876  20.718  20.870  1.00 8.86  ? 513  TRP D CB  1 
ATOM   8619  C  CG  . TRP D  2  401 ? 16.951  21.678  21.273  1.00 9.78  ? 513  TRP D CG  1 
ATOM   8620  C  CD1 . TRP D  2  401 ? 17.164  22.926  20.765  1.00 8.99  ? 513  TRP D CD1 1 
ATOM   8621  C  CD2 . TRP D  2  401 ? 17.886  21.521  22.360  1.00 11.27 ? 513  TRP D CD2 1 
ATOM   8622  N  NE1 . TRP D  2  401 ? 18.160  23.559  21.471  1.00 8.86  ? 513  TRP D NE1 1 
ATOM   8623  C  CE2 . TRP D  2  401 ? 18.616  22.719  22.455  1.00 10.31 ? 513  TRP D CE2 1 
ATOM   8624  C  CE3 . TRP D  2  401 ? 18.177  20.476  23.256  1.00 9.40  ? 513  TRP D CE3 1 
ATOM   8625  C  CZ2 . TRP D  2  401 ? 19.611  22.907  23.416  1.00 8.74  ? 513  TRP D CZ2 1 
ATOM   8626  C  CZ3 . TRP D  2  401 ? 19.170  20.665  24.204  1.00 10.21 ? 513  TRP D CZ3 1 
ATOM   8627  C  CH2 . TRP D  2  401 ? 19.868  21.874  24.275  1.00 8.50  ? 513  TRP D CH2 1 
ATOM   8628  N  N   . TRP D  2  402 ? 14.274  22.622  23.249  1.00 11.79 ? 514  TRP D N   1 
ATOM   8629  C  CA  . TRP D  2  402 ? 13.558  23.848  23.593  1.00 11.91 ? 514  TRP D CA  1 
ATOM   8630  C  C   . TRP D  2  402 ? 13.598  24.936  22.507  1.00 12.38 ? 514  TRP D C   1 
ATOM   8631  O  O   . TRP D  2  402 ? 12.667  25.752  22.419  1.00 11.24 ? 514  TRP D O   1 
ATOM   8632  C  CB  . TRP D  2  402 ? 14.077  24.405  24.928  1.00 12.98 ? 514  TRP D CB  1 
ATOM   8633  C  CG  . TRP D  2  402 ? 15.369  25.138  24.833  1.00 11.99 ? 514  TRP D CG  1 
ATOM   8634  C  CD1 . TRP D  2  402 ? 16.611  24.604  24.890  1.00 11.60 ? 514  TRP D CD1 1 
ATOM   8635  C  CD2 . TRP D  2  402 ? 15.538  26.553  24.748  1.00 13.64 ? 514  TRP D CD2 1 
ATOM   8636  N  NE1 . TRP D  2  402 ? 17.553  25.610  24.859  1.00 13.79 ? 514  TRP D NE1 1 
ATOM   8637  C  CE2 . TRP D  2  402 ? 16.920  26.813  24.777  1.00 14.11 ? 514  TRP D CE2 1 
ATOM   8638  C  CE3 . TRP D  2  402 ? 14.648  27.640  24.653  1.00 15.55 ? 514  TRP D CE3 1 
ATOM   8639  C  CZ2 . TRP D  2  402 ? 17.442  28.110  24.727  1.00 13.12 ? 514  TRP D CZ2 1 
ATOM   8640  C  CZ3 . TRP D  2  402 ? 15.168  28.926  24.597  1.00 15.94 ? 514  TRP D CZ3 1 
ATOM   8641  C  CH2 . TRP D  2  402 ? 16.553  29.146  24.637  1.00 14.62 ? 514  TRP D CH2 1 
ATOM   8642  N  N   . GLU D  2  403 ? 14.669  24.950  21.689  1.00 10.39 ? 515  GLU D N   1 
ATOM   8643  C  CA  . GLU D  2  403 ? 14.840  25.934  20.620  1.00 12.58 ? 515  GLU D CA  1 
ATOM   8644  C  C   . GLU D  2  403 ? 14.312  25.488  19.255  1.00 11.54 ? 515  GLU D C   1 
ATOM   8645  O  O   . GLU D  2  403 ? 14.290  26.286  18.309  1.00 14.34 ? 515  GLU D O   1 
ATOM   8646  C  CB  . GLU D  2  403 ? 16.296  26.301  20.444  1.00 12.39 ? 515  GLU D CB  1 
ATOM   8647  C  CG  . GLU D  2  403 ? 16.895  27.130  21.547  1.00 16.64 ? 515  GLU D CG  1 
ATOM   8648  C  CD  . GLU D  2  403 ? 18.353  27.437  21.241  1.00 20.88 ? 515  GLU D CD  1 
ATOM   8649  O  OE1 . GLU D  2  403 ? 18.652  28.596  20.895  1.00 22.10 ? 515  GLU D OE1 1 
ATOM   8650  O  OE2 . GLU D  2  403 ? 19.191  26.505  21.318  1.00 18.89 ? 515  GLU D OE2 1 
ATOM   8651  N  N   . ASN D  2  404 ? 13.901  24.243  19.126  1.00 11.21 ? 516  ASN D N   1 
ATOM   8652  C  CA  . ASN D  2  404 ? 13.363  23.772  17.849  1.00 10.78 ? 516  ASN D CA  1 
ATOM   8653  C  C   . ASN D  2  404 ? 12.052  24.528  17.521  1.00 10.87 ? 516  ASN D C   1 
ATOM   8654  O  O   . ASN D  2  404 ? 11.246  24.763  18.428  1.00 12.17 ? 516  ASN D O   1 
ATOM   8655  C  CB  . ASN D  2  404 ? 13.112  22.252  17.942  1.00 10.07 ? 516  ASN D CB  1 
ATOM   8656  C  CG  . ASN D  2  404 ? 12.698  21.633  16.615  1.00 11.27 ? 516  ASN D CG  1 
ATOM   8657  O  OD1 . ASN D  2  404 ? 13.171  22.048  15.553  1.00 13.49 ? 516  ASN D OD1 1 
ATOM   8658  N  ND2 . ASN D  2  404 ? 11.819  20.640  16.665  1.00 9.57  ? 516  ASN D ND2 1 
ATOM   8659  N  N   . GLU D  2  405 ? 11.839  24.947  16.263  1.00 10.27 ? 517  GLU D N   1 
ATOM   8660  C  CA  . GLU D  2  405 ? 10.567  25.647  15.969  1.00 13.13 ? 517  GLU D CA  1 
ATOM   8661  C  C   . GLU D  2  405 ? 9.389   24.755  16.341  1.00 12.00 ? 517  GLU D C   1 
ATOM   8662  O  O   . GLU D  2  405 ? 9.449   23.545  16.153  1.00 11.90 ? 517  GLU D O   1 
ATOM   8663  C  CB  . GLU D  2  405 ? 10.434  26.072  14.488  1.00 15.00 ? 517  GLU D CB  1 
ATOM   8664  C  CG  . GLU D  2  405 ? 9.189   26.957  14.172  1.00 22.14 ? 517  GLU D CG  1 
ATOM   8665  C  CD  . GLU D  2  405 ? 7.800   26.232  14.092  1.00 24.26 ? 517  GLU D CD  1 
ATOM   8666  O  OE1 . GLU D  2  405 ? 6.747   26.861  14.435  1.00 23.92 ? 517  GLU D OE1 1 
ATOM   8667  O  OE2 . GLU D  2  405 ? 7.751   25.052  13.670  1.00 24.50 ? 517  GLU D OE2 1 
ATOM   8668  N  N   . GLY D  2  406 ? 8.346   25.360  16.916  1.00 12.30 ? 518  GLY D N   1 
ATOM   8669  C  CA  . GLY D  2  406 ? 7.150   24.603  17.222  1.00 13.09 ? 518  GLY D CA  1 
ATOM   8670  C  C   . GLY D  2  406 ? 7.053   24.105  18.650  1.00 14.31 ? 518  GLY D C   1 
ATOM   8671  O  O   . GLY D  2  406 ? 5.952   23.774  19.095  1.00 17.26 ? 518  GLY D O   1 
ATOM   8672  N  N   . VAL D  2  407 ? 8.200   24.045  19.369  1.00 12.72 ? 519  VAL D N   1 
ATOM   8673  C  CA  . VAL D  2  407 ? 8.240   23.566  20.762  1.00 10.74 ? 519  VAL D CA  1 
ATOM   8674  C  C   . VAL D  2  407 ? 7.715   24.627  21.730  1.00 10.47 ? 519  VAL D C   1 
ATOM   8675  O  O   . VAL D  2  407 ? 6.831   24.369  22.534  1.00 9.58  ? 519  VAL D O   1 
ATOM   8676  C  CB  . VAL D  2  407 ? 9.694   23.173  21.157  1.00 10.53 ? 519  VAL D CB  1 
ATOM   8677  C  CG1 . VAL D  2  407 ? 9.751   22.657  22.584  1.00 4.17  ? 519  VAL D CG1 1 
ATOM   8678  C  CG2 . VAL D  2  407 ? 10.230  22.130  20.185  1.00 9.83  ? 519  VAL D CG2 1 
ATOM   8679  N  N   . PHE D  2  408 ? 8.318   25.807  21.667  1.00 11.91 ? 520  PHE D N   1 
ATOM   8680  C  CA  . PHE D  2  408 ? 7.897   26.965  22.426  1.00 10.76 ? 520  PHE D CA  1 
ATOM   8681  C  C   . PHE D  2  408 ? 7.661   28.093  21.447  1.00 13.57 ? 520  PHE D C   1 
ATOM   8682  O  O   . PHE D  2  408 ? 8.137   28.045  20.295  1.00 13.51 ? 520  PHE D O   1 
ATOM   8683  C  CB  . PHE D  2  408 ? 8.984   27.411  23.420  1.00 10.24 ? 520  PHE D CB  1 
ATOM   8684  C  CG  . PHE D  2  408 ? 9.153   26.539  24.632  1.00 11.76 ? 520  PHE D CG  1 
ATOM   8685  C  CD1 . PHE D  2  408 ? 8.215   26.567  25.676  1.00 10.69 ? 520  PHE D CD1 1 
ATOM   8686  C  CD2 . PHE D  2  408 ? 10.225  25.656  24.728  1.00 10.38 ? 520  PHE D CD2 1 
ATOM   8687  C  CE1 . PHE D  2  408 ? 8.340   25.729  26.786  1.00 10.51 ? 520  PHE D CE1 1 
ATOM   8688  C  CE2 . PHE D  2  408 ? 10.357  24.816  25.834  1.00 9.01  ? 520  PHE D CE2 1 
ATOM   8689  C  CZ  . PHE D  2  408 ? 9.414   24.848  26.867  1.00 10.01 ? 520  PHE D CZ  1 
ATOM   8690  N  N   . SER D  2  409 ? 6.925   29.109  21.883  1.00 15.64 ? 521  SER D N   1 
ATOM   8691  C  CA  . SER D  2  409 ? 6.754   30.304  21.058  1.00 16.81 ? 521  SER D CA  1 
ATOM   8692  C  C   . SER D  2  409 ? 8.010   31.195  21.157  1.00 18.07 ? 521  SER D C   1 
ATOM   8693  O  O   . SER D  2  409 ? 8.869   31.001  22.037  1.00 16.70 ? 521  SER D O   1 
ATOM   8694  C  CB  . SER D  2  409 ? 5.512   31.091  21.498  1.00 16.42 ? 521  SER D CB  1 
ATOM   8695  O  OG  . SER D  2  409 ? 5.679   31.671  22.783  1.00 16.43 ? 521  SER D OG  1 
ATOM   8696  N  N   . MET D  2  410 ? 8.123   32.153  20.239  1.00 19.41 ? 522  MET D N   1 
ATOM   8697  C  CA  . MET D  2  410 ? 9.246   33.086  20.253  1.00 21.72 ? 522  MET D CA  1 
ATOM   8698  C  C   . MET D  2  410 ? 9.263   33.899  21.555  1.00 22.10 ? 522  MET D C   1 
ATOM   8699  O  O   . MET D  2  410 ? 10.326  34.280  22.048  1.00 22.03 ? 522  MET D O   1 
ATOM   8700  C  CB  . MET D  2  410 ? 9.174   34.020  19.040  1.00 25.63 ? 522  MET D CB  1 
ATOM   8701  C  CG  . MET D  2  410 ? 10.200  35.153  19.026  1.00 30.62 ? 522  MET D CG  1 
ATOM   8702  S  SD  . MET D  2  410 ? 10.183  36.085  17.469  1.00 38.25 ? 522  MET D SD  1 
ATOM   8703  C  CE  . MET D  2  410 ? 8.704   37.074  17.691  1.00 31.90 ? 522  MET D CE  1 
ATOM   8704  N  N   . GLN D  2  411 ? 8.073   34.169  22.092  1.00 22.16 ? 523  GLN D N   1 
ATOM   8705  C  CA  . GLN D  2  411 ? 7.948   34.872  23.355  1.00 22.29 ? 523  GLN D CA  1 
ATOM   8706  C  C   . GLN D  2  411 ? 8.255   33.935  24.531  1.00 19.24 ? 523  GLN D C   1 
ATOM   8707  O  O   . GLN D  2  411 ? 8.803   34.375  25.546  1.00 15.53 ? 523  GLN D O   1 
ATOM   8708  C  CB  . GLN D  2  411 ? 6.547   35.524  23.521  1.00 25.25 ? 523  GLN D CB  1 
ATOM   8709  C  CG  . GLN D  2  411 ? 5.425   34.919  22.692  1.00 31.75 ? 523  GLN D CG  1 
ATOM   8710  C  CD  . GLN D  2  411 ? 5.491   35.354  21.233  1.00 34.12 ? 523  GLN D CD  1 
ATOM   8711  O  OE1 . GLN D  2  411 ? 5.522   34.526  20.314  1.00 34.60 ? 523  GLN D OE1 1 
ATOM   8712  N  NE2 . GLN D  2  411 ? 5.520   36.667  21.012  1.00 35.90 ? 523  GLN D NE2 1 
ATOM   8713  N  N   . GLN D  2  412 ? 7.918   32.639  24.389  1.00 17.15 ? 524  GLN D N   1 
ATOM   8714  C  CA  . GLN D  2  412 ? 8.241   31.675  25.451  1.00 17.65 ? 524  GLN D CA  1 
ATOM   8715  C  C   . GLN D  2  412 ? 9.751   31.409  25.535  1.00 17.13 ? 524  GLN D C   1 
ATOM   8716  O  O   . GLN D  2  412 ? 10.285  31.210  26.632  1.00 17.10 ? 524  GLN D O   1 
ATOM   8717  C  CB  . GLN D  2  412 ? 7.472   30.362  25.278  1.00 15.60 ? 524  GLN D CB  1 
ATOM   8718  C  CG  . GLN D  2  412 ? 6.007   30.518  25.648  1.00 18.61 ? 524  GLN D CG  1 
ATOM   8719  C  CD  . GLN D  2  412 ? 5.219   29.239  25.621  1.00 16.07 ? 524  GLN D CD  1 
ATOM   8720  O  OE1 . GLN D  2  412 ? 5.359   28.437  24.714  1.00 17.62 ? 524  GLN D OE1 1 
ATOM   8721  N  NE2 . GLN D  2  412 ? 4.375   29.060  26.615  1.00 19.76 ? 524  GLN D NE2 1 
ATOM   8722  N  N   . ARG D  2  413 ? 10.427  31.417  24.385  1.00 16.32 ? 525  ARG D N   1 
ATOM   8723  C  CA  . ARG D  2  413 ? 11.876  31.235  24.370  1.00 17.85 ? 525  ARG D CA  1 
ATOM   8724  C  C   . ARG D  2  413 ? 12.604  32.432  25.011  1.00 18.70 ? 525  ARG D C   1 
ATOM   8725  O  O   . ARG D  2  413 ? 13.608  32.258  25.710  1.00 16.63 ? 525  ARG D O   1 
ATOM   8726  C  CB  . ARG D  2  413 ? 12.355  31.024  22.945  1.00 15.98 ? 525  ARG D CB  1 
ATOM   8727  C  CG  . ARG D  2  413 ? 11.898  29.703  22.376  1.00 19.65 ? 525  ARG D CG  1 
ATOM   8728  C  CD  . ARG D  2  413 ? 12.686  29.328  21.133  1.00 19.08 ? 525  ARG D CD  1 
ATOM   8729  N  NE  . ARG D  2  413 ? 12.418  30.231  20.020  1.00 19.74 ? 525  ARG D NE  1 
ATOM   8730  C  CZ  . ARG D  2  413 ? 11.377  30.130  19.208  1.00 16.36 ? 525  ARG D CZ  1 
ATOM   8731  N  NH1 . ARG D  2  413 ? 10.473  29.188  19.396  1.00 14.37 ? 525  ARG D NH1 1 
ATOM   8732  N  NH2 . ARG D  2  413 ? 11.245  30.983  18.219  1.00 17.15 ? 525  ARG D NH2 1 
ATOM   8733  N  N   . GLN D  2  414 ? 12.082  33.646  24.779  1.00 16.76 ? 526  GLN D N   1 
ATOM   8734  C  CA  . GLN D  2  414 ? 12.634  34.860  25.368  1.00 18.35 ? 526  GLN D CA  1 
ATOM   8735  C  C   . GLN D  2  414 ? 12.587  34.776  26.898  1.00 17.08 ? 526  GLN D C   1 
ATOM   8736  O  O   . GLN D  2  414 ? 13.542  35.144  27.585  1.00 17.74 ? 526  GLN D O   1 
ATOM   8737  C  CB  . GLN D  2  414 ? 11.850  36.097  24.869  1.00 19.66 ? 526  GLN D CB  1 
ATOM   8738  C  CG  . GLN D  2  414 ? 12.342  37.451  25.391  1.00 26.39 ? 526  GLN D CG  1 
ATOM   8739  C  CD  . GLN D  2  414 ? 11.866  37.817  26.819  1.00 31.74 ? 526  GLN D CD  1 
ATOM   8740  O  OE1 . GLN D  2  414 ? 10.680  38.108  27.052  1.00 35.61 ? 526  GLN D OE1 1 
ATOM   8741  N  NE2 . GLN D  2  414 ? 12.797  37.822  27.783  1.00 34.00 ? 526  GLN D NE2 1 
ATOM   8742  N  N   . ALA D  2  415 ? 11.479  34.280  27.425  1.00 15.95 ? 527  ALA D N   1 
ATOM   8743  C  CA  . ALA D  2  415 ? 11.295  34.180  28.871  1.00 16.45 ? 527  ALA D CA  1 
ATOM   8744  C  C   . ALA D  2  415 ? 12.229  33.104  29.483  1.00 15.28 ? 527  ALA D C   1 
ATOM   8745  O  O   . ALA D  2  415 ? 12.847  33.328  30.534  1.00 16.22 ? 527  ALA D O   1 
ATOM   8746  C  CB  . ALA D  2  415 ? 9.823   33.907  29.183  1.00 12.59 ? 527  ALA D CB  1 
ATOM   8747  N  N   . LEU D  2  416 ? 12.338  31.958  28.799  1.00 15.15 ? 528  LEU D N   1 
ATOM   8748  C  CA  . LEU D  2  416 ? 13.220  30.858  29.214  1.00 14.68 ? 528  LEU D CA  1 
ATOM   8749  C  C   . LEU D  2  416 ? 14.729  31.240  29.207  1.00 15.09 ? 528  LEU D C   1 
ATOM   8750  O  O   . LEU D  2  416 ? 15.469  30.832  30.107  1.00 13.40 ? 528  LEU D O   1 
ATOM   8751  C  CB  . LEU D  2  416 ? 12.974  29.633  28.334  1.00 11.74 ? 528  LEU D CB  1 
ATOM   8752  C  CG  . LEU D  2  416 ? 11.652  28.894  28.580  1.00 10.25 ? 528  LEU D CG  1 
ATOM   8753  C  CD1 . LEU D  2  416 ? 11.493  27.740  27.598  1.00 9.98  ? 528  LEU D CD1 1 
ATOM   8754  C  CD2 . LEU D  2  416 ? 11.602  28.391  30.007  1.00 8.50  ? 528  LEU D CD2 1 
ATOM   8755  N  N   . ALA D  2  417 ? 15.163  32.042  28.213  1.00 15.28 ? 529  ALA D N   1 
ATOM   8756  C  CA  . ALA D  2  417 ? 16.571  32.522  28.109  1.00 17.40 ? 529  ALA D CA  1 
ATOM   8757  C  C   . ALA D  2  417 ? 17.023  33.355  29.338  1.00 16.30 ? 529  ALA D C   1 
ATOM   8758  O  O   . ALA D  2  417 ? 18.206  33.614  29.519  1.00 14.10 ? 529  ALA D O   1 
ATOM   8759  C  CB  . ALA D  2  417 ? 16.759  33.345  26.822  1.00 15.37 ? 529  ALA D CB  1 
ATOM   8760  N  N   . GLN D  2  418 ? 16.063  33.764  30.166  1.00 17.15 ? 530  GLN D N   1 
ATOM   8761  C  CA  . GLN D  2  418 ? 16.351  34.538  31.356  1.00 16.80 ? 530  GLN D CA  1 
ATOM   8762  C  C   . GLN D  2  418 ? 16.434  33.650  32.581  1.00 16.67 ? 530  GLN D C   1 
ATOM   8763  O  O   . GLN D  2  418 ? 16.589  34.183  33.691  1.00 16.68 ? 530  GLN D O   1 
ATOM   8764  C  CB  . GLN D  2  418 ? 15.277  35.610  31.595  1.00 19.58 ? 530  GLN D CB  1 
ATOM   8765  C  CG  . GLN D  2  418 ? 14.873  36.413  30.348  1.00 24.28 ? 530  GLN D CG  1 
ATOM   8766  C  CD  . GLN D  2  418 ? 16.041  37.083  29.625  1.00 25.56 ? 530  GLN D CD  1 
ATOM   8767  O  OE1 . GLN D  2  418 ? 16.906  37.704  30.253  1.00 26.84 ? 530  GLN D OE1 1 
ATOM   8768  N  NE2 . GLN D  2  418 ? 16.070  36.960  28.296  1.00 25.33 ? 530  GLN D NE2 1 
ATOM   8769  N  N   . ILE D  2  419 ? 16.306  32.296  32.416  1.00 14.84 ? 531  ILE D N   1 
ATOM   8770  C  CA  . ILE D  2  419 ? 16.414  31.409  33.600  1.00 12.92 ? 531  ILE D CA  1 
ATOM   8771  C  C   . ILE D  2  419 ? 17.882  31.140  33.993  1.00 11.36 ? 531  ILE D C   1 
ATOM   8772  O  O   . ILE D  2  419 ? 18.787  31.322  33.216  1.00 10.58 ? 531  ILE D O   1 
ATOM   8773  C  CB  . ILE D  2  419 ? 15.682  30.023  33.475  1.00 10.95 ? 531  ILE D CB  1 
ATOM   8774  C  CG1 . ILE D  2  419 ? 16.356  29.124  32.453  1.00 12.41 ? 531  ILE D CG1 1 
ATOM   8775  C  CG2 . ILE D  2  419 ? 14.208  30.199  33.172  1.00 12.42 ? 531  ILE D CG2 1 
ATOM   8776  C  CD1 . ILE D  2  419 ? 17.099  27.977  33.108  1.00 10.87 ? 531  ILE D CD1 1 
ATOM   8777  N  N   . SER D  2  420 ? 18.081  30.733  35.221  1.00 13.12 ? 532  SER D N   1 
ATOM   8778  C  CA  . SER D  2  420 ? 19.403  30.385  35.730  1.00 14.53 ? 532  SER D CA  1 
ATOM   8779  C  C   . SER D  2  420 ? 19.239  29.573  37.002  1.00 14.52 ? 532  SER D C   1 
ATOM   8780  O  O   . SER D  2  420 ? 18.221  29.673  37.697  1.00 14.25 ? 532  SER D O   1 
ATOM   8781  C  CB  . SER D  2  420 ? 20.263  31.648  36.001  1.00 15.25 ? 532  SER D CB  1 
ATOM   8782  O  OG  . SER D  2  420 ? 19.961  32.268  37.253  1.00 17.93 ? 532  SER D OG  1 
ATOM   8783  N  N   . LEU D  2  421 ? 20.227  28.745  37.291  1.00 15.12 ? 533  LEU D N   1 
ATOM   8784  C  CA  . LEU D  2  421 ? 20.206  27.888  38.467  1.00 14.71 ? 533  LEU D CA  1 
ATOM   8785  C  C   . LEU D  2  421 ? 20.087  28.721  39.738  1.00 13.82 ? 533  LEU D C   1 
ATOM   8786  O  O   . LEU D  2  421 ? 19.342  28.357  40.664  1.00 15.29 ? 533  LEU D O   1 
ATOM   8787  C  CB  . LEU D  2  421 ? 21.456  26.994  38.469  1.00 12.67 ? 533  LEU D CB  1 
ATOM   8788  C  CG  . LEU D  2  421 ? 21.477  25.801  39.422  1.00 13.06 ? 533  LEU D CG  1 
ATOM   8789  C  CD1 . LEU D  2  421 ? 20.125  25.071  39.427  1.00 10.23 ? 533  LEU D CD1 1 
ATOM   8790  C  CD2 . LEU D  2  421 ? 22.617  24.869  39.020  1.00 11.98 ? 533  LEU D CD2 1 
ATOM   8791  N  N   . PRO D  2  422 ? 20.825  29.838  39.822  1.00 14.58 ? 534  PRO D N   1 
ATOM   8792  C  CA  . PRO D  2  422 ? 20.764  30.740  40.992  1.00 15.34 ? 534  PRO D CA  1 
ATOM   8793  C  C   . PRO D  2  422 ? 19.323  31.232  41.266  1.00 14.98 ? 534  PRO D C   1 
ATOM   8794  O  O   . PRO D  2  422 ? 18.836  31.167  42.409  1.00 12.39 ? 534  PRO D O   1 
ATOM   8795  C  CB  . PRO D  2  422 ? 21.704  31.883  40.597  1.00 16.86 ? 534  PRO D CB  1 
ATOM   8796  C  CG  . PRO D  2  422 ? 22.710  31.179  39.749  1.00 17.37 ? 534  PRO D CG  1 
ATOM   8797  C  CD  . PRO D  2  422 ? 21.881  30.272  38.878  1.00 13.23 ? 534  PRO D CD  1 
ATOM   8798  N  N   . ARG D  2  423 ? 18.650  31.716  40.221  1.00 13.69 ? 535  ARG D N   1 
ATOM   8799  C  CA  . ARG D  2  423 ? 17.270  32.154  40.370  1.00 16.38 ? 535  ARG D CA  1 
ATOM   8800  C  C   . ARG D  2  423 ? 16.358  30.997  40.771  1.00 15.28 ? 535  ARG D C   1 
ATOM   8801  O  O   . ARG D  2  423 ? 15.442  31.177  41.579  1.00 15.81 ? 535  ARG D O   1 
ATOM   8802  C  CB  . ARG D  2  423 ? 16.756  32.781  39.078  1.00 18.65 ? 535  ARG D CB  1 
ATOM   8803  C  CG  . ARG D  2  423 ? 15.310  33.268  39.181  1.00 24.10 ? 535  ARG D CG  1 
ATOM   8804  C  CD  . ARG D  2  423 ? 15.193  34.501  40.056  1.00 23.65 ? 535  ARG D CD  1 
ATOM   8805  N  NE  . ARG D  2  423 ? 14.191  34.331  41.083  1.00 25.72 ? 535  ARG D NE  1 
ATOM   8806  C  CZ  . ARG D  2  423 ? 14.268  34.934  42.246  1.00 29.96 ? 535  ARG D CZ  1 
ATOM   8807  N  NH1 . ARG D  2  423 ? 15.296  35.734  42.505  1.00 33.05 ? 535  ARG D NH1 1 
ATOM   8808  N  NH2 . ARG D  2  423 ? 13.330  34.742  43.159  1.00 33.33 ? 535  ARG D NH2 1 
ATOM   8809  N  N   . ILE D  2  424 ? 16.587  29.796  40.195  1.00 16.34 ? 536  ILE D N   1 
ATOM   8810  C  CA  . ILE D  2  424 ? 15.801  28.628  40.604  1.00 15.03 ? 536  ILE D CA  1 
ATOM   8811  C  C   . ILE D  2  424 ? 16.047  28.351  42.090  1.00 16.63 ? 536  ILE D C   1 
ATOM   8812  O  O   . ILE D  2  424 ? 15.097  28.051  42.842  1.00 16.86 ? 536  ILE D O   1 
ATOM   8813  C  CB  . ILE D  2  424 ? 16.138  27.360  39.785  1.00 14.77 ? 536  ILE D CB  1 
ATOM   8814  C  CG1 . ILE D  2  424 ? 15.753  27.577  38.314  1.00 14.68 ? 536  ILE D CG1 1 
ATOM   8815  C  CG2 . ILE D  2  424 ? 15.398  26.151  40.368  1.00 14.55 ? 536  ILE D CG2 1 
ATOM   8816  C  CD1 . ILE D  2  424 ? 16.056  26.412  37.386  1.00 11.88 ? 536  ILE D CD1 1 
ATOM   8817  N  N   . ILE D  2  425 ? 17.323  28.465  42.525  1.00 13.52 ? 537  ILE D N   1 
ATOM   8818  C  CA  . ILE D  2  425 ? 17.629  28.305  43.947  1.00 14.38 ? 537  ILE D CA  1 
ATOM   8819  C  C   . ILE D  2  425 ? 16.859  29.345  44.801  1.00 12.07 ? 537  ILE D C   1 
ATOM   8820  O  O   . ILE D  2  425 ? 16.280  29.010  45.824  1.00 10.08 ? 537  ILE D O   1 
ATOM   8821  C  CB  . ILE D  2  425 ? 19.162  28.397  44.201  1.00 15.64 ? 537  ILE D CB  1 
ATOM   8822  C  CG1 . ILE D  2  425 ? 19.835  27.221  43.466  1.00 16.33 ? 537  ILE D CG1 1 
ATOM   8823  C  CG2 . ILE D  2  425 ? 19.481  28.353  45.710  1.00 11.86 ? 537  ILE D CG2 1 
ATOM   8824  C  CD1 . ILE D  2  425 ? 21.314  27.397  43.185  1.00 17.37 ? 537  ILE D CD1 1 
ATOM   8825  N  N   . CYS D  2  426 ? 16.819  30.584  44.348  1.00 14.01 ? 538  CYS D N   1 
ATOM   8826  C  CA  . CYS D  2  426 ? 16.084  31.640  45.057  1.00 17.34 ? 538  CYS D CA  1 
ATOM   8827  C  C   . CYS D  2  426 ? 14.574  31.373  45.151  1.00 18.47 ? 538  CYS D C   1 
ATOM   8828  O  O   . CYS D  2  426 ? 13.926  31.822  46.104  1.00 17.70 ? 538  CYS D O   1 
ATOM   8829  C  CB  . CYS D  2  426 ? 16.296  32.980  44.357  1.00 19.03 ? 538  CYS D CB  1 
ATOM   8830  S  SG  . CYS D  2  426 ? 17.978  33.641  44.481  1.00 24.36 ? 538  CYS D SG  1 
ATOM   8831  N  N   . ASP D  2  427 ? 14.019  30.655  44.160  1.00 17.17 ? 539  ASP D N   1 
ATOM   8832  C  CA  . ASP D  2  427 ? 12.579  30.398  44.111  1.00 15.94 ? 539  ASP D CA  1 
ATOM   8833  C  C   . ASP D  2  427 ? 12.147  29.232  44.961  1.00 15.17 ? 539  ASP D C   1 
ATOM   8834  O  O   . ASP D  2  427 ? 10.967  29.105  45.236  1.00 16.56 ? 539  ASP D O   1 
ATOM   8835  C  CB  . ASP D  2  427 ? 12.111  30.090  42.680  1.00 19.11 ? 539  ASP D CB  1 
ATOM   8836  C  CG  . ASP D  2  427 ? 12.306  31.204  41.667  1.00 19.83 ? 539  ASP D CG  1 
ATOM   8837  O  OD1 . ASP D  2  427 ? 12.575  30.889  40.485  1.00 20.51 ? 539  ASP D OD1 1 
ATOM   8838  O  OD2 . ASP D  2  427 ? 12.186  32.383  42.043  1.00 21.55 ? 539  ASP D OD2 1 
ATOM   8839  N  N   . ASN D  2  428 ? 13.068  28.357  45.367  1.00 14.35 ? 540  ASN D N   1 
ATOM   8840  C  CA  . ASN D  2  428 ? 12.649  27.111  46.043  1.00 14.18 ? 540  ASN D CA  1 
ATOM   8841  C  C   . ASN D  2  428 ? 13.351  26.830  47.368  1.00 14.55 ? 540  ASN D C   1 
ATOM   8842  O  O   . ASN D  2  428 ? 13.236  25.728  47.914  1.00 12.66 ? 540  ASN D O   1 
ATOM   8843  C  CB  . ASN D  2  428 ? 12.856  25.925  45.097  1.00 11.56 ? 540  ASN D CB  1 
ATOM   8844  C  CG  . ASN D  2  428 ? 12.039  26.045  43.828  1.00 14.57 ? 540  ASN D CG  1 
ATOM   8845  O  OD1 . ASN D  2  428 ? 10.821  25.955  43.856  1.00 14.01 ? 540  ASN D OD1 1 
ATOM   8846  N  ND2 . ASN D  2  428 ? 12.708  26.257  42.700  1.00 16.89 ? 540  ASN D ND2 1 
ATOM   8847  N  N   . THR D  2  429 ? 14.062  27.822  47.901  1.00 17.48 ? 541  THR D N   1 
ATOM   8848  C  CA  . THR D  2  429 ? 14.821  27.644  49.145  1.00 16.50 ? 541  THR D CA  1 
ATOM   8849  C  C   . THR D  2  429 ? 14.751  28.868  50.039  1.00 16.82 ? 541  THR D C   1 
ATOM   8850  O  O   . THR D  2  429 ? 14.338  29.929  49.611  1.00 16.32 ? 541  THR D O   1 
ATOM   8851  C  CB  . THR D  2  429 ? 16.316  27.413  48.852  1.00 14.52 ? 541  THR D CB  1 
ATOM   8852  O  OG1 . THR D  2  429 ? 16.900  28.630  48.378  1.00 13.01 ? 541  THR D OG1 1 
ATOM   8853  C  CG2 . THR D  2  429 ? 16.503  26.329  47.793  1.00 17.87 ? 541  THR D CG2 1 
ATOM   8854  N  N   . GLY D  2  430 ? 15.201  28.701  51.280  1.00 18.10 ? 542  GLY D N   1 
ATOM   8855  C  CA  . GLY D  2  430 ? 15.330  29.829  52.194  1.00 19.25 ? 542  GLY D CA  1 
ATOM   8856  C  C   . GLY D  2  430 ? 16.587  30.684  51.909  1.00 21.12 ? 542  GLY D C   1 
ATOM   8857  O  O   . GLY D  2  430 ? 16.772  31.743  52.491  1.00 21.85 ? 542  GLY D O   1 
ATOM   8858  N  N   . ILE D  2  431 ? 17.448  30.234  51.002  1.00 22.75 ? 543  ILE D N   1 
ATOM   8859  C  CA  . ILE D  2  431 ? 18.662  30.976  50.642  1.00 20.45 ? 543  ILE D CA  1 
ATOM   8860  C  C   . ILE D  2  431 ? 18.300  32.250  49.867  1.00 22.60 ? 543  ILE D C   1 
ATOM   8861  O  O   . ILE D  2  431 ? 17.657  32.203  48.801  1.00 25.40 ? 543  ILE D O   1 
ATOM   8862  C  CB  . ILE D  2  431 ? 19.598  30.087  49.788  1.00 19.29 ? 543  ILE D CB  1 
ATOM   8863  C  CG1 . ILE D  2  431 ? 20.007  28.847  50.596  1.00 18.39 ? 543  ILE D CG1 1 
ATOM   8864  C  CG2 . ILE D  2  431 ? 20.820  30.875  49.340  1.00 15.59 ? 543  ILE D CG2 1 
ATOM   8865  C  CD1 . ILE D  2  431 ? 20.719  27.793  49.770  1.00 20.26 ? 543  ILE D CD1 1 
ATOM   8866  N  N   . THR D  2  432 ? 18.698  33.395  50.409  1.00 21.42 ? 544  THR D N   1 
ATOM   8867  C  CA  . THR D  2  432 ? 18.406  34.685  49.799  1.00 20.48 ? 544  THR D CA  1 
ATOM   8868  C  C   . THR D  2  432 ? 19.643  35.317  49.201  1.00 18.45 ? 544  THR D C   1 
ATOM   8869  O  O   . THR D  2  432 ? 19.578  36.387  48.601  1.00 18.61 ? 544  THR D O   1 
ATOM   8870  C  CB  . THR D  2  432 ? 17.790  35.632  50.839  1.00 22.69 ? 544  THR D CB  1 
ATOM   8871  O  OG1 . THR D  2  432 ? 18.496  35.479  52.075  1.00 24.68 ? 544  THR D OG1 1 
ATOM   8872  C  CG2 . THR D  2  432 ? 16.326  35.294  51.062  1.00 21.36 ? 544  THR D CG2 1 
ATOM   8873  N  N   . THR D  2  433 ? 20.783  34.638  49.367  1.00 18.72 ? 545  THR D N   1 
