data_1DY5
# 
_entry.id   1DY5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DY5         
PDBE  EBI-4534     
WWPDB D_1290004534 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1SSB unspecified 
'RIBONUCLEASE A (RESIDUES 1 - 118) COMPLEXED WITH SYNTHETIC RIBONUCLEASE A (RESIDUES 111 - 124, PHE 120 REPLACED BY TYR (F120Y))' 
PDB 1W4Q unspecified 
;BINDING OF NONNATURAL 3'-NUCLEOTIDES TO RIBONUCLEASE A
;
PDB 1AFU unspecified 'STRUCTURE OF RIBONUCLEASE A AT 2.0 ANGSTROMS FROM MONOCLINIC CRYSTALS' 
PDB 1C0B unspecified 'BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 2.5 DAYS' 
PDB 6RAT unspecified 'RIBONUCLEASE A AT 240K' 
PDB 1YMR unspecified 'THE STUDY OF REDUCTIVE UNFOLDING PATHWAYS OF RNASE A (Y92AMUTANT)' 
PDB 1O0O unspecified 
;RIBONUCLEASE A IN COMPLEX WITH ADENOSINE-2 ',5'-DIPHOSPHATE
;
PDB 8RSA unspecified 'RIBONUCLEASE A (PHOSPHATE-FREE) COMPLEX WITH N==E2.12==-N-ACETYL DEOXYTHYMIDINE' 
PDB 5RSA unspecified 'RIBONUCLEASE A (JOINT NEUTRON AND X-RAY)' 
PDB 7RAT unspecified 'RIBONUCLEASE A AT 260K' 
PDB 1RNO unspecified 'RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE' 
PDB 2W5L unspecified 'RNASE A-NADP COMPLEX' 
PDB 1IZQ unspecified 'F46V MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 1EID unspecified 'CRYSTAL STRUCTURE OF F120G MUTANT OF BOVINE PANCREATICRIBONUCLEASE A' 
PDB 1CJQ unspecified 'X-RAY CRYSTALLOGRAPHIC STUDIES OF THE DENATURATION OF THE DENATURATION OF RIBONUCLEASE S.' 
PDB 1EOS unspecified 
;CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2', 5')GUANOSINE (PRODUCTIVE BINDING)
;
PDB 1RNN unspecified 
;RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID ( 5'CMP) CRYSTALLIZED FROM 8M SODIUM FORMATE
;
PDB 1J82 unspecified 'OSMOLYTE STABILIZATION OF RNASE' 
PDB 1QHC unspecified 
;CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'- PHOSPHO-2'-DEOXYURIDINE-3 '-PYROPHOSPHATE ADENOSINE-3'- PHOSPHATE
;
PDB 1YMW unspecified 'THE STUDY OF REDUCTIVE UNFOLDING PATHWAYS OF RNASE A (Y92GMUTANT)' 
PDB 1F0V unspecified 'CRYSTAL STRUCTURE OF AN RNASE A DIMER DISPLAYING A NEW TYPE OF 3D DOMAIN SWAPPING' 
PDB 1AFK unspecified 
;CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 5'-DIPHOSPHOADENOSINE-3'- PHOSPHATE
;
PDB 1O0H unspecified 
;RIBONUCLEASE A IN COMPLEX WITH 5'-ADP
;
PDB 1JN4 unspecified 
;THE CRYSTAL STRUCTURE OF RIBONUCLEASE A IN COMPLEX WITH 2'-DEOXYURIDINE 3'-PYROPHOSPHATE (P'-5') ADENOSINE
;
PDB 1RNQ unspecified 'RIBONUCLEASE A CRYSTALLIZED FROM 8M SODIUM FORMATE' 
PDB 1RNM unspecified 
;RIBONUCLEASE A COMPLEX WITH CYTIDYLIC ACID ( 5'CMP) CRYSTALLIZED FROM 80% AMMONIUM SULPHATE
;
PDB 1RBF unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY GLY (M13G)' 
PDB 1Z3M unspecified 'CRYSTAL STRUCTURE OF MUTANT RIBONUCLEASE S ( F8NVA)' 
PDB 1RNX unspecified 'RIBONUCLEASE A CRYSTALLIZED FROM 3M SODIUM CHLORIDE, 30% AMMONIUM SULFATE' 
PDB 1ROB unspecified 'RIBONUCLEASE A COMPLEXED WITH CYTIDYLIC ACID' 
PDB 1RBN unspecified 
;RIBONUCLEASE A DERIVATIVE II COMPLEXED WITH 6-CHLOROPURINE RIBOSIDE 5'-MONOPHOSPHATE
;
PDB 1RBX unspecified 'RIBONUCLEASE A CONTROL' 
PDB 1EOW unspecified 
;CRYSTAL STRUCTURE OF RIBONUCLEASE A COMPLEXED WITH URIDYLYL(2', 5')GUANOSINE (NON- PRODUCTIVE BINDING)
;
PDB 1RBI unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY VAL (M13V)' 
PDB 7RSA unspecified 'RIBONUCLEASE A (PHOSPHATE-FREE)' 
PDB 1RBJ unspecified 'RIBONUCLEASE B COMPLEX WITH D(TETRA-(DEOXY- ADENYLATE))' 
PDB 1DFJ unspecified 'RIBONUCLEASE INHIBITOR COMPLEXED WITH RIBONUCLEASE A' 
PDB 1RSM unspecified 'LYS-7-(DINITROPHENYLENE)-LYS-41 CROSS-LINKED RIBONUCLEASE A' 
PDB 1KF5 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 7.1' 
PDB 1XPS unspecified 'BOVINE RIBONUCLEASE A (PHOSPHATE-FREE) (93 % HUMIDITY)' 
PDB 1RAT unspecified 'RIBONUCLEASE A AT 98K' 
PDB 1FEV unspecified 'CRYSTAL STRUCTURE OF THE ALA4AIB MUTATION IN RNASE S' 
PDB 2AAS unspecified 'RIBONUCLEASE A (NMR, 32 STRUCTURES)' 
PDB 1J80 unspecified 'OSMOLYTE STABILIZATION OF RNASE' 
PDB 1RHB unspecified 'RIBONUCLEASE A (LOW HUMIDITY FORM: RELATIVE HUMIDITY 88 %)' 
PDB 1RPG unspecified 
;RIBONUCLEASE A COMPLEXED WITH DEOXYCYTIDYL-3 ',5'-DEOXYADENOSINE (RNASE A/D(CPA)
;
PDB 1FS3 unspecified 'CRYSTAL STRUCTURE OF WILD-TYPE BOVINE PANCREATICRIBONUCLEASE A' 
PDB 1B6V unspecified 'CRYSTAL STRUCTURE OF A HYBRID BETWEEN RIBONUCLEASE A AND BOVINE SEMINAL RIBONUCLEASE' 
PDB 3SRN unspecified 'SEMISYNTHETIC RIBONUCLEASE A MUTANT WITH ASP 121 REPLACED BY ASN (D121N) (RNASE 1-118: 111-124 (D121N))' 
PDB 1Z6S unspecified 'RIBONUCLEASE A- AMP COMPLEX' 
PDB 1KF8 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 8.8' 
PDB 1RTB unspecified 'RIBONUCLEASE A (RNASE A)' 
PDB 4RSK unspecified 
;STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A COMPLEXED WITH 3'-UMP
;
PDB 1BZQ unspecified 'COMPLEX OF A DROMEDARY SINGLE-DOMAIN VHH ANTIBODY FRAGMENT WITH RNASE A' 
PDB 9RSA unspecified 'RIBONUCLEASE A (PHOSPHATE-FREE) COMPLEX WITH N==D1.119==-N-ACETYL DEOXYURIDINE' 
PDB 1BEL unspecified 'HYDROLASE PHOSPHORIC DIESTER, RIBONUCLEIC ACID' 
PDB 1KF4 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 6.3' 
PDB 1KF7 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 8.0' 
PDB 1RBW unspecified 'RIBONUCLEASE A WITH GUANIDINIUM' 
PDB 9RAT unspecified 'RIBONUCLEASE A AT 320K' 
PDB 1EIE unspecified 'CRYSTAL STRUCTURE OF F120W MUTANT OF BOVINE PANCREATICRIBONUCLEASE A' 
PDB 1RPF unspecified 
;RIBONUCLEASE A COMPLEXED WITH CYTIDINE-3'- MONOPHOSPHATE (RNASE A/3'-CMP)
;
PDB 1O0M unspecified 
;RIBONUCLEASE A IN COMPLEX WITH URIDINE-2'- PHOSPHATE
;
PDB 1C8W unspecified 'THR45GLY VARIANT OF RIBONUCLEASE A' 
PDB 1RNC unspecified 
;RIBONUCLEASE A COMPLEX WITH CYTIDYLYL-2',5 '-GUANOSINE (2',5'-CPG)
;
PDB 1RCA unspecified 
;MOL_ID: 1; MOLECULE: RIBONUCLEASE A; CHAIN: NULL; SYNONYM: RNASE A; EC: 3.1.27.5; HETEROGEN: DEOXYCYTIDYLYL-3',5'-GUANOSINE (3 ',5'-DCPDG); OTHER_DETAILS: CO-CRYSTALLIZED COMPLEX
;
PDB 1JVT unspecified 'CRYSTAL STRUCTURE OF RIBONUCLEASE A (LIGAND- FREE FORM)' 
PDB 1C0C unspecified 'BOVINE PANCREATIC RIBONUCLEASE A DESICCATED FOR 4.0 DAYS' 
PDB 3RSD unspecified 'STRUCTURE OF THE D121N VARIANT OF RIBONUCLEASE A' 
PDB 1XPT unspecified 'BOVINE RIBONUCLEASE A (PHOSPHATE-FREE)' 
PDB 1RBB unspecified 'RIBONUCLEASE B' 
PDB 2BLZ unspecified 
;RNASE AFTER A HIGH DOSE X-RAY "BURN"
;
PDB 3RSP unspecified 'STRUCTURE OF THE P93G VARIANT OF RIBONUCLEASE A' 
PDB 1SSC unspecified 'RIBONUCLEASE A (SEMISYNTHETIC) CRYSTALLIZED FROM AQUEOUS ETHANOL [RNASE 1-118:111-124]' 
PDB 8RAT unspecified 'RIBONUCLEASE A AT 300K' 
PDB 2APQ unspecified 
;CRYSTAL STRUCTURE OF AN ACTIVE SITE MUTANT OF BOVINEPANCREATIC RIBONUCLEASE A (H119A- RNASE A) WITH A 10-GLUTAMINE EXPANSION IN THE C-TERMINAL HINGE-LOOP.
;
PDB 1W4O unspecified 
;BINDING OF NONNATURAL 3'-NUCLEOTIDES TO RIBONUCLEASE A
;
PDB 1J7Z unspecified 'OSMOLYTE STABILIZATION OF RIBONUCLEASE' 
PDB 1RBD unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY ALPHA-AMINO-NORMAL-BUTYRIC ACID (M13ABA)' 
PDB 1RNZ unspecified 'RIBONUCLEASE A CRYSTALLIZED FROM 2.5M SODIUM CHLORIDE, 3.3M SODIUM FORMATE' 
PDB 1JVV unspecified 'CRYSTAL STRUCTURE OF RIBONUCLEASE A (RETRO- SOAKED FORM)' 
PDB 1RAR unspecified 'RIBONUCLEASE A FLUORESCENT DERIVATIVE [RNASE 1 -124 (AENS-HIS -12)] FROM NACL CRYSTAL' 
PDB 1Z3L unspecified 'X-RAY CRYSTAL STRUCTURE OF A MUTANT RIBONUCLEASE S (F8ANB)' 
PDB 1KF3 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 5.9' 
PDB 1AQP unspecified 'RIBONUCLEASE A COPPER COMPLEX' 
PDB 2W5M unspecified 'RNASE A-PYROPHOSPHATE ION COMPLEX' 
PDB 1RBH unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY LEU (M13L)' 
PDB 1RBG unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY ILE (M13I)' 
PDB 1O0N unspecified 
;RIBONUCLEASE A IN COMPLEX WITH URIDINE-3'- PHOSPHATE
;
PDB 3RSK unspecified 'STRUCTURE OF THE K7A/R10A/K66A VARIANT OF RIBONUCLEASE A' 
PDB 1JS0 unspecified 'CRYSTAL STRUCTURE OF 3D DOMAIN-SWAPPED RNASE A MINOR TRIMER' 
PDB 1SSA unspecified 
'RIBONUCLEASE A (RESIDUES 1 - 118) COMPLEXED WITH SYNTHETIC RIBONUCLEASE A (RESIDUES 111 - 124, PHE 120 REPLACED BY LEU (F120L))' 
PDB 1CJR unspecified 'X-RAY CRYSTALLOGRAPHIC STUDIES OF DENATURATION IN RIBONUCLEASE S' 
PDB 1EIC unspecified 'CRYSTAL STRUCTURE OF F120A MUTANT OF BOVINE PANCREATICRIBONUCLEASE A' 
PDB 1D5D unspecified 
'THE ROLE OF PHENYLALANINE 8 IN THE STABILIZATION OF THE SPROTEIN-S PEPTIDE INTERACTION: PACKING AND CAVITIES' 
PDB 1YMN unspecified 'THE STUDY OF REDUCTIVE UNFOLDING PATHWAYS OF RNASE A (Y92LMUTANT)' 
PDB 1J81 unspecified 'OSMOLYTE STABILIZATION OF RNASE' 
PDB 1RNW unspecified 'RECOMBINANT RIBONUCLEASE A CRYSTALLIZED FROM 80% AMMONIUM SULPHATE' 
PDB 2W5K unspecified 'RNASE A-NADPH COMPLEX' 
PDB 1RPH unspecified 'RIBONUCLEASE A' 
PDB 2RNS unspecified 'RIBONUCLEASE S (PH 4.75)' 
PDB 1RTA unspecified 'RIBONUCLEASE A COMPLEX WITH THYMIDYLIC ACID TETRAMER' 
PDB 1RNU unspecified 'RIBONUCLEASE S (PH 5.5)' 
PDB 1RNY unspecified 'RIBONUCLEASE A CRYSTALLIZED FROM 3M CESIUM CHLORIDE, 30% AMMONIUM SULFATE' 
PDB 1Z3P unspecified 'X-RAY CRYSTAL STRUCTURE OF A MUTANT RIBONUCLEASE S (M13NVA)' 
PDB 1GV7 unspecified 'GUEST-HOST CROSSTALK IN AN ANGIOGENIN/RNASE A CHIMERIC PROTEIN' 
PDB 1RCN unspecified 
;RIBONUCLEASE A COMPLEXED WITH DEOXYRIBONUCLEIC ACID (5'-D(APTPAPAP)-3')
;
PDB 1RNV unspecified 'RIBONUCLEASE S (PH 4.75)' 
PDB 4RAT unspecified 'RIBONUCLEASE A AT 180K' 
PDB 1W4P unspecified 
;BINDING OF NONNATURAL 3'-NUCLEOTIDES TO RIBONUCLEASE A
;
PDB 4RSD unspecified 'STRUCTURE OF THE D121A VARIANT OF RIBONUCLEASE A' 
PDB 1A5P unspecified 'C[40,95]A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 1WBU unspecified 'FRAGMENT BASED LEAD DISCOVERY USING CRYSTALLOGRAPHY' 
PDB 1RHA unspecified 'RIBONUCLEASE A (LOW HUMIDITY FORM: RELATIVE HUMIDITY 79 %)' 
PDB 1RAS unspecified 'RIBONUCLEASE A FLUORESCENT DERIVATIVE [RNASE 1 -124 (AENS-HIS-12)] FROM AMMONIUM SULFATE CRYSTAL' 
PDB 2BLP unspecified 'RNASE BEFORE UNATTENUATED X-RAY BURN' 
PDB 1KF2 unspecified 'ATOMIC RESOLUTION STRUCTURE OF RNASE A AT PH 5.2' 
PDB 1RND unspecified 
;RIBONUCLEASE A COMPLEX WITH DEOXYCYTIDYLYL-3 ',5'-GUANOSINE (3',5'-DCPDG)
;
PDB 1D5H unspecified 'RNASE S(F8A). MUTANT RIBONUCLEASE S.' 