ATOM   8874  C  CA  . THR D  2  433 ? 22.058  35.082  48.801  1.00 17.73 ? 545  THR D CA  1 
ATOM   8875  C  C   . THR D  2  433 ? 22.585  34.000  47.895  1.00 15.20 ? 545  THR D C   1 
ATOM   8876  O  O   . THR D  2  433 ? 22.829  32.906  48.351  1.00 16.58 ? 545  THR D O   1 
ATOM   8877  C  CB  . THR D  2  433 ? 23.085  35.341  49.916  1.00 19.11 ? 545  THR D CB  1 
ATOM   8878  O  OG1 . THR D  2  433 ? 22.567  36.347  50.786  1.00 22.59 ? 545  THR D OG1 1 
ATOM   8879  C  CG2 . THR D  2  433 ? 24.415  35.801  49.339  1.00 18.83 ? 545  THR D CG2 1 
ATOM   8880  N  N   . VAL D  2  434 ? 22.750  34.300  46.614  1.00 15.47 ? 546  VAL D N   1 
ATOM   8881  C  CA  . VAL D  2  434 ? 23.178  33.271  45.673  1.00 15.60 ? 546  VAL D CA  1 
ATOM   8882  C  C   . VAL D  2  434 ? 24.335  33.721  44.778  1.00 18.01 ? 546  VAL D C   1 
ATOM   8883  O  O   . VAL D  2  434 ? 24.618  34.920  44.607  1.00 18.33 ? 546  VAL D O   1 
ATOM   8884  C  CB  . VAL D  2  434 ? 22.000  32.782  44.767  1.00 14.21 ? 546  VAL D CB  1 
ATOM   8885  C  CG1 . VAL D  2  434 ? 21.015  31.957  45.564  1.00 11.40 ? 546  VAL D CG1 1 
ATOM   8886  C  CG2 . VAL D  2  434 ? 21.289  33.959  44.149  1.00 13.10 ? 546  VAL D CG2 1 
ATOM   8887  N  N   . SER D  2  435 ? 24.997  32.715  44.195  1.00 18.92 ? 547  SER D N   1 
ATOM   8888  C  CA  . SER D  2  435 ? 26.140  32.901  43.316  1.00 18.37 ? 547  SER D CA  1 
ATOM   8889  C  C   . SER D  2  435 ? 25.777  33.762  42.098  1.00 18.49 ? 547  SER D C   1 
ATOM   8890  O  O   . SER D  2  435 ? 24.676  33.659  41.556  1.00 16.52 ? 547  SER D O   1 
ATOM   8891  C  CB  . SER D  2  435 ? 26.676  31.520  42.847  1.00 16.06 ? 547  SER D CB  1 
ATOM   8892  O  OG  . SER D  2  435 ? 26.954  30.634  43.935  1.00 16.21 ? 547  SER D OG  1 
ATOM   8893  N  N   . LYS D  2  436 ? 26.702  34.641  41.711  1.00 19.97 ? 548  LYS D N   1 
ATOM   8894  C  CA  . LYS D  2  436 ? 26.571  35.446  40.502  1.00 22.48 ? 548  LYS D CA  1 
ATOM   8895  C  C   . LYS D  2  436 ? 26.817  34.535  39.315  1.00 23.50 ? 548  LYS D C   1 
ATOM   8896  O  O   . LYS D  2  436 ? 27.663  33.650  39.400  1.00 23.18 ? 548  LYS D O   1 
ATOM   8897  C  CB  . LYS D  2  436 ? 27.648  36.541  40.407  1.00 23.98 ? 548  LYS D CB  1 
ATOM   8898  C  CG  . LYS D  2  436 ? 27.751  37.526  41.557  1.00 24.88 ? 548  LYS D CG  1 
ATOM   8899  C  CD  . LYS D  2  436 ? 28.698  38.660  41.170  1.00 27.47 ? 548  LYS D CD  1 
ATOM   8900  C  CE  . LYS D  2  436 ? 29.003  39.584  42.339  1.00 28.82 ? 548  LYS D CE  1 
ATOM   8901  N  NZ  . LYS D  2  436 ? 29.513  40.900  41.873  1.00 29.79 ? 548  LYS D NZ  1 
ATOM   8902  N  N   . ASN D  2  437 ? 26.095  34.732  38.207  1.00 23.23 ? 549  ASN D N   1 
ATOM   8903  C  CA  . ASN D  2  437 ? 26.371  33.930  37.016  1.00 22.22 ? 549  ASN D CA  1 
ATOM   8904  C  C   . ASN D  2  437 ? 27.795  34.222  36.578  1.00 20.52 ? 549  ASN D C   1 
ATOM   8905  O  O   . ASN D  2  437 ? 28.245  35.358  36.741  1.00 20.21 ? 549  ASN D O   1 
ATOM   8906  C  CB  . ASN D  2  437 ? 25.388  34.296  35.906  1.00 25.97 ? 549  ASN D CB  1 
ATOM   8907  C  CG  . ASN D  2  437 ? 23.964  34.074  36.365  1.00 25.82 ? 549  ASN D CG  1 
ATOM   8908  O  OD1 . ASN D  2  437 ? 23.074  34.863  36.070  1.00 30.73 ? 549  ASN D OD1 1 
ATOM   8909  N  ND2 . ASN D  2  437 ? 23.748  33.005  37.110  1.00 25.85 ? 549  ASN D ND2 1 
ATOM   8910  N  N   . ASN D  2  438 ? 28.538  33.220  36.086  1.00 16.96 ? 550  ASN D N   1 
ATOM   8911  C  CA  . ASN D  2  438 ? 28.132  31.818  35.925  1.00 14.55 ? 550  ASN D CA  1 
ATOM   8912  C  C   . ASN D  2  438 ? 28.347  31.030  37.222  1.00 13.19 ? 550  ASN D C   1 
ATOM   8913  O  O   . ASN D  2  438 ? 29.461  30.986  37.748  1.00 13.12 ? 550  ASN D O   1 
ATOM   8914  C  CB  . ASN D  2  438 ? 28.984  31.206  34.781  1.00 14.21 ? 550  ASN D CB  1 
ATOM   8915  C  CG  . ASN D  2  438 ? 28.581  29.811  34.287  1.00 11.13 ? 550  ASN D CG  1 
ATOM   8916  O  OD1 . ASN D  2  438 ? 28.083  28.972  35.029  1.00 10.62 ? 550  ASN D OD1 1 
ATOM   8917  N  ND2 . ASN D  2  438 ? 28.826  29.562  33.008  1.00 9.87  ? 550  ASN D ND2 1 
ATOM   8918  N  N   . ILE D  2  439 ? 27.271  30.380  37.710  1.00 12.65 ? 551  ILE D N   1 
ATOM   8919  C  CA  . ILE D  2  439 ? 27.269  29.571  38.952  1.00 10.93 ? 551  ILE D CA  1 
ATOM   8920  C  C   . ILE D  2  439 ? 28.319  28.442  38.936  1.00 11.21 ? 551  ILE D C   1 
ATOM   8921  O  O   . ILE D  2  439 ? 28.742  27.989  39.984  1.00 13.78 ? 551  ILE D O   1 
ATOM   8922  C  CB  . ILE D  2  439 ? 25.845  28.974  39.229  1.00 11.09 ? 551  ILE D CB  1 
ATOM   8923  C  CG1 . ILE D  2  439 ? 25.757  28.434  40.661  1.00 9.81  ? 551  ILE D CG1 1 
ATOM   8924  C  CG2 . ILE D  2  439 ? 25.495  27.871  38.216  1.00 12.19 ? 551  ILE D CG2 1 
ATOM   8925  C  CD1 . ILE D  2  439 ? 24.377  27.945  41.065  1.00 8.94  ? 551  ILE D CD1 1 
ATOM   8926  N  N   . PHE D  2  440 ? 28.740  28.000  37.754  1.00 9.30  ? 552  PHE D N   1 
ATOM   8927  C  CA  . PHE D  2  440 ? 29.741  26.950  37.655  1.00 10.55 ? 552  PHE D CA  1 
ATOM   8928  C  C   . PHE D  2  440 ? 31.159  27.510  37.847  1.00 12.49 ? 552  PHE D C   1 
ATOM   8929  O  O   . PHE D  2  440 ? 32.097  26.770  38.187  1.00 11.00 ? 552  PHE D O   1 
ATOM   8930  C  CB  . PHE D  2  440 ? 29.614  26.223  36.314  1.00 11.25 ? 552  PHE D CB  1 
ATOM   8931  C  CG  . PHE D  2  440 ? 28.301  25.495  36.192  1.00 13.12 ? 552  PHE D CG  1 
ATOM   8932  C  CD1 . PHE D  2  440 ? 27.434  25.762  35.128  1.00 13.09 ? 552  PHE D CD1 1 
ATOM   8933  C  CD2 . PHE D  2  440 ? 27.888  24.609  37.190  1.00 12.21 ? 552  PHE D CD2 1 
ATOM   8934  C  CE1 . PHE D  2  440 ? 26.168  25.171  35.056  1.00 12.16 ? 552  PHE D CE1 1 
ATOM   8935  C  CE2 . PHE D  2  440 ? 26.622  24.017  37.131  1.00 15.55 ? 552  PHE D CE2 1 
ATOM   8936  C  CZ  . PHE D  2  440 ? 25.755  24.302  36.059  1.00 12.72 ? 552  PHE D CZ  1 
ATOM   8937  N  N   . MET D  2  441 ? 31.301  28.827  37.655  1.00 14.88 ? 553  MET D N   1 
ATOM   8938  C  CA  . MET D  2  441 ? 32.591  29.495  37.845  1.00 16.52 ? 553  MET D CA  1 
ATOM   8939  C  C   . MET D  2  441 ? 32.692  30.118  39.237  1.00 16.99 ? 553  MET D C   1 
ATOM   8940  O  O   . MET D  2  441 ? 33.669  29.893  39.953  1.00 17.17 ? 553  MET D O   1 
ATOM   8941  C  CB  . MET D  2  441 ? 32.822  30.567  36.785  1.00 17.13 ? 553  MET D CB  1 
ATOM   8942  C  CG  . MET D  2  441 ? 34.299  30.878  36.596  1.00 18.44 ? 553  MET D CG  1 
ATOM   8943  S  SD  . MET D  2  441 ? 34.587  32.196  35.429  1.00 23.35 ? 553  MET D SD  1 
ATOM   8944  C  CE  . MET D  2  441 ? 33.403  31.783  34.151  1.00 23.09 ? 553  MET D CE  1 
ATOM   8945  N  N   . SER D  2  442 ? 31.679  30.902  39.611  1.00 14.13 ? 554  SER D N   1 
ATOM   8946  C  CA  . SER D  2  442 ? 31.635  31.503  40.936  1.00 14.96 ? 554  SER D CA  1 
ATOM   8947  C  C   . SER D  2  442 ? 31.813  30.425  41.983  1.00 13.42 ? 554  SER D C   1 
ATOM   8948  O  O   . SER D  2  442 ? 31.302  29.318  41.778  1.00 12.88 ? 554  SER D O   1 
ATOM   8949  C  CB  . SER D  2  442 ? 30.279  32.205  41.140  1.00 14.44 ? 554  SER D CB  1 
ATOM   8950  O  OG  . SER D  2  442 ? 30.120  33.308  40.242  1.00 15.26 ? 554  SER D OG  1 
ATOM   8951  N  N   . ASN D  2  443 ? 32.554  30.733  43.080  1.00 12.84 ? 555  ASN D N   1 
ATOM   8952  C  CA  . ASN D  2  443 ? 32.791  29.769  44.194  1.00 15.04 ? 555  ASN D CA  1 
ATOM   8953  C  C   . ASN D  2  443 ? 33.334  30.452  45.458  1.00 15.53 ? 555  ASN D C   1 
ATOM   8954  O  O   . ASN D  2  443 ? 33.738  29.774  46.397  1.00 12.77 ? 555  ASN D O   1 
ATOM   8955  C  CB  . ASN D  2  443 ? 33.784  28.643  43.783  1.00 13.57 ? 555  ASN D CB  1 
ATOM   8956  C  CG  . ASN D  2  443 ? 35.175  29.150  43.412  1.00 15.62 ? 555  ASN D CG  1 
ATOM   8957  O  OD1 . ASN D  2  443 ? 35.467  30.344  43.531  1.00 15.22 ? 555  ASN D OD1 1 
ATOM   8958  N  ND2 . ASN D  2  443 ? 36.048  28.247  42.947  1.00 12.76 ? 555  ASN D ND2 1 
ATOM   8959  N  N   . SER D  2  444 ? 33.304  31.790  45.467  1.00 17.78 ? 556  SER D N   1 
ATOM   8960  C  CA  . SER D  2  444 ? 33.863  32.591  46.554  1.00 18.25 ? 556  SER D CA  1 
ATOM   8961  C  C   . SER D  2  444 ? 32.869  33.600  47.157  1.00 17.93 ? 556  SER D C   1 
ATOM   8962  O  O   . SER D  2  444 ? 32.455  34.565  46.517  1.00 17.83 ? 556  SER D O   1 
ATOM   8963  C  CB  . SER D  2  444 ? 35.095  33.328  46.033  1.00 17.57 ? 556  SER D CB  1 
ATOM   8964  O  OG  . SER D  2  444 ? 35.648  34.176  47.013  1.00 21.75 ? 556  SER D OG  1 
ATOM   8965  N  N   . TYR D  2  445 ? 32.494  33.364  48.400  1.00 19.37 ? 557  TYR D N   1 
ATOM   8966  C  CA  . TYR D  2  445 ? 31.623  34.278  49.138  1.00 22.73 ? 557  TYR D CA  1 
ATOM   8967  C  C   . TYR D  2  445 ? 32.485  35.133  50.099  1.00 23.05 ? 557  TYR D C   1 
ATOM   8968  O  O   . TYR D  2  445 ? 33.362  34.604  50.789  1.00 21.01 ? 557  TYR D O   1 
ATOM   8969  C  CB  . TYR D  2  445 ? 30.547  33.496  49.933  1.00 24.29 ? 557  TYR D CB  1 
ATOM   8970  C  CG  . TYR D  2  445 ? 29.672  34.355  50.865  1.00 27.06 ? 557  TYR D CG  1 
ATOM   8971  C  CD1 . TYR D  2  445 ? 28.419  34.843  50.452  1.00 26.34 ? 557  TYR D CD1 1 
ATOM   8972  C  CD2 . TYR D  2  445 ? 30.094  34.669  52.175  1.00 28.43 ? 557  TYR D CD2 1 
ATOM   8973  C  CE1 . TYR D  2  445 ? 27.624  35.606  51.303  1.00 25.64 ? 557  TYR D CE1 1 
ATOM   8974  C  CE2 . TYR D  2  445 ? 29.301  35.430  53.032  1.00 26.77 ? 557  TYR D CE2 1 
ATOM   8975  C  CZ  . TYR D  2  445 ? 28.069  35.895  52.593  1.00 26.03 ? 557  TYR D CZ  1 
ATOM   8976  O  OH  . TYR D  2  445 ? 27.283  36.640  53.446  1.00 25.03 ? 557  TYR D OH  1 
ATOM   8977  N  N   . PRO D  2  446 ? 32.205  36.453  50.209  1.00 22.49 ? 558  PRO D N   1 
ATOM   8978  C  CA  . PRO D  2  446 ? 31.111  37.153  49.478  1.00 21.82 ? 558  PRO D CA  1 
ATOM   8979  C  C   . PRO D  2  446 ? 31.376  37.608  48.017  1.00 21.03 ? 558  PRO D C   1 
ATOM   8980  O  O   . PRO D  2  446 ? 30.433  37.966  47.325  1.00 22.30 ? 558  PRO D O   1 
ATOM   8981  C  CB  . PRO D  2  446 ? 30.860  38.340  50.398  1.00 22.55 ? 558  PRO D CB  1 
ATOM   8982  C  CG  . PRO D  2  446 ? 32.251  38.688  50.802  1.00 20.17 ? 558  PRO D CG  1 
ATOM   8983  C  CD  . PRO D  2  446 ? 32.854  37.368  51.173  1.00 20.66 ? 558  PRO D CD  1 
ATOM   8984  N  N   . ARG D  2  447 ? 32.631  37.604  47.555  1.00 20.11 ? 559  ARG D N   1 
ATOM   8985  C  CA  . ARG D  2  447 ? 33.007  38.124  46.212  1.00 20.45 ? 559  ARG D CA  1 
ATOM   8986  C  C   . ARG D  2  447 ? 32.090  37.680  45.031  1.00 20.18 ? 559  ARG D C   1 
ATOM   8987  O  O   . ARG D  2  447 ? 31.747  38.486  44.150  1.00 18.26 ? 559  ARG D O   1 
ATOM   8988  C  CB  . ARG D  2  447 ? 34.455  37.730  45.882  1.00 20.23 ? 559  ARG D CB  1 
ATOM   8989  C  CG  . ARG D  2  447 ? 34.987  38.342  44.591  1.00 23.08 ? 559  ARG D CG  1 
ATOM   8990  C  CD  . ARG D  2  447 ? 36.301  37.697  44.172  1.00 27.04 ? 559  ARG D CD  1 
ATOM   8991  N  NE  . ARG D  2  447 ? 36.116  36.347  43.626  1.00 29.76 ? 559  ARG D NE  1 
ATOM   8992  C  CZ  . ARG D  2  447 ? 36.953  35.301  43.821  1.00 33.91 ? 559  ARG D CZ  1 
ATOM   8993  N  NH1 . ARG D  2  447 ? 38.052  35.436  44.604  1.00 31.69 ? 559  ARG D NH1 1 
ATOM   8994  N  NH2 . ARG D  2  447 ? 36.681  34.109  43.240  1.00 30.43 ? 559  ARG D NH2 1 
ATOM   8995  N  N   . ASP D  2  448 ? 31.712  36.424  45.008  1.00 18.80 ? 560  ASP D N   1 
ATOM   8996  C  CA  . ASP D  2  448 ? 30.972  35.903  43.878  1.00 20.27 ? 560  ASP D CA  1 
ATOM   8997  C  C   . ASP D  2  448 ? 29.487  35.717  44.177  1.00 21.90 ? 560  ASP D C   1 
ATOM   8998  O  O   . ASP D  2  448 ? 28.869  34.776  43.659  1.00 23.82 ? 560  ASP D O   1 
ATOM   8999  C  CB  . ASP D  2  448 ? 31.593  34.556  43.458  1.00 20.23 ? 560  ASP D CB  1 
ATOM   9000  C  CG  . ASP D  2  448 ? 33.064  34.652  43.041  1.00 19.12 ? 560  ASP D CG  1 
ATOM   9001  O  OD1 . ASP D  2  448 ? 33.487  35.749  42.593  1.00 18.26 ? 560  ASP D OD1 1 
ATOM   9002  O  OD2 . ASP D  2  448 ? 33.791  33.632  43.155  1.00 14.40 ? 560  ASP D OD2 1 
ATOM   9003  N  N   . PHE D  2  449 ? 28.892  36.593  44.999  1.00 21.55 ? 561  PHE D N   1 
ATOM   9004  C  CA  . PHE D  2  449 ? 27.485  36.432  45.377  1.00 20.82 ? 561  PHE D CA  1 
ATOM   9005  C  C   . PHE D  2  449 ? 26.657  37.720  45.297  1.00 20.95 ? 561  PHE D C   1 
ATOM   9006  O  O   . PHE D  2  449 ? 27.181  38.827  45.332  1.00 20.26 ? 561  PHE D O   1 
ATOM   9007  C  CB  . PHE D  2  449 ? 27.393  35.833  46.776  1.00 20.84 ? 561  PHE D CB  1 
ATOM   9008  C  CG  . PHE D  2  449 ? 27.787  34.392  46.823  1.00 22.81 ? 561  PHE D CG  1 
ATOM   9009  C  CD1 . PHE D  2  449 ? 26.812  33.397  46.951  1.00 21.12 ? 561  PHE D CD1 1 
ATOM   9010  C  CD2 . PHE D  2  449 ? 29.139  34.009  46.671  1.00 24.18 ? 561  PHE D CD2 1 
ATOM   9011  C  CE1 . PHE D  2  449 ? 27.163  32.043  46.917  1.00 22.48 ? 561  PHE D CE1 1 
ATOM   9012  C  CE2 . PHE D  2  449 ? 29.501  32.659  46.635  1.00 24.93 ? 561  PHE D CE2 1 
ATOM   9013  C  CZ  . PHE D  2  449 ? 28.509  31.676  46.757  1.00 24.69 ? 561  PHE D CZ  1 
ATOM   9014  N  N   . VAL D  2  450 ? 25.339  37.545  45.169  1.00 22.78 ? 562  VAL D N   1 
ATOM   9015  C  CA  . VAL D  2  450 ? 24.374  38.646  45.104  1.00 22.96 ? 562  VAL D CA  1 
ATOM   9016  C  C   . VAL D  2  450 ? 23.077  38.226  45.762  1.00 22.91 ? 562  VAL D C   1 
ATOM   9017  O  O   . VAL D  2  450 ? 22.825  37.028  45.963  1.00 22.51 ? 562  VAL D O   1 
ATOM   9018  C  CB  . VAL D  2  450 ? 24.047  39.080  43.651  1.00 24.55 ? 562  VAL D CB  1 
ATOM   9019  C  CG1 . VAL D  2  450 ? 25.240  39.784  43.030  1.00 25.18 ? 562  VAL D CG1 1 
ATOM   9020  C  CG2 . VAL D  2  450 ? 23.653  37.866  42.806  1.00 26.20 ? 562  VAL D CG2 1 
ATOM   9021  N  N   . ASN D  2  451 ? 22.258  39.202  46.099  1.00 22.93 ? 563  ASN D N   1 
ATOM   9022  C  CA  . ASN D  2  451 ? 20.985  38.924  46.742  1.00 23.91 ? 563  ASN D CA  1 
ATOM   9023  C  C   . ASN D  2  451 ? 19.990  38.419  45.734  1.00 22.54 ? 563  ASN D C   1 
ATOM   9024  O  O   . ASN D  2  451 ? 20.008  38.829  44.579  1.00 22.71 ? 563  ASN D O   1 
ATOM   9025  C  CB  . ASN D  2  451 ? 20.426  40.186  47.400  1.00 28.65 ? 563  ASN D CB  1 
ATOM   9026  C  CG  . ASN D  2  451 ? 21.390  40.787  48.409  1.00 31.74 ? 563  ASN D CG  1 
ATOM   9027  O  OD1 . ASN D  2  451 ? 22.292  40.099  48.914  1.00 34.71 ? 563  ASN D OD1 1 
ATOM   9028  N  ND2 . ASN D  2  451 ? 21.203  42.073  48.712  1.00 32.45 ? 563  ASN D ND2 1 
ATOM   9029  N  N   . CYS D  2  452 ? 19.128  37.526  46.182  1.00 22.48 ? 564  CYS D N   1 
ATOM   9030  C  CA  . CYS D  2  452 ? 18.086  36.959  45.349  1.00 23.83 ? 564  CYS D CA  1 
ATOM   9031  C  C   . CYS D  2  452 ? 17.170  38.035  44.772  1.00 26.85 ? 564  CYS D C   1 
ATOM   9032  O  O   . CYS D  2  452 ? 16.675  37.882  43.655  1.00 28.57 ? 564  CYS D O   1 
ATOM   9033  C  CB  . CYS D  2  452 ? 17.251  35.980  46.169  1.00 19.77 ? 564  CYS D CB  1 
ATOM   9034  S  SG  . CYS D  2  452 ? 18.024  34.367  46.376  1.00 19.47 ? 564  CYS D SG  1 
ATOM   9035  N  N   . SER D  2  453 ? 16.967  39.134  45.545  1.00 27.48 ? 565  SER D N   1 
ATOM   9036  C  CA  . SER D  2  453 ? 16.059  40.233  45.185  1.00 27.34 ? 565  SER D CA  1 
ATOM   9037  C  C   . SER D  2  453 ? 16.529  41.031  43.971  1.00 27.55 ? 565  SER D C   1 
ATOM   9038  O  O   . SER D  2  453 ? 15.791  41.868  43.477  1.00 29.05 ? 565  SER D O   1 
ATOM   9039  C  CB  . SER D  2  453 ? 15.907  41.186  46.363  1.00 27.45 ? 565  SER D CB  1 
ATOM   9040  O  OG  . SER D  2  453 ? 17.078  41.964  46.515  1.00 29.15 ? 565  SER D OG  1 
ATOM   9041  N  N   . THR D  2  454 ? 17.754  40.767  43.497  1.00 26.91 ? 566  THR D N   1 
ATOM   9042  C  CA  . THR D  2  454 ? 18.327  41.486  42.352  1.00 23.83 ? 566  THR D CA  1 
ATOM   9043  C  C   . THR D  2  454 ? 18.187  40.698  41.033  1.00 22.12 ? 566  THR D C   1 
ATOM   9044  O  O   . THR D  2  454 ? 18.516  41.190  39.954  1.00 19.37 ? 566  THR D O   1 
ATOM   9045  C  CB  . THR D  2  454 ? 19.824  41.785  42.627  1.00 25.01 ? 566  THR D CB  1 
ATOM   9046  O  OG1 . THR D  2  454 ? 20.557  40.546  42.703  1.00 24.74 ? 566  THR D OG1 1 
ATOM   9047  C  CG2 . THR D  2  454 ? 19.985  42.526  43.949  1.00 22.76 ? 566  THR D CG2 1 
ATOM   9048  N  N   . LEU D  2  455 ? 17.688  39.473  41.140  1.00 22.98 ? 567  LEU D N   1 
ATOM   9049  C  CA  . LEU D  2  455 ? 17.534  38.573  39.996  1.00 25.21 ? 567  LEU D CA  1 
ATOM   9050  C  C   . LEU D  2  455 ? 16.077  38.513  39.506  1.00 26.36 ? 567  LEU D C   1 
ATOM   9051  O  O   . LEU D  2  455 ? 15.163  38.278  40.299  1.00 28.58 ? 567  LEU D O   1 
ATOM   9052  C  CB  . LEU D  2  455 ? 18.004  37.169  40.397  1.00 23.98 ? 567  LEU D CB  1 
ATOM   9053  C  CG  . LEU D  2  455 ? 19.411  37.076  41.019  1.00 23.46 ? 567  LEU D CG  1 
ATOM   9054  C  CD1 . LEU D  2  455 ? 19.695  35.652  41.479  1.00 20.88 ? 567  LEU D CD1 1 
ATOM   9055  C  CD2 . LEU D  2  455 ? 20.454  37.531  40.013  1.00 20.80 ? 567  LEU D CD2 1 
ATOM   9056  N  N   . PRO D  2  456 ? 15.833  38.703  38.185  1.00 27.48 ? 568  PRO D N   1 
ATOM   9057  C  CA  . PRO D  2  456 ? 14.474  38.665  37.610  1.00 27.50 ? 568  PRO D CA  1 
ATOM   9058  C  C   . PRO D  2  456 ? 13.917  37.266  37.582  1.00 26.07 ? 568  PRO D C   1 
ATOM   9059  O  O   . PRO D  2  456 ? 14.584  36.333  37.142  1.00 27.67 ? 568  PRO D O   1 
ATOM   9060  C  CB  . PRO D  2  456 ? 14.669  39.206  36.204  1.00 27.27 ? 568  PRO D CB  1 
ATOM   9061  C  CG  . PRO D  2  456 ? 16.033  38.705  35.872  1.00 29.41 ? 568  PRO D CG  1 
ATOM   9062  C  CD  . PRO D  2  456 ? 16.830  38.968  37.129  1.00 28.16 ? 568  PRO D CD  1 
ATOM   9063  N  N   . ALA D  2  457 ? 12.705  37.125  38.066  1.00 25.37 ? 569  ALA D N   1 
ATOM   9064  C  CA  . ALA D  2  457 ? 12.047  35.845  38.036  1.00 24.06 ? 569  ALA D CA  1 
ATOM   9065  C  C   . ALA D  2  457 ? 11.637  35.503  36.604  1.00 23.37 ? 569  ALA D C   1 
ATOM   9066  O  O   . ALA D  2  457 ? 11.672  36.351  35.713  1.00 23.73 ? 569  ALA D O   1 
ATOM   9067  C  CB  . ALA D  2  457 ? 10.829  35.875  38.944  1.00 25.14 ? 569  ALA D CB  1 
ATOM   9068  N  N   . LEU D  2  458 ? 11.301  34.247  36.377  1.00 23.23 ? 570  LEU D N   1 
ATOM   9069  C  CA  . LEU D  2  458 ? 10.819  33.818  35.084  1.00 21.43 ? 570  LEU D CA  1 
ATOM   9070  C  C   . LEU D  2  458 ? 9.391   34.374  34.871  1.00 21.16 ? 570  LEU D C   1 
ATOM   9071  O  O   . LEU D  2  458 ? 8.521   34.285  35.747  1.00 19.44 ? 570  LEU D O   1 
ATOM   9072  C  CB  . LEU D  2  458 ? 10.836  32.276  35.007  1.00 21.61 ? 570  LEU D CB  1 
ATOM   9073  C  CG  . LEU D  2  458 ? 10.119  31.614  33.803  1.00 22.66 ? 570  LEU D CG  1 
ATOM   9074  C  CD1 . LEU D  2  458 ? 10.821  31.960  32.501  1.00 21.10 ? 570  LEU D CD1 1 
ATOM   9075  C  CD2 . LEU D  2  458 ? 10.046  30.101  33.996  1.00 22.44 ? 570  LEU D CD2 1 
ATOM   9076  N  N   . ASN D  2  459 ? 9.189   34.977  33.717  1.00 20.32 ? 571  ASN D N   1 
ATOM   9077  C  CA  . ASN D  2  459 ? 7.919   35.566  33.346  1.00 20.43 ? 571  ASN D CA  1 
ATOM   9078  C  C   . ASN D  2  459 ? 7.082   34.536  32.589  1.00 20.06 ? 571  ASN D C   1 
ATOM   9079  O  O   . ASN D  2  459 ? 7.412   34.190  31.457  1.00 20.57 ? 571  ASN D O   1 
ATOM   9080  C  CB  . ASN D  2  459 ? 8.195   36.782  32.455  1.00 21.22 ? 571  ASN D CB  1 
ATOM   9081  C  CG  . ASN D  2  459 ? 7.011   37.718  32.326  1.00 24.93 ? 571  ASN D CG  1 
ATOM   9082  O  OD1 . ASN D  2  459 ? 5.857   37.300  32.439  1.00 25.76 ? 571  ASN D OD1 1 
ATOM   9083  N  ND2 . ASN D  2  459 ? 7.291   38.996  32.089  1.00 23.96 ? 571  ASN D ND2 1 
ATOM   9084  N  N   . LEU D  2  460 ? 6.007   34.042  33.208  1.00 19.92 ? 572  LEU D N   1 
ATOM   9085  C  CA  . LEU D  2  460 ? 5.144   33.047  32.550  1.00 20.63 ? 572  LEU D CA  1 
ATOM   9086  C  C   . LEU D  2  460 ? 3.965   33.676  31.829  1.00 19.43 ? 572  LEU D C   1 
ATOM   9087  O  O   . LEU D  2  460 ? 3.028   32.988  31.486  1.00 19.36 ? 572  LEU D O   1 
ATOM   9088  C  CB  . LEU D  2  460 ? 4.597   32.020  33.562  1.00 20.98 ? 572  LEU D CB  1 
ATOM   9089  C  CG  . LEU D  2  460 ? 5.615   31.105  34.246  1.00 20.13 ? 572  LEU D CG  1 
ATOM   9090  C  CD1 . LEU D  2  460 ? 4.918   30.261  35.297  1.00 20.60 ? 572  LEU D CD1 1 
ATOM   9091  C  CD2 . LEU D  2  460 ? 6.316   30.228  33.226  1.00 19.03 ? 572  LEU D CD2 1 
ATOM   9092  N  N   . ALA D  2  461 ? 4.008   34.971  31.577  1.00 19.94 ? 573  ALA D N   1 
ATOM   9093  C  CA  . ALA D  2  461 ? 2.870   35.639  30.932  1.00 19.71 ? 573  ALA D CA  1 
ATOM   9094  C  C   . ALA D  2  461 ? 2.559   35.095  29.504  1.00 19.68 ? 573  ALA D C   1 
ATOM   9095  O  O   . ALA D  2  461 ? 1.390   35.021  29.114  1.00 18.04 ? 573  ALA D O   1 
ATOM   9096  C  CB  . ALA D  2  461 ? 3.104   37.145  30.919  1.00 17.77 ? 573  ALA D CB  1 
ATOM   9097  N  N   . SER D  2  462 ? 3.611   34.717  28.738  1.00 19.00 ? 574  SER D N   1 
ATOM   9098  C  CA  . SER D  2  462 ? 3.444   34.139  27.402  1.00 18.11 ? 574  SER D CA  1 
ATOM   9099  C  C   . SER D  2  462 ? 2.943   32.658  27.447  1.00 19.34 ? 574  SER D C   1 
ATOM   9100  O  O   . SER D  2  462 ? 2.649   32.056  26.416  1.00 19.99 ? 574  SER D O   1 
ATOM   9101  C  CB  . SER D  2  462 ? 4.744   34.278  26.575  1.00 16.12 ? 574  SER D CB  1 
ATOM   9102  O  OG  . SER D  2  462 ? 5.853   33.689  27.226  1.00 16.35 ? 574  SER D OG  1 
ATOM   9103  N  N   . TRP D  2  463 ? 2.841   32.085  28.642  1.00 19.82 ? 575  TRP D N   1 
ATOM   9104  C  CA  . TRP D  2  463 ? 2.220   30.780  28.825  1.00 19.21 ? 575  TRP D CA  1 
ATOM   9105  C  C   . TRP D  2  463 ? 0.708   30.917  29.056  1.00 20.97 ? 575  TRP D C   1 
ATOM   9106  O  O   . TRP D  2  463 ? 0.043   29.924  29.280  1.00 21.30 ? 575  TRP D O   1 
ATOM   9107  C  CB  . TRP D  2  463 ? 2.817   30.046  30.022  1.00 18.62 ? 575  TRP D CB  1 
ATOM   9108  C  CG  . TRP D  2  463 ? 4.034   29.242  29.690  1.00 21.37 ? 575  TRP D CG  1 
ATOM   9109  C  CD1 . TRP D  2  463 ? 4.114   27.875  29.519  1.00 20.44 ? 575  TRP D CD1 1 
ATOM   9110  C  CD2 . TRP D  2  463 ? 5.348   29.748  29.486  1.00 19.28 ? 575  TRP D CD2 1 
ATOM   9111  N  NE1 . TRP D  2  463 ? 5.408   27.504  29.220  1.00 17.51 ? 575  TRP D NE1 1 
ATOM   9112  C  CE2 . TRP D  2  463 ? 6.188   28.631  29.192  1.00 18.64 ? 575  TRP D CE2 1 
ATOM   9113  C  CE3 . TRP D  2  463 ? 5.905   31.036  29.520  1.00 18.69 ? 575  TRP D CE3 1 
ATOM   9114  C  CZ2 . TRP D  2  463 ? 7.555   28.773  28.937  1.00 16.26 ? 575  TRP D CZ2 1 
ATOM   9115  C  CZ3 . TRP D  2  463 ? 7.270   31.163  29.260  1.00 18.76 ? 575  TRP D CZ3 1 
ATOM   9116  C  CH2 . TRP D  2  463 ? 8.080   30.040  28.972  1.00 14.76 ? 575  TRP D CH2 1 
ATOM   9117  N  N   . ARG D  2  464 ? 0.180   32.157  29.052  1.00 22.96 ? 576  ARG D N   1 
ATOM   9118  C  CA  . ARG D  2  464 ? -1.262  32.397  29.229  1.00 24.93 ? 576  ARG D CA  1 
ATOM   9119  C  C   . ARG D  2  464 ? -2.030  31.955  27.991  1.00 24.80 ? 576  ARG D C   1 
ATOM   9120  O  O   . ARG D  2  464 ? -1.744  32.369  26.874  1.00 25.16 ? 576  ARG D O   1 
ATOM   9121  C  CB  . ARG D  2  464 ? -1.558  33.887  29.490  1.00 29.09 ? 576  ARG D CB  1 
ATOM   9122  C  CG  . ARG D  2  464 ? -3.049  34.228  29.537  1.00 33.30 ? 576  ARG D CG  1 
ATOM   9123  C  CD  . ARG D  2  464 ? -3.648  34.038  30.931  1.00 39.01 ? 576  ARG D CD  1 
ATOM   9124  N  NE  . ARG D  2  464 ? -3.345  35.186  31.803  1.00 45.43 ? 576  ARG D NE  1 
ATOM   9125  C  CZ  . ARG D  2  464 ? -3.546  35.264  33.133  1.00 46.84 ? 576  ARG D CZ  1 
ATOM   9126  N  NH1 . ARG D  2  464 ? -4.060  34.250  33.813  1.00 47.26 ? 576  ARG D NH1 1 
ATOM   9127  N  NH2 . ARG D  2  464 ? -3.214  36.372  33.779  1.00 47.97 ? 576  ARG D NH2 1 
ATOM   9128  N  N   . GLU D  2  465 ? -2.993  31.103  28.201  1.00 26.10 ? 577  GLU D N   1 