PDB 1SRN unspecified 'SEMISYNTHETIC RIBONUCLEASE A (RNASE 1-118( COLON)111-124)' 
PDB 1D5E unspecified 
'THE ROLE OF PHENYLALANINE 8 IN THE STABILIZATION OF THE SPROTEIN-S PEPTIDE INTERACTION: PACKING AND CAVITIES' 
PDB 2RAT unspecified 'RIBONUCLEASE A AT 130K' 
PDB 1IZP unspecified 'F46L MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 2W5G unspecified 
;RNASE A-5'-ATP COMPLEX
;
PDB 1O0F unspecified 
;RNASE A IN COMPLEX WITH 3',5'-ADP
;
PDB 1IZR unspecified 'F46A MUTANT OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 1C9X unspecified 'H119A VARIANT OF RIBONUCLEASE A' 
PDB 2RLN unspecified 'RIBONUCLEASE S MUTANT WITH MET S 13 REPLACED BY NORLEUCINE (M(S 13)NLE)' 
PDB 4SRN unspecified 'SEMISYNTHETIC RIBONUCLEASE A MUTANT WITH ASP 121 REPLACED BY ALA (D121A) (RNASE 1-118: 111-124 (D121A))' 
PDB 1C9V unspecified 'H12A VARIANT OF RIBONUCLEASE A' 
PDB 5RAT unspecified 'RIBONUCLEASE A AT 220K' 
PDB 1U1B unspecified 
;STRUCTURE OF BOVINE PANCREATIC RIBONUCLEASE A IN COMPLEXWITH 3'-PHOSPHOTHYMIDINE (3'-5')- PYROPHOSPHATE ADENOSINE3'-PHOSPHATE
;
PDB 1RUV unspecified 'RIBONUCLEASE A-URIDINE VANADATE COMPLEX: HIGH RESOLUTION RESOLUTION X-RAY STRUCTURE (1.3 A)' 
PDB 2W5I unspecified 'RNASE A-AP3A COMPLEX' 
PDB 1RBC unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY ALA (M13A)' 
PDB 1AFL unspecified 
;RIBONUCLEASE A IN COMPLEX WITH 5'- DIPHOSPHOADENOSINE 2'-PHOSPHATE AT 1.7 ANGSTROM RESOLUTION
;
PDB 1Z6D unspecified 'RIBONUCLEASE A- IMP COMPLEX' 
PDB 1RBE unspecified 'RIBONUCLEASE S MUTANT WITH MET 13 REPLACED BY PHE (M13F)' 
PDB 1A5Q unspecified 'P93A VARIANT OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 1KH8 unspecified 'STRUCTURE OF A CIS-PROLINE (P114) TO GLYCINE VARIANT OFRIBONUCLEASE A' 
PDB 1LSQ unspecified 'RIBONUCLEASE A WITH ASN 67 REPLACED BY A BETA-ASPARTYL RESIDUE' 
PDB 1JVU unspecified 'CRYSTAL STRUCTURE OF RIBONUCLEASE A (COMPLEXED FORM)' 
PDB 1A2W unspecified 'CRYSTAL STRUCTURE OF A 3D DOMAIN-SWAPPED DIMER OF BOVINE PANCREATIC RIBONUCLEASE A' 
PDB 3RAT unspecified 'RIBONUCLEASE A AT 160K' 
PDB 3RN3 unspecified 'RIBONUCLEASE A' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DY5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-01-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Esposito, L.'   1 
'Vitagliano, L.' 2 
'Sica, F.'       3 
'Zagari, A.'     4 
'Mazzarella, L.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The Ultrahigh Resolution Crystal Structure of Ribonuclease A Containing an Isoaspartyl Residue: Hydration and Sterochemical Analysis.
;
J.Mol.Biol. 297 713 ? 2000 JMOBAK UK 0022-2836 0070 ? 10731423 10.1006/JMBI.2000.3597 
1       
'Deamidation in Proteins:The Crystal Structure of Bovine Pancreatic Ribonuclease with an Isoaspartyl Residue at Position 67' 
J.Mol.Biol. 257 492 ? 1996 JMOBAK UK 0022-2836 0070 ? 8648618  10.1006/JMBI.1996.0179 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Esposito, L.'   1  ? 
primary 'Vitagliano, L.' 2  ? 
primary 'Sica, F.'       3  ? 
primary 'Sorrentino, G.' 4  ? 
primary 'Zagari, A.'     5  ? 
primary 'Mazzarella, L.' 6  ? 
1       'Capasso, S.'    7  ? 
1       'Di Donato, A.'  8  ? 
1       'Esposito, L.'   9  ? 
1       'Sica, F.'       10 ? 
1       'Sorrentino, G.' 11 ? 
1       'Vitagliano, L.' 12 ? 
1       'Zagari, A.'     13 ? 
1       'Mazzarella, L.' 14 ? 
# 
_cell.entry_id           1DY5 
_cell.length_a           61.314 
_cell.length_b           37.470 
_cell.length_c           44.915 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.55 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DY5 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'RIBONUCLEASE A'    13709.311 2   3.1.27.5 YES ? 'ASN 67 REPLACED BY A BETA-ASPARTYL RESIDUE' 
2 non-polymer syn 'SULFATE ION'       96.063    3   ?        ?   ? ?                                            
3 non-polymer syn 'ACETATE ION'       59.044    4   ?        ?   ? ?                                            
4 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095    8   ?        ?   ? ?                                            
5 water       nat water               18.015    381 ?        ?   ? ?                                            
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACK(IAS)GQTNCYQSY
STMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKDGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   THR n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   LYS n 
1 8   PHE n 
1 9   GLU n 
1 10  ARG n 
1 11  GLN n 
1 12  HIS n 
1 13  MET n 
1 14  ASP n 
1 15  SER n 
1 16  SER n 
1 17  THR n 
1 18  SER n 
1 19  ALA n 
1 20  ALA n 
1 21  SER n 
1 22  SER n 
1 23  SER n 
1 24  ASN n 
1 25  TYR n 
1 26  CYS n 
1 27  ASN n 
1 28  GLN n 
1 29  MET n 
1 30  MET n 
1 31  LYS n 
1 32  SER n 
1 33  ARG n 
1 34  ASN n 
1 35  LEU n 
1 36  THR n 
1 37  LYS n 
1 38  ASP n 
1 39  ARG n 
1 40  CYS n 
1 41  LYS n 
1 42  PRO n 
1 43  VAL n 
1 44  ASN n 
1 45  THR n 
1 46  PHE n 
1 47  VAL n 
1 48  HIS n 
1 49  GLU n 
1 50  SER n 
1 51  LEU n 
1 52  ALA n 
1 53  ASP n 
1 54  VAL n 
1 55  GLN n 
1 56  ALA n 
1 57  VAL n 
1 58  CYS n 
1 59  SER n 
1 60  GLN n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  ALA n 
1 65  CYS n 
1 66  LYS n 
1 67  IAS n 
1 68  GLY n 
1 69  GLN n 
1 70  THR n 
1 71  ASN n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  SER n 
1 76  TYR n 
1 77  SER n 
1 78  THR n 
1 79  MET n 
1 80  SER n 
1 81  ILE n 
1 82  THR n 
1 83  ASP n 
1 84  CYS n 
1 85  ARG n 
1 86  GLU n 
1 87  THR n 
1 88  GLY n 
1 89  SER n 
1 90  SER n 
1 91  LYS n 
1 92  TYR n 
1 93  PRO n 
1 94  ASN n 
1 95  CYS n 
1 96  ALA n 
1 97  TYR n 
1 98  LYS n 
1 99  THR n 
1 100 THR n 
1 101 GLN n 
1 102 ALA n 
1 103 ASN n 
1 104 LYS n 
1 105 HIS n 
1 106 ILE n 
1 107 ILE n 
1 108 VAL n 
1 109 ALA n 
1 110 CYS n 
1 111 GLU n 
1 112 GLY n 
1 113 ASN n 
1 114 PRO n 
1 115 TYR n 
1 116 VAL n 
1 117 PRO n 
1 118 VAL n 
1 119 HIS n 
1 120 PHE n 
1 121 ASP n 
1 122 ALA n 
1 123 SER n 
1 124 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                BOVINE 
_entity_src_nat.pdbx_organism_scientific   'BOS TAURUS' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 PANCREAS 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNAS1_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P61823 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DY5 A 1 ? 124 ? P61823 27 ? 150 ? 1 124 
2 1 1DY5 B 1 ? 124 ? P61823 27 ? 150 ? 1 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1DY5 IAS A 67 ? UNP P61823 ASN 93 conflict 67 1 
2 1DY5 IAS B 67 ? UNP P61823 ASN 93 conflict 67 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer                       . 'ACETATE ION'          ?                 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking'               y ALANINE                ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'               y ARGININE               ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'               y ASPARAGINE             ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'               y 'ASPARTIC ACID'        ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'               y CYSTEINE               ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'               y GLUTAMINE              ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'               y 'GLUTAMIC ACID'        ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'                 y GLYCINE                ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'               y HISTIDINE              ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                       . WATER                  ?                 'H2 O'           18.015  
IAS 'L-beta-peptide, C-gamma linking' . 'BETA-L-ASPARTIC ACID' 'L-aspartic acid' 'C4 H7 N O4'     133.103 