ATOM   9129  C  CA  . GLU D  2  465 ? -3.791  30.607  27.116  1.00 29.24 ? 577  GLU D CA  1 
ATOM   9130  C  C   . GLU D  2  465 ? -4.871  31.617  26.773  1.00 31.99 ? 577  GLU D C   1 
ATOM   9131  O  O   . GLU D  2  465 ? -5.228  31.776  25.605  1.00 31.69 ? 577  GLU D O   1 
ATOM   9132  C  CB  . GLU D  2  465 ? -4.399  29.283  27.534  1.00 30.21 ? 577  GLU D CB  1 
ATOM   9133  C  CG  . GLU D  2  465 ? -4.819  28.423  26.368  1.00 32.03 ? 577  GLU D CG  1 
ATOM   9134  C  CD  . GLU D  2  465 ? -5.021  26.993  26.767  1.00 31.17 ? 577  GLU D CD  1 
ATOM   9135  O  OE1 . GLU D  2  465 ? -4.505  26.105  26.062  1.00 28.45 ? 577  GLU D OE1 1 
ATOM   9136  O  OE2 . GLU D  2  465 ? -5.690  26.762  27.795  1.00 32.94 ? 577  GLU D OE2 1 
ATOM   9137  N  N   . ALA D  2  466 ? -5.351  32.314  27.824  1.00 35.39 ? 578  ALA D N   1 
ATOM   9138  C  CA  . ALA D  2  466 ? -6.399  33.347  27.747  1.00 38.54 ? 578  ALA D CA  1 
ATOM   9139  C  C   . ALA D  2  466 ? -7.780  32.774  27.325  1.00 38.72 ? 578  ALA D C   1 
ATOM   9140  O  O   . ALA D  2  466 ? -7.958  32.457  26.116  1.00 39.42 ? 578  ALA D O   1 
ATOM   9141  C  CB  . ALA D  2  466 ? -5.955  34.488  26.816  1.00 38.35 ? 578  ALA D CB  1 
ATOM   9142  O  OXT . ALA D  2  466 ? -8.659  32.644  28.214  1.00 35.28 ? 578  ALA D OXT 1 
HETATM 9143  C  C1  . NAG E  3  .   ? 42.045  3.904   9.067   1.00 11.84 ? 1    NAG E C1  1 
HETATM 9144  C  C2  . NAG E  3  .   ? 42.576  5.318   9.013   1.00 11.62 ? 1    NAG E C2  1 
HETATM 9145  C  C3  . NAG E  3  .   ? 41.893  6.114   10.120  1.00 12.93 ? 1    NAG E C3  1 
HETATM 9146  C  C4  . NAG E  3  .   ? 40.356  6.000   9.999   1.00 11.85 ? 1    NAG E C4  1 
HETATM 9147  C  C5  . NAG E  3  .   ? 39.872  4.534   9.767   1.00 11.56 ? 1    NAG E C5  1 
HETATM 9148  C  C6  . NAG E  3  .   ? 38.421  4.484   9.281   1.00 9.49  ? 1    NAG E C6  1 
HETATM 9149  C  C7  . NAG E  3  .   ? 44.834  5.452   8.161   1.00 17.27 ? 1    NAG E C7  1 
HETATM 9150  C  C8  . NAG E  3  .   ? 46.342  5.468   8.417   1.00 13.46 ? 1    NAG E C8  1 
HETATM 9151  N  N2  . NAG E  3  .   ? 44.024  5.336   9.208   1.00 12.90 ? 1    NAG E N2  1 
HETATM 9152  O  O3  . NAG E  3  .   ? 42.287  7.484   10.040  1.00 9.34  ? 1    NAG E O3  1 
HETATM 9153  O  O4  . NAG E  3  .   ? 39.766  6.499   11.198  1.00 10.45 ? 1    NAG E O4  1 
HETATM 9154  O  O5  . NAG E  3  .   ? 40.659  3.899   8.725   1.00 9.11  ? 1    NAG E O5  1 
HETATM 9155  O  O6  . NAG E  3  .   ? 38.353  5.304   8.102   1.00 11.89 ? 1    NAG E O6  1 
HETATM 9156  O  O7  . NAG E  3  .   ? 44.402  5.525   7.008   1.00 20.04 ? 1    NAG E O7  1 
HETATM 9157  C  C1  . NAG E  3  .   ? 38.767  7.428   11.001  1.00 9.37  ? 2    NAG E C1  1 
HETATM 9158  C  C2  . NAG E  3  .   ? 37.823  7.444   12.213  1.00 7.97  ? 2    NAG E C2  1 
HETATM 9159  C  C3  . NAG E  3  .   ? 36.785  8.582   12.074  1.00 7.98  ? 2    NAG E C3  1 
HETATM 9160  C  C4  . NAG E  3  .   ? 37.521  9.910   11.773  1.00 8.82  ? 2    NAG E C4  1 
HETATM 9161  C  C5  . NAG E  3  .   ? 38.396  9.733   10.522  1.00 10.05 ? 2    NAG E C5  1 
HETATM 9162  C  C6  . NAG E  3  .   ? 39.146  10.981  10.090  1.00 10.56 ? 2    NAG E C6  1 
HETATM 9163  C  C7  . NAG E  3  .   ? 37.609  5.214   13.080  1.00 7.97  ? 2    NAG E C7  1 
HETATM 9164  C  C8  . NAG E  3  .   ? 36.975  3.841   13.026  1.00 5.87  ? 2    NAG E C8  1 
HETATM 9165  N  N2  . NAG E  3  .   ? 37.170  6.147   12.236  1.00 9.28  ? 2    NAG E N2  1 
HETATM 9166  O  O3  . NAG E  3  .   ? 35.978  8.697   13.257  1.00 8.28  ? 2    NAG E O3  1 
HETATM 9167  O  O4  . NAG E  3  .   ? 36.584  10.972  11.542  1.00 13.71 ? 2    NAG E O4  1 
HETATM 9168  O  O5  . NAG E  3  .   ? 39.374  8.703   10.759  1.00 11.82 ? 2    NAG E O5  1 
HETATM 9169  O  O6  . NAG E  3  .   ? 39.793  11.592  11.185  1.00 10.88 ? 2    NAG E O6  1 
HETATM 9170  O  O7  . NAG E  3  .   ? 38.476  5.439   13.904  1.00 8.92  ? 2    NAG E O7  1 
HETATM 9171  C  C1  . BMA E  3  .   ? 36.465  11.918  12.555  1.00 14.36 ? 3    BMA E C1  1 
HETATM 9172  C  C2  . BMA E  3  .   ? 36.041  13.263  11.995  1.00 15.31 ? 3    BMA E C2  1 
HETATM 9173  C  C3  . BMA E  3  .   ? 36.021  14.269  13.142  1.00 17.30 ? 3    BMA E C3  1 
HETATM 9174  C  C4  . BMA E  3  .   ? 35.082  13.774  14.267  1.00 15.42 ? 3    BMA E C4  1 
HETATM 9175  C  C5  . BMA E  3  .   ? 35.427  12.330  14.662  1.00 12.42 ? 3    BMA E C5  1 
HETATM 9176  C  C6  . BMA E  3  .   ? 34.397  11.702  15.588  1.00 12.30 ? 3    BMA E C6  1 
HETATM 9177  O  O2  . BMA E  3  .   ? 34.728  13.159  11.397  1.00 13.41 ? 3    BMA E O2  1 
HETATM 9178  O  O3  . BMA E  3  .   ? 35.534  15.503  12.604  1.00 21.98 ? 3    BMA E O3  1 
HETATM 9179  O  O4  . BMA E  3  .   ? 35.171  14.619  15.417  1.00 14.63 ? 3    BMA E O4  1 
HETATM 9180  O  O5  . BMA E  3  .   ? 35.473  11.494  13.493  1.00 13.35 ? 3    BMA E O5  1 
HETATM 9181  O  O6  . BMA E  3  .   ? 33.084  11.804  14.985  1.00 13.24 ? 3    BMA E O6  1 
HETATM 9182  C  C1  . MAN E  3  .   ? 35.870  16.634  13.314  1.00 24.92 ? 4    MAN E C1  1 
HETATM 9183  C  C2  . MAN E  3  .   ? 34.832  17.692  13.005  1.00 26.79 ? 4    MAN E C2  1 
HETATM 9184  C  C3  . MAN E  3  .   ? 34.855  17.982  11.502  1.00 27.94 ? 4    MAN E C3  1 
HETATM 9185  C  C4  . MAN E  3  .   ? 36.265  18.357  11.035  1.00 29.81 ? 4    MAN E C4  1 
HETATM 9186  C  C5  . MAN E  3  .   ? 37.324  17.379  11.544  1.00 27.78 ? 4    MAN E C5  1 
HETATM 9187  C  C6  . MAN E  3  .   ? 38.708  17.977  11.402  1.00 27.11 ? 4    MAN E C6  1 
HETATM 9188  O  O2  . MAN E  3  .   ? 35.096  18.860  13.766  1.00 27.61 ? 4    MAN E O2  1 
HETATM 9189  O  O3  . MAN E  3  .   ? 33.960  19.042  11.190  1.00 27.97 ? 4    MAN E O3  1 
HETATM 9190  O  O4  . MAN E  3  .   ? 36.305  18.356  9.611   1.00 33.36 ? 4    MAN E O4  1 
HETATM 9191  O  O5  . MAN E  3  .   ? 37.150  17.104  12.949  1.00 27.63 ? 4    MAN E O5  1 
HETATM 9192  O  O6  . MAN E  3  .   ? 38.936  18.987  12.391  1.00 28.50 ? 4    MAN E O6  1 
HETATM 9193  C  C1  . MAN E  3  .   ? 32.819  10.796  14.050  1.00 14.41 ? 5    MAN E C1  1 
HETATM 9194  C  C2  . MAN E  3  .   ? 32.175  11.423  12.797  1.00 19.38 ? 5    MAN E C2  1 
HETATM 9195  C  C3  . MAN E  3  .   ? 30.797  12.022  13.167  1.00 17.97 ? 5    MAN E C3  1 
HETATM 9196  C  C4  . MAN E  3  .   ? 29.931  10.932  13.813  1.00 16.40 ? 5    MAN E C4  1 
HETATM 9197  C  C5  . MAN E  3  .   ? 30.673  10.388  15.034  1.00 14.29 ? 5    MAN E C5  1 
HETATM 9198  C  C6  . MAN E  3  .   ? 29.927  9.307   15.756  1.00 14.90 ? 5    MAN E C6  1 
HETATM 9199  O  O2  . MAN E  3  .   ? 32.022  10.420  11.777  1.00 18.72 ? 5    MAN E O2  1 
HETATM 9200  O  O3  . MAN E  3  .   ? 30.145  12.575  12.023  1.00 19.59 ? 5    MAN E O3  1 
HETATM 9201  O  O4  . MAN E  3  .   ? 28.668  11.454  14.182  1.00 13.96 ? 5    MAN E O4  1 
HETATM 9202  O  O5  . MAN E  3  .   ? 31.932  9.828   14.598  1.00 17.19 ? 5    MAN E O5  1 
HETATM 9203  O  O6  . MAN E  3  .   ? 29.723  8.194   14.890  1.00 17.21 ? 5    MAN E O6  1 
HETATM 9204  C  C1  . FUC E  3  .   ? 37.100  5.355   7.501   1.00 14.94 ? 6    FUC E C1  1 
HETATM 9205  C  C2  . FUC E  3  .   ? 37.020  6.689   6.755   1.00 15.66 ? 6    FUC E C2  1 
HETATM 9206  C  C3  . FUC E  3  .   ? 38.042  6.688   5.591   1.00 15.97 ? 6    FUC E C3  1 
HETATM 9207  C  C4  . FUC E  3  .   ? 37.825  5.458   4.712   1.00 14.91 ? 6    FUC E C4  1 
HETATM 9208  C  C5  . FUC E  3  .   ? 37.890  4.183   5.552   1.00 15.22 ? 6    FUC E C5  1 
HETATM 9209  C  C6  . FUC E  3  .   ? 37.608  2.923   4.743   1.00 14.88 ? 6    FUC E C6  1 
HETATM 9210  O  O2  . FUC E  3  .   ? 37.317  7.739   7.679   1.00 16.44 ? 6    FUC E O2  1 
HETATM 9211  O  O3  . FUC E  3  .   ? 37.918  7.863   4.790   1.00 13.07 ? 6    FUC E O3  1 
HETATM 9212  O  O4  . FUC E  3  .   ? 36.544  5.560   4.129   1.00 16.17 ? 6    FUC E O4  1 
HETATM 9213  O  O5  . FUC E  3  .   ? 36.900  4.262   6.593   1.00 14.86 ? 6    FUC E O5  1 
HETATM 9214  C  C1  . NAG F  3  .   ? 21.449  15.902  9.433   1.00 10.06 ? 1    NAG F C1  1 
HETATM 9215  C  C2  . NAG F  3  .   ? 22.175  16.596  8.302   1.00 11.06 ? 1    NAG F C2  1 
HETATM 9216  C  C3  . NAG F  3  .   ? 22.676  15.515  7.370   1.00 12.41 ? 1    NAG F C3  1 
HETATM 9217  C  C4  . NAG F  3  .   ? 23.621  14.580  8.118   1.00 12.17 ? 1    NAG F C4  1 
HETATM 9218  C  C5  . NAG F  3  .   ? 22.985  14.061  9.437   1.00 12.41 ? 1    NAG F C5  1 
HETATM 9219  C  C6  . NAG F  3  .   ? 24.023  13.433  10.392  1.00 10.66 ? 1    NAG F C6  1 
HETATM 9220  C  C7  . NAG F  3  .   ? 21.313  18.841  7.925   1.00 17.87 ? 1    NAG F C7  1 
HETATM 9221  C  C8  . NAG F  3  .   ? 20.429  19.786  7.127   1.00 17.80 ? 1    NAG F C8  1 
HETATM 9222  N  N2  . NAG F  3  .   ? 21.325  17.539  7.579   1.00 12.20 ? 1    NAG F N2  1 
HETATM 9223  O  O3  . NAG F  3  .   ? 23.344  16.072  6.250   1.00 10.85 ? 1    NAG F O3  1 
HETATM 9224  O  O4  . NAG F  3  .   ? 23.906  13.473  7.248   1.00 12.80 ? 1    NAG F O4  1 
HETATM 9225  O  O5  . NAG F  3  .   ? 22.393  15.152  10.175  1.00 12.99 ? 1    NAG F O5  1 
HETATM 9226  O  O6  . NAG F  3  .   ? 25.098  14.388  10.564  1.00 12.71 ? 1    NAG F O6  1 
HETATM 9227  O  O7  . NAG F  3  .   ? 21.961  19.292  8.878   1.00 21.03 ? 1    NAG F O7  1 
HETATM 9228  C  C1  . NAG F  3  .   ? 25.227  13.111  7.130   1.00 11.40 ? 2    NAG F C1  1 
HETATM 9229  C  C2  . NAG F  3  .   ? 25.322  11.595  6.826   1.00 9.45  ? 2    NAG F C2  1 
HETATM 9230  C  C3  . NAG F  3  .   ? 26.791  11.211  6.600   1.00 7.91  ? 2    NAG F C3  1 
HETATM 9231  C  C4  . NAG F  3  .   ? 27.342  12.120  5.489   1.00 11.23 ? 2    NAG F C4  1 
HETATM 9232  C  C5  . NAG F  3  .   ? 27.209  13.584  5.890   1.00 10.12 ? 2    NAG F C5  1 
HETATM 9233  C  C6  . NAG F  3  .   ? 27.737  14.512  4.838   1.00 8.00  ? 2    NAG F C6  1 
HETATM 9234  C  C7  . NAG F  3  .   ? 23.547  10.407  7.913   1.00 9.41  ? 2    NAG F C7  1 
HETATM 9235  C  C8  . NAG F  3  .   ? 23.050  9.684   9.157   1.00 8.20  ? 2    NAG F C8  1 
HETATM 9236  N  N2  . NAG F  3  .   ? 24.792  10.855  7.942   1.00 6.49  ? 2    NAG F N2  1 
HETATM 9237  O  O3  . NAG F  3  .   ? 26.872  9.826   6.253   1.00 6.22  ? 2    NAG F O3  1 
HETATM 9238  O  O4  . NAG F  3  .   ? 28.705  11.849  5.191   1.00 10.61 ? 2    NAG F O4  1 
HETATM 9239  O  O5  . NAG F  3  .   ? 25.817  13.910  6.084   1.00 10.82 ? 2    NAG F O5  1 
HETATM 9240  O  O6  . NAG F  3  .   ? 26.898  14.483  3.714   1.00 8.43  ? 2    NAG F O6  1 
HETATM 9241  O  O7  . NAG F  3  .   ? 22.792  10.552  6.938   1.00 7.65  ? 2    NAG F O7  1 
HETATM 9242  C  C1  . BMA F  3  .   ? 28.928  11.220  3.981   1.00 11.54 ? 3    BMA F C1  1 
HETATM 9243  C  C2  . BMA F  3  .   ? 30.282  11.662  3.441   1.00 16.31 ? 3    BMA F C2  1 
HETATM 9244  C  C3  . BMA F  3  .   ? 30.640  10.870  2.191   1.00 17.83 ? 3    BMA F C3  1 
HETATM 9245  C  C4  . BMA F  3  .   ? 30.488  9.352   2.451   1.00 15.13 ? 3    BMA F C4  1 
HETATM 9246  C  C5  . BMA F  3  .   ? 29.135  9.051   3.041   1.00 13.41 ? 3    BMA F C5  1 
HETATM 9247  C  C6  . BMA F  3  .   ? 29.014  7.598   3.410   1.00 13.56 ? 3    BMA F C6  1 
HETATM 9248  O  O2  . BMA F  3  .   ? 31.292  11.446  4.430   1.00 13.35 ? 3    BMA F O2  1 
HETATM 9249  O  O3  . BMA F  3  .   ? 32.012  11.174  1.878   1.00 21.15 ? 3    BMA F O3  1 
HETATM 9250  O  O4  . BMA F  3  .   ? 30.604  8.613   1.239   1.00 18.61 ? 3    BMA F O4  1 
HETATM 9251  O  O5  . BMA F  3  .   ? 28.954  9.810   4.233   1.00 11.43 ? 3    BMA F O5  1 
HETATM 9252  O  O6  . BMA F  3  .   ? 30.147  7.228   4.189   1.00 13.82 ? 3    BMA F O6  1 
HETATM 9253  C  C1  . MAN F  3  .   ? 32.317  11.233  0.520   1.00 24.70 ? 4    MAN F C1  1 
HETATM 9254  C  C2  . MAN F  3  .   ? 33.824  11.189  0.384   1.00 26.63 ? 4    MAN F C2  1 
HETATM 9255  C  C3  . MAN F  3  .   ? 34.416  12.333  1.182   1.00 29.05 ? 4    MAN F C3  1 
HETATM 9256  C  C4  . MAN F  3  .   ? 33.838  13.664  0.665   1.00 27.44 ? 4    MAN F C4  1 
HETATM 9257  C  C5  . MAN F  3  .   ? 32.318  13.627  0.602   1.00 27.14 ? 4    MAN F C5  1 
HETATM 9258  C  C6  . MAN F  3  .   ? 31.806  14.793  -0.201  1.00 28.43 ? 4    MAN F C6  1 
HETATM 9259  O  O2  . MAN F  3  .   ? 34.171  11.326  -0.985  1.00 28.78 ? 4    MAN F O2  1 
HETATM 9260  O  O3  . MAN F  3  .   ? 35.839  12.307  1.053   1.00 30.38 ? 4    MAN F O3  1 
HETATM 9261  O  O4  . MAN F  3  .   ? 34.199  14.724  1.535   1.00 30.96 ? 4    MAN F O4  1 
HETATM 9262  O  O5  . MAN F  3  .   ? 31.844  12.430  -0.057  1.00 24.82 ? 4    MAN F O5  1 
HETATM 9263  O  O6  . MAN F  3  .   ? 32.554  14.942  -1.408  1.00 29.40 ? 4    MAN F O6  1 
HETATM 9264  C  C1  . MAN F  3  .   ? 29.905  7.424   5.553   1.00 13.80 ? 5    MAN F C1  1 
HETATM 9265  C  C2  . MAN F  3  .   ? 31.185  7.958   6.224   1.00 14.02 ? 5    MAN F C2  1 
HETATM 9266  C  C3  . MAN F  3  .   ? 32.300  6.902   6.079   1.00 15.59 ? 5    MAN F C3  1 
HETATM 9267  C  C4  . MAN F  3  .   ? 31.851  5.595   6.724   1.00 16.89 ? 5    MAN F C4  1 
HETATM 9268  C  C5  . MAN F  3  .   ? 30.516  5.143   6.051   1.00 17.03 ? 5    MAN F C5  1 
HETATM 9269  C  C6  . MAN F  3  .   ? 29.926  3.901   6.687   1.00 16.37 ? 5    MAN F C6  1 
HETATM 9270  O  O2  . MAN F  3  .   ? 30.934  8.244   7.604   1.00 13.07 ? 5    MAN F O2  1 
HETATM 9271  O  O3  . MAN F  3  .   ? 33.531  7.339   6.637   1.00 12.24 ? 5    MAN F O3  1 
HETATM 9272  O  O4  . MAN F  3  .   ? 32.860  4.603   6.579   1.00 12.94 ? 5    MAN F O4  1 
HETATM 9273  O  O5  . MAN F  3  .   ? 29.513  6.207   6.169   1.00 15.63 ? 5    MAN F O5  1 
HETATM 9274  O  O6  . MAN F  3  .   ? 29.545  4.173   8.036   1.00 15.17 ? 5    MAN F O6  1 
HETATM 9275  C  C1  . FUC F  3  .   ? 26.132  13.978  11.427  1.00 14.69 ? 6    FUC F C1  1 
HETATM 9276  C  C2  . FUC F  3  .   ? 27.351  14.776  11.081  1.00 15.35 ? 6    FUC F C2  1 
HETATM 9277  C  C3  . FUC F  3  .   ? 27.024  16.261  11.278  1.00 18.57 ? 6    FUC F C3  1 
HETATM 9278  C  C4  . FUC F  3  .   ? 26.600  16.540  12.718  1.00 17.43 ? 6    FUC F C4  1 
HETATM 9279  C  C5  . FUC F  3  .   ? 25.509  15.547  13.166  1.00 18.11 ? 6    FUC F C5  1 
HETATM 9280  C  C6  . FUC F  3  .   ? 25.275  15.552  14.671  1.00 16.32 ? 6    FUC F C6  1 
HETATM 9281  O  O2  . FUC F  3  .   ? 27.711  14.515  9.730   1.00 15.51 ? 6    FUC F O2  1 
HETATM 9282  O  O3  . FUC F  3  .   ? 28.169  17.027  10.985  1.00 23.14 ? 6    FUC F O3  1 
HETATM 9283  O  O4  . FUC F  3  .   ? 27.724  16.440  13.572  1.00 20.45 ? 6    FUC F O4  1 
HETATM 9284  O  O5  . FUC F  3  .   ? 25.853  14.194  12.812  1.00 13.63 ? 6    FUC F O5  1 
HETATM 9285  BR BR  . BR  G  4  .   ? 22.319  -0.776  7.070   1.00 6.94  ? 1601 BR  A BR  1 
HETATM 9286  S  S   . SO4 H  5  .   ? 7.478   -13.128 -21.613 0.50 11.17 ? 1602 SO4 A S   1 
HETATM 9287  O  O1  . SO4 H  5  .   ? 7.898   -12.348 -20.439 0.50 11.82 ? 1602 SO4 A O1  1 
HETATM 9288  O  O2  . SO4 H  5  .   ? 6.918   -12.254 -22.639 0.50 13.09 ? 1602 SO4 A O2  1 
HETATM 9289  O  O3  . SO4 H  5  .   ? 6.470   -14.099 -21.191 0.50 15.35 ? 1602 SO4 A O3  1 
HETATM 9290  O  O4  . SO4 H  5  .   ? 8.633   -13.828 -22.170 0.50 14.75 ? 1602 SO4 A O4  1 
HETATM 9291  C  C   . CYN I  6  .   ? 21.280  -14.177 -6.313  1.00 6.78  ? 1844 CYN A C   1 
HETATM 9292  N  N   . CYN I  6  .   ? 21.583  -14.577 -5.285  1.00 6.64  ? 1844 CYN A N   1 
HETATM 9293  C  C   . ACT J  7  .   ? 37.604  -2.014  14.553  1.00 29.58 ? 2608 ACT A C   1 
HETATM 9294  O  O   . ACT J  7  .   ? 37.943  -3.113  15.201  1.00 30.43 ? 2608 ACT A O   1 
HETATM 9295  O  OXT . ACT J  7  .   ? 37.390  -0.858  15.065  1.00 30.57 ? 2608 ACT A OXT 1 
HETATM 9296  C  CH3 . ACT J  7  .   ? 37.467  -2.193  13.031  1.00 24.79 ? 2608 ACT A CH3 1 
HETATM 9297  C  CHA . HEM K  8  .   ? 19.128  -12.297 -3.211  1.00 5.04  ? 605  HEM A CHA 1 
HETATM 9298  C  CHB . HEM K  8  .   ? 17.887  -14.924 -6.997  1.00 4.32  ? 605  HEM A CHB 1 
HETATM 9299  C  CHC . HEM K  8  .   ? 21.501  -12.976 -9.528  1.00 2.32  ? 605  HEM A CHC 1 
HETATM 9300  C  CHD . HEM K  8  .   ? 22.678  -10.330 -5.738  1.00 5.04  ? 605  HEM A CHD 1 
HETATM 9301  C  C1A . HEM K  8  .   ? 18.368  -13.054 -4.092  1.00 6.53  ? 605  HEM A C1A 1 
HETATM 9302  C  C2A . HEM K  8  .   ? 17.216  -13.821 -3.685  1.00 3.98  ? 605  HEM A C2A 1 
HETATM 9303  C  C3A . HEM K  8  .   ? 16.867  -14.575 -4.759  1.00 5.95  ? 605  HEM A C3A 1 
HETATM 9304  C  C4A . HEM K  8  .   ? 17.806  -14.248 -5.807  1.00 5.70  ? 605  HEM A C4A 1 
HETATM 9305  C  CMA . HEM K  8  .   ? 15.672  -15.545 -4.862  1.00 6.19  ? 605  HEM A CMA 1 
HETATM 9306  C  CAA . HEM K  8  .   ? 16.480  -13.711 -2.353  1.00 4.41  ? 605  HEM A CAA 1 
HETATM 9307  C  CBA . HEM K  8  .   ? 15.133  -13.015 -2.509  1.00 3.89  ? 605  HEM A CBA 1 
HETATM 9308  C  CGA . HEM K  8  .   ? 14.480  -12.742 -1.183  1.00 5.74  ? 605  HEM A CGA 1 
HETATM 9309  O  O1A . HEM K  8  .   ? 13.595  -13.526 -0.786  1.00 8.27  ? 605  HEM A O1A 1 
HETATM 9310  O  O2A . HEM K  8  .   ? 14.838  -11.732 -0.533  1.00 7.56  ? 605  HEM A O2A 1 
HETATM 9311  C  C1B . HEM K  8  .   ? 18.847  -14.720 -7.978  1.00 5.83  ? 605  HEM A C1B 1 
HETATM 9312  C  C2B . HEM K  8  .   ? 18.907  -15.455 -9.250  1.00 5.98  ? 605  HEM A C2B 1 
HETATM 9313  C  C3B . HEM K  8  .   ? 19.946  -14.912 -9.953  1.00 4.99  ? 605  HEM A C3B 1 
HETATM 9314  C  C4B . HEM K  8  .   ? 20.485  -13.841 -9.118  1.00 6.21  ? 605  HEM A C4B 1 
HETATM 9315  C  CMB . HEM K  8  .   ? 17.936  -16.571 -9.715  1.00 6.08  ? 605  HEM A CMB 1 
HETATM 9316  C  CAB . HEM K  8  .   ? 20.444  -15.301 -11.209 1.00 3.19  ? 605  HEM A CAB 1 
HETATM 9317  C  CBB . HEM K  8  .   ? 20.509  -16.672 -11.688 1.00 6.35  ? 605  HEM A CBB 1 
HETATM 9318  C  C1C . HEM K  8  .   ? 22.049  -11.973 -8.761  1.00 2.26  ? 605  HEM A C1C 1 
HETATM 9319  C  C2C . HEM K  8  .   ? 23.118  -11.087 -9.198  1.00 2.00  ? 605  HEM A C2C 1 
HETATM 9320  C  C3C . HEM K  8  .   ? 23.444  -10.330 -8.104  1.00 4.70  ? 605  HEM A C3C 1 
HETATM 9321  C  C4C . HEM K  8  .   ? 22.575  -10.768 -7.043  1.00 5.75  ? 605  HEM A C4C 1 
HETATM 9322  C  CMC . HEM K  8  .   ? 23.697  -10.992 -10.616 1.00 2.77  ? 605  HEM A CMC 1 
HETATM 9323  C  CAC . HEM K  8  .   ? 24.379  -9.292  -7.991  1.00 4.04  ? 605  HEM A CAC 1 
HETATM 9324  C  CBC . HEM K  8  .   ? 25.112  -8.718  -9.108  1.00 4.85  ? 605  HEM A CBC 1 
HETATM 9325  C  C1D . HEM K  8  .   ? 21.869  -10.726 -4.693  1.00 5.29  ? 605  HEM A C1D 1 
HETATM 9326  C  C2D . HEM K  8  .   ? 22.117  -10.372 -3.320  1.00 5.64  ? 605  HEM A C2D 1 
HETATM 9327  C  C3D . HEM K  8  .   ? 21.131  -10.958 -2.587  1.00 5.01  ? 605  HEM A C3D 1 
HETATM 9328  C  C4D . HEM K  8  .   ? 20.277  -11.633 -3.545  1.00 3.61  ? 605  HEM A C4D 1 
HETATM 9329  C  CMD . HEM K  8  .   ? 23.329  -9.575  -2.802  1.00 5.79  ? 605  HEM A CMD 1 
HETATM 9330  C  CAD . HEM K  8  .   ? 21.066  -11.116 -1.062  1.00 2.00  ? 605  HEM A CAD 1 
HETATM 9331  C  CBD . HEM K  8  .   ? 21.825  -12.381 -0.575  1.00 2.60  ? 605  HEM A CBD 1 
HETATM 9332  C  CGD . HEM K  8  .   ? 21.749  -12.665 0.934   1.00 2.83  ? 605  HEM A CGD 1 
HETATM 9333  O  O1D . HEM K  8  .   ? 22.438  -11.957 1.740   1.00 3.82  ? 605  HEM A O1D 1 
HETATM 9334  O  O2D . HEM K  8  .   ? 21.023  -13.610 1.331   1.00 2.77  ? 605  HEM A O2D 1 
HETATM 9335  N  NA  . HEM K  8  .   ? 18.702  -13.278 -5.408  1.00 5.61  ? 605  HEM A NA  1 
HETATM 9336  N  NB  . HEM K  8  .   ? 19.844  -13.750 -7.896  1.00 4.58  ? 605  HEM A NB  1 
HETATM 9337  N  NC  . HEM K  8  .   ? 21.689  -11.731 -7.457  1.00 5.31  ? 605  HEM A NC  1 
HETATM 9338  N  ND  . HEM K  8  .   ? 20.778  -11.539 -4.822  1.00 5.48  ? 605  HEM A ND  1 
HETATM 9339  FE FE  . HEM K  8  .   ? 20.148  -12.466 -6.459  1.00 10.65 ? 605  HEM A FE  1 
HETATM 9340  C  C1  . NAG L  9  .   ? 40.497  -37.719 -3.944  1.00 15.42 ? 1620 NAG C C1  1 
HETATM 9341  C  C2  . NAG L  9  .   ? 39.216  -38.086 -4.690  1.00 17.81 ? 1620 NAG C C2  1 
HETATM 9342  C  C3  . NAG L  9  .   ? 39.418  -39.350 -5.497  1.00 20.74 ? 1620 NAG C C3  1 
HETATM 9343  C  C4  . NAG L  9  .   ? 40.598  -39.156 -6.437  1.00 21.13 ? 1620 NAG C C4  1 
HETATM 9344  C  C5  . NAG L  9  .   ? 41.838  -38.823 -5.611  1.00 18.26 ? 1620 NAG C C5  1 
HETATM 9345  C  C6  . NAG L  9  .   ? 43.042  -38.528 -6.471  1.00 16.76 ? 1620 NAG C C6  1 
HETATM 9346  C  C7  . NAG L  9  .   ? 37.055  -37.462 -3.783  1.00 18.75 ? 1620 NAG C C7  1 
HETATM 9347  C  C8  . NAG L  9  .   ? 35.952  -37.701 -2.752  1.00 14.88 ? 1620 NAG C C8  1 
HETATM 9348  N  N2  . NAG L  9  .   ? 38.128  -38.274 -3.749  1.00 14.10 ? 1620 NAG C N2  1 
HETATM 9349  O  O3  . NAG L  9  .   ? 38.241  -39.624 -6.245  1.00 24.48 ? 1620 NAG C O3  1 
HETATM 9350  O  O4  . NAG L  9  .   ? 40.808  -40.334 -7.217  1.00 24.90 ? 1620 NAG C O4  1 
HETATM 9351  O  O5  . NAG L  9  .   ? 41.609  -37.646 -4.841  1.00 16.62 ? 1620 NAG C O5  1 
HETATM 9352  O  O6  . NAG L  9  .   ? 42.915  -37.272 -7.098  1.00 17.22 ? 1620 NAG C O6  1 
HETATM 9353  O  O7  . NAG L  9  .   ? 36.913  -36.559 -4.610  1.00 15.02 ? 1620 NAG C O7  1 
HETATM 9354  C  C1  . NAG M  9  .   ? 14.719  -34.632 -17.999 1.00 22.25 ? 1630 NAG C C1  1 
HETATM 9355  C  C2  . NAG M  9  .   ? 14.427  -34.018 -19.377 1.00 24.19 ? 1630 NAG C C2  1 
HETATM 9356  C  C3  . NAG M  9  .   ? 14.577  -35.046 -20.518 1.00 24.88 ? 1630 NAG C C3  1 
HETATM 9357  C  C4  . NAG M  9  .   ? 15.800  -35.940 -20.323 1.00 24.73 ? 1630 NAG C C4  1 
HETATM 9358  C  C5  . NAG M  9  .   ? 15.854  -36.442 -18.879 1.00 23.79 ? 1630 NAG C C5  1 
HETATM 9359  C  C6  . NAG M  9  .   ? 17.054  -37.299 -18.542 1.00 26.78 ? 1630 NAG C C6  1 
HETATM 9360  C  C7  . NAG M  9  .   ? 12.740  -32.335 -19.777 1.00 27.11 ? 1630 NAG C C7  1 
HETATM 9361  C  C8  . NAG M  9  .   ? 11.296  -31.905 -19.612 1.00 26.61 ? 1630 NAG C C8  1 
HETATM 9362  N  N2  . NAG M  9  .   ? 13.056  -33.545 -19.342 1.00 26.38 ? 1630 NAG C N2  1 
HETATM 9363  O  O3  . NAG M  9  .   ? 14.731  -34.346 -21.756 1.00 26.02 ? 1630 NAG C O3  1 
HETATM 9364  O  O4  . NAG M  9  .   ? 15.714  -37.031 -21.231 1.00 25.52 ? 1630 NAG C O4  1 
HETATM 9365  O  O5  . NAG M  9  .   ? 15.924  -35.347 -18.010 1.00 21.71 ? 1630 NAG C O5  1 
HETATM 9366  O  O6  . NAG M  9  .   ? 16.856  -37.954 -17.282 1.00 28.30 ? 1630 NAG C O6  1 
HETATM 9367  O  O7  . NAG M  9  .   ? 13.541  -31.592 -20.332 1.00 30.04 ? 1630 NAG C O7  1 
HETATM 9368  CA CA  . CA  N  10 .   ? 33.751  -14.400 1.990   1.00 7.61  ? 1600 CA  C CA  1 
HETATM 9369  S  S   . SO4 O  5  .   ? 9.739   -41.965 -7.416  1.00 18.45 ? 1603 SO4 C S   1 
HETATM 9370  O  O1  . SO4 O  5  .   ? 10.929  -41.634 -6.646  1.00 21.93 ? 1603 SO4 C O1  1 
HETATM 9371  O  O2  . SO4 O  5  .   ? 8.753   -42.584 -6.532  1.00 17.38 ? 1603 SO4 C O2  1 
HETATM 9372  O  O3  . SO4 O  5  .   ? 10.107  -42.892 -8.494  1.00 21.98 ? 1603 SO4 C O3  1 
HETATM 9373  O  O4  . SO4 O  5  .   ? 9.181   -40.751 -8.005  1.00 23.03 ? 1603 SO4 C O4  1 
HETATM 9374  S  S   . SO4 P  5  .   ? 28.669  2.412   -22.252 0.50 13.42 ? 1610 SO4 C S   1 
HETATM 9375  O  O1  . SO4 P  5  .   ? 29.099  2.328   -20.847 0.50 14.25 ? 1610 SO4 C O1  1 
HETATM 9376  O  O2  . SO4 P  5  .   ? 28.359  1.066   -22.753 0.50 14.49 ? 1610 SO4 C O2  1 
HETATM 9377  O  O3  . SO4 P  5  .   ? 29.744  2.988   -23.079 0.50 13.18 ? 1610 SO4 C O3  1 
HETATM 9378  O  O4  . SO4 P  5  .   ? 27.461  3.253   -22.326 0.50 14.47 ? 1610 SO4 C O4  1 
HETATM 9379  C  C   . ACT Q  7  .   ? 10.198  -14.258 13.164  1.00 12.86 ? 1606 ACT C C   1 
HETATM 9380  O  O   . ACT Q  7  .   ? 10.188  -15.132 14.112  1.00 16.45 ? 1606 ACT C O   1 
HETATM 9381  O  OXT . ACT Q  7  .   ? 11.152  -13.965 12.412  1.00 15.82 ? 1606 ACT C OXT 1 
HETATM 9382  C  CH3 . ACT Q  7  .   ? 8.892   -13.549 12.977  1.00 14.88 ? 1606 ACT C CH3 1 
HETATM 9383  C  C   . ACT R  7  .   ? 55.037  -4.794  -5.926  1.00 10.65 ? 1604 ACT C C   1 