ILE 'L-peptide linking'               y ISOLEUCINE             ?                 'C6 H13 N O2'    131.173 
IPA non-polymer                       . 'ISOPROPYL ALCOHOL'    2-PROPANOL        'C3 H8 O'        60.095  
LEU 'L-peptide linking'               y LEUCINE                ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'               y LYSINE                 ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'               y METHIONINE             ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'               y PHENYLALANINE          ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'               y PROLINE                ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'               y SERINE                 ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer                       . 'SULFATE ION'          ?                 'O4 S -2'        96.063  
THR 'L-peptide linking'               y THREONINE              ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking'               y TYROSINE               ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'               y VALINE                 ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DY5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.88 
_exptl_crystal.density_percent_sol   34.43 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.70 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;FREE LIQUID DIFFUSION METHOD USED. THE PROTEIN WAS CRYSTALLIZED FROM 50% ISOPROPANOL, 0.05 M AMMONIUM ACETATE, PH 5.7, CONC.=10 MG/ML
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-12-15 
_diffrn_detector.details                'BENT MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.888 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.888 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1DY5 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             61.000 
_reflns.d_resolution_high            0.870 
_reflns.number_obs                   160386 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.05300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.100 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             0.87 
_reflns_shell.d_res_low              0.88 
_reflns_shell.percent_possible_all   68.8 
_reflns_shell.Rmerge_I_obs           0.10400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.400 
_reflns_shell.pdbx_redundancy        1.35 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1DY5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     160386 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             61.0 
_refine.ls_d_res_high                            0.87 
_refine.ls_percent_reflns_obs                    96.6 
_refine.ls_R_factor_obs                          0.1009 
_refine.ls_R_factor_all                          0.1013 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.1198 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  16018 
_refine.ls_number_parameters                     22157 
_refine.ls_number_restraints                     26709 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  
;NO GEOMETRIC RESTRAINTS APPLIED TO IAS RESIDUE. DUE TO POORLY DEFINED DENSITY, THE FOLLOWING ATOMS: (CE,NZ) AND (CG,CD,CE,NZ) ARE MISSING FROM RESIDUES B31 E B37, RESPECTIVELY. FOR RESIDUE A37 ONLY A SINGLE SIDE CHAIN CONFORMATION HAS BEEN MODELED WHICH IS ALTERNATIVE TO A34 SIDE CHAIN AT MINOR OCCUPANCY. THE NUMBER OF PROTEIN ATOMS USED IN REFINEMENT (GIVEN ABOVE) INCLUDES CONTRIBUTIONS FROM THE MULTIPLE CONFORMERS AND ATOMS BELONGING TO THE IAS RESIDUES.
;
_refine.pdbx_starting_model                      1LSQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1DY5 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      38 
_refine_analyze.occupancy_sum_hydrogen          1776.33 
_refine_analyze.occupancy_sum_non_hydrogen      2287.34 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1894 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             381 
_refine_hist.number_atoms_total               2338 
_refine_hist.d_res_high                       0.87 
_refine_hist.d_res_low                        61.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.038 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.021 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.138 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.152 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.2   ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.037 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.095 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    1DY5 
_pdbx_refine.R_factor_all_no_cutoff                      0.1013 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1009 
_pdbx_refine.free_R_factor_no_cutoff                     0.1198 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            16018 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1000 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.0996 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1179 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          15426 
_pdbx_refine.number_reflns_obs_4sig_cutoff               154525 
# 
_struct.entry_id                  1DY5 
_struct.title                     'Deamidated derivative of bovine pancreatic ribonuclease' 
_struct.pdbx_descriptor           'RIBONUCLEASE A (E.C.3.1.27.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DY5 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, RIBONUCLEASE, DEAMIDATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 3  ? MET A 13 ? THR A 3  MET A 13 1 ? 11 
HELX_P HELX_P2 2 ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 
HELX_P HELX_P3 3 SER A 50 ? VAL A 57 ? SER A 50 VAL A 57 1 ? 8  
HELX_P HELX_P4 4 CYS A 58 ? GLN A 60 ? CYS A 58 GLN A 60 5 ? 3  
HELX_P HELX_P5 5 THR B 3  ? MET B 13 ? THR B 3  MET B 13 1 ? 11 
HELX_P HELX_P6 6 ASN B 24 ? ARG B 33 ? ASN B 24 ARG B 33 1 ? 10 
HELX_P HELX_P7 7 SER B 50 ? VAL B 57 ? SER B 50 VAL B 57 1 ? 8  
HELX_P HELX_P8 8 CYS B 58 ? GLN B 60 ? CYS B 58 GLN B 60 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 26 SG ? ? ? 1_555 A CYS 84  SG ? ? A CYS 26 A CYS 84  1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf2 disulf ?    ? A CYS 40 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 40 A CYS 95  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ?    ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf4 disulf ?    ? A CYS 65 SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 65 A CYS 72  1_555 ? ? ? ? ? ? ? 2.082 ? 
disulf5 disulf ?    ? B CYS 26 SG ? ? ? 1_555 B CYS 84  SG ? ? B CYS 26 B CYS 84  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf6 disulf ?    ? B CYS 40 SG ? ? ? 1_555 B CYS 95  SG ? ? B CYS 40 B CYS 95  1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf7 disulf ?    ? B CYS 58 SG ? ? ? 1_555 B CYS 110 SG ? ? B CYS 58 B CYS 110 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf8 disulf ?    ? B CYS 65 SG ? ? ? 1_555 B CYS 72  SG ? ? B CYS 65 B CYS 72  1_555 ? ? ? ? ? ? ? 2.079 ? 
covale1 covale both ? A LYS 66 C  ? ? ? 1_555 A IAS 67  N  ? ? A LYS 66 A IAS 67  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2 covale both ? A IAS 67 CG ? ? ? 1_555 A GLY 68  N  ? ? A IAS 67 A GLY 68  1_555 ? ? ? ? ? ? ? 1.314 ? 
covale3 covale both ? B LYS 66 C  ? ? ? 1_555 B IAS 67  N  ? ? B LYS 66 B IAS 67  1_555 ? ? ? ? ? ? ? 1.370 ? 
covale4 covale both ? B IAS 67 CG ? ? ? 1_555 B GLY 68  N  ? ? B IAS 67 B GLY 68  1_555 ? ? ? ? ? ? ? 1.378 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 92  A . ? TYR 92  A PRO 93  A ? PRO 93  A 1 12.19 
2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 7.63  
3 TYR 92  B . ? TYR 92  B PRO 93  B ? PRO 93  B 1 3.01  
4 ASN 113 B . ? ASN 113 B PRO 114 B ? PRO 114 B 1 5.81  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 4 ? 
BA ? 3 ? 