HETATM 9384  O  O   . ACT R  7  .   ? 54.941  -4.018  -4.908  1.00 15.78 ? 1604 ACT C O   1 
HETATM 9385  O  OXT . ACT R  7  .   ? 54.482  -5.918  -6.083  1.00 15.46 ? 1604 ACT C OXT 1 
HETATM 9386  C  CH3 . ACT R  7  .   ? 55.940  -4.255  -7.008  1.00 12.31 ? 1604 ACT C CH3 1 
HETATM 9387  C  C   . ACT S  7  .   ? 37.458  8.059   -17.654 1.00 23.90 ? 1607 ACT C C   1 
HETATM 9388  O  O   . ACT S  7  .   ? 36.578  7.486   -18.439 1.00 22.60 ? 1607 ACT C O   1 
HETATM 9389  O  OXT . ACT S  7  .   ? 37.382  9.222   -17.139 1.00 23.20 ? 1607 ACT C OXT 1 
HETATM 9390  C  CH3 . ACT S  7  .   ? 38.682  7.190   -17.352 1.00 22.98 ? 1607 ACT C CH3 1 
HETATM 9391  C  C   . ACT T  7  .   ? 45.834  -17.422 -14.917 1.00 21.30 ? 1609 ACT C C   1 
HETATM 9392  O  O   . ACT T  7  .   ? 45.011  -16.440 -15.140 1.00 19.97 ? 1609 ACT C O   1 
HETATM 9393  O  OXT . ACT T  7  .   ? 47.093  -17.434 -15.116 1.00 26.95 ? 1609 ACT C OXT 1 
HETATM 9394  C  CH3 . ACT T  7  .   ? 45.172  -18.665 -14.373 1.00 21.65 ? 1609 ACT C CH3 1 
HETATM 9395  C  C   . ACT U  7  .   ? 58.344  -19.730 -18.160 0.57 26.73 ? 1612 ACT C C   1 
HETATM 9396  O  O   . ACT U  7  .   ? 57.703  -19.834 -17.018 0.57 11.08 ? 1612 ACT C O   1 
HETATM 9397  O  OXT . ACT U  7  .   ? 59.535  -20.167 -18.426 0.57 17.22 ? 1612 ACT C OXT 1 
HETATM 9398  C  CH3 . ACT U  7  .   ? 57.538  -19.023 -19.250 0.57 9.10  ? 1612 ACT C CH3 1 
HETATM 9399  BR BR  . BR  V  4  .   A 36.075  -23.277 -28.035 0.65 22.31 ? 758  BR  C BR  1 
HETATM 9400  BR BR  . BR  W  4  .   A 29.071  -37.074 -5.374  0.73 21.24 ? 889  BR  C BR  1 
HETATM 9401  BR BR  . BR  X  4  .   A 18.563  -18.839 -3.685  0.51 29.00 ? 957  BR  C BR  1 
HETATM 9402  C  C   . ACT Y  7  .   ? 17.722  7.843   12.049  1.00 31.05 ? 1608 ACT B C   1 
HETATM 9403  O  O   . ACT Y  7  .   ? 16.477  7.436   12.171  1.00 30.00 ? 1608 ACT B O   1 
HETATM 9404  O  OXT . ACT Y  7  .   ? 18.544  7.536   11.103  1.00 31.17 ? 1608 ACT B OXT 1 
HETATM 9405  C  CH3 . ACT Y  7  .   ? 18.181  8.792   13.173  1.00 27.77 ? 1608 ACT B CH3 1 
HETATM 9406  BR BR  . BR  Z  4  .   ? 31.032  2.961   21.894  1.00 10.39 ? 2601 BR  B BR  1 
HETATM 9407  S  S   . SO4 AA 5  .   ? 42.890  11.262  54.243  0.50 25.90 ? 2602 SO4 B S   1 
HETATM 9408  O  O1  . SO4 AA 5  .   ? 42.666  10.658  52.914  0.50 22.57 ? 2602 SO4 B O1  1 
HETATM 9409  O  O2  . SO4 AA 5  .   ? 44.314  11.138  54.606  0.50 25.97 ? 2602 SO4 B O2  1 
HETATM 9410  O  O3  . SO4 AA 5  .   ? 42.060  10.579  55.252  0.50 25.02 ? 2602 SO4 B O3  1 
HETATM 9411  O  O4  . SO4 AA 5  .   ? 42.517  12.687  54.206  0.50 25.67 ? 2602 SO4 B O4  1 
HETATM 9412  C  C   . ACT BA 7  .   ? 5.020   9.097   12.566  0.84 21.34 ? 2611 ACT B C   1 
HETATM 9413  O  O   . ACT BA 7  .   ? 4.682   9.851   13.574  0.84 33.70 ? 2611 ACT B O   1 
HETATM 9414  O  OXT . ACT BA 7  .   ? 5.197   7.825   12.587  0.84 28.15 ? 2611 ACT B OXT 1 
HETATM 9415  C  CH3 . ACT BA 7  .   ? 5.226   9.881   11.271  0.84 12.10 ? 2611 ACT B CH3 1 
HETATM 9416  C  C   . CYN CA 6  .   ? 27.789  8.905   39.468  1.00 18.91 ? 2844 CYN B C   1 
HETATM 9417  N  N   . CYN CA 6  .   ? 26.860  8.363   39.111  1.00 18.73 ? 2844 CYN B N   1 
HETATM 9418  C  CHA . HEM DA 8  .   ? 29.132  5.857   37.323  1.00 7.49  ? 605  HEM B CHA 1 
HETATM 9419  C  CHB . HEM DA 8  .   ? 29.736  7.216   41.868  1.00 10.25 ? 605  HEM B CHB 1 
HETATM 9420  C  CHC . HEM DA 8  .   ? 29.782  11.804  40.511  1.00 2.00  ? 605  HEM B CHC 1 
HETATM 9421  C  CHD . HEM DA 8  .   ? 29.362  10.440  35.964  1.00 5.84  ? 605  HEM B CHD 1 
HETATM 9422  C  C1A . HEM DA 8  .   ? 29.478  5.819   38.653  1.00 11.11 ? 605  HEM B C1A 1 
HETATM 9423  C  C2A . HEM DA 8  .   ? 29.502  4.601   39.441  1.00 11.33 ? 605  HEM B C2A 1 
HETATM 9424  C  C3A . HEM DA 8  .   ? 29.656  4.989   40.735  1.00 8.95  ? 605  HEM B C3A 1 
HETATM 9425  C  C4A . HEM DA 8  .   ? 29.751  6.433   40.727  1.00 11.52 ? 605  HEM B C4A 1 
HETATM 9426  C  CMA . HEM DA 8  .   ? 29.640  4.097   41.951  1.00 7.93  ? 605  HEM B CMA 1 
HETATM 9427  C  CAA . HEM DA 8  .   ? 29.490  3.172   38.895  1.00 10.75 ? 605  HEM B CAA 1 
HETATM 9428  C  CBA . HEM DA 8  .   ? 30.907  2.594   38.881  1.00 10.70 ? 605  HEM B CBA 1 
HETATM 9429  C  CGA . HEM DA 8  .   ? 31.017  1.259   38.192  1.00 9.96  ? 605  HEM B CGA 1 
HETATM 9430  O  O1A . HEM DA 8  .   ? 30.959  0.229   38.881  1.00 14.33 ? 605  HEM B O1A 1 
HETATM 9431  O  O2A . HEM DA 8  .   ? 31.174  1.241   36.960  1.00 11.18 ? 605  HEM B O2A 1 
HETATM 9432  C  C1B . HEM DA 8  .   ? 29.684  8.609   41.898  1.00 7.63  ? 605  HEM B C1B 1 
HETATM 9433  C  C2B . HEM DA 8  .   ? 29.569  9.411   43.118  1.00 7.32  ? 605  HEM B C2B 1 
HETATM 9434  C  C3B . HEM DA 8  .   ? 29.596  10.704  42.737  1.00 6.16  ? 605  HEM B C3B 1 
HETATM 9435  C  C4B . HEM DA 8  .   ? 29.705  10.684  41.284  1.00 6.84  ? 605  HEM B C4B 1 
HETATM 9436  C  CMB . HEM DA 8  .   ? 29.379  8.874   44.532  1.00 10.36 ? 605  HEM B CMB 1 
HETATM 9437  C  CAB . HEM DA 8  .   ? 29.597  11.856  43.552  1.00 8.38  ? 605  HEM B CAB 1 
HETATM 9438  C  CBB . HEM DA 8  .   ? 28.915  11.982  44.841  1.00 8.37  ? 605  HEM B CBB 1 
HETATM 9439  C  C1C . HEM DA 8  .   ? 29.808  11.809  39.142  1.00 5.04  ? 605  HEM B C1C 1 
HETATM 9440  C  C2C . HEM DA 8  .   ? 29.944  12.993  38.367  1.00 6.78  ? 605  HEM B C2C 1 
HETATM 9441  C  C3C . HEM DA 8  .   ? 29.830  12.611  37.064  1.00 6.62  ? 605  HEM B C3C 1 
HETATM 9442  C  C4C . HEM DA 8  .   ? 29.629  11.188  37.085  1.00 5.64  ? 605  HEM B C4C 1 
HETATM 9443  C  CMC . HEM DA 8  .   ? 30.264  14.377  38.923  1.00 8.20  ? 605  HEM B CMC 1 
HETATM 9444  C  CAC . HEM DA 8  .   ? 29.946  13.370  35.897  1.00 8.15  ? 605  HEM B CAC 1 
HETATM 9445  C  CBC . HEM DA 8  .   ? 30.292  14.773  35.835  1.00 6.88  ? 605  HEM B CBC 1 
HETATM 9446  C  C1D . HEM DA 8  .   ? 29.166  9.076   35.948  1.00 6.88  ? 605  HEM B C1D 1 
HETATM 9447  C  C2D . HEM DA 8  .   ? 28.698  8.322   34.785  1.00 5.53  ? 605  HEM B C2D 1 
HETATM 9448  C  C3D . HEM DA 8  .   ? 28.556  7.033   35.204  1.00 6.94  ? 605  HEM B C3D 1 
HETATM 9449  C  C4D . HEM DA 8  .   ? 29.004  7.008   36.580  1.00 6.72  ? 605  HEM B C4D 1 
HETATM 9450  C  CMD . HEM DA 8  .   ? 28.396  8.878   33.391  1.00 3.57  ? 605  HEM B CMD 1 
HETATM 9451  C  CAD . HEM DA 8  .   ? 27.835  5.885   34.475  1.00 2.46  ? 605  HEM B CAD 1 
HETATM 9452  C  CBD . HEM DA 8  .   ? 26.319  5.843   34.747  1.00 4.11  ? 605  HEM B CBD 1 
HETATM 9453  C  CGD . HEM DA 8  .   ? 25.616  4.629   34.115  1.00 3.74  ? 605  HEM B CGD 1 
HETATM 9454  O  O1D . HEM DA 8  .   ? 25.485  4.612   32.875  1.00 7.94  ? 605  HEM B O1D 1 
HETATM 9455  O  O2D . HEM DA 8  .   ? 25.180  3.690   34.854  1.00 6.97  ? 605  HEM B O2D 1 
HETATM 9456  N  NA  . HEM DA 8  .   ? 29.675  6.941   39.447  1.00 11.07 ? 605  HEM B NA  1 
HETATM 9457  N  NB  . HEM DA 8  .   ? 29.725  9.394   40.779  1.00 7.26  ? 605  HEM B NB  1 
HETATM 9458  N  NC  . HEM DA 8  .   ? 29.664  10.690  38.357  1.00 5.71  ? 605  HEM B NC  1 
HETATM 9459  N  ND  . HEM DA 8  .   ? 29.311  8.266   37.048  1.00 7.44  ? 605  HEM B ND  1 
HETATM 9460  FE FE  . HEM DA 8  .   ? 29.715  8.817   38.907  1.00 10.22 ? 605  HEM B FE  1 
HETATM 9461  C  C1  . NAG EA 9  .   ? -0.857  16.162  46.936  1.00 23.78 ? 2620 NAG D C1  1 
HETATM 9462  C  C2  . NAG EA 9  .   ? -0.011  15.718  48.147  1.00 22.79 ? 2620 NAG D C2  1 
HETATM 9463  C  C3  . NAG EA 9  .   ? -0.668  16.101  49.482  1.00 26.15 ? 2620 NAG D C3  1 
HETATM 9464  C  C4  . NAG EA 9  .   ? -1.198  17.543  49.492  1.00 27.30 ? 2620 NAG D C4  1 
HETATM 9465  C  C5  . NAG EA 9  .   ? -1.936  17.906  48.192  1.00 28.23 ? 2620 NAG D C5  1 
HETATM 9466  C  C6  . NAG EA 9  .   ? -2.147  19.408  48.083  1.00 31.65 ? 2620 NAG D C6  1 
HETATM 9467  C  C7  . NAG EA 9  .   ? 1.366   13.682  48.044  1.00 18.12 ? 2620 NAG D C7  1 
HETATM 9468  C  C8  . NAG EA 9  .   ? 1.405   12.170  48.152  1.00 17.11 ? 2620 NAG D C8  1 
HETATM 9469  N  N2  . NAG EA 9  .   ? 0.163   14.262  48.152  1.00 21.48 ? 2620 NAG D N2  1 
HETATM 9470  O  O3  . NAG EA 9  .   ? 0.315   15.970  50.509  1.00 24.01 ? 2620 NAG D O3  1 
HETATM 9471  O  O4  . NAG EA 9  .   ? -2.106  17.689  50.586  1.00 27.95 ? 2620 NAG D O4  1 
HETATM 9472  O  O5  . NAG EA 9  .   ? -1.173  17.559  47.026  1.00 24.69 ? 2620 NAG D O5  1 
HETATM 9473  O  O6  . NAG EA 9  .   ? -0.956  20.060  47.621  1.00 33.19 ? 2620 NAG D O6  1 
HETATM 9474  O  O7  . NAG EA 9  .   ? 2.414   14.304  47.834  1.00 21.93 ? 2620 NAG D O7  1 
HETATM 9475  C  C1  . NAG FA 9  .   ? 22.146  9.120   63.374  1.00 31.62 ? 2630 NAG D C1  1 
HETATM 9476  C  C2  . NAG FA 9  .   ? 23.408  9.791   63.893  1.00 32.95 ? 2630 NAG D C2  1 
HETATM 9477  C  C3  . NAG FA 9  .   ? 23.206  10.362  65.320  1.00 32.98 ? 2630 NAG D C3  1 
HETATM 9478  C  C4  . NAG FA 9  .   ? 21.859  11.053  65.499  1.00 32.14 ? 2630 NAG D C4  1 
HETATM 9479  C  C5  . NAG FA 9  .   ? 20.725  10.249  64.834  1.00 33.02 ? 2630 NAG D C5  1 
HETATM 9480  C  C6  . NAG FA 9  .   ? 19.386  10.968  64.841  1.00 33.15 ? 2630 NAG D C6  1 
HETATM 9481  C  C7  . NAG FA 9  .   ? 25.636  9.016   63.422  1.00 31.61 ? 2630 NAG D C7  1 
HETATM 9482  C  C8  . NAG FA 9  .   ? 26.619  7.858   63.447  1.00 31.99 ? 2630 NAG D C8  1 
HETATM 9483  N  N2  . NAG FA 9  .   ? 24.435  8.770   63.909  1.00 31.65 ? 2630 NAG D N2  1 
HETATM 9484  O  O3  . NAG FA 9  .   ? 24.203  11.340  65.584  1.00 32.34 ? 2630 NAG D O3  1 
HETATM 9485  O  O4  . NAG FA 9  .   ? 21.621  11.187  66.902  1.00 34.17 ? 2630 NAG D O4  1 
HETATM 9486  O  O5  . NAG FA 9  .   ? 21.052  10.005  63.463  1.00 31.79 ? 2630 NAG D O5  1 
HETATM 9487  O  O6  . NAG FA 9  .   ? 18.336  10.127  64.357  1.00 36.92 ? 2630 NAG D O6  1 
HETATM 9488  O  O7  . NAG FA 9  .   ? 25.981  10.127  62.993  1.00 29.64 ? 2630 NAG D O7  1 
HETATM 9489  CA CA  . CA  GA 10 .   ? 16.843  11.707  29.886  1.00 9.48  ? 2600 CA  D CA  1 
HETATM 9490  S  S   . SO4 HA 5  .   ? 41.637  27.877  33.692  0.50 20.84 ? 2610 SO4 D S   1 
HETATM 9491  O  O1  . SO4 HA 5  .   ? 42.712  27.253  34.478  0.50 20.73 ? 2610 SO4 D O1  1 
HETATM 9492  O  O2  . SO4 HA 5  .   ? 41.123  26.912  32.715  0.50 22.16 ? 2610 SO4 D O2  1 
HETATM 9493  O  O3  . SO4 HA 5  .   ? 42.147  29.045  32.970  0.50 21.97 ? 2610 SO4 D O3  1 
HETATM 9494  O  O4  . SO4 HA 5  .   ? 40.563  28.297  34.596  0.50 20.46 ? 2610 SO4 D O4  1 
HETATM 9495  C  C   . ACT IA 7  .   ? 26.420  -12.419 32.630  1.00 21.45 ? 2606 ACT D C   1 
HETATM 9496  O  O   . ACT IA 7  .   ? 26.913  -13.116 31.640  1.00 22.45 ? 2606 ACT D O   1 
HETATM 9497  O  OXT . ACT IA 7  .   ? 26.818  -11.282 33.062  1.00 19.46 ? 2606 ACT D OXT 1 
HETATM 9498  C  CH3 . ACT IA 7  .   ? 25.240  -13.096 33.303  1.00 21.65 ? 2606 ACT D CH3 1 
HETATM 9499  C  C   . ACT JA 7  .   ? 13.968  33.624  18.798  1.00 35.41 ? 2604 ACT D C   1 
HETATM 9500  O  O   . ACT JA 7  .   ? 15.078  33.040  18.442  1.00 35.03 ? 2604 ACT D O   1 
HETATM 9501  O  OXT . ACT JA 7  .   ? 13.384  33.562  19.938  1.00 36.48 ? 2604 ACT D OXT 1 
HETATM 9502  C  CH3 . ACT JA 7  .   ? 13.350  34.461  17.688  1.00 36.13 ? 2604 ACT D CH3 1 
HETATM 9503  C  C   . ACT KA 7  .   ? 37.865  32.452  23.673  1.00 28.62 ? 2607 ACT D C   1 
HETATM 9504  O  O   . ACT KA 7  .   ? 38.435  32.411  24.840  1.00 28.58 ? 2607 ACT D O   1 
HETATM 9505  O  OXT . ACT KA 7  .   ? 38.353  32.071  22.552  1.00 28.71 ? 2607 ACT D OXT 1 
HETATM 9506  C  CH3 . ACT KA 7  .   ? 36.458  33.018  23.720  1.00 29.69 ? 2607 ACT D CH3 1 
HETATM 9507  C  C   . ACT LA 7  .   ? 14.744  31.627  36.525  1.00 31.11 ? 2609 ACT D C   1 
HETATM 9508  O  O   . ACT LA 7  .   ? 16.007  31.340  36.582  1.00 30.58 ? 2609 ACT D O   1 
HETATM 9509  O  OXT . ACT LA 7  .   ? 14.211  32.710  36.087  1.00 33.98 ? 2609 ACT D OXT 1 
HETATM 9510  C  CH3 . ACT LA 7  .   ? 13.859  30.527  37.068  1.00 31.06 ? 2609 ACT D CH3 1 
HETATM 9511  BR BR  . BR  MA 4  .   B 21.390  32.762  52.471  0.55 19.54 ? 758  BR  D BR  1 
HETATM 9512  BR BR  . BR  NA 4  .   B 6.948   9.694   51.906  0.63 22.46 ? 889  BR  D BR  1 
HETATM 9513  BR BR  . BR  OA 4  .   B 25.139  4.486   42.481  0.51 28.62 ? 957  BR  D BR  1 
HETATM 9514  O  O   . HOH PA 11 .   A 19.566  0.222   8.322   1.00 7.17  ? 652  HOH A O   1 
HETATM 9515  O  O   . HOH PA 11 .   A 37.727  -21.140 11.707  1.00 15.27 ? 656  HOH A O   1 
HETATM 9516  O  O   . HOH PA 11 .   A 7.873   -0.476  -18.376 1.00 11.29 ? 665  HOH A O   1 
HETATM 9517  O  O   . HOH PA 11 .   A 16.942  5.433   10.371  1.00 8.39  ? 668  HOH A O   1 
HETATM 9518  O  O   . HOH PA 11 .   A 39.965  -13.882 6.876   1.00 4.15  ? 670  HOH A O   1 
HETATM 9519  O  O   . HOH PA 11 .   A 37.904  -10.677 12.248  1.00 8.27  ? 671  HOH A O   1 
HETATM 9520  O  O   . HOH PA 11 .   A 36.340  -19.173 4.450   1.00 15.06 ? 672  HOH A O   1 
HETATM 9521  O  O   . HOH PA 11 .   A 34.470  -8.733  17.235  1.00 2.57  ? 673  HOH A O   1 
HETATM 9522  O  O   . HOH PA 11 .   A 30.754  -11.718 7.836   1.00 2.53  ? 674  HOH A O   1 
HETATM 9523  O  O   . HOH PA 11 .   A 31.139  -10.163 11.155  1.00 2.00  ? 675  HOH A O   1 
HETATM 9524  O  O   . HOH PA 11 .   A 3.042   -0.806  8.289   1.00 3.21  ? 677  HOH A O   1 
HETATM 9525  O  O   . HOH PA 11 .   A 0.111   1.114   5.216   1.00 15.44 ? 678  HOH A O   1 
HETATM 9526  O  O   . HOH PA 11 .   A 4.555   4.584   1.051   1.00 10.79 ? 679  HOH A O   1 
HETATM 9527  O  O   . HOH PA 11 .   A 5.508   2.016   1.137   1.00 5.63  ? 680  HOH A O   1 
HETATM 9528  O  O   . HOH PA 11 .   A 9.735   -8.914  -19.058 1.00 12.29 ? 684  HOH A O   1 
HETATM 9529  O  O   . HOH PA 11 .   A 24.123  -4.330  -18.095 1.00 6.32  ? 687  HOH A O   1 
HETATM 9530  O  O   . HOH PA 11 .   A 30.846  -17.496 0.729   1.00 4.06  ? 690  HOH A O   1 
HETATM 9531  O  O   . HOH PA 11 .   A 40.617  -7.054  9.671   1.00 3.11  ? 708  HOH A O   1 
HETATM 9532  O  O   . HOH PA 11 .   A 31.084  -9.276  13.706  1.00 8.15  ? 709  HOH A O   1 
HETATM 9533  O  O   . HOH PA 11 .   A 28.305  -8.175  14.071  1.00 6.48  ? 710  HOH A O   1 
HETATM 9534  O  O   . HOH PA 11 .   A 10.095  5.237   7.727   1.00 13.45 ? 712  HOH A O   1 
HETATM 9535  O  O   . HOH PA 11 .   A 10.486  -1.460  -16.169 1.00 5.58  ? 714  HOH A O   1 
HETATM 9536  O  O   . HOH PA 11 .   A 39.439  0.996   15.706  1.00 10.42 ? 723  HOH A O   1 
HETATM 9537  O  O   . HOH PA 11 .   A 48.778  -15.428 4.548   1.00 23.14 ? 726  HOH A O   1 
HETATM 9538  O  O   . HOH PA 11 .   A 26.994  -8.161  -12.058 1.00 2.09  ? 730  HOH A O   1 
HETATM 9539  O  O   . HOH PA 11 .   A 11.707  -16.225 1.932   1.00 3.09  ? 738  HOH A O   1 
HETATM 9540  O  O   . HOH PA 11 .   A 25.431  -2.109  13.439  1.00 10.03 ? 742  HOH A O   1 
HETATM 9541  O  O   . HOH PA 11 .   A 19.325  -0.311  14.201  1.00 2.03  ? 743  HOH A O   1 
HETATM 9542  O  O   . HOH PA 11 .   A 44.524  -17.793 3.405   1.00 9.75  ? 753  HOH A O   1 
HETATM 9543  O  O   . HOH PA 11 .   A 41.574  -13.669 -0.605  1.00 2.42  ? 755  HOH A O   1 
HETATM 9544  O  O   . HOH PA 11 .   A 19.229  -10.369 2.464   1.00 2.96  ? 763  HOH A O   1 
HETATM 9545  O  O   . HOH PA 11 .   A 43.921  -15.868 10.229  1.00 7.03  ? 772  HOH A O   1 
HETATM 9546  O  O   . HOH PA 11 .   A 41.418  -14.928 9.522   1.00 9.31  ? 773  HOH A O   1 
HETATM 9547  O  O   . HOH PA 11 .   A 28.510  -9.203  10.248  1.00 5.92  ? 774  HOH A O   1 
HETATM 9548  O  O   . HOH PA 11 .   A -0.110  -0.843  -2.575  1.00 6.68  ? 776  HOH A O   1 
HETATM 9549  O  O   . HOH PA 11 .   A 42.830  -16.465 1.258   1.00 7.32  ? 780  HOH A O   1 
HETATM 9550  O  O   . HOH PA 11 .   A 45.458  -15.401 14.381  1.00 27.26 ? 791  HOH A O   1 
HETATM 9551  O  O   . HOH PA 11 .   A 34.057  -15.096 15.543  1.00 22.59 ? 792  HOH A O   1 
HETATM 9552  O  O   . HOH PA 11 .   A 28.233  -16.927 15.792  1.00 11.23 ? 795  HOH A O   1 
HETATM 9553  O  O   . HOH PA 11 .   A 23.337  -1.096  -25.192 1.00 23.04 ? 796  HOH A O   1 
HETATM 9554  O  O   . HOH PA 11 .   A 12.725  -15.780 -1.579  1.00 4.41  ? 798  HOH A O   1 
HETATM 9555  O  O   . HOH PA 11 .   A 31.923  -15.619 13.948  1.00 19.00 ? 800  HOH A O   1 
HETATM 9556  O  O   . HOH PA 11 .   A 33.358  0.967   12.457  1.00 32.45 ? 806  HOH A O   1 
HETATM 9557  O  O   . HOH PA 11 .   A -0.693  -3.965  -9.397  1.00 10.55 ? 809  HOH A O   1 
HETATM 9558  O  O   . HOH PA 11 .   A 25.622  -4.819  14.182  1.00 11.20 ? 816  HOH A O   1 
HETATM 9559  O  O   . HOH PA 11 .   A 31.028  0.026   8.423   1.00 7.09  ? 817  HOH A O   1 
HETATM 9560  O  O   . HOH PA 11 .   A 12.616  1.470   13.998  1.00 11.52 ? 821  HOH A O   1 
HETATM 9561  O  O   . HOH PA 11 .   A 8.130   6.923   9.227   1.00 29.90 ? 823  HOH A O   1 
HETATM 9562  O  O   . HOH PA 11 .   A 5.828   -8.187  -19.400 1.00 16.85 ? 825  HOH A O   1 
HETATM 9563  O  O   . HOH PA 11 .   A -2.061  -2.432  -4.072  1.00 8.88  ? 827  HOH A O   1 
HETATM 9564  O  O   . HOH PA 11 .   A 4.129   -5.888  -20.911 1.00 12.09 ? 834  HOH A O   1 
HETATM 9565  O  O   . HOH PA 11 .   A 18.502  -20.063 5.022   1.00 8.81  ? 836  HOH A O   1 
HETATM 9566  O  O   . HOH PA 11 .   A 17.848  -17.385 3.151   1.00 4.21  ? 837  HOH A O   1 
HETATM 9567  O  O   . HOH PA 11 .   A 46.493  -15.838 3.066   1.00 9.35  ? 841  HOH A O   1 
HETATM 9568  O  O   . HOH PA 11 .   A 20.751  -17.677 -5.399  1.00 17.99 ? 843  HOH A O   1 
HETATM 9569  O  O   . HOH PA 11 .   A 19.029  -14.359 -0.052  1.00 5.38  ? 846  HOH A O   1 
HETATM 9570  O  O   . HOH PA 11 .   A 30.647  -19.300 12.027  1.00 7.84  ? 848  HOH A O   1 
HETATM 9571  O  O   . HOH PA 11 .   A 14.744  -15.945 0.358   1.00 26.64 ? 856  HOH A O   1 
HETATM 9572  O  O   . HOH PA 11 .   A 35.957  0.717   13.510  1.00 28.54 ? 860  HOH A O   1 
HETATM 9573  O  O   . HOH PA 11 .   A 1.137   -2.494  2.671   1.00 28.59 ? 868  HOH A O   1 
HETATM 9574  O  O   . HOH PA 11 .   A 7.130   -9.116  -25.142 1.00 17.67 ? 877  HOH A O   1 
HETATM 9575  O  O   . HOH PA 11 .   A 38.844  -19.402 14.119  1.00 31.54 ? 882  HOH A O   1 
HETATM 9576  O  O   . HOH PA 11 .   A 10.260  -21.517 8.694   1.00 28.98 ? 887  HOH A O   1 
HETATM 9577  O  O   . HOH PA 11 .   A 12.672  -9.572  16.920  1.00 17.01 ? 896  HOH A O   1 
HETATM 9578  O  O   . HOH PA 11 .   A 30.434  1.054   11.042  1.00 32.14 ? 898  HOH A O   1 
HETATM 9579  O  O   . HOH PA 11 .   A 19.565  -3.543  13.989  1.00 4.79  ? 901  HOH A O   1 
HETATM 9580  O  O   . HOH PA 11 .   A 3.611   -2.338  14.990  1.00 27.68 ? 902  HOH A O   1 
HETATM 9581  O  O   . HOH PA 11 .   A 27.716  -0.540  13.826  1.00 22.34 ? 914  HOH A O   1 
HETATM 9582  O  O   . HOH PA 11 .   A 15.508  -7.675  -27.523 1.00 26.64 ? 916  HOH A O   1 
HETATM 9583  O  O   . HOH PA 11 .   A 29.893  -16.669 19.521  1.00 8.27  ? 930  HOH A O   1 
HETATM 9584  O  O   . HOH PA 11 .   A 47.387  -19.844 9.688   1.00 33.59 ? 931  HOH A O   1 
HETATM 9585  O  O   . HOH PA 11 .   A 30.562  -18.261 14.760  1.00 18.90 ? 932  HOH A O   1 
HETATM 9586  O  O   . HOH PA 11 .   A 9.647   3.251   11.932  1.00 16.62 ? 933  HOH A O   1 
HETATM 9587  O  O   . HOH PA 11 .   B 39.374  -8.040  21.215  1.00 23.67 ? 933  HOH A O   1 
HETATM 9588  O  O   . HOH PA 11 .   A 5.615   -4.986  18.550  1.00 20.93 ? 934  HOH A O   1 
HETATM 9589  O  O   . HOH PA 11 .   A -0.569  4.891   11.038  1.00 21.21 ? 935  HOH A O   1 
HETATM 9590  O  O   . HOH PA 11 .   A 27.982  2.159   11.432  1.00 28.52 ? 942  HOH A O   1 
HETATM 9591  O  O   . HOH PA 11 .   A 10.836  -0.037  -24.006 1.00 10.50 ? 944  HOH A O   1 
HETATM 9592  O  O   . HOH PA 11 .   A 17.703  -16.734 0.606   1.00 13.79 ? 947  HOH A O   1 
HETATM 9593  O  O   . HOH PA 11 .   A 0.581   -2.023  6.972   1.00 16.67 ? 949  HOH A O   1 
HETATM 9594  O  O   . HOH PA 11 .   A 41.954  -11.814 19.986  1.00 33.63 ? 952  HOH A O   1 
HETATM 9595  O  O   . HOH PA 11 .   A 25.180  -0.215  -23.475 1.00 17.60 ? 954  HOH A O   1 
HETATM 9596  O  O   . HOH PA 11 .   A 6.164   -9.844  -22.408 1.00 20.59 ? 961  HOH A O   1 
HETATM 9597  O  O   . HOH PA 11 .   A 7.549   11.609  4.463   1.00 28.61 ? 969  HOH A O   1 
HETATM 9598  O  O   . HOH PA 11 .   A 23.494  2.864   12.748  1.00 9.89  ? 978  HOH A O   1 
HETATM 9599  O  O   . HOH PA 11 .   A 1.397   -5.603  -13.894 1.00 26.29 ? 984  HOH A O   1 
HETATM 9600  O  O   . HOH PA 11 .   A 24.596  6.926   9.748   1.00 22.36 ? 985  HOH A O   1 
HETATM 9601  O  O   . HOH PA 11 .   A 21.744  -2.477  -27.759 1.00 25.61 ? 1205 HOH A O   1 
HETATM 9602  O  O   . HOH PA 11 .   A 2.624   7.780   9.135   1.00 14.19 ? 1207 HOH A O   1 
HETATM 9603  O  O   . HOH PA 11 .   A -3.380  -0.576  4.873   1.00 24.74 ? 1237 HOH A O   1 
HETATM 9604  O  O   . HOH PA 11 .   A 0.854   -5.566  15.003  1.00 20.20 ? 1240 HOH A O   1 
HETATM 9605  O  O   . HOH PA 11 .   A 18.807  -20.509 9.735   1.00 30.71 ? 1247 HOH A O   1 
HETATM 9606  O  O   . HOH PA 11 .   A 13.905  -9.871  -25.890 1.00 25.67 ? 1254 HOH A O   1 
HETATM 9607  O  O   . HOH PA 11 .   A 6.236   -0.308  19.630  1.00 26.24 ? 1255 HOH A O   1 
HETATM 9608  O  O   . HOH PA 11 .   A 23.524  -18.312 12.500  1.00 26.37 ? 1257 HOH A O   1 
HETATM 9609  O  O   . HOH PA 11 .   A 4.302   12.215  7.706   1.00 28.72 ? 1269 HOH A O   1 
HETATM 9610  O  O   . HOH QA 11 .   A 44.944  -12.591 -2.064  1.00 30.77 ? 647  HOH C O   1 
HETATM 9611  O  O   . HOH QA 11 .   A 41.685  -12.749 -23.284 1.00 8.36  ? 648  HOH C O   1 
HETATM 9612  O  O   . HOH QA 11 .   A 24.472  12.755  -8.975  1.00 24.08 ? 649  HOH C O   1 
HETATM 9613  O  O   . HOH QA 11 .   A 40.884  -35.445 -7.692  1.00 25.58 ? 650  HOH C O   1 
HETATM 9614  O  O   . HOH QA 11 .   A 44.778  5.172   11.635  1.00 29.12 ? 651  HOH C O   1 
HETATM 9615  O  O   . HOH QA 11 .   A 50.834  -8.966  -0.495  1.00 7.58  ? 653  HOH C O   1 
HETATM 9616  O  O   . HOH QA 11 .   A 19.666  -3.075  19.534  1.00 7.05  ? 654  HOH C O   1 
HETATM 9617  O  O   . HOH QA 11 .   A 44.333  -31.415 -11.298 1.00 20.51 ? 655  HOH C O   1 
HETATM 9618  O  O   . HOH QA 11 .   A 43.992  -6.727  12.883  1.00 14.25 ? 657  HOH C O   1 
HETATM 9619  O  O   . HOH QA 11 .   A 9.023   -18.773 -19.883 1.00 11.98 ? 658  HOH C O   1 
HETATM 9620  O  O   . HOH QA 11 .   A 29.132  -9.437  7.398   1.00 6.85  ? 659  HOH C O   1 
HETATM 9621  O  O   . HOH QA 11 .   A 38.029  2.828   -13.502 1.00 18.11 ? 660  HOH C O   1 
HETATM 9622  O  O   . HOH QA 11 .   A 12.921  -15.620 10.938  1.00 10.57 ? 661  HOH C O   1 
HETATM 9623  O  O   . HOH QA 11 .   A 41.831  -24.309 -23.315 1.00 16.87 ? 662  HOH C O   1 
HETATM 9624  O  O   . HOH QA 11 .   A 32.948  -12.314 -22.067 1.00 6.14  ? 663  HOH C O   1 
HETATM 9625  O  O   . HOH QA 11 .   A 48.321  -10.605 6.691   1.00 15.16 ? 664  HOH C O   1 
HETATM 9626  O  O   . HOH QA 11 .   A 32.962  -23.325 12.349  1.00 8.36  ? 666  HOH C O   1 
HETATM 9627  O  O   . HOH QA 11 .   A 25.003  -19.719 -20.143 1.00 11.30 ? 667  HOH C O   1 
HETATM 9628  O  O   . HOH QA 11 .   A 38.285  -15.858 6.177   1.00 5.17  ? 669  HOH C O   1 
HETATM 9629  O  O   . HOH QA 11 .   A 10.249  -2.059  7.829   1.00 3.50  ? 676  HOH C O   1 
HETATM 9630  O  O   . HOH QA 11 .   A 8.366   1.442   1.629   1.00 4.10  ? 681  HOH C O   1 
HETATM 9631  O  O   . HOH QA 11 .   A 4.543   -6.096  0.171   1.00 2.00  ? 682  HOH C O   1 
HETATM 9632  O  O   . HOH QA 11 .   A 5.388   -4.870  3.269   1.00 2.13  ? 683  HOH C O   1 
HETATM 9633  O  O   . HOH QA 11 .   A 16.157  -8.686  -15.512 1.00 2.00  ? 685  HOH C O   1 
HETATM 9634  O  O   . HOH QA 11 .   A 20.285  -14.331 -17.246 1.00 8.28  ? 686  HOH C O   1 
HETATM 9635  O  O   . HOH QA 11 .   A 26.345  -20.077 -4.454  1.00 2.32  ? 688  HOH C O   1 
HETATM 9636  O  O   . HOH QA 11 .   A 25.137  -20.332 1.956   1.00 3.29  ? 689  HOH C O   1 
HETATM 9637  O  O   . HOH QA 11 .   A 19.370  -13.466 9.173   1.00 2.00  ? 691  HOH C O   1 
HETATM 9638  O  O   . HOH QA 11 .   A 14.108  -10.437 9.831   1.00 3.57  ? 692  HOH C O   1 
HETATM 9639  O  O   . HOH QA 11 .   A 2.655   -19.221 0.826   1.00 5.50  ? 693  HOH C O   1 
HETATM 9640  O  O   . HOH QA 11 .   A 34.055  -30.062 -2.550  1.00 7.19  ? 694  HOH C O   1 
HETATM 9641  O  O   . HOH QA 11 .   A 34.289  -28.716 -18.872 1.00 6.50  ? 695  HOH C O   1 
HETATM 9642  O  O   . HOH QA 11 .   A 29.387  -29.117 -10.962 1.00 3.66  ? 696  HOH C O   1 
HETATM 9643  O  O   . HOH QA 11 .   A 16.896  -34.130 -11.573 1.00 5.62  ? 697  HOH C O   1 
HETATM 9644  O  O   . HOH QA 11 .   A 25.750  -25.498 -3.131  1.00 13.13 ? 698  HOH C O   1 
HETATM 9645  O  O   . HOH QA 11 .   A 49.665  -19.062 -1.990  1.00 7.56  ? 699  HOH C O   1 
HETATM 9646  O  O   . HOH QA 11 .   A 40.991  -17.815 -0.103  1.00 5.48  ? 700  HOH C O   1 
HETATM 9647  O  O   . HOH QA 11 .   A 38.061  -19.140 2.222   1.00 5.37  ? 701  HOH C O   1 
HETATM 9648  O  O   . HOH QA 11 .   A 39.412  -11.348 -15.869 1.00 9.18  ? 702  HOH C O   1 
HETATM 9649  O  O   . HOH QA 11 .   A 44.071  -4.539  3.411   1.00 7.93  ? 703  HOH C O   1 
HETATM 9650  O  O   . HOH QA 11 .   A 14.294  -2.513  -1.593  1.00 2.70  ? 704  HOH C O   1 
HETATM 9651  O  O   . HOH QA 11 .   A 21.484  -16.553 -18.482 1.00 9.80  ? 705  HOH C O   1 
HETATM 9652  O  O   . HOH QA 11 .   A 9.525   1.917   -15.103 1.00 11.16 ? 707  HOH C O   1 
HETATM 9653  O  O   . HOH QA 11 .   A 12.965  6.390   5.496   1.00 7.07  ? 711  HOH C O   1 
HETATM 9654  O  O   . HOH QA 11 .   A 3.314   -7.377  -2.066  1.00 2.00  ? 713  HOH C O   1 
HETATM 9655  O  O   . HOH QA 11 .   A 21.762  4.273   -7.876  1.00 2.00  ? 715  HOH C O   1 
HETATM 9656  O  O   . HOH QA 11 .   A 16.872  -13.866 4.145   1.00 5.86  ? 716  HOH C O   1 
HETATM 9657  O  O   . HOH QA 11 .   A 2.383   -17.107 5.053   1.00 18.62 ? 717  HOH C O   1 
HETATM 9658  O  O   . HOH QA 11 .   A 17.669  -9.548  16.480  1.00 6.16  ? 718  HOH C O   1 
HETATM 9659  O  O   . HOH QA 11 .   A 30.700  -19.870 2.653   1.00 8.86  ? 719  HOH C O   1 
HETATM 9660  O  O   . HOH QA 11 .   A 32.848  -25.496 -3.424  1.00 6.21  ? 720  HOH C O   1 
HETATM 9661  O  O   . HOH QA 11 .   A 39.461  -34.555 -5.303  1.00 4.57  ? 721  HOH C O   1 
HETATM 9662  O  O   . HOH QA 11 .   A 43.242  -34.205 -1.297  1.00 7.63  ? 722  HOH C O   1 
HETATM 9663  O  O   . HOH QA 11 .   A 10.985  -12.510 -19.343 1.00 4.32  ? 724  HOH C O   1 
HETATM 9664  O  O   . HOH QA 11 .   A 31.415  -29.040 -20.957 1.00 18.26 ? 725  HOH C O   1 
HETATM 9665  O  O   . HOH QA 11 .   A 11.819  -0.867  5.387   1.00 5.05  ? 727  HOH C O   1 
HETATM 9666  O  O   . HOH QA 11 .   A 52.041  -15.067 -13.863 1.00 9.32  ? 728  HOH C O   1 
HETATM 9667  O  O   . HOH QA 11 .   A 49.231  -1.391  7.395   1.00 25.74 ? 729  HOH C O   1 
HETATM 9668  O  O   . HOH QA 11 .   A 33.795  -35.293 -11.090 1.00 8.12  ? 732  HOH C O   1 
HETATM 9669  O  O   . HOH QA 11 .   A 23.177  -17.795 -20.436 1.00 5.92  ? 733  HOH C O   1 
HETATM 9670  O  O   . HOH QA 11 .   A 4.726   -16.739 3.146   1.00 5.95  ? 734  HOH C O   1 
HETATM 9671  O  O   . HOH QA 11 .   A 42.959  3.907   -0.173  1.00 15.76 ? 735  HOH C O   1 
HETATM 9672  O  O   . HOH QA 11 .   A 2.680   -7.724  2.526   1.00 11.01 ? 736  HOH C O   1 
HETATM 9673  O  O   . HOH QA 11 .   A -3.146  -10.674 -0.507  1.00 16.21 ? 737  HOH C O   1 
HETATM 9674  O  O   . HOH QA 11 .   A 32.750  -23.725 -5.762  1.00 5.29  ? 739  HOH C O   1 
HETATM 9675  O  O   . HOH QA 11 .   A 37.228  -26.027 2.179   1.00 6.62  ? 740  HOH C O   1 
HETATM 9676  O  O   . HOH QA 11 .   A 18.250  -1.629  21.672  1.00 8.31  ? 741  HOH C O   1 
HETATM 9677  O  O   . HOH QA 11 .   A 17.510  -12.598 1.701   1.00 8.44  ? 744  HOH C O   1 
HETATM 9678  O  O   . HOH QA 11 .   A 13.858  -24.424 -12.982 1.00 6.48  ? 745  HOH C O   1 
HETATM 9679  O  O   . HOH QA 11 .   A 11.833  -22.756 -11.927 1.00 8.63  ? 746  HOH C O   1 
HETATM 9680  O  O   . HOH QA 11 .   A 29.503  -21.656 4.630   1.00 7.23  ? 747  HOH C O   1 
HETATM 9681  O  O   . HOH QA 11 .   A 27.174  -22.845 3.230   1.00 9.66  ? 748  HOH C O   1 
HETATM 9682  O  O   . HOH QA 11 .   A 27.127  -24.930 1.509   1.00 10.03 ? 749  HOH C O   1 
HETATM 9683  O  O   . HOH QA 11 .   A 23.011  -25.502 -4.451  1.00 5.88  ? 750  HOH C O   1 
HETATM 9684  O  O   . HOH QA 11 .   A 5.112   -22.441 -9.829  1.00 8.17  ? 751  HOH C O   1 
HETATM 9685  O  O   . HOH QA 11 .   A 44.458  -20.442 2.747   1.00 6.66  ? 752  HOH C O   1 
HETATM 9686  O  O   . HOH QA 11 .   A 44.092  -15.153 -0.837  1.00 14.57 ? 754  HOH C O   1 
HETATM 9687  O  O   . HOH QA 11 .   A 38.298  -8.997  1.332   1.00 4.27  ? 756  HOH C O   1 
HETATM 9688  O  O   . HOH QA 11 .   A 29.808  -33.017 -20.262 1.00 12.46 ? 757  HOH C O   1 
HETATM 9689  O  O   . HOH QA 11 .   A 22.571  -2.272  -16.829 1.00 8.54  ? 759  HOH C O   1 
HETATM 9690  O  O   . HOH QA 11 .   A 18.564  3.596   -15.019 1.00 13.57 ? 760  HOH C O   1 
HETATM 9691  O  O   . HOH QA 11 .   A 31.761  -10.560 -33.554 1.00 26.56 ? 761  HOH C O   1 
HETATM 9692  O  O   . HOH QA 11 .   A 23.056  -27.118 -19.630 1.00 11.63 ? 762  HOH C O   1 
HETATM 9693  O  O   . HOH QA 11 .   A 12.063  -0.493  2.533   1.00 11.14 ? 764  HOH C O   1 
HETATM 9694  O  O   . HOH QA 11 .   A 13.776  8.156   3.371   1.00 7.54  ? 765  HOH C O   1 
HETATM 9695  O  O   . HOH QA 11 .   A 14.511  10.589  5.220   1.00 4.17  ? 766  HOH C O   1 
HETATM 9696  O  O   . HOH QA 11 .   A 21.616  12.013  -8.207  1.00 13.46 ? 767  HOH C O   1 
HETATM 9697  O  O   . HOH QA 11 .   A 30.928  6.883   -11.886 1.00 11.46 ? 768  HOH C O   1 
HETATM 9698  O  O   . HOH QA 11 .   A 27.599  8.378   -5.483  1.00 13.67 ? 769  HOH C O   1 
HETATM 9699  O  O   . HOH QA 11 .   A 29.348  9.623   -1.010  1.00 14.49 ? 770  HOH C O   1 
HETATM 9700  O  O   . HOH QA 11 .   B 37.219  15.285  16.621  1.00 7.23  ? 770  HOH C O   1 
HETATM 9701  O  O   . HOH QA 11 .   A 32.200  6.116   1.476   1.00 14.68 ? 771  HOH C O   1 
HETATM 9702  O  O   . HOH QA 11 .   B 24.023  14.485  3.880   1.00 4.06  ? 775  HOH C O   1 
HETATM 9703  O  O   . HOH QA 11 .   A 33.952  -27.335 -25.626 1.00 22.18 ? 777  HOH C O   1 
HETATM 9704  O  O   . HOH QA 11 .   A 44.155  1.647   1.126   1.00 9.82  ? 778  HOH C O   1 
HETATM 9705  O  O   . HOH QA 11 .   A 40.101  -4.014  9.798   1.00 9.27  ? 779  HOH C O   1 
HETATM 9706  O  O   . HOH QA 11 .   A 42.317  -31.375 0.972   1.00 5.70  ? 781  HOH C O   1 
HETATM 9707  O  O   . HOH QA 11 .   A 22.634  -25.831 -11.508 1.00 11.55 ? 782  HOH C O   1 
HETATM 9708  O  O   . HOH QA 11 .   A 31.623  -2.400  7.287   1.00 9.59  ? 783  HOH C O   1 
HETATM 9709  O  O   . HOH QA 11 .   A 18.204  -7.567  1.757   1.00 5.89  ? 784  HOH C O   1 
HETATM 9710  O  O   . HOH QA 11 .   A 18.228  -31.517 -11.146 1.00 4.56  ? 785  HOH C O   1 
HETATM 9711  O  O   . HOH QA 11 .   A 20.797  2.735   -11.012 1.00 4.52  ? 786  HOH C O   1 
HETATM 9712  O  O   . HOH QA 11 .   A 21.220  -0.147  -11.735 1.00 5.87  ? 787  HOH C O   1 
HETATM 9713  O  O   . HOH QA 11 .   A 22.414  -2.441  -14.007 1.00 2.00  ? 788  HOH C O   1 
HETATM 9714  O  O   . HOH QA 11 .   A 51.007  -22.313 -13.444 1.00 22.31 ? 789  HOH C O   1 
HETATM 9715  O  O   . HOH QA 11 .   A 54.004  -19.185 -0.594  1.00 12.70 ? 790  HOH C O   1 
HETATM 9716  O  O   . HOH QA 11 .   B 29.253  -2.568  16.471  1.00 14.54 ? 793  HOH C O   1 
HETATM 9717  O  O   . HOH QA 11 .   A 2.843   -4.668  2.201   1.00 8.13  ? 794  HOH C O   1 
HETATM 9718  O  O   . HOH QA 11 .   A 10.331  -16.297 -0.699  1.00 8.88  ? 797  HOH C O   1 
HETATM 9719  O  O   . HOH QA 11 .   A 15.228  -9.493  17.163  1.00 18.29 ? 799  HOH C O   1 
HETATM 9720  O  O   . HOH QA 11 .   A 22.729  -28.297 -2.136  1.00 17.10 ? 801  HOH C O   1 
HETATM 9721  O  O   . HOH QA 11 .   A 41.643  -29.038 -11.981 1.00 8.81  ? 802  HOH C O   1 
HETATM 9722  O  O   . HOH QA 11 .   B 28.580  13.938  14.652  1.00 15.60 ? 803  HOH C O   1 
HETATM 9723  O  O   . HOH QA 11 .   A 35.042  5.734   10.416  1.00 4.07  ? 804  HOH C O   1 
HETATM 9724  O  O   . HOH QA 11 .   A 35.587  1.610   10.224  1.00 15.85 ? 805  HOH C O   1 
HETATM 9725  O  O   . HOH QA 11 .   A 25.688  -27.444 -21.027 1.00 4.52  ? 807  HOH C O   1 
HETATM 9726  O  O   . HOH QA 11 .   A 16.526  -3.914  -21.094 1.00 7.64  ? 808  HOH C O   1 
HETATM 9727  O  O   . HOH QA 11 .   A 3.754   -9.399  -16.202 1.00 8.57  ? 810  HOH C O   1 
HETATM 9728  O  O   . HOH QA 11 .   A 48.303  -32.387 5.783   1.00 12.05 ? 811  HOH C O   1 
HETATM 9729  O  O   . HOH QA 11 .   A 18.487  17.709  -0.290  1.00 11.36 ? 812  HOH C O   1 
HETATM 9730  O  O   . HOH QA 11 .   A 26.123  4.108   -18.389 1.00 14.27 ? 813  HOH C O   1 
HETATM 9731  O  O   . HOH QA 11 .   A 34.446  4.247   0.097   1.00 17.33 ? 814  HOH C O   1 
HETATM 9732  O  O   . HOH QA 11 .   A 10.223  7.167   5.724   1.00 7.14  ? 815  HOH C O   1 
HETATM 9733  O  O   . HOH QA 11 .   A 29.797  10.001  -7.216  1.00 33.33 ? 818  HOH C O   1 
HETATM 9734  O  O   . HOH QA 11 .   A 40.584  -3.275  15.056  1.00 19.40 ? 819  HOH C O   1 
HETATM 9735  O  O   . HOH QA 11 .   A 45.686  -13.887 1.201   1.00 23.43 ? 820  HOH C O   1 
HETATM 9736  O  O   . HOH QA 11 .   A 44.780  2.061   4.138   1.00 18.42 ? 822  HOH C O   1 
HETATM 9737  O  O   . HOH QA 11 .   A 0.767   0.659   -4.732  1.00 19.19 ? 824  HOH C O   1 
HETATM 9738  O  O   . HOH QA 11 .   A 9.446   -0.837  -21.879 1.00 12.54 ? 826  HOH C O   1 
HETATM 9739  O  O   . HOH QA 11 .   A 26.434  -26.676 -0.682  1.00 6.60  ? 828  HOH C O   1 
HETATM 9740  O  O   . HOH QA 11 .   A 39.448  -9.962  -18.588 1.00 4.48  ? 829  HOH C O   1 
HETATM 9741  O  O   . HOH QA 11 .   A 35.768  1.807   7.466   1.00 16.02 ? 830  HOH C O   1 
HETATM 9742  O  O   . HOH QA 11 .   A 13.634  13.749  3.519   1.00 13.24 ? 831  HOH C O   1 
HETATM 9743  O  O   . HOH QA 11 .   A 27.846  -20.417 6.461   1.00 8.22  ? 832  HOH C O   1 
HETATM 9744  O  O   . HOH QA 11 .   A 25.621  -20.801 4.653   1.00 7.27  ? 833  HOH C O   1 
HETATM 9745  O  O   . HOH QA 11 .   A 9.117   -7.212  -16.670 1.00 5.94  ? 835  HOH C O   1 
HETATM 9746  O  O   . HOH QA 11 .   A 20.354  -25.720 -3.651  1.00 23.12 ? 838  HOH C O   1 
HETATM 9747  O  O   . HOH QA 11 .   A 21.561  -26.073 -0.936  1.00 15.11 ? 839  HOH C O   1 
HETATM 9748  O  O   . HOH QA 11 .   A 51.718  -33.136 -8.679  1.00 10.00 ? 840  HOH C O   1 
HETATM 9749  O  O   . HOH QA 11 .   A 5.277   -12.599 -18.765 1.00 13.62 ? 842  HOH C O   1 
HETATM 9750  O  O   . HOH QA 11 .   A 20.620  -15.259 -2.548  1.00 5.96  ? 845  HOH C O   1 
HETATM 9751  O  O   . HOH QA 11 .   A -0.352  -10.948 11.725  1.00 21.14 ? 847  HOH C O   1 
HETATM 9752  O  O   . HOH QA 11 .   A 26.055  -34.067 -20.160 1.00 15.19 ? 849  HOH C O   1 
HETATM 9753  O  O   . HOH QA 11 .   A 16.849  4.657   -18.939 1.00 12.64 ? 850  HOH C O   1 
HETATM 9754  O  O   . HOH QA 11 .   A 20.666  2.685   -19.090 1.00 8.20  ? 851  HOH C O   1 
HETATM 9755  O  O   . HOH QA 11 .   A -3.411  -19.157 4.179   1.00 13.91 ? 852  HOH C O   1 
HETATM 9756  O  O   . HOH QA 11 .   A 19.138  -7.369  17.564  1.00 30.20 ? 853  HOH C O   1 
HETATM 9757  O  O   . HOH QA 11 .   A 19.499  -34.702 -1.999  1.00 31.71 ? 854  HOH C O   1 
HETATM 9758  O  O   . HOH QA 11 .   A 39.431  -31.006 -10.876 1.00 11.05 ? 855  HOH C O   1 
HETATM 9759  O  O   . HOH QA 11 .   A 43.142  -10.382 -24.578 1.00 22.26 ? 857  HOH C O   1 
HETATM 9760  O  O   . HOH QA 11 .   A 56.931  -13.259 -10.394 1.00 18.59 ? 858  HOH C O   1 
HETATM 9761  O  O   . HOH QA 11 .   A 56.204  -21.031 -1.255  1.00 25.51 ? 859  HOH C O   1 
HETATM 9762  O  O   . HOH QA 11 .   A 41.360  8.656   8.060   1.00 31.20 ? 861  HOH C O   1 
HETATM 9763  O  O   . HOH QA 11 .   A 28.723  -13.270 -29.675 1.00 15.60 ? 862  HOH C O   1 
HETATM 9764  O  O   . HOH QA 11 .   A 14.529  0.599   1.894   1.00 4.92  ? 863  HOH C O   1 
HETATM 9765  O  O   . HOH QA 11 .   A 50.671  -28.059 6.725   1.00 24.69 ? 864  HOH C O   1 
HETATM 9766  O  O   . HOH QA 11 .   A 16.485  1.946   -14.482 1.00 3.12  ? 865  HOH C O   1 
HETATM 9767  O  O   . HOH QA 11 .   A 42.329  2.929   5.160   1.00 14.39 ? 867  HOH C O   1 
HETATM 9768  O  O   . HOH QA 11 .   A 13.922  -7.348  18.358  1.00 9.89  ? 869  HOH C O   1 
HETATM 9769  O  O   . HOH QA 11 .   A 30.345  -36.292 -20.421 1.00 29.25 ? 870  HOH C O   1 
HETATM 9770  O  O   . HOH QA 11 .   A 11.393  -12.901 17.502  1.00 24.84 ? 871  HOH C O   1 
HETATM 9771  O  O   . HOH QA 11 .   A 41.880  -28.063 -14.522 1.00 13.88 ? 872  HOH C O   1 
HETATM 9772  O  O   . HOH QA 11 .   A 38.931  -31.520 -13.496 1.00 13.21 ? 873  HOH C O   1 
HETATM 9773  O  O   . HOH QA 11 .   A 45.882  -21.268 -13.239 1.00 13.85 ? 874  HOH C O   1 
HETATM 9774  O  O   . HOH QA 11 .   B 26.802  8.533   13.477  1.00 25.67 ? 875  HOH C O   1 
HETATM 9775  O  O   . HOH QA 11 .   A 39.922  -22.296 10.217  1.00 14.21 ? 876  HOH C O   1 
HETATM 9776  O  O   . HOH QA 11 .   A 49.132  -6.515  7.778   1.00 20.11 ? 878  HOH C O   1 
HETATM 9777  O  O   . HOH QA 11 .   A 49.358  -9.450  9.437   1.00 21.87 ? 879  HOH C O   1 
HETATM 9778  O  O   . HOH QA 11 .   A 46.117  -22.224 -23.621 1.00 30.61 ? 880  HOH C O   1 
HETATM 9779  O  O   . HOH QA 11 .   A 31.263  0.899   -20.055 1.00 8.94  ? 881  HOH C O   1 
HETATM 9780  O  O   . HOH QA 11 .   A 47.824  -22.875 -13.394 1.00 12.10 ? 883  HOH C O   1 
HETATM 9781  O  O   . HOH QA 11 .   A 42.219  -26.465 8.321   1.00 33.37 ? 884  HOH C O   1 
HETATM 9782  O  O   . HOH QA 11 .   A 47.280  -24.919 8.186   1.00 23.31 ? 885  HOH C O   1 
HETATM 9783  O  O   . HOH QA 11 .   A -5.615  -9.429  -7.890  1.00 8.47  ? 886  HOH C O   1 
HETATM 9784  O  O   . HOH QA 11 .   A 33.692  10.903  10.005  1.00 29.49 ? 888  HOH C O   1 
HETATM 9785  O  O   . HOH QA 11 .   A 55.017  -10.110 1.653   1.00 32.50 ? 890  HOH C O   1 
HETATM 9786  O  O   . HOH QA 11 .   A 14.516  -28.148 -15.401 1.00 10.79 ? 891  HOH C O   1 
HETATM 9787  O  O   . HOH QA 11 .   A 51.639  -33.961 -0.137  1.00 14.99 ? 892  HOH C O   1 
HETATM 9788  O  O   . HOH QA 11 .   A 48.489  -31.942 -4.972  1.00 9.38  ? 893  HOH C O   1 
HETATM 9789  O  O   . HOH QA 11 .   A 4.739   15.207  -4.713  1.00 21.74 ? 894  HOH C O   1 
HETATM 9790  O  O   . HOH QA 11 .   A 31.706  7.747   -14.537 1.00 7.95  ? 895  HOH C O   1 
HETATM 9791  O  O   . HOH QA 11 .   A 33.753  6.840   13.129  1.00 19.11 ? 897  HOH C O   1 
HETATM 9792  O  O   . HOH QA 11 .   A 20.946  14.961  -7.206  1.00 13.29 ? 899  HOH C O   1 
HETATM 9793  O  O   . HOH QA 11 .   A 49.750  -24.118 6.283   1.00 7.96  ? 900  HOH C O   1 
HETATM 9794  O  O   . HOH QA 11 .   A 32.376  -28.245 -3.855  1.00 7.24  ? 903  HOH C O   1 
HETATM 9795  O  O   . HOH QA 11 .   A 40.272  -1.066  -6.426  1.00 14.86 ? 904  HOH C O   1 
HETATM 9796  O  O   . HOH QA 11 .   A 13.802  -27.345 -22.263 1.00 12.15 ? 905  HOH C O   1 
HETATM 9797  O  O   . HOH QA 11 .   A 20.676  10.444  -10.160 1.00 16.73 ? 906  HOH C O   1 
HETATM 9798  O  O   . HOH QA 11 .   B 23.014  -5.973  15.703  1.00 13.22 ? 907  HOH C O   1 
HETATM 9799  O  O   . HOH QA 11 .   A 39.541  -29.483 -15.656 1.00 24.58 ? 908  HOH C O   1 
HETATM 9800  O  O   . HOH QA 11 .   A 44.686  0.431   -5.495  1.00 11.03 ? 909  HOH C O   1 
HETATM 9801  O  O   . HOH QA 11 .   A 47.842  -20.455 -16.506 1.00 16.87 ? 910  HOH C O   1 
HETATM 9802  O  O   . HOH QA 11 .   A 39.790  -26.186 5.639   1.00 8.08  ? 911  HOH C O   1 
HETATM 9803  O  O   . HOH QA 11 .   A 58.555  -9.466  -0.966  1.00 14.15 ? 912  HOH C O   1 
HETATM 9804  O  O   . HOH QA 11 .   A 44.939  -33.528 1.547   1.00 9.81  ? 913  HOH C O   1 
HETATM 9805  O  O   . HOH QA 11 .   A 7.485   -11.195 12.617  1.00 19.46 ? 915  HOH C O   1 
HETATM 9806  O  O   . HOH QA 11 .   A 20.535  -10.748 -26.192 1.00 23.74 ? 917  HOH C O   1 
HETATM 9807  O  O   . HOH QA 11 .   A 51.840  -18.326 2.127   1.00 9.11  ? 918  HOH C O   1 
HETATM 9808  O  O   . HOH QA 11 .   A 29.348  -26.647 8.759   1.00 18.63 ? 919  HOH C O   1 
HETATM 9809  O  O   . HOH QA 11 .   A 14.104  -36.599 -9.252  1.00 13.63 ? 920  HOH C O   1 
HETATM 9810  O  O   . HOH QA 11 .   A 9.815   5.811   -17.414 1.00 23.53 ? 921  HOH C O   1 
HETATM 9811  O  O   . HOH QA 11 .   A 43.260  -5.508  -7.102  1.00 2.00  ? 922  HOH C O   1 
HETATM 9812  O  O   . HOH QA 11 .   B 29.169  11.495  9.998   1.00 21.21 ? 923  HOH C O   1 
HETATM 9813  O  O   . HOH QA 11 .   A 50.375  -3.554  5.865   1.00 29.72 ? 924  HOH C O   1 
HETATM 9814  O  O   . HOH QA 11 .   A 35.727  11.190  -8.583  1.00 13.08 ? 925  HOH C O   1 
HETATM 9815  O  O   . HOH QA 11 .   A 46.616  -1.178  16.566  1.00 13.79 ? 926  HOH C O   1 
HETATM 9816  O  O   . HOH QA 11 .   A 26.594  -10.311 -29.095 1.00 23.63 ? 927  HOH C O   1 
HETATM 9817  O  O   . HOH QA 11 .   A 17.031  9.301   -17.314 1.00 24.79 ? 928  HOH C O   1 
HETATM 9818  O  O   . HOH QA 11 .   A 24.132  8.792   -12.894 1.00 25.31 ? 929  HOH C O   1 
HETATM 9819  O  O   . HOH QA 11 .   A 22.926  3.745   -20.154 1.00 24.93 ? 936  HOH C O   1 
HETATM 9820  O  O   . HOH QA 11 .   A 17.656  -16.268 14.550  1.00 12.72 ? 937  HOH C O   1 
HETATM 9821  O  O   . HOH QA 11 .   A 28.227  -35.493 -16.387 1.00 17.45 ? 939  HOH C O   1 
HETATM 9822  O  O   . HOH QA 11 .   A 34.596  2.848   2.355   1.00 14.31 ? 940  HOH C O   1 
HETATM 9823  O  O   . HOH QA 11 .   A 55.913  -16.725 -9.848  1.00 6.36  ? 941  HOH C O   1 
HETATM 9824  O  O   . HOH QA 11 .   A 4.079   -17.761 -13.244 1.00 19.41 ? 943  HOH C O   1 
HETATM 9825  O  O   . HOH QA 11 .   A 20.528  -21.675 -0.044  1.00 8.51  ? 945  HOH C O   1 
HETATM 9826  O  O   . HOH QA 11 .   A 18.618  -19.367 -0.333  1.00 15.41 ? 946  HOH C O   1 
HETATM 9827  O  O   . HOH QA 11 .   A 47.374  -33.429 -7.042  1.00 17.05 ? 948  HOH C O   1 
HETATM 9828  O  O   . HOH QA 11 .   A 35.376  -30.954 -19.962 1.00 23.68 ? 950  HOH C O   1 
HETATM 9829  O  O   . HOH QA 11 .   A 41.390  1.467   -6.269  1.00 6.24  ? 951  HOH C O   1 
HETATM 9830  O  O   . HOH QA 11 .   A 27.497  -5.592  16.624  1.00 21.28 ? 953  HOH C O   1 
HETATM 9831  O  O   . HOH QA 11 .   A 35.475  2.337   -14.643 1.00 24.58 ? 955  HOH C O   1 
HETATM 9832  O  O   . HOH QA 11 .   A 31.011  -28.869 -24.432 1.00 31.64 ? 956  HOH C O   1 
HETATM 9833  O  O   . HOH QA 11 .   A 30.626  10.986  -14.802 1.00 20.77 ? 958  HOH C O   1 
HETATM 9834  O  O   . HOH QA 11 .   A 43.652  7.160   -5.919  1.00 16.94 ? 959  HOH C O   1 
HETATM 9835  O  O   . HOH QA 11 .   A 6.706   18.985  -7.882  1.00 16.14 ? 960  HOH C O   1 
HETATM 9836  O  O   . HOH QA 11 .   A 52.637  -13.895 -17.087 1.00 27.43 ? 962  HOH C O   1 
HETATM 9837  O  O   . HOH QA 11 .   A 44.242  1.805   12.314  1.00 15.08 ? 963  HOH C O   1 
HETATM 9838  O  O   . HOH QA 11 .   A 12.977  -32.974 -3.618  1.00 21.99 ? 964  HOH C O   1 
HETATM 9839  O  O   . HOH QA 11 .   A 46.534  0.878   13.780  1.00 24.65 ? 965  HOH C O   1 
HETATM 9840  O  O   . HOH QA 11 .   B 10.987  14.519  5.540   1.00 29.54 ? 965  HOH C O   1 
HETATM 9841  O  O   . HOH QA 11 .   A 54.006  -29.472 4.548   1.00 15.80 ? 966  HOH C O   1 
HETATM 9842  O  O   . HOH QA 11 .   A 19.922  -22.389 -2.475  1.00 24.07 ? 967  HOH C O   1 
HETATM 9843  O  O   . HOH QA 11 .   A 11.058  13.863  -17.728 1.00 24.64 ? 968  HOH C O   1 
HETATM 9844  O  O   . HOH QA 11 .   A 56.940  -6.834  0.421   1.00 15.80 ? 971  HOH C O   1 
HETATM 9845  O  O   . HOH QA 11 .   A 23.439  -7.316  17.655  1.00 21.26 ? 972  HOH C O   1 
HETATM 9846  O  O   . HOH QA 11 .   B 21.378  -4.950  19.412  1.00 23.47 ? 972  HOH C O   1 
HETATM 9847  O  O   . HOH QA 11 .   A 7.514   -22.242 7.882   1.00 21.32 ? 973  HOH C O   1 
HETATM 9848  O  O   . HOH QA 11 .   A 48.506  0.445   -4.228  1.00 21.61 ? 974  HOH C O   1 
HETATM 9849  O  O   . HOH QA 11 .   A 11.952  -20.444 0.451   1.00 15.83 ? 975  HOH C O   1 
HETATM 9850  O  O   . HOH QA 11 .   A 30.439  -39.669 -16.302 1.00 32.18 ? 976  HOH C O   1 
HETATM 9851  O  O   . HOH QA 11 .   A 20.678  -25.887 1.831   1.00 18.44 ? 977  HOH C O   1 
HETATM 9852  O  O   . HOH QA 11 .   A 12.411  -5.237  21.274  1.00 32.07 ? 979  HOH C O   1 
HETATM 9853  O  O   . HOH QA 11 .   A 40.980  -1.635  -12.934 1.00 21.47 ? 980  HOH C O   1 
HETATM 9854  O  O   . HOH QA 11 .   A 13.083  -17.258 13.240  1.00 17.77 ? 981  HOH C O   1 
HETATM 9855  O  O   . HOH QA 11 .   A 44.857  7.158   -2.560  1.00 25.14 ? 982  HOH C O   1 
HETATM 9856  O  O   . HOH QA 11 .   A 9.940   -19.097 -0.764  1.00 32.07 ? 983  HOH C O   1 
HETATM 9857  O  O   . HOH QA 11 .   A 6.903   -10.955 15.161  1.00 14.60 ? 986  HOH C O   1 
HETATM 9858  O  O   . HOH QA 11 .   A 4.522   -11.855 16.592  1.00 32.36 ? 987  HOH C O   1 
HETATM 9859  O  O   . HOH QA 11 .   A 6.223   -13.245 11.300  1.00 34.95 ? 988  HOH C O   1 
HETATM 9860  O  O   . HOH QA 11 .   A 8.778   -12.913 16.122  1.00 19.46 ? 989  HOH C O   1 
HETATM 9861  O  O   . HOH QA 11 .   A 51.725  -14.527 4.133   1.00 20.25 ? 1200 HOH C O   1 
HETATM 9862  O  O   . HOH QA 11 .   A 58.691  -24.817 5.164   1.00 30.79 ? 1201 HOH C O   1 
HETATM 9863  O  O   . HOH QA 11 .   A -0.646  -7.785  6.700   1.00 20.29 ? 1202 HOH C O   1 
HETATM 9864  O  O   . HOH QA 11 .   A 45.363  -12.327 -26.807 1.00 21.33 ? 1203 HOH C O   1 
HETATM 9865  O  O   . HOH QA 11 .   A 46.539  -1.809  10.441  1.00 21.63 ? 1204 HOH C O   1 
HETATM 9866  O  O   . HOH QA 11 .   A 54.505  -27.120 -10.930 1.00 15.20 ? 1206 HOH C O   1 
HETATM 9867  O  O   . HOH QA 11 .   A -8.297  -17.263 -0.695  1.00 12.62 ? 1208 HOH C O   1 
HETATM 9868  O  O   . HOH QA 11 .   A 44.783  8.540   11.600  1.00 24.39 ? 1209 HOH C O   1 
HETATM 9869  O  O   . HOH QA 11 .   B 23.059  16.878  -0.380  1.00 25.93 ? 1209 HOH C O   1 
HETATM 9870  O  O   . HOH QA 11 .   A 38.351  -40.294 -2.183  1.00 27.93 ? 1210 HOH C O   1 
HETATM 9871  O  O   . HOH QA 11 .   A 60.594  -26.661 -2.932  1.00 25.98 ? 1211 HOH C O   1 
HETATM 9872  O  O   . HOH QA 11 .   A 33.616  -37.563 -18.661 1.00 21.94 ? 1212 HOH C O   1 
HETATM 9873  O  O   . HOH QA 11 .   A -4.471  -16.642 -7.635  1.00 33.09 ? 1213 HOH C O   1 
HETATM 9874  O  O   . HOH QA 11 .   A 10.747  -35.880 -15.790 1.00 20.73 ? 1214 HOH C O   1 
HETATM 9875  O  O   . HOH QA 11 .   A 55.661  -33.965 -6.157  1.00 12.58 ? 1215 HOH C O   1 
HETATM 9876  O  O   . HOH QA 11 .   A 11.328  -35.246 -5.408  1.00 25.95 ? 1216 HOH C O   1 
HETATM 9877  O  O   . HOH QA 11 .   A 22.987  11.344  -11.792 1.00 32.14 ? 1217 HOH C O   1 
HETATM 9878  O  O   . HOH QA 11 .   A 32.307  -36.244 -3.790  1.00 18.30 ? 1218 HOH C O   1 
HETATM 9879  O  O   . HOH QA 11 .   A 0.693   -22.815 -9.441  1.00 19.01 ? 1219 HOH C O   1 
HETATM 9880  O  O   . HOH QA 11 .   A 40.855  -28.773 8.825   1.00 15.98 ? 1220 HOH C O   1 
HETATM 9881  O  O   . HOH QA 11 .   A 55.695  -34.390 -10.607 1.00 32.57 ? 1221 HOH C O   1 
HETATM 9882  O  O   . HOH QA 11 .   A 59.692  -27.267 1.106   1.00 25.62 ? 1222 HOH C O   1 
HETATM 9883  O  O   . HOH QA 11 .   A 28.498  -32.938 -17.399 1.00 9.19  ? 1223 HOH C O   1 
HETATM 9884  O  O   . HOH QA 11 .   A 35.705  -5.956  -25.275 1.00 19.91 ? 1224 HOH C O   1 
HETATM 9885  O  O   . HOH QA 11 .   A 6.143   -22.757 -2.132  1.00 12.77 ? 1225 HOH C O   1 
HETATM 9886  O  O   . HOH QA 11 .   A 51.790  -36.844 -1.901  1.00 28.43 ? 1226 HOH C O   1 
HETATM 9887  O  O   . HOH QA 11 .   A 49.316  -38.414 -0.576  1.00 15.48 ? 1227 HOH C O   1 
HETATM 9888  O  O   . HOH QA 11 .   A 54.182  -21.457 2.076   1.00 32.64 ? 1228 HOH C O   1 
HETATM 9889  O  O   . HOH QA 11 .   A -8.605  -14.312 -3.515  1.00 26.30 ? 1229 HOH C O   1 
HETATM 9890  O  O   . HOH QA 11 .   A 59.537  -29.136 -1.338  1.00 9.55  ? 1230 HOH C O   1 
HETATM 9891  O  O   . HOH QA 11 .   A 3.935   -18.434 14.874  1.00 16.22 ? 1231 HOH C O   1 
HETATM 9892  O  O   . HOH QA 11 .   A 40.915  -7.758  -17.714 1.00 17.49 ? 1232 HOH C O   1 
HETATM 9893  O  O   . HOH QA 11 .   A 26.313  -26.987 3.308   1.00 17.25 ? 1233 HOH C O   1 