BB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 43  ? VAL A 47  ? VAL A 43  VAL A 47  
AA 2 MET A 79  ? GLU A 86  ? MET A 79  GLU A 86  
AA 3 TYR A 97  ? LYS A 104 ? TYR A 97  LYS A 104 
AB 1 LYS A 61  ? VAL A 63  ? LYS A 61  VAL A 63  
AB 2 CYS A 72  ? GLN A 74  ? CYS A 72  GLN A 74  
AB 3 ILE A 106 ? GLU A 111 ? ILE A 106 GLU A 111 
AB 4 VAL A 116 ? SER A 123 ? VAL A 116 SER A 123 
BA 1 VAL B 43  ? VAL B 47  ? VAL B 43  VAL B 47  
BA 2 MET B 79  ? GLU B 86  ? MET B 79  GLU B 86  
BA 3 TYR B 97  ? LYS B 104 ? TYR B 97  LYS B 104 
BB 1 LYS B 61  ? VAL B 63  ? LYS B 61  VAL B 63  
BB 2 CYS B 72  ? GLN B 74  ? CYS B 72  GLN B 74  
BB 3 ILE B 106 ? GLU B 111 ? ILE B 106 GLU B 111 
BB 4 VAL B 116 ? SER B 123 ? VAL B 116 SER B 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 46  ? N PHE A 46  O THR A 82  ? O THR A 82  
AA 2 3 N ARG A 85  ? N ARG A 85  O LYS A 98  ? O LYS A 98  
AB 1 2 N VAL A 63  ? N VAL A 63  O CYS A 72  ? O CYS A 72  
AB 2 3 N TYR A 73  ? N TYR A 73  O VAL A 108 ? O VAL A 108 
AB 3 4 N GLU A 111 ? N GLU A 111 O VAL A 116 ? O VAL A 116 
BA 1 2 N PHE B 46  ? N PHE B 46  O THR B 82  ? O THR B 82  
BA 2 3 N ARG B 85  ? N ARG B 85  O LYS B 98  ? O LYS B 98  
BB 1 2 N VAL B 63  ? N VAL B 63  O CYS B 72  ? O CYS B 72  
BB 2 3 N TYR B 73  ? N TYR B 73  O VAL B 108 ? O VAL B 108 
BB 3 4 N GLU B 111 ? N GLU B 111 O VAL B 116 ? O VAL B 116 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE SO4 A 125' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SO4 B 125' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 B 126' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACT A 600' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT B 600' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT B 601' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT B 602' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IPA A 800' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE IPA A 801' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IPA A 802' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IPA A 803' 
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE IPA B 800' 
BC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE IPA B 801' 
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IPA B 804' 
BC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IPA B 805' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLN A 11  ? GLN A 11   . ? 1_555 ? 
2  AC1 12 HIS A 12  ? HIS A 12   . ? 1_555 ? 
3  AC1 12 LYS A 41  ? LYS A 41   . ? 1_555 ? 
4  AC1 12 VAL A 118 ? VAL A 118  . ? 1_555 ? 
5  AC1 12 HIS A 119 ? HIS A 119  . ? 1_555 ? 
6  AC1 12 PHE A 120 ? PHE A 120  . ? 1_555 ? 
7  AC1 12 HOH R .   ? HOH A 2170 . ? 1_555 ? 
8  AC1 12 HOH R .   ? HOH A 2171 . ? 1_555 ? 
9  AC1 12 HOH R .   ? HOH A 2172 . ? 1_555 ? 
10 AC1 12 HOH R .   ? HOH A 2173 . ? 1_555 ? 
11 AC1 12 HOH R .   ? HOH A 2174 . ? 1_555 ? 
12 AC1 12 HOH R .   ? HOH A 2175 . ? 1_555 ? 
13 AC2 13 GLN B 11  ? GLN B 11   . ? 1_555 ? 
14 AC2 13 HIS B 12  ? HIS B 12   . ? 1_555 ? 
15 AC2 13 LYS B 41  ? LYS B 41   . ? 1_555 ? 
16 AC2 13 VAL B 118 ? VAL B 118  . ? 1_555 ? 
17 AC2 13 HIS B 119 ? HIS B 119  . ? 1_555 ? 
18 AC2 13 PHE B 120 ? PHE B 120  . ? 1_555 ? 
19 AC2 13 HOH S .   ? HOH B 2184 . ? 1_555 ? 
20 AC2 13 HOH S .   ? HOH B 2185 . ? 1_555 ? 
21 AC2 13 HOH S .   ? HOH B 2186 . ? 1_555 ? 
22 AC2 13 HOH S .   ? HOH B 2187 . ? 1_555 ? 
23 AC2 13 HOH S .   ? HOH B 2191 . ? 1_555 ? 
24 AC2 13 HOH S .   ? HOH B 2192 . ? 1_555 ? 
25 AC2 13 HOH S .   ? HOH B 2202 . ? 1_555 ? 
26 AC3 7  ALA B 64  ? ALA B 64   . ? 1_545 ? 
27 AC3 7  THR B 70  ? THR B 70   . ? 1_545 ? 
28 AC3 7  THR B 87  ? THR B 87   . ? 1_555 ? 
29 AC3 7  GLY B 88  ? GLY B 88   . ? 1_555 ? 
30 AC3 7  SER B 89  ? SER B 89   . ? 1_555 ? 
31 AC3 7  HOH S .   ? HOH B 2188 . ? 1_555 ? 
32 AC3 7  HOH S .   ? HOH B 2189 . ? 1_555 ? 
33 AC4 7  HIS A 12  ? HIS A 12   . ? 1_555 ? 
34 AC4 7  ASN A 44  ? ASN A 44   . ? 1_555 ? 
35 AC4 7  THR A 45  ? THR A 45   . ? 1_555 ? 
36 AC4 7  PHE A 120 ? PHE A 120  . ? 1_555 ? 
37 AC4 7  HOH R .   ? HOH A 2174 . ? 1_555 ? 
38 AC4 7  HOH R .   ? HOH A 2175 . ? 1_555 ? 
39 AC4 7  HOH R .   ? HOH A 2176 . ? 1_555 ? 
40 AC5 8  HIS B 12  ? HIS B 12   . ? 1_555 ? 
41 AC5 8  ASN B 44  ? ASN B 44   . ? 1_555 ? 
42 AC5 8  THR B 45  ? THR B 45   . ? 1_555 ? 
43 AC5 8  PHE B 120 ? PHE B 120  . ? 1_555 ? 
44 AC5 8  HOH S .   ? HOH B 2190 . ? 1_555 ? 
45 AC5 8  HOH S .   ? HOH B 2191 . ? 1_555 ? 
46 AC5 8  HOH S .   ? HOH B 2192 . ? 1_555 ? 
47 AC5 8  HOH S .   ? HOH B 2193 . ? 1_555 ? 
48 AC6 5  ARG B 85  ? ARG B 85   . ? 1_555 ? 
49 AC6 5  HOH S .   ? HOH B 2194 . ? 1_555 ? 
50 AC6 5  HOH S .   ? HOH B 2195 . ? 1_555 ? 
51 AC6 5  HOH S .   ? HOH B 2196 . ? 1_555 ? 
52 AC6 5  HOH S .   ? HOH B 2197 . ? 1_555 ? 
53 AC7 3  MET B 29  ? MET B 29   . ? 1_555 ? 
54 AC7 3  HOH S .   ? HOH B 2198 . ? 1_555 ? 
55 AC7 3  HOH S .   ? HOH B 2199 . ? 1_555 ? 
56 AC8 3  ASN A 62  ? ASN A 62   . ? 1_555 ? 
57 AC8 3  VAL A 63  ? VAL A 63   . ? 1_555 ? 
58 AC8 3  LYS A 98  ? LYS A 98   . ? 1_565 ? 
59 AC9 5  GLN A 55  ? GLN A 55   . ? 1_555 ? 
60 AC9 5  TYR A 115 ? TYR A 115  . ? 1_555 ? 
61 AC9 5  HOH R .   ? HOH A 2063 . ? 1_565 ? 
62 AC9 5  HOH R .   ? HOH A 2098 . ? 1_555 ? 
63 AC9 5  HOH R .   ? HOH A 2160 . ? 1_555 ? 
64 BC1 3  ASN A 27  ? ASN A 27   . ? 1_565 ? 
65 BC1 3  GLU A 111 ? GLU A 111  . ? 1_555 ? 
66 BC1 3  GLY A 112 ? GLY A 112  . ? 1_555 ? 
67 BC2 3  SER A 15  ? SER A 15   . ? 1_555 ? 
68 BC2 3  HIS A 48  ? HIS A 48   . ? 1_555 ? 
69 BC2 3  HOH R .   ? HOH A 2177 . ? 1_555 ? 
70 BC3 5  ASN B 62  ? ASN B 62   . ? 1_555 ? 
71 BC3 5  VAL B 63  ? VAL B 63   . ? 1_555 ? 
72 BC3 5  LYS B 98  ? LYS B 98   . ? 1_565 ? 
73 BC3 5  HOH S .   ? HOH B 2189 . ? 1_565 ? 
74 BC3 5  HOH S .   ? HOH B 2200 . ? 1_555 ? 
75 BC4 1  HOH S .   ? HOH B 2201 . ? 1_555 ? 
76 BC5 2  IAS B 67  ? IAS B 67   . ? 1_555 ? 
77 BC5 2  HOH S .   ? HOH B 2202 . ? 1_555 ? 
78 BC6 3  SER B 22  ? SER B 22   . ? 1_555 ? 
79 BC6 3  HOH S .   ? HOH B 2203 . ? 1_555 ? 
80 BC6 3  HOH S .   ? HOH B 2204 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DY5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DY5 
_atom_sites.fract_transf_matrix[1][1]   0.016309 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001298 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026688 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022335 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . LYS A 1 1   ? 2.087  8.496   42.816 1.00 8.63  ? 1    LYS A N    1 
ATOM   2    C CA   . LYS A 1 1   ? 2.505  9.252   41.652 1.00 5.60  ? 1    LYS A CA   1 
ATOM   3    C C    . LYS A 1 1   ? 4.014  9.496   41.721 1.00 5.44  ? 1    LYS A C    1 
ATOM   4    O O    . LYS A 1 1   ? 4.592  9.405   42.801 1.00 8.34  ? 1    LYS A O    1 
ATOM   5    C CB   . LYS A 1 1   ? 1.718  10.540  41.464 1.00 5.29  ? 1    LYS A CB   1 
ATOM   6    C CG   . LYS A 1 1   ? 2.180  11.630  42.428 1.00 7.43  ? 1    LYS A CG   1 
ATOM   7    C CD   . LYS A 1 1   ? 1.283  12.850  42.369 1.00 7.20  ? 1    LYS A CD   1 
ATOM   8    C CE   . LYS A 1 1   ? 1.839  13.786  43.417 1.00 7.33  ? 1    LYS A CE   1 
ATOM   9    N NZ   . LYS A 1 1   ? 0.949  14.961  43.498 1.00 7.08  ? 1    LYS A NZ   1 
ATOM   10   H H1   . LYS A 1 1   ? 2.581  7.734   42.876 1.00 12.95 ? 1    LYS A H1   1 
ATOM   11   H H2   . LYS A 1 1   ? 2.212  8.998   43.565 1.00 12.95 ? 1    LYS A H2   1 
ATOM   12   H H3   . LYS A 1 1   ? 1.206  8.281   42.739 1.00 12.95 ? 1    LYS A H3   1 
ATOM   13   H HA   . LYS A 1 1   ? 2.333  8.680   40.850 1.00 6.73  ? 1    LYS A HA   1 
ATOM   14   H HB2  . LYS A 1 1   ? 1.831  10.859  40.533 1.00 6.34  ? 1    LYS A HB2  1 
ATOM   15   H HB3  . LYS A 1 1   ? 0.756  10.360  41.611 1.00 6.34  ? 1    LYS A HB3  1 
ATOM   16   H HG2  . LYS A 1 1   ? 2.182  11.270  43.351 1.00 8.91  ? 1    LYS A HG2  1 
ATOM   17   H HG3  . LYS A 1 1   ? 3.107  11.895  42.202 1.00 8.91  ? 1    LYS A HG3  1 
ATOM   18   H HD2  . LYS A 1 1   ? 1.316  13.267  41.472 1.00 8.64  ? 1    LYS A HD2  1 
ATOM   19   H HD3  . LYS A 1 1   ? 0.346  12.607  42.576 1.00 8.64  ? 1    LYS A HD3  1 
ATOM   20   H HE2  . LYS A 1 1   ? 1.880  13.329  44.294 1.00 8.80  ? 1    LYS A HE2  1 
ATOM   21   H HE3  . LYS A 1 1   ? 2.754  14.069  43.169 1.00 8.80  ? 1    LYS A HE3  1 
ATOM   22   H HZ1  . LYS A 1 1   ? 0.107  14.689  43.713 1.00 10.63 ? 1    LYS A HZ1  1 
ATOM   23   H HZ2  . LYS A 1 1   ? 1.256  15.530  44.138 1.00 10.63 ? 1    LYS A HZ2  1 
ATOM   24   H HZ3  . LYS A 1 1   ? 0.934  15.387  42.694 1.00 10.63 ? 1    LYS A HZ3  1 
ATOM   25   N N    . GLU A 1 2   ? 4.580  9.856   40.602 1.00 4.82  ? 2    GLU A N    1 
ATOM   26   C CA   . GLU A 1 2   ? 6.021  10.169  40.533 1.00 5.18  ? 2    GLU A CA   1 