HETATM 9894  O  O   . HOH QA 11 .   A 3.675   16.150  -11.629 1.00 11.58 ? 1234 HOH C O   1 
HETATM 9895  O  O   . HOH QA 11 .   A -1.299  -12.805 3.627   1.00 22.84 ? 1235 HOH C O   1 
HETATM 9896  O  O   . HOH QA 11 .   A 40.967  5.062   -7.791  1.00 14.63 ? 1236 HOH C O   1 
HETATM 9897  O  O   . HOH QA 11 .   A 49.736  -20.159 -23.272 1.00 26.04 ? 1238 HOH C O   1 
HETATM 9898  O  O   . HOH QA 11 .   A 53.126  -28.526 -13.145 1.00 18.00 ? 1239 HOH C O   1 
HETATM 9899  O  O   . HOH QA 11 .   A 43.746  4.430   -7.955  1.00 20.88 ? 1241 HOH C O   1 
HETATM 9900  O  O   . HOH QA 11 .   A 54.616  -17.822 1.799   1.00 21.88 ? 1242 HOH C O   1 
HETATM 9901  O  O   . HOH QA 11 .   A 45.500  -4.897  16.726  1.00 28.49 ? 1243 HOH C O   1 
HETATM 9902  O  O   . HOH QA 11 .   A 1.885   -10.365 5.012   1.00 16.41 ? 1244 HOH C O   1 
HETATM 9903  O  O   . HOH QA 11 .   A 47.272  -1.020  -7.138  1.00 27.88 ? 1246 HOH C O   1 
HETATM 9904  O  O   . HOH QA 11 .   A 41.205  -27.009 -23.564 1.00 21.97 ? 1248 HOH C O   1 
HETATM 9905  O  O   . HOH QA 11 .   A 43.695  -12.672 -20.491 1.00 17.39 ? 1249 HOH C O   1 
HETATM 9906  O  O   . HOH QA 11 .   A 43.274  -40.681 -2.902  1.00 19.79 ? 1250 HOH C O   1 
HETATM 9907  O  O   . HOH QA 11 .   A 45.565  -34.835 -8.826  1.00 27.32 ? 1251 HOH C O   1 
HETATM 9908  O  O   . HOH QA 11 .   A 47.048  -5.999  13.149  1.00 22.54 ? 1252 HOH C O   1 
HETATM 9909  O  O   . HOH QA 11 .   A 33.933  1.477   -16.948 1.00 18.77 ? 1253 HOH C O   1 
HETATM 9910  O  O   . HOH QA 11 .   A 15.539  18.020  0.661   1.00 22.73 ? 1256 HOH C O   1 
HETATM 9911  O  O   . HOH QA 11 .   A 49.715  -21.451 -25.831 1.00 34.83 ? 1258 HOH C O   1 
HETATM 9912  O  O   . HOH QA 11 .   A -4.752  -18.182 0.382   1.00 18.86 ? 1259 HOH C O   1 
HETATM 9913  O  O   . HOH QA 11 .   A 37.041  -6.701  -30.021 1.00 30.05 ? 1260 HOH C O   1 
HETATM 9914  O  O   . HOH QA 11 .   A 13.939  -0.431  -26.877 1.00 31.12 ? 1261 HOH C O   1 
HETATM 9915  O  O   . HOH QA 11 .   A 17.885  -27.254 1.937   1.00 26.08 ? 1262 HOH C O   1 
HETATM 9916  O  O   . HOH QA 11 .   A 12.363  -28.014 -2.234  1.00 23.37 ? 1263 HOH C O   1 
HETATM 9917  O  O   . HOH QA 11 .   A 20.273  -39.599 -13.562 1.00 26.89 ? 1264 HOH C O   1 
HETATM 9918  O  O   . HOH QA 11 .   A 43.509  -15.541 -31.367 1.00 25.81 ? 1265 HOH C O   1 
HETATM 9919  O  O   . HOH QA 11 .   A 58.410  -15.627 -3.677  1.00 10.23 ? 1266 HOH C O   1 
HETATM 9920  O  O   . HOH QA 11 .   A 46.775  1.843   7.546   1.00 21.52 ? 1267 HOH C O   1 
HETATM 9921  O  O   . HOH QA 11 .   A 12.406  -17.182 -21.453 1.00 21.25 ? 1268 HOH C O   1 
HETATM 9922  O  O   . HOH QA 11 .   A 32.296  12.363  -7.748  1.00 25.82 ? 1270 HOH C O   1 
HETATM 9923  O  O   . HOH QA 11 .   A 34.522  -30.289 -22.673 1.00 28.97 ? 1271 HOH C O   1 
HETATM 9924  O  O   . HOH RA 11 .   B 32.921  0.122   21.635  1.00 5.16  ? 652  HOH B O   1 
HETATM 9925  O  O   . HOH RA 11 .   B 49.953  10.803  42.599  1.00 13.01 ? 665  HOH B O   1 
HETATM 9926  O  O   . HOH RA 11 .   B 37.371  -1.625  17.789  1.00 12.97 ? 668  HOH B O   1 
HETATM 9927  O  O   . HOH RA 11 .   B 11.460  12.562  24.041  1.00 6.68  ? 670  HOH B O   1 
HETATM 9928  O  O   . HOH RA 11 .   B 12.728  7.986   19.855  1.00 11.06 ? 671  HOH B O   1 
HETATM 9929  O  O   . HOH RA 11 .   B 11.120  11.007  30.681  1.00 10.12 ? 672  HOH B O   1 
HETATM 9930  O  O   . HOH RA 11 .   B 14.177  2.534   16.707  1.00 2.29  ? 673  HOH B O   1 
HETATM 9931  O  O   . HOH RA 11 .   B 17.653  4.436   22.709  1.00 2.00  ? 675  HOH B O   1 
HETATM 9932  O  O   . HOH RA 11 .   B 42.488  -10.712 29.178  1.00 12.54 ? 677  HOH B O   1 
HETATM 9933  O  O   . HOH RA 11 .   B 46.601  -10.460 30.485  1.00 15.49 ? 678  HOH B O   1 
HETATM 9934  O  O   . HOH RA 11 .   B 45.449  -3.665  30.393  1.00 9.17  ? 680  HOH B O   1 
HETATM 9935  O  O   . HOH RA 11 .   B 40.325  -6.756  33.973  1.00 5.00  ? 683  HOH B O   1 
HETATM 9936  O  O   . HOH RA 11 .   B 43.683  11.565  47.908  1.00 16.65 ? 684  HOH B O   1 
HETATM 9937  O  O   . HOH RA 11 .   B 37.662  21.324  38.470  1.00 8.83  ? 687  HOH B O   1 
HETATM 9938  O  O   . HOH RA 11 .   B 17.212  2.580   20.451  1.00 6.19  ? 709  HOH B O   1 
HETATM 9939  O  O   . HOH RA 11 .   B 19.565  0.801   20.557  1.00 6.48  ? 710  HOH B O   1 
HETATM 9940  O  O   . HOH RA 11 .   B 42.065  -0.873  21.491  1.00 7.42  ? 711  HOH B O   1 
HETATM 9941  O  O   . HOH RA 11 .   B 42.043  -4.768  22.132  1.00 16.15 ? 712  HOH B O   1 
HETATM 9942  O  O   . HOH RA 11 .   B 41.846  -4.795  39.814  1.00 10.29 ? 713  HOH B O   1 
HETATM 9943  O  O   . HOH RA 11 .   B 46.981  11.082  40.716  1.00 5.10  ? 714  HOH B O   1 
HETATM 9944  O  O   . HOH RA 11 .   B 18.298  9.213   8.540   1.00 14.27 ? 723  HOH B O   1 
HETATM 9945  O  O   . HOH RA 11 .   B 40.896  11.746  50.631  1.00 3.63  ? 724  HOH B O   1 
HETATM 9946  O  O   . HOH RA 11 .   B 5.849   20.076  23.436  1.00 14.72 ? 726  HOH B O   1 
HETATM 9947  O  O   . HOH RA 11 .   B 30.824  18.143  36.328  1.00 4.70  ? 730  HOH B O   1 
HETATM 9948  O  O   . HOH RA 11 .   A 5.460   6.115   10.491  1.00 17.21 ? 731  HOH B O   1 
HETATM 9949  O  O   . HOH RA 11 .   B 44.323  -9.324  22.277  1.00 26.60 ? 731  HOH B O   1 
HETATM 9950  O  O   . HOH RA 11 .   B 25.669  0.128   17.683  1.00 6.92  ? 742  HOH B O   1 
HETATM 9951  O  O   . HOH RA 11 .   B 30.293  -4.218  18.298  1.00 2.00  ? 743  HOH B O   1 
HETATM 9952  O  O   . HOH RA 11 .   B 7.474   17.328  27.183  1.00 9.06  ? 753  HOH B O   1 
HETATM 9953  O  O   . HOH RA 11 .   B 6.372   12.330  22.163  1.00 11.65 ? 772  HOH B O   1 
HETATM 9954  O  O   . HOH RA 11 .   B 8.953   11.442  22.977  1.00 6.01  ? 773  HOH B O   1 
HETATM 9955  O  O   . HOH RA 11 .   B 20.488  3.309   23.628  1.00 10.88 ? 774  HOH B O   1 
HETATM 9956  O  O   . HOH RA 11 .   B 48.583  -5.537  37.130  1.00 7.43  ? 776  HOH B O   1 
HETATM 9957  O  O   . HOH RA 11 .   B 10.067  17.967  28.021  1.00 5.46  ? 780  HOH B O   1 
HETATM 9958  O  O   . HOH RA 11 .   B 4.380   10.947  17.714  1.00 14.42 ? 791  HOH B O   1 
HETATM 9959  O  O   . HOH RA 11 .   B 10.955  1.813   22.396  1.00 31.51 ? 792  HOH B O   1 
HETATM 9960  O  O   . HOH RA 11 .   B 42.461  -7.534  35.521  1.00 13.66 ? 794  HOH B O   1 
HETATM 9961  O  O   . HOH RA 11 .   B 12.946  -2.224  25.820  1.00 17.38 ? 795  HOH B O   1 
HETATM 9962  O  O   . HOH RA 11 .   B 43.006  26.534  40.508  1.00 13.44 ? 796  HOH B O   1 
HETATM 9963  O  O   . HOH RA 11 .   B 29.926  -0.071  41.804  1.00 13.80 ? 798  HOH B O   1 
HETATM 9964  O  O   . HOH RA 11 .   B 12.358  2.180   24.572  1.00 17.74 ? 800  HOH B O   1 
HETATM 9965  O  O   . HOH RA 11 .   B 49.494  -1.417  43.140  1.00 11.60 ? 809  HOH B O   1 
HETATM 9966  O  O   . HOH RA 11 .   B 44.469  -2.686  22.244  1.00 14.21 ? 815  HOH B O   1 
HETATM 9967  O  O   . HOH RA 11 .   B 23.034  -0.804  19.708  1.00 13.87 ? 816  HOH B O   1 
HETATM 9968  O  O   . HOH RA 11 .   B 25.868  7.924   17.078  1.00 8.33  ? 817  HOH B O   1 
HETATM 9969  O  O   . HOH RA 11 .   B 14.587  9.563   11.611  1.00 26.09 ? 819  HOH B O   1 
HETATM 9970  O  O   . HOH RA 11 .   B 36.015  -7.819  20.072  1.00 10.46 ? 821  HOH B O   1 
HETATM 9971  O  O   . HOH RA 11 .   B 43.186  -6.926  21.249  1.00 27.19 ? 823  HOH B O   1 
HETATM 9972  O  O   . HOH RA 11 .   B 49.197  -6.332  39.726  1.00 13.03 ? 827  HOH B O   1 
HETATM 9973  O  O   . HOH RA 11 .   B 49.250  8.766   48.445  1.00 24.43 ? 834  HOH B O   1 
HETATM 9974  O  O   . HOH RA 11 .   B 20.758  -2.017  38.122  1.00 15.33 ? 836  HOH B O   1 
HETATM 9975  O  O   . HOH RA 11 .   B 24.008  -0.649  37.702  1.00 5.80  ? 837  HOH B O   1 
HETATM 9976  O  O   . HOH RA 11 .   B 7.932   19.330  25.120  1.00 18.29 ? 841  HOH B O   1 
HETATM 9977  O  O   . HOH RA 11 .   B 25.350  7.665   41.489  1.00 26.52 ? 843  HOH B O   1 
HETATM 9978  O  O   . HOH RA 11 .   B 26.194  5.871   38.270  1.00 16.10 ? 845  HOH B O   1 
HETATM 9979  O  O   . HOH RA 11 .   B 26.965  3.077   37.239  1.00 16.69 ? 846  HOH B O   1 
HETATM 9980  O  O   . HOH RA 11 .   B 11.670  1.364   28.826  1.00 15.48 ? 848  HOH B O   1 
HETATM 9981  O  O   . HOH RA 11 .   B 27.837  -0.344  39.861  1.00 20.94 ? 856  HOH B O   1 
HETATM 9982  O  O   . HOH RA 11 .   B 44.827  -8.682  34.667  1.00 26.01 ? 868  HOH B O   1 
HETATM 9983  O  O   . HOH RA 11 .   B 28.487  -12.409 23.353  1.00 29.42 ? 869  HOH B O   1 
HETATM 9984  O  O   . HOH RA 11 .   B 4.654   8.483   28.316  1.00 16.50 ? 876  HOH B O   1 
HETATM 9985  O  O   . HOH RA 11 .   B 47.640  14.087  52.764  1.00 24.90 ? 877  HOH B O   1 
HETATM 9986  O  O   . HOH RA 11 .   B 23.482  -10.696 40.648  1.00 26.49 ? 887  HOH B O   1 
HETATM 9987  O  O   . HOH RA 11 .   B -1.510  17.790  27.982  1.00 28.06 ? 900  HOH B O   1 
HETATM 9988  O  O   . HOH RA 11 .   B 28.236  -4.420  21.079  1.00 8.89  ? 901  HOH B O   1 
HETATM 9989  O  O   . HOH RA 11 .   B 39.240  -16.323 26.018  1.00 28.98 ? 902  HOH B O   1 
HETATM 9990  O  O   . HOH RA 11 .   B 26.672  1.584   15.423  1.00 30.52 ? 914  HOH B O   1 
HETATM 9991  O  O   . HOH RA 11 .   B 44.068  22.111  49.534  1.00 29.17 ? 916  HOH B O   1 
HETATM 9992  O  O   . HOH RA 11 .   B 10.490  -3.538  22.677  1.00 14.90 ? 930  HOH B O   1 
HETATM 9993  O  O   . HOH RA 11 .   B 1.759   14.168  24.124  1.00 33.83 ? 931  HOH B O   1 
HETATM 9994  O  O   . HOH RA 11 .   B 11.012  -0.596  26.458  1.00 18.23 ? 932  HOH B O   1 
HETATM 9995  O  O   . HOH RA 11 .   B 34.245  -17.403 25.257  1.00 18.63 ? 934  HOH B O   1 
HETATM 9996  O  O   . HOH RA 11 .   B 47.579  -14.642 26.108  1.00 29.92 ? 935  HOH B O   1 
HETATM 9997  O  O   . HOH RA 11 .   B 28.571  3.722   15.111  1.00 31.14 ? 942  HOH B O   1 
HETATM 9998  O  O   . HOH RA 11 .   B 51.186  17.499  43.988  1.00 23.08 ? 944  HOH B O   1 
HETATM 9999  O  O   . HOH RA 11 .   B 25.223  1.201   38.877  1.00 21.34 ? 947  HOH B O   1 
HETATM 10000 O  O   . HOH RA 11 .   B 43.826  -11.854 31.406  1.00 28.88 ? 949  HOH B O   1 
HETATM 10001 O  O   . HOH RA 11 .   B 6.958   5.936   13.845  1.00 19.08 ? 952  HOH B O   1 
HETATM 10002 O  O   . HOH RA 11 .   B 41.913  26.168  37.912  1.00 22.40 ? 954  HOH B O   1 
HETATM 10003 O  O   . HOH RA 11 .   B 46.111  11.076  51.439  1.00 20.35 ? 961  HOH B O   1 
HETATM 10004 O  O   . HOH RA 11 .   A 49.389  -3.092  17.600  1.00 35.00 ? 970  HOH B O   1 
HETATM 10005 O  O   . HOH RA 11 .   B 31.000  0.591   15.691  1.00 12.64 ? 978  HOH B O   1 
HETATM 10006 O  O   . HOH RA 11 .   B 33.322  4.310   13.841  1.00 23.38 ? 985  HOH B O   1 
HETATM 10007 O  O   . HOH RA 11 .   B 2.281   20.763  23.423  1.00 17.56 ? 1201 HOH B O   1 
HETATM 10008 O  O   . HOH RA 11 .   B 3.603   12.022  23.870  1.00 25.98 ? 1213 HOH B O   1 
HETATM 10009 O  O   . HOH RA 11 .   B 4.442   18.098  19.607  1.00 21.49 ? 1221 HOH B O   1 
HETATM 10010 O  O   . HOH RA 11 .   B 44.554  -19.737 31.587  1.00 24.58 ? 1222 HOH B O   1 
HETATM 10011 O  O   . HOH RA 11 .   B 4.031   12.341  28.398  1.00 21.22 ? 1226 HOH B O   1 
HETATM 10012 O  O   . HOH RA 11 .   B 4.251   10.363  20.837  1.00 31.55 ? 1233 HOH B O   1 
HETATM 10013 O  O   . HOH RA 11 .   B 53.731  -8.575  26.661  1.00 32.26 ? 1234 HOH B O   1 
HETATM 10014 O  O   . HOH RA 11 .   B 53.997  19.675  49.248  1.00 20.77 ? 1237 HOH B O   1 
HETATM 10015 O  O   . HOH RA 11 .   B -2.538  8.656   15.877  1.00 25.77 ? 1239 HOH B O   1 
HETATM 10016 O  O   . HOH RA 11 .   B 50.688  -4.526  30.572  1.00 21.04 ? 1244 HOH B O   1 
HETATM 10017 O  O   . HOH RA 11 .   B 3.058   15.447  13.806  1.00 33.81 ? 1245 HOH B O   1 
HETATM 10018 O  O   . HOH RA 11 .   B 3.853   7.695   21.961  1.00 34.70 ? 1246 HOH B O   1 
HETATM 10019 O  O   . HOH RA 11 .   B 1.462   14.278  10.152  1.00 27.52 ? 1253 HOH B O   1 
HETATM 10020 O  O   . HOH RA 11 .   B 53.103  14.880  46.968  1.00 21.75 ? 1254 HOH B O   1 
HETATM 10021 O  O   . HOH RA 11 .   B 45.255  -7.131  19.073  1.00 17.76 ? 1255 HOH B O   1 
HETATM 10022 O  O   . HOH SA 11 .   B 13.735  22.086  26.464  1.00 33.42 ? 647  HOH D O   1 
HETATM 10023 O  O   . HOH SA 11 .   B 22.996  34.970  39.626  1.00 15.14 ? 648  HOH D O   1 
HETATM 10024 O  O   . HOH SA 11 .   B 47.062  17.037  18.025  1.00 25.33 ? 649  HOH D O   1 
HETATM 10025 O  O   . HOH SA 11 .   B 2.783   19.014  48.190  1.00 31.35 ? 650  HOH D O   1 
HETATM 10026 O  O   . HOH SA 11 .   B 19.966  16.446  5.261   1.00 24.43 ? 651  HOH D O   1 
HETATM 10027 O  O   . HOH SA 11 .   B 11.193  26.379  20.356  1.00 7.41  ? 653  HOH D O   1 
HETATM 10028 O  O   . HOH SA 11 .   B 26.090  -7.921  17.302  1.00 12.72 ? 654  HOH D O   1 
HETATM 10029 O  O   . HOH SA 11 .   B 3.976   24.516  45.494  1.00 29.40 ? 655  HOH D O   1 
HETATM 10030 O  O   . HOH SA 11 .   B 5.910   6.379   27.626  1.00 19.37 ? 656  HOH D O   1 
HETATM 10031 O  O   . HOH SA 11 .   B 11.306  12.709  13.960  1.00 9.52  ? 657  HOH D O   1 
HETATM 10032 O  O   . HOH SA 11 .   B 38.491  9.981   56.122  1.00 30.11 ? 658  HOH D O   1 
HETATM 10033 O  O   . HOH SA 11 .   B 20.923  5.917   24.871  1.00 5.68  ? 659  HOH D O   1 
HETATM 10034 O  O   . HOH SA 11 .   B 32.599  28.691  24.359  1.00 25.39 ? 660  HOH D O   1 
HETATM 10035 O  O   . HOH SA 11 .   B 25.303  -9.221  34.092  1.00 8.32  ? 661  HOH D O   1 
HETATM 10036 O  O   . HOH SA 11 .   B 15.236  33.187  48.268  1.00 19.84 ? 662  HOH D O   1 
HETATM 10037 O  O   . HOH SA 11 .   B 28.437  28.936  42.704  1.00 6.69  ? 663  HOH D O   1 
HETATM 10038 O  O   . HOH SA 11 .   B 8.575   19.428  18.510  1.00 21.68 ? 664  HOH D O   1 
HETATM 10039 O  O   . HOH SA 11 .   B 7.284   1.892   30.537  1.00 18.06 ? 666  HOH D O   1 
HETATM 10040 O  O   . HOH SA 11 .   B 27.247  20.891  50.239  1.00 13.56 ? 667  HOH D O   1 
HETATM 10041 O  O   . HOH SA 11 .   B 11.319  11.690  26.599  1.00 6.83  ? 669  HOH D O   1 
HETATM 10042 O  O   . HOH SA 11 .   B 18.144  5.919   25.882  1.00 2.15  ? 674  HOH D O   1 
HETATM 10043 O  O   . HOH SA 11 .   B 37.228  -5.837  27.236  1.00 9.81  ? 676  HOH D O   1 
HETATM 10044 O  O   . HOH SA 11 .   B 48.001  -3.717  28.583  1.00 11.40 ? 679  HOH D O   1 
HETATM 10045 O  O   . HOH SA 11 .   B 43.088  -2.362  28.999  1.00 9.29  ? 681  HOH D O   1 
HETATM 10046 O  O   . HOH SA 11 .   B 41.075  -5.456  37.127  1.00 4.87  ? 682  HOH D O   1 
HETATM 10047 O  O   . HOH SA 11 .   B 38.341  13.242  43.133  1.00 5.30  ? 685  HOH D O   1 
HETATM 10048 O  O   . HOH SA 11 .   B 32.619  16.460  46.482  1.00 8.11  ? 686  HOH D O   1 
HETATM 10049 O  O   . HOH SA 11 .   B 20.048  10.493  40.763  1.00 6.86  ? 688  HOH D O   1 
HETATM 10050 O  O   . HOH SA 11 .   B 17.866  4.688   37.645  1.00 10.46 ? 689  HOH D O   1 
HETATM 10051 O  O   . HOH SA 11 .   B 16.868  10.057  33.948  1.00 2.70  ? 690  HOH D O   1 
HETATM 10052 O  O   . HOH SA 11 .   B 23.471  -3.090  30.965  1.00 4.67  ? 691  HOH D O   1 
HETATM 10053 O  O   . HOH SA 11 .   B 28.358  -6.570  30.497  1.00 7.66  ? 692  HOH D O   1 
HETATM 10054 O  O   . HOH SA 11 .   B 32.887  -9.554  46.712  1.00 18.03 ? 693  HOH D O   1 
HETATM 10055 O  O   . HOH SA 11 .   B 7.760   12.471  43.542  1.00 10.42 ? 694  HOH D O   1 
HETATM 10056 O  O   . HOH SA 11 .   B 15.350  24.413  51.682  1.00 14.18 ? 695  HOH D O   1 
HETATM 10057 O  O   . HOH SA 11 .   B 14.531  15.119  49.757  1.00 11.27 ? 696  HOH D O   1 
HETATM 10058 O  O   . HOH SA 11 .   B 18.929  5.874   58.340  1.00 26.46 ? 697  HOH D O   1 
HETATM 10059 O  O   . HOH SA 11 .   B 16.237  7.452   44.006  1.00 19.18 ? 698  HOH D O   1 
HETATM 10060 O  O   . HOH SA 11 .   B 5.397   24.802  29.035  1.00 11.08 ? 699  HOH D O   1 
HETATM 10061 O  O   . HOH SA 11 .   B 11.035  17.648  30.388  1.00 10.61 ? 700  HOH D O   1 
HETATM 10062 O  O   . HOH SA 11 .   B 10.780  13.889  31.459  1.00 5.94  ? 701  HOH D O   1 
HETATM 10063 O  O   . HOH SA 11 .   B 22.578  29.069  35.607  1.00 17.45 ? 702  HOH D O   1 
HETATM 10064 O  O   . HOH SA 11 .   B 16.688  19.529  17.927  1.00 10.81 ? 703  HOH D O   1 
HETATM 10065 O  O   . HOH SA 11 .   B 38.278  3.116   31.453  1.00 3.27  ? 704  HOH D O   1 
HETATM 10066 O  O   . HOH SA 11 .   B 30.813  17.435  48.176  1.00 9.12  ? 705  HOH D O   1 
HETATM 10067 O  O   . HOH SA 11 .   A 20.246  9.683   6.650   1.00 4.24  ? 706  HOH D O   1 
HETATM 10068 O  O   . HOH SA 11 .   B 39.828  3.855   15.771  1.00 3.62  ? 706  HOH D O   1 
HETATM 10069 O  O   . HOH SA 11 .   B 49.792  10.387  38.295  1.00 18.27 ? 707  HOH D O   1 
HETATM 10070 O  O   . HOH SA 11 .   B 14.743  12.152  17.347  1.00 7.45  ? 708  HOH D O   1 
HETATM 10071 O  O   . HOH SA 11 .   B 40.847  14.000  27.447  1.00 2.00  ? 715  HOH D O   1 
HETATM 10072 O  O   . HOH SA 11 .   B 26.388  -1.411  35.047  1.00 8.77  ? 716  HOH D O   1 
HETATM 10073 O  O   . HOH SA 11 .   B 32.557  -12.451 42.979  1.00 11.82 ? 717  HOH D O   1 
HETATM 10074 O  O   . HOH SA 11 .   B 24.352  -8.386  24.633  1.00 14.91 ? 718  HOH D O   1 
HETATM 10075 O  O   . HOH SA 11 .   B 14.793  8.283   34.344  1.00 11.38 ? 719  HOH D O   1 
HETATM 10076 O  O   . HOH SA 11 .   B 11.822  13.283  41.091  1.00 11.01 ? 720  HOH D O   1 
HETATM 10077 O  O   . HOH SA 11 .   B 2.496   17.089  45.756  1.00 16.61 ? 721  HOH D O   1 
HETATM 10078 O  O   . HOH SA 11 .   B -1.284  17.346  41.643  1.00 19.40 ? 722  HOH D O   1 
HETATM 10079 O  O   . HOH SA 11 .   B 17.304  23.620  54.447  1.00 16.63 ? 725  HOH D O   1 
HETATM 10080 O  O   . HOH SA 11 .   B 38.021  -3.127  27.212  1.00 11.75 ? 727  HOH D O   1 
HETATM 10081 O  O   . HOH SA 11 .   B 11.477  36.203  31.771  1.00 20.36 ? 728  HOH D O   1 
HETATM 10082 O  O   . HOH SA 11 .   B 13.955  20.642  11.064  1.00 27.90 ? 729  HOH D O   1 
HETATM 10083 O  O   . HOH SA 11 .   B 7.730   16.745  52.174  1.00 17.40 ? 732  HOH D O   1 
HETATM 10084 O  O   . HOH SA 11 .   B 29.896  19.681  49.400  1.00 10.66 ? 733  HOH D O   1 
HETATM 10085 O  O   . HOH SA 11 .   B 32.411  -9.536  42.805  1.00 18.22 ? 734  HOH D O   1 
HETATM 10086 O  O   . HOH SA 11 .   B 24.495  23.086  14.681  1.00 12.45 ? 735  HOH D O   1 
HETATM 10087 O  O   . HOH SA 11 .   B 39.407  -8.669  37.545  1.00 22.11 ? 736  HOH D O   1 
HETATM 10088 O  O   . HOH SA 11 .   B 42.879  -10.629 44.074  1.00 28.34 ? 737  HOH D O   1 
HETATM 10089 O  O   . HOH SA 11 .   B 29.155  -3.557  40.070  1.00 7.28  ? 738  HOH D O   1 
HETATM 10090 O  O   . HOH SA 11 .   B 14.019  15.057  41.134  1.00 14.06 ? 739  HOH D O   1 
HETATM 10091 O  O   . HOH SA 11 .   B 6.516   11.615  36.628  1.00 9.07  ? 740  HOH D O   1 
HETATM 10092 O  O   . HOH SA 11 .   B 27.108  -10.290 15.784  1.00 2.62  ? 741  HOH D O   1 
HETATM 10093 O  O   . HOH SA 11 .   B 27.968  1.341   35.417  1.00 4.95  ? 744  HOH D O   1 
HETATM 10094 O  O   . HOH SA 11 .   B 28.112  6.547   53.758  1.00 14.40 ? 745  HOH D O   1 
HETATM 10095 O  O   . HOH SA 11 .   B 30.177  5.096   52.517  1.00 20.99 ? 746  HOH D O   1 
HETATM 10096 O  O   . HOH SA 11 .   B 13.392  5.821   35.040  1.00 13.38 ? 747  HOH D O   1 
HETATM 10097 O  O   . HOH SA 11 .   B 13.934  4.267   37.698  1.00 18.09 ? 748  HOH D O   1 
HETATM 10098 O  O   . HOH SA 11 .   B 13.898  5.669   40.044  1.00 15.71 ? 749  HOH D O   1 
HETATM 10099 O  O   . HOH SA 11 .   B 17.953  6.977   45.956  1.00 22.11 ? 750  HOH D O   1 
HETATM 10100 O  O   . HOH SA 11 .   B 33.281  -1.540  54.452  1.00 14.23 ? 751  HOH D O   1 
HETATM 10101 O  O   . HOH SA 11 .   B 5.768   17.701  29.230  1.00 7.97  ? 752  HOH D O   1 
HETATM 10102 O  O   . HOH SA 11 .   B 11.119  20.672  27.621  1.00 11.01 ? 754  HOH D O   1 
HETATM 10103 O  O   . HOH SA 11 .   B 13.655  18.698  27.666  1.00 7.26  ? 755  HOH D O   1 
HETATM 10104 O  O   . HOH SA 11 .   B 18.179  16.323  24.323  1.00 10.90 ? 756  HOH D O   1 
HETATM 10105 O  O   . HOH SA 11 .   B 15.518  21.149  57.524  1.00 21.47 ? 757  HOH D O   1 
HETATM 10106 O  O   . HOH SA 11 .   B 39.510  19.794  36.673  1.00 4.29  ? 759  HOH D O   1 
HETATM 10107 O  O   . HOH SA 11 .   B 45.356  16.813  33.117  1.00 7.34  ? 760  HOH D O   1 
HETATM 10108 O  O   . HOH SA 11 .   B 34.903  36.117  48.532  1.00 19.73 ? 761  HOH D O   1 
HETATM 10109 O  O   . HOH SA 11 .   B 22.860  17.636  55.633  1.00 15.17 ? 762  HOH D O   1 
HETATM 10110 O  O   . HOH SA 11 .   B 28.255  2.333   32.872  1.00 7.92  ? 763  HOH D O   1 
HETATM 10111 O  O   . HOH SA 11 .   B 39.162  -0.896  28.846  1.00 9.49  ? 764  HOH D O   1 
HETATM 10112 O  O   . HOH SA 11 .   B 43.724  1.510   21.191  1.00 10.57 ? 765  HOH D O   1 
HETATM 10113 O  O   . HOH SA 11 .   B 44.456  1.186   18.316  1.00 6.02  ? 766  HOH D O   1 
HETATM 10114 O  O   . HOH SA 11 .   B 46.445  16.080  22.065  1.00 7.45  ? 767  HOH D O   1 
HETATM 10115 O  O   . HOH SA 11 .   B 38.485  23.656  24.067  1.00 4.90  ? 768  HOH D O   1 
HETATM 10116 O  O   . HOH SA 11 .   B 38.963  17.354  20.732  1.00 14.73 ? 769  HOH D O   1 
HETATM 10117 O  O   . HOH SA 11 .   B 32.119  14.983  16.157  1.00 12.27 ? 771  HOH D O   1 
HETATM 10118 O  O   . HOH SA 11 .   A 41.827  9.178   12.381  1.00 2.77  ? 775  HOH D O   1 
HETATM 10119 O  O   . HOH SA 11 .   B 18.215  28.270  55.353  1.00 13.74 ? 777  HOH D O   1 
HETATM 10120 O  O   . HOH SA 11 .   B 21.677  22.410  15.013  1.00 9.72  ? 778  HOH D O   1 
HETATM 10121 O  O   . HOH SA 11 .   B 16.984  12.410  15.509  1.00 13.86 ? 779  HOH D O   1 
HETATM 10122 O  O   . HOH SA 11 .   B 0.322   15.116  38.782  1.00 12.42 ? 781  HOH D O   1 
HETATM 10123 O  O   . HOH SA 11 .   B 21.530  11.491  50.388  1.00 16.46 ? 782  HOH D O   1 
HETATM 10124 O  O   . HOH SA 11 .   B 24.073  9.087   19.191  1.00 15.07 ? 783  HOH D O   1 
HETATM 10125 O  O   . HOH SA 11 .   B 30.817  2.793   31.607  1.00 8.74  ? 784  HOH D O   1 
HETATM 10126 O  O   . HOH SA 11 .   B 19.772  7.517   55.767  1.00 14.59 ? 785  HOH D O   1 
HETATM 10127 O  O   . HOH SA 11 .   B 41.750  15.226  30.543  1.00 2.85  ? 786  HOH D O   1 
HETATM 10128 O  O   . HOH SA 11 .   B 39.480  15.502  32.828  1.00 10.53 ? 787  HOH D O   1 
HETATM 10129 O  O   . HOH SA 11 .   B 38.353  17.621  35.295  1.00 13.63 ? 788  HOH D O   1 
HETATM 10130 O  O   . HOH SA 11 .   B 4.913   33.319  37.470  1.00 28.35 ? 789  HOH D O   1 
HETATM 10131 O  O   . HOH SA 11 .   B 2.830   26.562  26.487  1.00 20.66 ? 790  HOH D O   1 
HETATM 10132 O  O   . HOH SA 11 .   A 22.094  1.129   14.541  1.00 11.21 ? 793  HOH D O   1 
HETATM 10133 O  O   . HOH SA 11 .   B 30.855  -2.873  42.536  1.00 14.07 ? 797  HOH D O   1 
HETATM 10134 O  O   . HOH SA 11 .   B 25.191  -10.749 24.594  1.00 12.24 ? 799  HOH D O   1 
HETATM 10135 O  O   . HOH SA 11 .   B 15.926  4.769   46.090  1.00 19.88 ? 801  HOH D O   1 
HETATM 10136 O  O   . HOH SA 11 .   B 7.273   24.324  44.961  1.00 15.82 ? 802  HOH D O   1 
HETATM 10137 O  O   . HOH SA 11 .   A 34.157  4.680   4.516   1.00 17.18 ? 803  HOH D O   1 
HETATM 10138 O  O   . HOH SA 11 .   B 26.280  10.702  10.160  1.00 7.68  ? 804  HOH D O   1 
HETATM 10139 O  O   . HOH SA 11 .   B 23.395  10.364  13.328  1.00 11.21 ? 805  HOH D O   1 
HETATM 10140 O  O   . HOH SA 11 .   B 23.183  7.713   12.327  1.00 24.93 ? 806  HOH D O   1 
HETATM 10141 O  O   . HOH SA 11 .   B 21.777  19.895  55.893  1.00 10.38 ? 807  HOH D O   1 
HETATM 10142 O  O   . HOH SA 11 .   B 43.698  18.390  42.824  1.00 6.77  ? 808  HOH D O   1 
HETATM 10143 O  O   . HOH SA 11 .   B 45.611  4.923   49.014  1.00 16.78 ? 810  HOH D O   1 
HETATM 10144 O  O   . HOH SA 11 .   B -5.814  15.488  34.921  1.00 23.49 ? 811  HOH D O   1 
HETATM 10145 O  O   . HOH SA 11 .   B 48.564  8.931   14.809  1.00 18.55 ? 812  HOH D O   1 
HETATM 10146 O  O   . HOH SA 11 .   B 42.213  24.579  31.634  1.00 19.78 ? 813  HOH D O   1 
HETATM 10147 O  O   . HOH SA 11 .   B 29.929  17.412  17.382  1.00 8.33  ? 814  HOH D O   1 
HETATM 10148 O  O   . HOH SA 11 .   B 38.990  21.194  20.244  1.00 17.13 ? 818  HOH D O   1 