ATOM   27   C C    . GLU A 1 2   ? 6.237  11.546  39.899 1.00 5.59  ? 2    GLU A C    1 
ATOM   28   O O    . GLU A 1 2   ? 5.923  11.782  38.741 1.00 5.89  ? 2    GLU A O    1 
ATOM   29   C CB   . GLU A 1 2   ? 6.754  9.143   39.664 1.00 5.68  ? 2    GLU A CB   1 
ATOM   30   C CG   . GLU A 1 2   ? 6.676  7.733   40.213 1.00 7.85  ? 2    GLU A CG   1 
ATOM   31   C CD   . GLU A 1 2   ? 7.359  6.781   39.220 1.00 7.40  ? 2    GLU A CD   1 
ATOM   32   O OE1  . GLU A 1 2   ? 6.785  6.458   38.174 1.00 9.41  ? 2    GLU A OE1  1 
ATOM   33   O OE2  . GLU A 1 2   ? 8.525  6.372   39.530 1.00 9.01  ? 2    GLU A OE2  1 
ATOM   34   H H    . GLU A 1 2   ? 4.091  9.913   39.872 1.00 5.79  ? 2    GLU A H    1 
ATOM   35   H HA   . GLU A 1 2   ? 6.408  10.162  41.455 1.00 6.21  ? 2    GLU A HA   1 
ATOM   36   H HB2  . GLU A 1 2   ? 6.364  9.155   38.754 1.00 6.82  ? 2    GLU A HB2  1 
ATOM   37   H HB3  . GLU A 1 2   ? 7.705  9.406   39.588 1.00 6.82  ? 2    GLU A HB3  1 
ATOM   38   H HG2  . GLU A 1 2   ? 7.130  7.687   41.091 1.00 9.42  ? 2    GLU A HG2  1 
ATOM   39   H HG3  . GLU A 1 2   ? 5.730  7.470   40.337 1.00 9.42  ? 2    GLU A HG3  1 
ATOM   40   N N    . THR A 1 3   ? 6.845  12.446  40.709 1.00 5.71  ? 3    THR A N    1 
ATOM   41   C CA   . THR A 1 3   ? 7.366  13.651  40.118 1.00 5.96  ? 3    THR A CA   1 
ATOM   42   C C    . THR A 1 3   ? 8.439  13.268  39.086 1.00 5.65  ? 3    THR A C    1 
ATOM   43   O O    . THR A 1 3   ? 8.950  12.165  39.081 1.00 5.40  ? 3    THR A O    1 
ATOM   44   C CB   . THR A 1 3   ? 7.967  14.575  41.186 1.00 8.08  ? 3    THR A CB   1 
ATOM   45   O OG1  . THR A 1 3   ? 9.114  13.852  41.705 1.00 7.85  ? 3    THR A OG1  1 
ATOM   46   C CG2  . THR A 1 3   ? 6.998  14.907  42.304 1.00 9.40  ? 3    THR A CG2  1 
ATOM   47   H H    . THR A 1 3   ? 6.919  12.297  41.573 1.00 6.85  ? 3    THR A H    1 
ATOM   48   H HA   . THR A 1 3   ? 6.624  14.133  39.652 1.00 7.15  ? 3    THR A HA   1 
ATOM   49   H HB   . THR A 1 3   ? 8.277  15.422  40.755 1.00 9.70  ? 3    THR A HB   1 
ATOM   50   H HG1  . THR A 1 3   ? 9.486  14.310  42.303 1.00 11.78 ? 3    THR A HG1  1 
ATOM   51   H HG21 . THR A 1 3   ? 6.718  14.081  42.750 1.00 14.10 ? 3    THR A HG21 1 
ATOM   52   H HG22 . THR A 1 3   ? 7.437  15.495  42.953 1.00 14.10 ? 3    THR A HG22 1 
ATOM   53   H HG23 . THR A 1 3   ? 6.213  15.360  41.932 1.00 14.10 ? 3    THR A HG23 1 
ATOM   54   N N    . ALA A 1 4   ? 8.819  14.243  38.237 1.00 6.50  ? 4    ALA A N    1 
ATOM   55   C CA   . ALA A 1 4   ? 9.862  13.948  37.262 1.00 6.55  ? 4    ALA A CA   1 
ATOM   56   C C    . ALA A 1 4   ? 11.142 13.529  37.996 1.00 6.19  ? 4    ALA A C    1 
ATOM   57   O O    . ALA A 1 4   ? 11.827 12.625  37.522 1.00 6.14  ? 4    ALA A O    1 
ATOM   58   C CB   . ALA A 1 4   ? 10.109 15.190  36.419 1.00 9.23  ? 4    ALA A CB   1 
ATOM   59   H H    . ALA A 1 4   ? 8.446  15.039  38.270 1.00 7.80  ? 4    ALA A H    1 
ATOM   60   H HA   . ALA A 1 4   ? 9.560  13.201  36.670 1.00 7.86  ? 4    ALA A HA   1 
ATOM   61   H HB1  . ALA A 1 4   ? 10.810 15.003  35.760 1.00 13.84 ? 4    ALA A HB1  1 
ATOM   62   H HB2  . ALA A 1 4   ? 9.282  15.439  35.955 1.00 13.84 ? 4    ALA A HB2  1 
ATOM   63   H HB3  . ALA A 1 4   ? 10.393 15.927  36.999 1.00 13.84 ? 4    ALA A HB3  1 
ATOM   64   N N    . ALA A 1 5   ? 11.479 14.229  39.087 1.00 6.39  ? 5    ALA A N    1 
ATOM   65   C CA   . ALA A 1 5   ? 12.687 13.883  39.829 1.00 6.91  ? 5    ALA A CA   1 
ATOM   66   C C    . ALA A 1 5   ? 12.592 12.471  40.372 1.00 6.52  ? 5    ALA A C    1 
ATOM   67   O O    . ALA A 1 5   ? 13.595 11.723  40.351 1.00 7.23  ? 5    ALA A O    1 
ATOM   68   C CB   . ALA A 1 5   ? 12.935 14.882  40.937 1.00 9.65  ? 5    ALA A CB   1 
ATOM   69   H H    . ALA A 1 5   ? 10.972 14.896  39.357 1.00 7.67  ? 5    ALA A H    1 
ATOM   70   H HA   . ALA A 1 5   ? 13.462 13.922  39.197 1.00 8.29  ? 5    ALA A HA   1 
ATOM   71   H HB1  . ALA A 1 5   ? 12.984 15.785  40.558 1.00 14.48 ? 5    ALA A HB1  1 
ATOM   72   H HB2  . ALA A 1 5   ? 12.200 14.840  41.585 1.00 14.48 ? 5    ALA A HB2  1 
ATOM   73   H HB3  . ALA A 1 5   ? 13.779 14.670  41.386 1.00 14.48 ? 5    ALA A HB3  1 
ATOM   74   N N    . ALA A 1 6   ? 11.436 12.088  40.929 1.00 6.13  ? 6    ALA A N    1 
ATOM   75   C CA   . ALA A 1 6   ? 11.271 10.758  41.473 1.00 6.39  ? 6    ALA A CA   1 
ATOM   76   C C    . ALA A 1 6   ? 11.343 9.677   40.414 1.00 6.24  ? 6    ALA A C    1 
ATOM   77   O O    . ALA A 1 6   ? 11.899 8.596   40.616 1.00 7.09  ? 6    ALA A O    1 
ATOM   78   C CB   . ALA A 1 6   ? 9.920  10.661  42.210 1.00 7.53  ? 6    ALA A CB   1 
ATOM   79   H H    . ALA A 1 6   ? 10.765 12.656  40.964 1.00 7.35  ? 6    ALA A H    1 
ATOM   80   H HA   . ALA A 1 6   ? 12.002 10.598  42.136 1.00 7.67  ? 6    ALA A HA   1 
ATOM   81   H HB1  . ALA A 1 6   ? 9.869  11.363  42.891 1.00 11.30 ? 6    ALA A HB1  1 
ATOM   82   H HB2  . ALA A 1 6   ? 9.189  10.775  41.567 1.00 11.30 ? 6    ALA A HB2  1 
ATOM   83   H HB3  . ALA A 1 6   ? 9.844  9.783   42.639 1.00 11.30 ? 6    ALA A HB3  1 
ATOM   84   N N    . LYS A 1 7   ? 10.771 9.957   39.241 1.00 5.57  ? 7    LYS A N    1 
ATOM   85   C CA   . LYS A 1 7   ? 10.834 8.995   38.166 1.00 5.39  ? 7    LYS A CA   1 
ATOM   86   C C    . LYS A 1 7   ? 12.280 8.807   37.690 1.00 4.87  ? 7    LYS A C    1 
ATOM   87   O O    . LYS A 1 7   ? 12.687 7.688   37.366 1.00 5.20  ? 7    LYS A O    1 
ATOM   88   C CB   . LYS A 1 7   ? 9.903  9.390   37.022 1.00 5.87  ? 7    LYS A CB   1 
ATOM   89   C CG   . LYS A 1 7   ? 9.801  8.265   36.009 1.00 8.51  ? 7    LYS A CG   1 
ATOM   90   C CD   . LYS A 1 7   ? 8.704  8.370   35.075 1.00 10.50 ? 7    LYS A CD   1 
ATOM   91   C CE   . LYS A 1 7   ? 8.944  9.367   34.136 1.00 10.90 ? 7    LYS A CE   1 
ATOM   92   N NZ   . LYS A 1 7   ? 7.807  9.313   33.090 1.00 14.35 ? 7    LYS A NZ   1 
ATOM   93   H H    . LYS A 1 7   ? 10.357 10.725  39.123 1.00 6.68  ? 7    LYS A H    1 
ATOM   94   H HA   . LYS A 1 7   ? 10.517 8.118   38.526 1.00 6.46  ? 7    LYS A HA   1 
ATOM   95   H HB2  . LYS A 1 7   ? 9.004  9.595   37.382 1.00 7.04  ? 7    LYS A HB2  1 
ATOM   96   H HB3  . LYS A 1 7   ? 10.250 10.205  36.579 1.00 7.04  ? 7    LYS A HB3  1 
ATOM   97   H HG2  . LYS A 1 7   ? 10.647 8.229   35.496 1.00 10.21 ? 7    LYS A HG2  1 
ATOM   98   H HG3  . LYS A 1 7   ? 9.714  7.410   36.499 1.00 10.21 ? 7    LYS A HG3  1 