HETATM 10149 O  O   . HOH SA 11 .   B 10.345  20.830  24.954  1.00 15.02 ? 820  HOH D O   1 
HETATM 10150 O  O   . HOH SA 11 .   B 20.677  20.885  12.953  1.00 18.06 ? 822  HOH D O   1 
HETATM 10151 O  O   . HOH SA 11 .   B 50.242  -3.177  36.852  1.00 24.33 ? 824  HOH D O   1 
HETATM 10152 O  O   . HOH SA 11 .   B 46.243  9.141   49.237  1.00 23.98 ? 825  HOH D O   1 
HETATM 10153 O  O   . HOH SA 11 .   B 50.221  14.393  44.219  1.00 13.85 ? 826  HOH D O   1 
HETATM 10154 O  O   . HOH SA 11 .   B 14.127  6.389   42.881  1.00 24.88 ? 828  HOH D O   1 
HETATM 10155 O  O   . HOH SA 11 .   B 24.669  30.804  36.516  1.00 9.38  ? 829  HOH D O   1 
HETATM 10156 O  O   . HOH SA 11 .   B 24.692  12.467  14.548  1.00 22.07 ? 830  HOH D O   1 
HETATM 10157 O  O   . HOH SA 11 .   B 47.572  2.432   17.437  1.00 10.66 ? 831  HOH D O   1 
HETATM 10158 O  O   . HOH SA 11 .   B 14.519  3.311   33.829  1.00 13.45 ? 832  HOH D O   1 
HETATM 10159 O  O   . HOH SA 11 .   B 16.281  3.282   36.041  1.00 6.08  ? 833  HOH D O   1 
HETATM 10160 O  O   . HOH SA 11 .   B 44.173  9.326   45.790  1.00 9.85  ? 835  HOH D O   1 
HETATM 10161 O  O   . HOH SA 11 .   B 20.120  4.942   46.019  1.00 27.95 ? 838  HOH D O   1 
HETATM 10162 O  O   . HOH SA 11 .   B 17.713  3.250   44.729  1.00 21.48 ? 839  HOH D O   1 
HETATM 10163 O  O   . HOH SA 11 .   B -2.652  27.665  41.902  1.00 16.38 ? 840  HOH D O   1 
HETATM 10164 O  O   . HOH SA 11 .   B 43.907  7.814   52.110  1.00 30.51 ? 842  HOH D O   1 
HETATM 10165 O  O   . HOH SA 11 .   B 36.389  -17.561 35.909  1.00 15.62 ? 847  HOH D O   1 
HETATM 10166 O  O   . HOH SA 11 .   B 16.787  18.774  59.502  1.00 19.53 ? 849  HOH D O   1 
HETATM 10167 O  O   . HOH SA 11 .   B 48.535  18.142  35.511  1.00 14.34 ? 850  HOH D O   1 
HETATM 10168 O  O   . HOH SA 11 .   B 44.761  20.839  35.099  1.00 16.02 ? 851  HOH D O   1 
HETATM 10169 O  O   . HOH SA 11 .   B 35.762  -15.523 47.949  1.00 30.99 ? 852  HOH D O   1 
HETATM 10170 O  O   . HOH SA 11 .   B 24.269  -7.551  21.601  1.00 30.41 ? 853  HOH D O   1 
HETATM 10171 O  O   . HOH SA 11 .   B 13.343  2.567   51.480  1.00 29.88 ? 854  HOH D O   1 
HETATM 10172 O  O   . HOH SA 11 .   B 7.634   21.687  46.700  1.00 20.18 ? 855  HOH D O   1 
HETATM 10173 O  O   . HOH SA 11 .   B 24.381  37.229  38.594  1.00 28.23 ? 857  HOH D O   1 
HETATM 10174 O  O   . HOH SA 11 .   B 8.542   36.753  27.417  1.00 25.21 ? 858  HOH D O   1 
HETATM 10175 O  O   . HOH SA 11 .   B 0.023   28.112  26.528  1.00 16.81 ? 859  HOH D O   1 
HETATM 10176 O  O   . HOH SA 11 .   B 20.826  8.708   11.358  1.00 14.91 ? 860  HOH D O   1 
HETATM 10177 O  O   . HOH SA 11 .   B 25.740  16.553  8.062   1.00 30.70 ? 861  HOH D O   1 
HETATM 10178 O  O   . HOH SA 11 .   B 33.885  30.899  49.688  1.00 19.48 ? 862  HOH D O   1 
HETATM 10179 O  O   . HOH SA 11 .   B 38.740  1.529   27.230  1.00 9.17  ? 863  HOH D O   1 
HETATM 10180 O  O   . HOH SA 11 .   B -4.734  17.367  29.320  1.00 31.53 ? 864  HOH D O   1 
HETATM 10181 O  O   . HOH SA 11 .   B 45.230  14.615  34.965  1.00 8.31  ? 865  HOH D O   1 
HETATM 10182 O  O   . HOH SA 11 .   A 19.857  -15.320 21.934  1.00 17.89 ? 866  HOH D O   1 
HETATM 10183 O  O   . HOH SA 11 .   B 17.528  -12.248 24.332  1.00 26.32 ? 866  HOH D O   1 
HETATM 10184 O  O   . HOH SA 11 .   B 22.432  18.814  12.384  1.00 16.19 ? 867  HOH D O   1 
HETATM 10185 O  O   . HOH SA 11 .   B 12.859  21.575  58.895  1.00 18.82 ? 870  HOH D O   1 
HETATM 10186 O  O   . HOH SA 11 .   B 24.744  -12.914 29.801  1.00 28.19 ? 871  HOH D O   1 
HETATM 10187 O  O   . HOH SA 11 .   B 9.127   26.988  45.443  1.00 33.74 ? 872  HOH D O   1 
HETATM 10188 O  O   . HOH SA 11 .   B 8.425   23.606  48.640  1.00 18.16 ? 873  HOH D O   1 
HETATM 10189 O  O   . HOH SA 11 .   B 10.691  29.538  37.925  1.00 25.54 ? 874  HOH D O   1 
HETATM 10190 O  O   . HOH SA 11 .   A 31.889  3.106   10.013  1.00 20.94 ? 875  HOH D O   1 
HETATM 10191 O  O   . HOH SA 11 .   B 10.332  19.590  14.376  1.00 8.53  ? 878  HOH D O   1 
HETATM 10192 O  O   . HOH SA 11 .   B 7.260   17.877  16.481  1.00 12.01 ? 879  HOH D O   1 
HETATM 10193 O  O   . HOH SA 11 .   B 13.770  37.464  45.024  1.00 31.39 ? 880  HOH D O   1 
HETATM 10194 O  O   . HOH SA 11 .   B 38.083  28.630  32.772  1.00 14.85 ? 881  HOH D O   1 
HETATM 10195 O  O   . HOH SA 11 .   B 4.901   5.605   24.650  1.00 19.68 ? 882  HOH D O   1 
HETATM 10196 O  O   . HOH SA 11 .   B 8.534   30.867  38.579  1.00 29.17 ? 883  HOH D O   1 
HETATM 10197 O  O   . HOH SA 11 .   B 0.609   11.066  30.662  1.00 27.56 ? 884  HOH D O   1 
HETATM 10198 O  O   . HOH SA 11 .   B -0.747  14.644  27.656  1.00 34.66 ? 885  HOH D O   1 
HETATM 10199 O  O   . HOH SA 11 .   B 47.677  -6.531  48.454  1.00 14.13 ? 886  HOH D O   1 
HETATM 10200 O  O   . HOH SA 11 .   B 30.320  11.452  7.532   1.00 28.58 ? 888  HOH D O   1 
HETATM 10201 O  O   . HOH SA 11 .   B 8.548   28.033  17.602  1.00 25.29 ? 890  HOH D O   1 
HETATM 10202 O  O   . HOH SA 11 .   B 25.921  8.191   57.328  1.00 19.17 ? 891  HOH D O   1 
HETATM 10203 O  O   . HOH SA 11 .   B -6.567  22.241  37.121  1.00 22.36 ? 892  HOH D O   1 
HETATM 10204 O  O   . HOH SA 11 .   B -1.539  23.517  40.024  1.00 14.89 ? 893  HOH D O   1 
HETATM 10205 O  O   . HOH SA 11 .   B 58.014  2.937   23.222  1.00 20.88 ? 894  HOH D O   1 
HETATM 10206 O  O   . HOH SA 11 .   B 40.060  26.232  24.585  1.00 13.41 ? 895  HOH D O   1 
HETATM 10207 O  O   . HOH SA 11 .   B 25.987  -12.050 27.131  1.00 31.48 ? 896  HOH D O   1 
HETATM 10208 O  O   . HOH SA 11 .   B 26.890  7.951   8.474   1.00 11.38 ? 897  HOH D O   1 
HETATM 10209 O  O   . HOH SA 11 .   B 25.218  6.006   14.989  1.00 29.78 ? 898  HOH D O   1 
HETATM 10210 O  O   . HOH SA 11 .   B 48.491  15.221  20.239  1.00 24.95 ? 899  HOH D O   1 
HETATM 10211 O  O   . HOH SA 11 .   B 10.541  12.453  43.361  1.00 12.27 ? 903  HOH D O   1 
HETATM 10212 O  O   . HOH SA 11 .   B 24.791  24.240  22.721  1.00 27.19 ? 904  HOH D O   1 
HETATM 10213 O  O   . HOH SA 11 .   B 29.852  13.080  61.052  1.00 15.35 ? 905  HOH D O   1 
HETATM 10214 O  O   . HOH SA 11 .   B 46.794  17.603  24.374  1.00 28.48 ? 906  HOH D O   1 
HETATM 10215 O  O   . HOH SA 11 .   A 23.446  -3.948  20.639  1.00 16.60 ? 907  HOH D O   1 
HETATM 10216 O  O   . HOH SA 11 .   B 10.106  25.716  47.821  1.00 23.43 ? 908  HOH D O   1 
HETATM 10217 O  O   . HOH SA 11 .   B 23.303  27.137  19.626  1.00 22.01 ? 909  HOH D O   1 
HETATM 10218 O  O   . HOH SA 11 .   B 12.263  33.246  39.264  1.00 29.29 ? 910  HOH D O   1 
HETATM 10219 O  O   . HOH SA 11 .   B 3.569   11.446  33.419  1.00 15.89 ? 911  HOH D O   1 
HETATM 10220 O  O   . HOH SA 11 .   B 6.000   31.856  17.955  1.00 27.35 ? 912  HOH D O   1 
HETATM 10221 O  O   . HOH SA 11 .   B -2.709  16.221  39.109  1.00 21.74 ? 913  HOH D O   1 
HETATM 10222 O  O   . HOH SA 11 .   B 30.242  -13.112 32.310  1.00 41.63 ? 915  HOH D O   1 
HETATM 10223 O  O   . HOH SA 11 .   B 38.897  23.250  48.961  1.00 29.71 ? 917  HOH D O   1 
HETATM 10224 O  O   . HOH SA 11 .   B 2.911   23.145  25.153  1.00 12.05 ? 918  HOH D O   1 
HETATM 10225 O  O   . HOH SA 11 .   B 9.004   1.693   36.492  1.00 29.69 ? 919  HOH D O   1 
HETATM 10226 O  O   . HOH SA 11 .   B 18.264  2.232   60.062  1.00 27.08 ? 920  HOH D O   1 
HETATM 10227 O  O   . HOH SA 11 .   B 51.756  12.141  36.664  1.00 31.12 ? 921  HOH D O   1 
HETATM 10228 O  O   . HOH SA 11 .   B 20.649  26.321  25.268  1.00 7.49  ? 922  HOH D O   1 
HETATM 10229 O  O   . HOH SA 11 .   A 34.595  7.989   8.566   1.00 24.95 ? 923  HOH D O   1 
HETATM 10230 O  O   . HOH SA 11 .   B 11.663  22.264  13.429  1.00 31.87 ? 924  HOH D O   1 
HETATM 10231 O  O   . HOH SA 11 .   B 36.574  25.488  17.019  1.00 22.68 ? 925  HOH D O   1 
HETATM 10232 O  O   . HOH SA 11 .   B 12.081  12.566  6.919   1.00 6.03  ? 926  HOH D O   1 
HETATM 10233 O  O   . HOH SA 11 .   B 36.179  29.891  47.533  1.00 25.39 ? 927  HOH D O   1 
HETATM 10234 O  O   . HOH SA 11 .   B 51.234  18.861  31.186  1.00 22.93 ? 928  HOH D O   1 
HETATM 10235 O  O   . HOH SA 11 .   B 44.994  20.183  26.112  1.00 22.03 ? 929  HOH D O   1 
HETATM 10236 O  O   . HOH SA 11 .   B 43.172  23.776  34.257  1.00 28.73 ? 936  HOH D O   1 
HETATM 10237 O  O   . HOH SA 11 .   B 19.932  -8.748  30.460  1.00 22.08 ? 937  HOH D O   1 
HETATM 10238 O  O   . HOH SA 11 .   A 21.217  -14.766 19.677  1.00 9.36  ? 938  HOH D O   1 
HETATM 10239 O  O   . HOH SA 11 .   B 17.175  -9.336  24.991  1.00 8.60  ? 938  HOH D O   1 
HETATM 10240 O  O   . HOH SA 11 .   B 13.294  16.871  57.771  1.00 26.79 ? 939  HOH D O   1 
HETATM 10241 O  O   . HOH SA 11 .   B 27.919  15.250  17.401  1.00 22.42 ? 940  HOH D O   1 
HETATM 10242 O  O   . HOH SA 11 .   B 6.308   35.085  29.349  1.00 21.32 ? 941  HOH D O   1 
HETATM 10243 O  O   . HOH SA 11 .   B 37.921  1.160   52.439  1.00 22.96 ? 943  HOH D O   1 
HETATM 10244 O  O   . HOH SA 11 .   B 20.741  2.194   41.432  1.00 17.39 ? 945  HOH D O   1 
HETATM 10245 O  O   . HOH SA 11 .   B 23.561  1.872   40.934  1.00 23.65 ? 946  HOH D O   1 
HETATM 10246 O  O   . HOH SA 11 .   B -0.951  24.046  43.011  1.00 24.69 ? 948  HOH D O   1 
HETATM 10247 O  O   . HOH SA 11 .   B 13.813  25.733  53.462  1.00 30.21 ? 950  HOH D O   1 
HETATM 10248 O  O   . HOH SA 11 .   B 26.165  25.890  20.283  1.00 10.15 ? 951  HOH D O   1 
HETATM 10249 O  O   . HOH SA 11 .   B 21.159  -0.822  17.741  1.00 26.29 ? 953  HOH D O   1 
HETATM 10250 O  O   . HOH SA 11 .   B 33.878  28.030  26.734  1.00 12.10 ? 955  HOH D O   1 
HETATM 10251 O  O   . HOH SA 11 .   B 17.828  24.851  58.034  1.00 34.41 ? 956  HOH D O   1 
HETATM 10252 O  O   . HOH SA 11 .   B 42.633  26.028  23.250  1.00 17.52 ? 958  HOH D O   1 
HETATM 10253 O  O   . HOH SA 11 .   B 28.810  28.032  15.370  1.00 15.17 ? 959  HOH D O   1 
HETATM 10254 O  O   . HOH SA 11 .   B 60.240  7.053   23.278  1.00 21.73 ? 960  HOH D O   1 
HETATM 10255 O  O   . HOH SA 11 .   B 13.106  37.090  33.705  1.00 27.35 ? 962  HOH D O   1 
HETATM 10256 O  O   . HOH SA 11 .   B 17.351  14.517  8.374   1.00 19.03 ? 963  HOH D O   1 
HETATM 10257 O  O   . HOH SA 11 .   B 18.756  -2.312  54.306  1.00 24.56 ? 964  HOH D O   1 
HETATM 10258 O  O   . HOH SA 11 .   B -7.547  21.656  30.357  1.00 27.76 ? 966  HOH D O   1 
HETATM 10259 O  O   . HOH SA 11 .   B 20.416  1.928   46.130  1.00 35.00 ? 967  HOH D O   1 
HETATM 10260 O  O   . HOH SA 11 .   B 57.557  15.981  30.986  1.00 14.22 ? 968  HOH D O   1 
HETATM 10261 O  O   . HOH SA 11 .   B 50.217  -2.617  20.543  1.00 26.95 ? 969  HOH D O   1 
HETATM 10262 O  O   . HOH SA 11 .   B 10.318  12.314  8.730   1.00 35.00 ? 970  HOH D O   1 
HETATM 10263 O  O   . HOH SA 11 .   B 8.575   30.205  15.647  1.00 21.87 ? 971  HOH D O   1 
HETATM 10264 O  O   . HOH SA 11 .   B 25.093  -11.948 43.247  1.00 24.00 ? 973  HOH D O   1 
HETATM 10265 O  O   . HOH SA 11 .   B 19.751  28.705  17.070  1.00 27.82 ? 974  HOH D O   1 
HETATM 10266 O  O   . HOH SA 11 .   B 25.920  -3.234  43.705  1.00 27.83 ? 975  HOH D O   1 
HETATM 10267 O  O   . HOH SA 11 .   B 9.988   17.976  59.134  1.00 23.19 ? 976  HOH D O   1 
HETATM 10268 O  O   . HOH SA 11 .   B 16.835  1.354   43.172  1.00 33.03 ? 977  HOH D O   1 
HETATM 10269 O  O   . HOH SA 11 .   B 28.057  -14.172 20.655  1.00 31.13 ? 979  HOH D O   1 
HETATM 10270 O  O   . HOH SA 11 .   B 26.890  29.545  26.078  1.00 30.42 ? 980  HOH D O   1 
HETATM 10271 O  O   . HOH SA 11 .   B 23.192  -11.007 34.675  1.00 26.38 ? 981  HOH D O   1 
HETATM 10272 O  O   . HOH SA 11 .   B 25.337  26.714  13.294  1.00 14.86 ? 982  HOH D O   1 
HETATM 10273 O  O   . HOH SA 11 .   B 28.482  -2.939  44.478  1.00 26.88 ? 983  HOH D O   1 
HETATM 10274 O  O   . HOH SA 11 .   B 50.331  2.196   45.923  1.00 27.87 ? 984  HOH D O   1 
HETATM 10275 O  O   . HOH SA 11 .   B 30.930  -15.421 30.954  1.00 21.55 ? 986  HOH D O   1 
HETATM 10276 O  O   . HOH SA 11 .   B 31.202  -17.926 31.915  1.00 27.97 ? 987  HOH D O   1 
HETATM 10277 O  O   . HOH SA 11 .   B 30.392  -12.646 34.858  1.00 36.17 ? 988  HOH D O   1 
HETATM 10278 O  O   . HOH SA 11 .   B 27.943  -15.329 31.041  1.00 41.67 ? 989  HOH D O   1 
HETATM 10279 O  O   . HOH SA 11 .   B -8.989  20.381  36.332  1.00 32.58 ? 1200 HOH D O   1 
HETATM 10280 O  O   . HOH SA 11 .   B 31.709  27.049  15.454  1.00 19.93 ? 1202 HOH D O   1 
HETATM 10281 O  O   . HOH SA 11 .   B 50.834  -4.370  41.115  1.00 20.50 ? 1203 HOH D O   1 
HETATM 10282 O  O   . HOH SA 11 .   B 55.529  -4.621  44.495  1.00 25.67 ? 1204 HOH D O   1 
HETATM 10283 O  O   . HOH SA 11 .   B 50.979  -0.839  45.498  1.00 32.62 ? 1205 HOH D O   1 
HETATM 10284 O  O   . HOH SA 11 .   B 51.801  -6.430  33.905  1.00 28.59 ? 1206 HOH D O   1 
HETATM 10285 O  O   . HOH SA 11 .   B 51.106  -8.075  49.128  1.00 17.51 ? 1207 HOH D O   1 
HETATM 10286 O  O   . HOH SA 11 .   B 29.005  29.715  29.788  1.00 26.93 ? 1208 HOH D O   1 
HETATM 10287 O  O   . HOH SA 11 .   B 57.671  10.271  15.877  1.00 17.80 ? 1210 HOH D O   1 
HETATM 10288 O  O   . HOH SA 11 .   B 47.636  -10.384 43.061  1.00 23.91 ? 1211 HOH D O   1 
HETATM 10289 O  O   . HOH SA 11 .   B 41.214  16.216  13.480  1.00 24.21 ? 1212 HOH D O   1 
HETATM 10290 O  O   . HOH SA 11 .   B 57.184  12.863  21.038  1.00 12.56 ? 1214 HOH D O   1 
HETATM 10291 O  O   . HOH SA 11 .   B 59.364  11.326  21.172  1.00 23.18 ? 1215 HOH D O   1 
HETATM 10292 O  O   . HOH SA 11 .   B 11.636  16.018  10.977  1.00 24.72 ? 1216 HOH D O   1 
HETATM 10293 O  O   . HOH SA 11 .   B -3.600  12.800  28.142  1.00 28.44 ? 1217 HOH D O   1 
HETATM 10294 O  O   . HOH SA 11 .   B 58.413  2.329   26.606  1.00 24.30 ? 1218 HOH D O   1 
HETATM 10295 O  O   . HOH SA 11 .   B 54.448  -0.866  22.960  1.00 15.59 ? 1219 HOH D O   1 
HETATM 10296 O  O   . HOH SA 11 .   B 6.852   20.283  20.573  1.00 23.34 ? 1220 HOH D O   1 
HETATM 10297 O  O   . HOH SA 11 .   B 40.826  -12.319 44.131  1.00 13.46 ? 1223 HOH D O   1 
HETATM 10298 O  O   . HOH SA 11 .   B 33.511  25.858  52.050  1.00 23.49 ? 1224 HOH D O   1 
HETATM 10299 O  O   . HOH SA 11 .   B 57.506  14.446  33.579  1.00 26.33 ? 1225 HOH D O   1 
HETATM 10300 O  O   . HOH SA 11 .   B 55.117  -2.946  31.318  1.00 12.44 ? 1227 HOH D O   1 
HETATM 10301 O  O   . HOH SA 11 .   B 50.795  16.131  21.202  1.00 15.30 ? 1228 HOH D O   1 
HETATM 10302 O  O   . HOH SA 11 .   B 48.217  -11.109 50.661  1.00 26.05 ? 1229 HOH D O   1 
HETATM 10303 O  O   . HOH SA 11 .   B 36.991  -1.153  53.419  1.00 13.75 ? 1230 HOH D O   1 
HETATM 10304 O  O   . HOH SA 11 .   B 39.672  -1.934  53.041  1.00 14.39 ? 1231 HOH D O   1 
HETATM 10305 O  O   . HOH SA 11 .   B 51.206  8.716   40.689  1.00 27.98 ? 1232 HOH D O   1 
HETATM 10306 O  O   . HOH SA 11 .   B 35.524  31.543  40.831  1.00 23.46 ? 1235 HOH D O   1 
HETATM 10307 O  O   . HOH SA 11 .   B 34.332  34.579  40.151  1.00 30.57 ? 1236 HOH D O   1 
HETATM 10308 O  O   . HOH SA 11 .   B 44.464  -14.604 45.024  1.00 26.47 ? 1238 HOH D O   1 
HETATM 10309 O  O   . HOH SA 11 .   B 37.518  -17.457 39.693  1.00 26.42 ? 1240 HOH D O   1 
HETATM 10310 O  O   . HOH SA 11 .   B 59.281  8.533   20.250  1.00 19.43 ? 1241 HOH D O   1 
HETATM 10311 O  O   . HOH SA 11 .   B 52.185  -3.273  38.878  1.00 21.12 ? 1242 HOH D O   1 
HETATM 10312 O  O   . HOH SA 11 .   B 51.601  -3.600  34.384  1.00 31.38 ? 1243 HOH D O   1 
HETATM 10313 O  O   . HOH SA 11 .   A 22.956  -2.547  16.097  1.00 23.17 ? 1245 HOH D O   1 
HETATM 10314 O  O   . HOH SA 11 .   B 37.094  -7.762  53.294  1.00 31.41 ? 1247 HOH D O   1 
HETATM 10315 O  O   . HOH SA 11 .   B 24.549  36.219  52.936  1.00 25.00 ? 1248 HOH D O   1 
HETATM 10316 O  O   . HOH SA 11 .   B 32.168  24.054  55.258  1.00 21.89 ? 1249 HOH D O   1 
HETATM 10317 O  O   . HOH SA 11 .   B 22.453  25.386  21.862  1.00 26.90 ? 1250 HOH D O   1 
HETATM 10318 O  O   . HOH SA 11 .   B -6.841  28.015  30.328  1.00 27.86 ? 1251 HOH D O   1 
HETATM 10319 O  O   . HOH SA 11 .   B 52.611  -4.077  51.201  1.00 28.27 ? 1252 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   1   1   CYS CYS A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   GLN 4   4   4   GLN GLN A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  TRP 32  32  32  TRP TRP A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  TRP 47  47  47  TRP TRP A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  TRP 89  89  89  TRP TRP A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
B 2 1   VAL 1   113 113 VAL VAL C . n 
B 2 2   ASN 2   114 114 ASN ASN C . n 
B 2 3   CYS 3   115 115 CYS CYS C . n 
B 2 4   GLU 4   116 116 GLU GLU C . n 
B 2 5   THR 5   117 117 THR THR C . n 
B 2 6   SER 6   118 118 SER SER C . n 
B 2 7   CYS 7   119 119 CYS CYS C . n 
B 2 8   VAL 8   120 120 VAL VAL C . n 
B 2 9   GLN 9   121 121 GLN GLN C . n 
B 2 10  GLN 10  122 122 GLN GLN C . n 
B 2 11  PRO 11  123 123 PRO PRO C . n 
B 2 12  PRO 12  124 124 PRO PRO C . n 
B 2 13  CYS 13  125 125 CYS CYS C . n 
B 2 14  PHE 14  126 126 PHE PHE C . n 
B 2 15  PRO 15  127 127 PRO PRO C . n 
B 2 16  LEU 16  128 128 LEU LEU C . n 
B 2 17  LYS 17  129 129 LYS LYS C . n 
B 2 18  ILE 18  130 130 ILE ILE C . n 
B 2 19  PRO 19  131 131 PRO PRO C . n 
B 2 20  PRO 20  132 132 PRO PRO C . n 
B 2 21  ASN 21  133 133 ASN ASN C . n 
B 2 22  ASP 22  134 134 ASP ASP C . n 
B 2 23  PRO 23  135 135 PRO PRO C . n 
B 2 24  ARG 24  136 136 ARG ARG C . n 
B 2 25  ILE 25  137 137 ILE ILE C . n 
B 2 26  LYS 26  138 138 LYS LYS C . n 
B 2 27  ASN 27  139 139 ASN ASN C . n 
B 2 28  GLN 28  140 140 GLN GLN C . n 
B 2 29  ALA 29  141 141 ALA ALA C . n 
B 2 30  ASP 30  142 142 ASP ASP C . n 
B 2 31  CYS 31  143 143 CYS CYS C . n 
B 2 32  ILE 32  144 144 ILE ILE C . n 
B 2 33  PRO 33  145 145 PRO PRO C . n 
B 2 34  PHE 34  146 146 PHE PHE C . n 
B 2 35  PHE 35  147 147 PHE PHE C . n 
B 2 36  ARG 36  148 148 ARG ARG C . n 
B 2 37  SER 37  149 149 SER SER C . n 
B 2 38  CSO 38  150 150 CSO CEA C . n 
B 2 39  PRO 39  151 151 PRO PRO C . n 
B 2 40  ALA 40  152 152 ALA ALA C . n 
B 2 41  CYS 41  153 153 CYS CYS C . n 
B 2 42  PRO 42  154 154 PRO PRO C . n 
B 2 43  GLY 43  155 155 GLY GLY C . n 
B 2 44  SER 44  156 156 SER SER C . n 
B 2 45  ASN 45  157 157 ASN ASN C . n 
B 2 46  ILE 46  158 158 ILE ILE C . n 
B 2 47  THR 47  159 159 THR THR C . n 
B 2 48  ILE 48  160 160 ILE ILE C . n 
B 2 49  ARG 49  161 161 ARG ARG C . n 
B 2 50  ASN 50  162 162 ASN ASN C . n 
B 2 51  GLN 51  163 163 GLN GLN C . n 
B 2 52  ILE 52  164 164 ILE ILE C . n 
B 2 53  ASN 53  165 165 ASN ASN C . n 
B 2 54  ALA 54  166 166 ALA ALA C . n 
B 2 55  LEU 55  167 167 LEU LEU C . n 
B 2 56  THR 56  168 168 THR THR C . n 
B 2 57  SER 57  169 169 SER SER C . n 
B 2 58  PHE 58  170 170 PHE PHE C . n 
B 2 59  VAL 59  171 171 VAL VAL C . n 
B 2 60  ASP 60  172 172 ASP ASP C . n 
B 2 61  ALA 61  173 173 ALA ALA C . n 
B 2 62  SER 62  174 174 SER SER C . n 
B 2 63  MET 63  175 175 MET MET C . n 
B 2 64  VAL 64  176 176 VAL VAL C . n 
B 2 65  TYR 65  177 177 TYR TYR C . n 
B 2 66  GLY 66  178 178 GLY GLY C . n 
B 2 67  SER 67  179 179 SER SER C . n 
B 2 68  GLU 68  180 180 GLU GLU C . n 
B 2 69  GLU 69  181 181 GLU GLU C . n 
B 2 70  PRO 70  182 182 PRO PRO C . n 
B 2 71  LEU 71  183 183 LEU LEU C . n 
B 2 72  ALA 72  184 184 ALA ALA C . n 
B 2 73  ARG 73  185 185 ARG ARG C . n 
B 2 74  ASN 74  186 186 ASN ASN C . n 
B 2 75  LEU 75  187 187 LEU LEU C . n 
B 2 76  ARG 76  188 188 ARG ARG C . n 
B 2 77  ASN 77  189 189 ASN ASN C . n 
B 2 78  MET 78  190 190 MET MET C . n 
B 2 79  SER 79  191 191 SER SER C . n 
B 2 80  ASN 80  192 192 ASN ASN C . n 
B 2 81  GLN 81  193 193 GLN GLN C . n 
B 2 82  LEU 82  194 194 LEU LEU C . n 
B 2 83  GLY 83  195 195 GLY GLY C . n 
B 2 84  LEU 84  196 196 LEU LEU C . n 
B 2 85  LEU 85  197 197 LEU LEU C . n 
B 2 86  ALA 86  198 198 ALA ALA C . n 
B 2 87  VAL 87  199 199 VAL VAL C . n 
B 2 88  ASN 88  200 200 ASN ASN C . n 
B 2 89  GLN 89  201 201 GLN GLN C . n 
B 2 90  ARG 90  202 202 ARG ARG C . n 
B 2 91  PHE 91  203 203 PHE PHE C . n 
B 2 92  GLN 92  204 204 GLN GLN C . n 
B 2 93  ASP 93  205 205 ASP ASP C . n 
B 2 94  ASN 94  206 206 ASN ASN C . n 
B 2 95  GLY 95  207 207 GLY GLY C . n 
B 2 96  ARG 96  208 208 ARG ARG C . n 
B 2 97  ALA 97  209 209 ALA ALA C . n 
B 2 98  LEU 98  210 210 LEU LEU C . n 
B 2 99  LEU 99  211 211 LEU LEU C . n 
B 2 100 PRO 100 212 212 PRO PRO C . n 
B 2 101 PHE 101 213 213 PHE PHE C . n 
B 2 102 ASP 102 214 214 ASP ASP C . n 
B 2 103 ASN 103 215 215 ASN ASN C . n 
B 2 104 LEU 104 216 216 LEU LEU C . n 
B 2 105 HIS 105 217 217 HIS HIS C . n 
B 2 106 ASP 106 218 218 ASP ASP C . n 
B 2 107 ASP 107 219 219 ASP ASP C . n 
B 2 108 PRO 108 220 220 PRO PRO C . n 
B 2 109 CYS 109 221 221 CYS CYS C . n 
B 2 110 LEU 110 222 222 LEU LEU C . n 
B 2 111 LEU 111 223 223 LEU LEU C . n 
B 2 112 THR 112 224 224 THR THR C . n 
B 2 113 ASN 113 225 225 ASN ASN C . n 
B 2 114 ARG 114 226 226 ARG ARG C . n 
B 2 115 SER 115 227 227 SER SER C . n 
B 2 116 ALA 116 228 228 ALA ALA C . n 
B 2 117 ARG 117 229 229 ARG ARG C . n 
B 2 118 ILE 118 230 230 ILE ILE C . n 
B 2 119 PRO 119 231 231 PRO PRO C . n 
B 2 120 CYS 120 232 232 CYS CYS C . n 
B 2 121 PHE 121 233 233 PHE PHE C . n 
B 2 122 LEU 122 234 234 LEU LEU C . n 
B 2 123 ALA 123 235 235 ALA ALA C . n 
B 2 124 GLY 124 236 236 GLY GLY C . n 
B 2 125 ASP 125 237 237 ASP ASP C . n 
B 2 126 THR 126 238 238 THR THR C . n 
B 2 127 ARG 127 239 239 ARG ARG C . n 
B 2 128 SER 128 240 240 SER SER C . n 
B 2 129 SER 129 241 241 SER SER C . n 
B 2 130 GLU 130 242 242 GLU GLU C . n 
B 2 131 MET 131 243 243 MET MET C . n 
B 2 132 PRO 132 244 244 PRO PRO C . n 
B 2 133 GLU 133 245 245 GLU GLU C . n 
B 2 134 LEU 134 246 246 LEU LEU C . n 
B 2 135 THR 135 247 247 THR THR C . n 
B 2 136 SER 136 248 248 SER SER C . n 
B 2 137 MET 137 249 249 MET MET C . n 
B 2 138 HIS 138 250 250 HIS HIS C . n 
B 2 139 THR 139 251 251 THR THR C . n 
B 2 140 LEU 140 252 252 LEU LEU C . n 
B 2 141 LEU 141 253 253 LEU LEU C . n 
B 2 142 LEU 142 254 254 LEU LEU C . n 
B 2 143 ARG 143 255 255 ARG ARG C . n 
B 2 144 GLU 144 256 256 GLU GLU C . n 
B 2 145 HIS 145 257 257 HIS HIS C . n 
B 2 146 ASN 146 258 258 ASN ASN C . n 
B 2 147 ARG 147 259 259 ARG ARG C . n 
B 2 148 LEU 148 260 260 LEU LEU C . n 
B 2 149 ALA 149 261 261 ALA ALA C . n 
B 2 150 THR 150 262 262 THR THR C . n 
B 2 151 GLU 151 263 263 GLU GLU C . n 
B 2 152 LEU 152 264 264 LEU LEU C . n 
B 2 153 LYS 153 265 265 LYS LYS C . n 
B 2 154 SER 154 266 266 SER SER C . n 
B 2 155 LEU 155 267 267 LEU LEU C . n 
B 2 156 ASN 156 268 268 ASN ASN C . n 
B 2 157 PRO 157 269 269 PRO PRO C . n 
B 2 158 ARG 158 270 270 ARG ARG C . n 
B 2 159 TRP 159 271 271 TRP TRP C . n 
B 2 160 ASP 160 272 272 ASP ASP C . n 
B 2 161 GLY 161 273 273 GLY GLY C . n 
B 2 162 GLU 162 274 274 GLU GLU C . n 
B 2 163 ARG 163 275 275 ARG ARG C . n 
B 2 164 LEU 164 276 276 LEU LEU C . n 
B 2 165 TYR 165 277 277 TYR TYR C . n 
B 2 166 GLN 166 278 278 GLN GLN C . n 
B 2 167 GLU 167 279 279 GLU GLU C . n 
B 2 168 ALA 168 280 280 ALA ALA C . n 
B 2 169 ARG 169 281 281 ARG ARG C . n 
B 2 170 LYS 170 282 282 LYS LYS C . n 
B 2 171 ILE 171 283 283 ILE ILE C . n 
B 2 172 VAL 172 284 284 VAL VAL C . n 
B 2 173 GLY 173 285 285 GLY GLY C . n 
B 2 174 ALA 174 286 286 ALA ALA C . n 
B 2 175 MET 175 287 287 MET MET C . n 
B 2 176 VAL 176 288 288 VAL VAL C . n 
B 2 177 GLN 177 289 289 GLN GLN C . n 
B 2 178 ILE 178 290 290 ILE ILE C . n 
B 2 179 ILE 179 291 291 ILE ILE C . n 
B 2 180 THR 180 292 292 THR THR C . n 
B 2 181 TYR 181 293 293 TYR TYR C . n 
B 2 182 ARG 182 294 294 ARG ARG C . n 
B 2 183 ASP 183 295 295 ASP ASP C . n 
B 2 184 TYR 184 296 296 TYR TYR C . n 
B 2 185 LEU 185 297 297 LEU LEU C . n 
B 2 186 PRO 186 298 298 PRO PRO C . n 
B 2 187 LEU 187 299 299 LEU LEU C . n 
B 2 188 VAL 188 300 300 VAL VAL C . n 
B 2 189 LEU 189 301 301 LEU LEU C . n 
B 2 190 GLY 190 302 302 GLY GLY C . n 
B 2 191 PRO 191 303 303 PRO PRO C . n 
B 2 192 THR 192 304 304 THR THR C . n 
B 2 193 ALA 193 305 305 ALA ALA C . n 
B 2 194 MET 194 306 306 MET MET C . n 
B 2 195 ARG 195 307 307 ARG ARG C . n 
B 2 196 LYS 196 308 308 LYS LYS C . n 
B 2 197 TYR 197 309 309 TYR TYR C . n 
B 2 198 LEU 198 310 310 LEU LEU C . n 
B 2 199 PRO 199 311 311 PRO PRO C . n 
B 2 200 THR 200 312 312 THR THR C . n 
B 2 201 TYR 201 313 313 TYR TYR C . n 
B 2 202 ARG 202 314 314 ARG ARG C . n 
B 2 203 SER 203 315 315 SER SER C . n 
B 2 204 TYR 204 316 316 TYR TYR C . n 
B 2 205 ASN 205 317 317 ASN ASN C . n 
B 2 206 ASP 206 318 318 ASP ASP C . n 
B 2 207 SER 207 319 319 SER SER C . n 
B 2 208 VAL 208 320 320 VAL VAL C . n 
B 2 209 ASP 209 321 321 ASP ASP C . n 
B 2 210 PRO 210 322 322 PRO PRO C . n 
B 2 211 ARG 211 323 323 ARG ARG C . n 
B 2 212 ILE 212 324 324 ILE ILE C . n 
B 2 213 ALA 213 325 325 ALA ALA C . n 
B 2 214 ASN 214 326 326 ASN ASN C . n 
B 2 215 VAL 215 327 327 VAL VAL C . n 
B 2 216 PHE 216 328 328 PHE PHE C . n 
B 2 217 THR 217 329 329 THR THR C . n 
B 2 218 ASN 218 330 330 ASN ASN C . n 
B 2 219 ALA 219 331 331 ALA ALA C . n 
B 2 220 PHE 220 332 332 PHE PHE C . n 
B 2 221 ARG 221 333 333 ARG ARG C . n 
B 2 222 TYR 222 334 334 TYR TYR C . n 
B 2 223 GLY 223 335 335 GLY GLY C . n 
B 2 224 HIS 224 336 336 HIS HIS C . n 
B 2 225 THR 225 337 337 THR THR C . n 
B 2 226 LEU 226 338 338 LEU LEU C . n 
B 2 227 ILE 227 339 339 ILE ILE C . n 
B 2 228 GLN 228 340 340 GLN GLN C . n 
B 2 229 PRO 229 341 341 PRO PRO C . n 
B 2 230 PHE 230 342 342 PHE PHE C . n 
B 2 231 MET 231 343 343 MET MET C . n 
B 2 232 PHE 232 344 344 PHE PHE C . n 
B 2 233 ARG 233 345 345 ARG ARG C . n 
B 2 234 LEU 234 346 346 LEU LEU C . n 
B 2 235 ASP 235 347 347 ASP ASP C . n 
B 2 236 ASN 236 348 348 ASN ASN C . n 
B 2 237 ARG 237 349 349 ARG ARG C . n 
B 2 238 TYR 238 350 350 TYR TYR C . n 
B 2 239 GLN 239 351 351 GLN GLN C . n 
B 2 240 PRO 240 352 352 PRO PRO C . n 
B 2 241 MET 241 353 353 MET MET C . n 
B 2 242 GLU 242 354 354 GLU GLU C . n 
B 2 243 PRO 243 355 355 PRO PRO C . n 
B 2 244 ASN 244 356 356 ASN ASN C . n 
B 2 245 PRO 245 357 357 PRO PRO C . n 
B 2 246 ARG 246 358 358 ARG ARG C . n 
B 2 247 VAL 247 359 359 VAL VAL C . n 
B 2 248 PRO 248 360 360 PRO PRO C . n 
B 2 249 LEU 249 361 361 LEU LEU C . n 
B 2 250 SER 250 362 362 SER SER C . n 
B 2 251 ARG 251 363 363 ARG ARG C . n 
B 2 252 VAL 252 364 364 VAL VAL C . n 
B 2 253 PHE 253 365 365 PHE PHE C . n 
B 2 254 PHE 254 366 366 PHE PHE C . n 
B 2 255 ALA 255 367 367 ALA ALA C . n 
B 2 256 SER 256 368 368 SER SER C . n 
B 2 257 TRP 257 369 369 TRP TRP C . n 
B 2 258 ARG 258 370 370 ARG ARG C . n 
B 2 259 VAL 259 371 371 VAL VAL C . n 
B 2 260 VAL 260 372 372 VAL VAL C . n 
B 2 261 LEU 261 373 373 LEU LEU C . n 
B 2 262 GLU 262 374 374 GLU GLU C . n 
B 2 263 GLY 263 375 375 GLY GLY C . n 
B 2 264 GLY 264 376 376 GLY GLY C . n 
B 2 265 ILE 265 377 377 ILE ILE C . n 
B 2 266 ASP 266 378 378 ASP ASP C . n 
B 2 267 PRO 267 379 379 PRO PRO C . n 
B 2 268 ILE 268 380 380 ILE ILE C . n 
B 2 269 LEU 269 381 381 LEU LEU C . n 
B 2 270 ARG 270 382 382 ARG ARG C . n 
B 2 271 GLY 271 383 383 GLY GLY C . n 
B 2 272 LEU 272 384 384 LEU LEU C . n 
B 2 273 MET 273 385 385 MET MET C . n 
B 2 274 ALA 274 386 386 ALA ALA C . n 
B 2 275 THR 275 387 387 THR THR C . n 
B 2 276 PRO 276 388 388 PRO PRO C . n 
B 2 277 ALA 277 389 389 ALA ALA C . n 
B 2 278 LYS 278 390 390 LYS LYS C . n 
B 2 279 LEU 279 391 391 LEU LEU C . n 
B 2 280 ASN 280 392 392 ASN ASN C . n 
B 2 281 ARG 281 393 393 ARG ARG C . n 
B 2 282 GLN 282 394 394 GLN GLN C . n 
B 2 283 ASN 283 395 395 ASN ASN C . n 
B 2 284 GLN 284 396 396 GLN GLN C . n 
B 2 285 ILE 285 397 397 ILE ILE C . n 
B 2 286 ALA 286 398 398 ALA ALA C . n 
B 2 287 VAL 287 399 399 VAL VAL C . n 
B 2 288 ASP 288 400 400 ASP ASP C . n 
B 2 289 GLU 289 401 401 GLU GLU C . n 
B 2 290 ILE 290 402 402 ILE ILE C . n 
B 2 291 ARG 291 403 403 ARG ARG C . n 
B 2 292 GLU 292 404 404 GLU GLU C . n 
B 2 293 ARG 293 405 405 ARG ARG C . n 
B 2 294 LEU 294 406 406 LEU LEU C . n 
B 2 295 PHE 295 407 407 PHE PHE C . n 
B 2 296 GLU 296 408 408 GLU GLU C . n 
B 2 297 GLN 297 409 409 GLN GLN C . n 
B 2 298 VAL 298 410 410 VAL VAL C . n 
B 2 299 MET 299 411 411 MET MET C . n 
B 2 300 ARG 300 412 412 ARG ARG C . n 
B 2 301 ILE 301 413 413 ILE ILE C . n 
B 2 302 GLY 302 414 414 GLY GLY C . n 
B 2 303 LEU 303 415 415 LEU LEU C . n 
B 2 304 ASP 304 416 416 ASP ASP C . n 
B 2 305 LEU 305 417 417 LEU LEU C . n 
B 2 306 PRO 306 418 418 PRO PRO C . n 
B 2 307 ALA 307 419 419 ALA ALA C . n 
B 2 308 LEU 308 420 420 LEU LEU C . n 
B 2 309 ASN 309 421 421 ASN ASN C . n 
B 2 310 MET 310 422 422 MET MET C . n 
B 2 311 GLN 311 423 423 GLN GLN C . n 
B 2 312 ARG 312 424 424 ARG ARG C . n 
B 2 313 SER 313 425 425 SER SER C . n 
B 2 314 ARG 314 426 426 ARG ARG C . n 
B 2 315 ASP 315 427 427 ASP ASP C . n 
B 2 316 HIS 316 428 428 HIS HIS C . n 
B 2 317 GLY 317 429 429 GLY GLY C . n 
B 2 318 LEU 318 430 430 LEU LEU C . n 
B 2 319 PRO 319 431 431 PRO PRO C . n 
B 2 320 GLY 320 432 432 GLY GLY C . n 
B 2 321 TYR 321 433 433 TYR TYR C . n 
B 2 322 ASN 322 434 434 ASN ASN C . n 
B 2 323 ALA 323 435 435 ALA ALA C . n 
B 2 324 TRP 324 436 436 TRP TRP C . n 
B 2 325 ARG 325 437 437 ARG ARG C . n 
B 2 326 ARG 326 438 438 ARG ARG C . n 
B 2 327 PHE 327 439 439 PHE PHE C . n 
B 2 328 CYS 328 440 440 CYS CYS C . n 
B 2 329 GLY 329 441 441 GLY GLY C . n 
B 2 330 LEU 330 442 442 LEU LEU C . n 
B 2 331 PRO 331 443 443 PRO PRO C . n 
B 2 332 GLN 332 444 444 GLN GLN C . n 
B 2 333 PRO 333 445 445 PRO PRO C . n 
B 2 334 GLU 334 446 446 GLU GLU C . n 
B 2 335 THR 335 447 447 THR THR C . n 
B 2 336 VAL 336 448 448 VAL VAL C . n 
B 2 337 GLY 337 449 449 GLY GLY C . n 
B 2 338 GLN 338 450 450 GLN GLN C . n 
B 2 339 LEU 339 451 451 LEU LEU C . n 
B 2 340 GLY 340 452 452 GLY GLY C . n 
B 2 341 THR 341 453 453 THR THR C . n 
B 2 342 VAL 342 454 454 VAL VAL C . n 
B 2 343 LEU 343 455 455 LEU LEU C . n 
B 2 344 ARG 344 456 456 ARG ARG C . n 
B 2 345 ASN 345 457 457 ASN ASN C . n 
B 2 346 LEU 346 458 458 LEU LEU C . n 
B 2 347 LYS 347 459 459 LYS LYS C . n 
B 2 348 LEU 348 460 460 LEU LEU C . n 
B 2 349 ALA 349 461 461 ALA ALA C . n 
B 2 350 ARG 350 462 462 ARG ARG C . n 
B 2 351 LYS 351 463 463 LYS LYS C . n 
B 2 352 LEU 352 464 464 LEU LEU C . n 
B 2 353 MET 353 465 465 MET MET C . n 
B 2 354 GLU 354 466 466 GLU GLU C . n 
B 2 355 GLN 355 467 467 GLN GLN C . n 
B 2 356 TYR 356 468 468 TYR TYR C . n 
B 2 357 GLY 357 469 469 GLY GLY C . n 
B 2 358 THR 358 470 470 THR THR C . n 
B 2 359 PRO 359 471 471 PRO PRO C . n 
B 2 360 ASN 360 472 472 ASN ASN C . n 
B 2 361 ASN 361 473 473 ASN ASN C . n 
B 2 362 ILE 362 474 474 ILE ILE C . n 
B 2 363 ASP 363 475 475 ASP ASP C . n 
B 2 364 ILE 364 476 476 ILE ILE C . n 
B 2 365 TRP 365 477 477 TRP TRP C . n 
B 2 366 MET 366 478 478 MET MET C . n 
B 2 367 GLY 367 479 479 GLY GLY C . n 
B 2 368 GLY 368 480 480 GLY GLY C . n 
B 2 369 VAL 369 481 481 VAL VAL C . n 
B 2 370 SER 370 482 482 SER SER C . n 
B 2 371 GLU 371 483 483 GLU GLU C . n 
B 2 372 PRO 372 484 484 PRO PRO C . n 
B 2 373 LEU 373 485 485 LEU LEU C . n 
B 2 374 LYS 374 486 486 LYS LYS C . n 
B 2 375 ARG 375 487 487 ARG ARG C . n 
B 2 376 LYS 376 488 488 LYS LYS C . n 
B 2 377 GLY 377 489 489 GLY GLY C . n 
B 2 378 ARG 378 490 490 ARG ARG C . n 
B 2 379 VAL 379 491 491 VAL VAL C . n 
B 2 380 GLY 380 492 492 GLY GLY C . n 
B 2 381 PRO 381 493 493 PRO PRO C . n 
B 2 382 LEU 382 494 494 LEU LEU C . n 
B 2 383 LEU 383 495 495 LEU LEU C . n 
B 2 384 ALA 384 496 496 ALA ALA C . n 
B 2 385 CYS 385 497 497 CYS CYS C . n 
B 2 386 ILE 386 498 498 ILE ILE C . n 
B 2 387 ILE 387 499 499 ILE ILE C . n 
B 2 388 GLY 388 500 500 GLY GLY C . n 
B 2 389 THR 389 501 501 THR THR C . n 
B 2 390 GLN 390 502 502 GLN GLN C . n 
B 2 391 PHE 391 503 503 PHE PHE C . n 
B 2 392 ARG 392 504 504 ARG ARG C . n 
B 2 393 LYS 393 505 505 LYS LYS C . n 
B 2 394 LEU 394 506 506 LEU LEU C . n 
B 2 395 ARG 395 507 507 ARG ARG C . n 
B 2 396 ASP 396 508 508 ASP ASP C . n 
B 2 397 GLY 397 509 509 GLY GLY C . n 
B 2 398 ASP 398 510 510 ASP ASP C . n 
B 2 399 ARG 399 511 511 ARG ARG C . n 
B 2 400 PHE 400 512 512 PHE PHE C . n 
B 2 401 TRP 401 513 513 TRP TRP C . n 
B 2 402 TRP 402 514 514 TRP TRP C . n 
B 2 403 GLU 403 515 515 GLU GLU C . n 
B 2 404 ASN 404 516 516 ASN ASN C . n 
B 2 405 GLU 405 517 517 GLU GLU C . n 
B 2 406 GLY 406 518 518 GLY GLY C . n 
B 2 407 VAL 407 519 519 VAL VAL C . n 
B 2 408 PHE 408 520 520 PHE PHE C . n 
B 2 409 SER 409 521 521 SER SER C . n 
B 2 410 MET 410 522 522 MET MET C . n 
B 2 411 GLN 411 523 523 GLN GLN C . n 
B 2 412 GLN 412 524 524 GLN GLN C . n 
B 2 413 ARG 413 525 525 ARG ARG C . n 
B 2 414 GLN 414 526 526 GLN GLN C . n 
B 2 415 ALA 415 527 527 ALA ALA C . n 
B 2 416 LEU 416 528 528 LEU LEU C . n 
B 2 417 ALA 417 529 529 ALA ALA C . n 
B 2 418 GLN 418 530 530 GLN GLN C . n 
B 2 419 ILE 419 531 531 ILE ILE C . n 
B 2 420 SER 420 532 532 SER SER C . n 
B 2 421 LEU 421 533 533 LEU LEU C . n 
B 2 422 PRO 422 534 534 PRO PRO C . n 
B 2 423 ARG 423 535 535 ARG ARG C . n 
B 2 424 ILE 424 536 536 ILE ILE C . n 
B 2 425 ILE 425 537 537 ILE ILE C . n 
B 2 426 CYS 426 538 538 CYS CYS C . n 
B 2 427 ASP 427 539 539 ASP ASP C . n 
B 2 428 ASN 428 540 540 ASN ASN C . n 
B 2 429 THR 429 541 541 THR THR C . n 
B 2 430 GLY 430 542 542 GLY GLY C . n 
B 2 431 ILE 431 543 543 ILE ILE C . n 
B 2 432 THR 432 544 544 THR THR C . n 
B 2 433 THR 433 545 545 THR THR C . n 
B 2 434 VAL 434 546 546 VAL VAL C . n 
B 2 435 SER 435 547 547 SER SER C . n 
B 2 436 LYS 436 548 548 LYS LYS C . n 
B 2 437 ASN 437 549 549 ASN ASN C . n 
B 2 438 ASN 438 550 550 ASN ASN C . n 
B 2 439 ILE 439 551 551 ILE ILE C . n 
B 2 440 PHE 440 552 552 PHE PHE C . n 
B 2 441 MET 441 553 553 MET MET C . n 
B 2 442 SER 442 554 554 SER SER C . n 
B 2 443 ASN 443 555 555 ASN ASN C . n 
B 2 444 SER 444 556 556 SER SER C . n 
B 2 445 TYR 445 557 557 TYR TYR C . n 
B 2 446 PRO 446 558 558 PRO PRO C . n 
B 2 447 ARG 447 559 559 ARG ARG C . n 
B 2 448 ASP 448 560 560 ASP ASP C . n 
B 2 449 PHE 449 561 561 PHE PHE C . n 
B 2 450 VAL 450 562 562 VAL VAL C . n 
B 2 451 ASN 451 563 563 ASN ASN C . n 
B 2 452 CYS 452 564 564 CYS CYS C . n 
B 2 453 SER 453 565 565 SER SER C . n 
B 2 454 THR 454 566 566 THR THR C . n 
B 2 455 LEU 455 567 567 LEU LEU C . n 
B 2 456 PRO 456 568 568 PRO PRO C . n 
B 2 457 ALA 457 569 569 ALA ALA C . n 
B 2 458 LEU 458 570 570 LEU LEU C . n 
B 2 459 ASN 459 571 571 ASN ASN C . n 
B 2 460 LEU 460 572 572 LEU LEU C . n 
B 2 461 ALA 461 573 573 ALA ALA C . n 
B 2 462 SER 462 574 574 SER SER C . n 
B 2 463 TRP 463 575 575 TRP TRP C . n 
B 2 464 ARG 464 576 576 ARG ARG C . n 
B 2 465 GLU 465 577 577 GLU GLU C . n 
B 2 466 ALA 466 578 578 ALA ALA C . n 
C 1 1   CYS 1   1   1   CYS CYS B . n 
C 1 2   PRO 2   2   2   PRO PRO B . n 
C 1 3   GLU 3   3   3   GLU GLU B . n 
C 1 4   GLN 4   4   4   GLN GLN B . n 
C 1 5   ASP 5   5   5   ASP ASP B . n 
C 1 6   LYS 6   6   6   LYS LYS B . n 
C 1 7   TYR 7   7   7   TYR TYR B . n 
C 1 8   ARG 8   8   8   ARG ARG B . n 
C 1 9   THR 9   9   9   THR THR B . n 
C 1 10  ILE 10  10  10  ILE ILE B . n 
C 1 11  THR 11  11  11  THR THR B . n 
C 1 12  GLY 12  12  12  GLY GLY B . n 
C 1 13  MET 13  13  13  MET MET B . n 
C 1 14  CYS 14  14  14  CYS CYS B . n 
C 1 15  ASN 15  15  15  ASN ASN B . n 
C 1 16  ASN 16  16  16  ASN ASN B . n 
C 1 17  ARG 17  17  17  ARG ARG B . n 
C 1 18  ARG 18  18  18  ARG ARG B . n 
C 1 19  SER 19  19  19  SER SER B . n 
C 1 20  PRO 20  20  20  PRO PRO B . n 
C 1 21  THR 21  21  21  THR THR B . n 
C 1 22  LEU 22  22  22  LEU LEU B . n 
C 1 23  GLY 23  23  23  GLY GLY B . n 
C 1 24  ALA 24  24  24  ALA ALA B . n 
C 1 25  SER 25  25  25  SER SER B . n 
C 1 26  ASN 26  26  26  ASN ASN B . n 
C 1 27  ARG 27  27  27  ARG ARG B . n 
C 1 28  ALA 28  28  28  ALA ALA B . n 
C 1 29  PHE 29  29  29  PHE PHE B . n 
C 1 30  VAL 30  30  30  VAL VAL B . n 
C 1 31  ARG 31  31  31  ARG ARG B . n 
C 1 32  TRP 32  32  32  TRP TRP B . n 
C 1 33  LEU 33  33  33  LEU LEU B . n 
C 1 34  PRO 34  34  34  PRO PRO B . n 
C 1 35  ALA 35  35  35  ALA ALA B . n 
C 1 36  GLU 36  36  36  GLU GLU B . n 
C 1 37  TYR 37  37  37  TYR TYR B . n 
C 1 38  GLU 38  38  38  GLU GLU B . n 
C 1 39  ASP 39  39  39  ASP ASP B . n 
C 1 40  GLY 40  40  40  GLY GLY B . n 
C 1 41  PHE 41  41  41  PHE PHE B . n 
C 1 42  SER 42  42  42  SER SER B . n 
C 1 43  LEU 43  43  43  LEU LEU B . n 
C 1 44  PRO 44  44  44  PRO PRO B . n 
C 1 45  TYR 45  45  45  TYR TYR B . n 
C 1 46  GLY 46  46  46  GLY GLY B . n 
C 1 47  TRP 47  47  47  TRP TRP B . n 
C 1 48  THR 48  48  48  THR THR B . n 
C 1 49  PRO 49  49  49  PRO PRO B . n 
C 1 50  GLY 50  50  50  GLY GLY B . n 
C 1 51  VAL 51  51  51  VAL VAL B . n 
C 1 52  LYS 52  52  52  LYS LYS B . n 
C 1 53  ARG 53  53  53  ARG ARG B . n 
C 1 54  ASN 54  54  54  ASN ASN B . n 
C 1 55  GLY 55  55  55  GLY GLY B . n 
C 1 56  PHE 56  56  56  PHE PHE B . n 
C 1 57  PRO 57  57  57  PRO PRO B . n 
C 1 58  VAL 58  58  58  VAL VAL B . n 
C 1 59  ALA 59  59  59  ALA ALA B . n 
C 1 60  LEU 60  60  60  LEU LEU B . n 
C 1 61  ALA 61  61  61  ALA ALA B . n 
C 1 62  ARG 62  62  62  ARG ARG B . n 
C 1 63  ALA 63  63  63  ALA ALA B . n 
C 1 64  VAL 64  64  64  VAL VAL B . n 
C 1 65  SER 65  65  65  SER SER B . n 
C 1 66  ASN 66  66  66  ASN ASN B . n 
C 1 67  GLU 67  67  67  GLU GLU B . n 
C 1 68  ILE 68  68  68  ILE ILE B . n 
C 1 69  VAL 69  69  69  VAL VAL B . n 
C 1 70  ARG 70  70  70  ARG ARG B . n 
C 1 71  PHE 71  71  71  PHE PHE B . n 
C 1 72  PRO 72  72  72  PRO PRO B . n 
C 1 73  THR 73  73  73  THR THR B . n 
C 1 74  ASP 74  74  74  ASP ASP B . n 
C 1 75  GLN 75  75  75  GLN GLN B . n 
C 1 76  LEU 76  76  76  LEU LEU B . n 
C 1 77  THR 77  77  77  THR THR B . n 
C 1 78  PRO 78  78  78  PRO PRO B . n 
C 1 79  ASP 79  79  79  ASP ASP B . n 
C 1 80  GLN 80  80  80  GLN GLN B . n 
C 1 81  GLU 81  81  81  GLU GLU B . n 
C 1 82  ARG 82  82  82  ARG ARG B . n 
C 1 83  SER 83  83  83  SER SER B . n 
C 1 84  LEU 84  84  84  LEU LEU B . n 
C 1 85  MET 85  85  85  MET MET B . n 
C 1 86  PHE 86  86  86  PHE PHE B . n 
C 1 87  MET 87  87  87  MET MET B . n 
C 1 88  GLN 88  88  88  GLN GLN B . n 
C 1 89  TRP 89  89  89  TRP TRP B . n 
C 1 90  GLY 90  90  90  GLY GLY B . n 
C 1 91  GLN 91  91  91  GLN GLN B . n 
C 1 92  LEU 92  92  92  LEU LEU B . n 
C 1 93  LEU 93  93  93  LEU LEU B . n 
C 1 94  ASP 94  94  94  ASP ASP B . n 
C 1 95  HIS 95  95  95  HIS HIS B . n 
C 1 96  ASP 96  96  96  ASP ASP B . n 
C 1 97  LEU 97  97  97  LEU LEU B . n 
C 1 98  ASP 98  98  98  ASP ASP B . n 
C 1 99  PHE 99  99  99  PHE PHE B . n 
C 1 100 THR 100 100 100 THR THR B . n 
C 1 101 PRO 101 101 101 PRO PRO B . n 
C 1 102 GLU 102 102 102 GLU GLU B . n 
C 1 103 PRO 103 103 103 PRO PRO B . n 
C 1 104 ALA 104 104 104 ALA ALA B . n 
D 2 1   VAL 1   113 113 VAL VAL D . n 
D 2 2   ASN 2   114 114 ASN ASN D . n 
D 2 3   CYS 3   115 115 CYS CYS D . n 
D 2 4   GLU 4   116 116 GLU GLU D . n 
D 2 5   THR 5   117 117 THR THR D . n 
D 2 6   SER 6   118 118 SER SER D . n 
D 2 7   CYS 7   119 119 CYS CYS D . n 
D 2 8   VAL 8   120 120 VAL VAL D . n 
D 2 9   GLN 9   121 121 GLN GLN D . n 
D 2 10  GLN 10  122 122 GLN GLN D . n 
D 2 11  PRO 11  123 123 PRO PRO D . n 
D 2 12  PRO 12  124 124 PRO PRO D . n 
D 2 13  CYS 13  125 125 CYS CYS D . n 
D 2 14  PHE 14  126 126 PHE PHE D . n 
D 2 15  PRO 15  127 127 PRO PRO D . n 
D 2 16  LEU 16  128 128 LEU LEU D . n 
D 2 17  LYS 17  129 129 LYS LYS D . n 
D 2 18  ILE 18  130 130 ILE ILE D . n 
D 2 19  PRO 19  131 131 PRO PRO D . n 
D 2 20  PRO 20  132 132 PRO PRO D . n 
D 2 21  ASN 21  133 133 ASN ASN D . n 
D 2 22  ASP 22  134 134 ASP ASP D . n 
D 2 23  PRO 23  135 135 PRO PRO D . n 
D 2 24  ARG 24  136 136 ARG ARG D . n 
D 2 25  ILE 25  137 137 ILE ILE D . n 
D 2 26  LYS 26  138 138 LYS LYS D . n 
D 2 27  ASN 27  139 139 ASN ASN D . n 
D 2 28  GLN 28  140 140 GLN GLN D . n 
D 2 29  ALA 29  141 141 ALA ALA D . n 
D 2 30  ASP 30  142 142 ASP ASP D . n 
D 2 31  CYS 31  143 143 CYS CYS D . n 
D 2 32  ILE 32  144 144 ILE ILE D . n 
D 2 33  PRO 33  145 145 PRO PRO D . n 
D 2 34  PHE 34  146 146 PHE PHE D . n 
D 2 35  PHE 35  147 147 PHE PHE D . n 
D 2 36  ARG 36  148 148 ARG ARG D . n 
D 2 37  SER 37  149 149 SER SER D . n 
D 2 38  CSO 38  150 150 CSO CEA D . n 
D 2 39  PRO 39  151 151 PRO PRO D . n 
D 2 40  ALA 40  152 152 ALA ALA D . n 
D 2 41  CYS 41  153 153 CYS CYS D . n 
D 2 42  PRO 42  154 154 PRO PRO D . n 
D 2 43  GLY 43  155 155 GLY GLY D . n 
D 2 44  SER 44  156 156 SER SER D . n 
D 2 45  ASN 45  157 157 ASN ASN D . n 
D 2 46  ILE 46  158 158 ILE ILE D . n 
D 2 47  THR 47  159 159 THR THR D . n 
D 2 48  ILE 48  160 160 ILE ILE D . n 
D 2 49  ARG 49  161 161 ARG ARG D . n 
D 2 50  ASN 50  162 162 ASN ASN D . n 
D 2 51  GLN 51  163 163 GLN GLN D . n 
D 2 52  ILE 52  164 164 ILE ILE D . n 
D 2 53  ASN 53  165 165 ASN ASN D . n 
D 2 54  ALA 54  166 166 ALA ALA D . n 
D 2 55  LEU 55  167 167 LEU LEU D . n 
D 2 56  THR 56  168 168 THR THR D . n 
D 2 57  SER 57  169 169 SER SER D . n 
D 2 58  PHE 58  170 170 PHE PHE D . n 
D 2 59  VAL 59  171 171 VAL VAL D . n 
D 2 60  ASP 60  172 172 ASP ASP D . n 
D 2 61  ALA 61  173 173 ALA ALA D . n 
D 2 62  SER 62  174 174 SER SER D . n 
D 2 63  MET 63  175 175 MET MET D . n 
D 2 64  VAL 64  176 176 VAL VAL D . n 
D 2 65  TYR 65  177 177 TYR TYR D . n 
D 2 66  GLY 66  178 178 GLY GLY D . n 
D 2 67  SER 67  179 179 SER SER D . n 
D 2 68  GLU 68  180 180 GLU GLU D . n 
D 2 69  GLU 69  181 181 GLU GLU D . n 
D 2 70  PRO 70  182 182 PRO PRO D . n 
D 2 71  LEU 71  183 183 LEU LEU D . n 
D 2 72  ALA 72  184 184 ALA ALA D . n 
D 2 73  ARG 73  185 185 ARG ARG D . n 
D 2 74  ASN 74  186 186 ASN ASN D . n 
D 2 75  LEU 75  187 187 LEU LEU D . n 
D 2 76  ARG 76  188 188 ARG ARG D . n 
D 2 77  ASN 77  189 189 ASN ASN D . n 
D 2 78  MET 78  190 190 MET MET D . n 
D 2 79  SER 79  191 191 SER SER D . n 
D 2 80  ASN 80  192 192 ASN ASN D . n 
D 2 81  GLN 81  193 193 GLN GLN D . n 
D 2 82  LEU 82  194 194 LEU LEU D . n 
D 2 83  GLY 83  195 195 GLY GLY D . n 
D 2 84  LEU 84  196 196 LEU LEU D . n 
D 2 85  LEU 85  197 197 LEU LEU D . n 
D 2 86  ALA 86  198 198 ALA ALA D . n 
D 2 87  VAL 87  199 199 VAL VAL D . n 
D 2 88  ASN 88  200 200 ASN ASN D . n 
D 2 89  GLN 89  201 201 GLN GLN D . n 
D 2 90  ARG 90  202 202 ARG ARG D . n 
D 2 91  PHE 91  203 203 PHE PHE D . n 
D 2 92  GLN 92  204 204 GLN GLN D . n 
D 2 93  ASP 93  205 205 ASP ASP D . n 
D 2 94  ASN 94  206 206 ASN ASN D . n 
D 2 95  GLY 95  207 207 GLY GLY D . n 
D 2 96  ARG 96  208 208 ARG ARG D . n 
D 2 97  ALA 97  209 209 ALA ALA D . n 
D 2 98  LEU 98  210 210 LEU LEU D . n 
D 2 99  LEU 99  211 211 LEU LEU D . n 
D 2 100 PRO 100 212 212 PRO PRO D . n 
D 2 101 PHE 101 213 213 PHE PHE D . n 
D 2 102 ASP 102 214 214 ASP ASP D . n 
D 2 103 ASN 103 215 215 ASN ASN D . n 
D 2 104 LEU 104 216 216 LEU LEU D . n 
D 2 105 HIS 105 217 217 HIS HIS D . n 
D 2 106 ASP 106 218 218 ASP ASP D . n 
D 2 107 ASP 107 219 219 ASP ASP D . n 
D 2 108 PRO 108 220 220 PRO PRO D . n 
D 2 109 CYS 109 221 221 CYS CYS D . n 
D 2 110 LEU 110 222 222 LEU LEU D . n 
D 2 111 LEU 111 223 223 LEU LEU D . n 
D 2 112 THR 112 224 224 THR THR D . n 
D 2 113 ASN 113 225 225 ASN ASN D . n 
D 2 114 ARG 114 226 226 ARG ARG D . n 
D 2 115 SER 115 227 227 SER SER D . n 
D 2 116 ALA 116 228 228 ALA ALA D . n 
D 2 117 ARG 117 229 229 ARG ARG D . n 
D 2 118 ILE 118 230 230 ILE ILE D . n 
D 2 119 PRO 119 231 231 PRO PRO D . n 
D 2 120 CYS 120 232 232 CYS CYS D . n 
D 2 121 PHE 121 233 233 PHE PHE D . n 
D 2 122 LEU 122 234 234 LEU LEU D . n 
D 2 123 ALA 123 235 235 ALA ALA D . n 
D 2 124 GLY 124 236 236 GLY GLY D . n 
D 2 125 ASP 125 237 237 ASP ASP D . n 
D 2 126 THR 126 238 238 THR THR D . n 
D 2 127 ARG 127 239 239 ARG ARG D . n 
D 2 128 SER 128 240 240 SER SER D . n 
D 2 129 SER 129 241 241 SER SER D . n 
D 2 130 GLU 130 242 242 GLU GLU D . n 
D 2 131 MET 131 243 243 MET MET D . n 
D 2 132 PRO 132 244 244 PRO PRO D . n 
D 2 133 GLU 133 245 245 GLU GLU D . n 
D 2 134 LEU 134 246 246 LEU LEU D . n 
D 2 135 THR 135 247 247 THR THR D . n 
D 2 136 SER 136 248 248 SER SER D . n 
D 2 137 MET 137 249 249 MET MET D . n 
D 2 138 HIS 138 250 250 HIS HIS D . n 
D 2 139 THR 139 251 251 THR THR D . n 
D 2 140 LEU 140 252 252 LEU LEU D . n 
D 2 141 LEU 141 253 253 LEU LEU D . n 
D 2 142 LEU 142 254 254 LEU LEU D . n 
D 2 143 ARG 143 255 255 ARG ARG D . n 
D 2 144 GLU 144 256 256 GLU GLU D . n 
D 2 145 HIS 145 257 257 HIS HIS D . n 
D 2 146 ASN 146 258 258 ASN ASN D . n 
D 2 147 ARG 147 259 259 ARG ARG D . n 
D 2 148 LEU 148 260 260 LEU LEU D . n 
D 2 149 ALA 149 261 261 ALA ALA D . n 
D 2 150 THR 150 262 262 THR THR D . n 
D 2 151 GLU 151 263 263 GLU GLU D . n 
D 2 152 LEU 152 264 264 LEU LEU D . n 
D 2 153 LYS 153 265 265 LYS LYS D . n 
D 2 154 SER 154 266 266 SER SER D . n 
D 2 155 LEU 155 267 267 LEU LEU D . n 
D 2 156 ASN 156 268 268 ASN ASN D . n 
D 2 157 PRO 157 269 269 PRO PRO D . n 
D 2 158 ARG 158 270 270 ARG ARG D . n 
D 2 159 TRP 159 271 271 TRP TRP D . n 
D 2 160 ASP 160 272 272 ASP ASP D . n 
D 2 161 GLY 161 273 273 GLY GLY D . n 
D 2 162 GLU 162 274 274 GLU GLU D . n 
D 2 163 ARG 163 275 275 ARG ARG D . n 
D 2 164 LEU 164 276 276 LEU LEU D . n 
D 2 165 TYR 165 277 277 TYR TYR D . n 
D 2 166 GLN 166 278 278 GLN GLN D . n 
D 2 167 GLU 167 279 279 GLU GLU D . n 
D 2 168 ALA 168 280 280 ALA ALA D . n 
D 2 169 ARG 169 281 281 ARG ARG D . n 
D 2 170 LYS 170 282 282 LYS LYS D . n 
D 2 171 ILE 171 283 283 ILE ILE D . n 
D 2 172 VAL 172 284 284 VAL VAL D . n 
D 2 173 GLY 173 285 285 GLY GLY D . n 
D 2 174 ALA 174 286 286 ALA ALA D . n 
D 2 175 MET 175 287 287 MET MET D . n 
D 2 176 VAL 176 288 288 VAL VAL D . n 
D 2 177 GLN 177 289 289 GLN GLN D . n 
D 2 178 ILE 178 290 290 ILE ILE D . n 
D 2 179 ILE 179 291 291 ILE ILE D . n 
D 2 180 THR 180 292 292 THR THR D . n 
D 2 181 TYR 181 293 293 TYR TYR D . n 
D 2 182 ARG 182 294 294 ARG ARG D . n 
D 2 183 ASP 183 295 295 ASP ASP D . n 
D 2 184 TYR 184 296 296 TYR TYR D . n 
D 2 185 LEU 185 297 297 LEU LEU D . n 
D 2 186 PRO 186 298 298 PRO PRO D . n 
D 2 187 LEU 187 299 299 LEU LEU D . n 
D 2 188 VAL 188 300 300 VAL VAL D . n 
D 2 189 LEU 189 301 301 LEU LEU D . n 
D 2 190 GLY 190 302 302 GLY GLY D . n 
D 2 191 PRO 191 303 303 PRO PRO D . n 
D 2 192 THR 192 304 304 THR THR D . n 
D 2 193 ALA 193 305 305 ALA ALA D . n 
D 2 194 MET 194 306 306 MET MET D . n 
D 2 195 ARG 195 307 307 ARG ARG D . n 
D 2 196 LYS 196 308 308 LYS LYS D . n 
D 2 197 TYR 197 309 309 TYR TYR D . n 
D 2 198 LEU 198 310 310 LEU LEU D . n 
D 2 199 PRO 199 311 311 PRO PRO D . n 
D 2 200 THR 200 312 312 THR THR D . n 
D 2 201 TYR 201 313 313 TYR TYR D . n 
D 2 202 ARG 202 314 314 ARG ARG D . n 
D 2 203 SER 203 315 315 SER SER D . n 
D 2 204 TYR 204 316 316 TYR TYR D . n 
D 2 205 ASN 205 317 317 ASN ASN D . n 
D 2 206 ASP 206 318 318 ASP ASP D . n 
D 2 207 SER 207 319 319 SER SER D . n 
D 2 208 VAL 208 320 320 VAL VAL D . n 
D 2 209 ASP 209 321 321 ASP ASP D . n 
D 2 210 PRO 210 322 322 PRO PRO D . n 
D 2 211 ARG 211 323 323 ARG ARG D . n 
D 2 212 ILE 212 324 324 ILE ILE D . n 
D 2 213 ALA 213 325 325 ALA ALA D . n 
D 2 214 ASN 214 326 326 ASN ASN D . n 
D 2 215 VAL 215 327 327 VAL VAL D . n 
D 2 216 PHE 216 328 328 PHE PHE D . n 
D 2 217 THR 217 329 329 THR THR D . n 
D 2 218 ASN 218 330 330 ASN ASN D . n 
D 2 219 ALA 219 331 331 ALA ALA D . n 
D 2 220 PHE 220 332 332 PHE PHE D . n 
D 2 221 ARG 221 333 333 ARG ARG D . n 
D 2 222 TYR 222 334 334 TYR TYR D . n 
D 2 223 GLY 223 335 335 GLY GLY D . n 
D 2 224 HIS 224 336 336 HIS HIS D . n 
D 2 225 THR 225 337 337 THR THR D . n 
D 2 226 LEU 226 338 338 LEU LEU D . n 
D 2 227 ILE 227 339 339 ILE ILE D . n 
D 2 228 GLN 228 340 340 GLN GLN D . n