ATOM   99   H HD2  . LYS A 1 7   ? 8.582  7.504   34.612 1.00 12.60 ? 7    LYS A HD2  1 
ATOM   100  H HD3  . LYS A 1 7   ? 7.870  8.575   35.567 1.00 12.60 ? 7    LYS A HD3  1 
ATOM   101  H HE2  . LYS A 1 7   ? 8.961  10.254  34.576 1.00 13.09 ? 7    LYS A HE2  1 
ATOM   102  H HE3  . LYS A 1 7   ? 9.819  9.219   33.697 1.00 13.09 ? 7    LYS A HE3  1 
ATOM   103  H HZ1  . LYS A 1 7   ? 7.796  8.493   32.696 1.00 21.53 ? 7    LYS A HZ1  1 
ATOM   104  H HZ2  . LYS A 1 7   ? 7.009  9.463   33.501 1.00 21.53 ? 7    LYS A HZ2  1 
ATOM   105  H HZ3  . LYS A 1 7   ? 7.947  9.952   32.457 1.00 21.53 ? 7    LYS A HZ3  1 
ATOM   106  N N    . PHE A 1 8   ? 13.054 9.897   37.661 1.00 4.97  ? 8    PHE A N    1 
ATOM   107  C CA   . PHE A 1 8   ? 14.470 9.767   37.321 1.00 4.78  ? 8    PHE A CA   1 
ATOM   108  C C    . PHE A 1 8   ? 15.169 8.842   38.278 1.00 4.55  ? 8    PHE A C    1 
ATOM   109  O O    . PHE A 1 8   ? 16.000 8.001   37.896 1.00 4.77  ? 8    PHE A O    1 
ATOM   110  C CB   . PHE A 1 8   ? 15.115 11.165  37.287 1.00 5.20  ? 8    PHE A CB   1 
ATOM   111  C CG   . PHE A 1 8   ? 16.626 11.119  37.078 1.00 4.66  ? 8    PHE A CG   1 
ATOM   112  C CD1  . PHE A 1 8   ? 17.480 11.005  38.170 1.00 5.77  ? 8    PHE A CD1  1 
ATOM   113  C CD2  . PHE A 1 8   ? 17.127 11.182  35.794 1.00 5.48  ? 8    PHE A CD2  1 
ATOM   114  C CE1  . PHE A 1 8   ? 18.868 10.914  37.965 1.00 5.65  ? 8    PHE A CE1  1 
ATOM   115  C CE2  . PHE A 1 8   ? 18.529 11.120  35.592 1.00 5.92  ? 8    PHE A CE2  1 
ATOM   116  C CZ   . PHE A 1 8   ? 19.364 10.974  36.649 1.00 5.68  ? 8    PHE A CZ   1 
ATOM   117  H H    . PHE A 1 8   ? 12.714 10.687  37.846 1.00 5.97  ? 8    PHE A H    1 
ATOM   118  H HA   . PHE A 1 8   ? 14.535 9.372   36.404 1.00 5.74  ? 8    PHE A HA   1 
ATOM   119  H HB2  . PHE A 1 8   ? 14.705 11.691  36.556 1.00 6.24  ? 8    PHE A HB2  1 
ATOM   120  H HB3  . PHE A 1 8   ? 14.922 11.630  38.139 1.00 6.24  ? 8    PHE A HB3  1 
ATOM   121  H HD1  . PHE A 1 8   ? 17.126 10.989  39.051 1.00 6.93  ? 8    PHE A HD1  1 
ATOM   122  H HD2  . PHE A 1 8   ? 16.539 11.265  35.052 1.00 6.58  ? 8    PHE A HD2  1 
ATOM   123  H HE1  . PHE A 1 8   ? 19.460 10.814  38.701 1.00 6.78  ? 8    PHE A HE1  1 
ATOM   124  H HE2  . PHE A 1 8   ? 18.885 11.181  34.713 1.00 7.10  ? 8    PHE A HE2  1 
ATOM   125  H HZ   . PHE A 1 8   ? 20.300 10.911  36.499 1.00 6.82  ? 8    PHE A HZ   1 
ATOM   126  N N    . GLU A 1 9   ? 14.884 8.967   39.584 1.00 5.07  ? 9    GLU A N    1 
ATOM   127  C CA   . GLU A 1 9   ? 15.499 8.100   40.552 1.00 5.31  ? 9    GLU A CA   1 
ATOM   128  C C    . GLU A 1 9   ? 15.136 6.623   40.304 1.00 4.89  ? 9    GLU A C    1 
ATOM   129  O O    . GLU A 1 9   ? 15.990 5.741   40.325 1.00 5.19  ? 9    GLU A O    1 
ATOM   130  C CB   . GLU A 1 9   ? 15.108 8.536   41.982 1.00 6.79  ? 9    GLU A CB   1 
ATOM   131  C CG   A GLU A 1 9   ? 15.684 9.836   42.467 0.43 7.41  ? 9    GLU A CG   1 
ATOM   132  C CG   B GLU A 1 9   ? 15.339 10.018  42.267 0.23 5.72  ? 9    GLU A CG   1 
ATOM   133  C CG   C GLU A 1 9   ? 15.963 7.805   43.018 0.34 9.16  ? 9    GLU A CG   1 
ATOM   134  C CD   A GLU A 1 9   ? 15.325 10.199  43.912 0.43 11.39 ? 9    GLU A CD   1 
ATOM   135  C CD   B GLU A 1 9   ? 14.603 10.610  43.455 0.23 6.65  ? 9    GLU A CD   1 
ATOM   136  C CD   C GLU A 1 9   ? 15.904 8.188   44.469 0.34 12.24 ? 9    GLU A CD   1 
ATOM   137  O OE1  A GLU A 1 9   ? 15.624 9.356   44.730 0.43 17.21 ? 9    GLU A OE1  1 
ATOM   138  O OE1  B GLU A 1 9   ? 13.783 9.958   44.139 0.23 9.72  ? 9    GLU A OE1  1 
ATOM   139  O OE1  C GLU A 1 9   ? 14.876 8.566   44.988 0.34 17.96 ? 9    GLU A OE1  1 
ATOM   140  O OE2  A GLU A 1 9   ? 14.884 11.321  44.190 0.43 22.66 ? 9    GLU A OE2  1 
ATOM   141  O OE2  B GLU A 1 9   ? 14.855 11.800  43.827 0.23 9.69  ? 9    GLU A OE2  1 
ATOM   142  O OE2  C GLU A 1 9   ? 16.859 8.129   45.259 0.34 17.03 ? 9    GLU A OE2  1 
ATOM   143  H H    . GLU A 1 9   ? 14.316 9.585   39.850 1.00 6.09  ? 9    GLU A H    1 
ATOM   144  H HA   . GLU A 1 9   ? 16.490 8.193   40.462 1.00 6.38  ? 9    GLU A HA   1 
ATOM   145  H HB2  A GLU A 1 9   ? 14.121 8.600   42.026 1.00 8.15  ? 9    GLU A HB2  1 
ATOM   146  H HB3  A GLU A 1 9   ? 15.385 7.822   42.609 1.00 8.15  ? 9    GLU A HB3  1 
ATOM   147  H HG2  A GLU A 1 9   ? 16.670 9.792   42.388 0.43 8.89  ? 9    GLU A HG2  1 
ATOM   148  H HG2  B GLU A 1 9   ? 16.309 10.156  42.407 0.23 6.87  ? 9    GLU A HG2  1 
ATOM   149  H HG2  C GLU A 1 9   ? 15.734 6.844   42.960 0.34 10.99 ? 9    GLU A HG2  1 
ATOM   150  H HG3  A GLU A 1 9   ? 15.369 10.562  41.872 0.43 8.89  ? 9    GLU A HG3  1 
ATOM   151  H HG3  B GLU A 1 9   ? 15.082 10.530  41.460 0.23 6.87  ? 9    GLU A HG3  1 
ATOM   152  H HG3  C GLU A 1 9   ? 16.907 7.892   42.731 0.34 10.99 ? 9    GLU A HG3  1 
ATOM   153  N N    . ARG A 1 10  ? 13.850 6.352   40.041 1.00 4.99  ? 10   ARG A N    1 
ATOM   154  C CA   . ARG A 1 10  ? 13.411 4.976   39.769 1.00 5.26  ? 10   ARG A CA   1 
ATOM   155  C C    . ARG A 1 10  ? 14.087 4.423   38.526 1.00 4.98  ? 10   ARG A C    1 
ATOM   156  O O    . ARG A 1 10  ? 14.490 3.250   38.471 1.00 5.88  ? 10   ARG A O    1 
ATOM   157  C CB   . ARG A 1 10  ? 11.899 4.870   39.596 1.00 6.64  ? 10   ARG A CB   1 
ATOM   158  C CG   . ARG A 1 10  ? 11.477 3.422   39.027 1.00 7.58  ? 10   ARG A CG   1 
ATOM   159  C CD   . ARG A 1 10  ? 9.997  3.268   39.033 1.00 7.42  ? 10   ARG A CD   1 
ATOM   160  N NE   . ARG A 1 10  ? 9.350  4.182   38.123 1.00 7.29  ? 10   ARG A NE   1 
ATOM   161  C CZ   . ARG A 1 10  ? 8.985  3.998   36.856 1.00 6.78  ? 10   ARG A CZ   1 
ATOM   162  N NH1  . ARG A 1 10  ? 9.442  2.982   36.136 1.00 8.75  ? 10   ARG A NH1  1 
ATOM   163  N NH2  . ARG A 1 10  ? 8.139  4.862   36.292 1.00 7.88  ? 10   ARG A NH2  1 
ATOM   164  H H    . ARG A 1 10  ? 13.261 7.006   40.032 1.00 5.99  ? 10   ARG A H    1 
ATOM   165  H HA   . ARG A 1 10  ? 13.675 4.406   40.546 1.00 6.31  ? 10   ARG A HA   1 
ATOM   166  H HB2  . ARG A 1 10  ? 11.457 5.022   40.469 1.00 7.97  ? 10   ARG A HB2  1 
ATOM   167  H HB3  . ARG A 1 10  ? 11.589 5.573   38.971 1.00 7.97  ? 10   ARG A HB3  1 
ATOM   168  H HG2  . ARG A 1 10  ? 11.817 3.319   38.103 1.00 9.10  ? 10   ARG A HG2  1 
ATOM   169  H HG3  . ARG A 1 10  ? 11.886 2.715   39.586 1.00 9.10  ? 10   ARG A HG3  1 
ATOM   170  H HD2  . ARG A 1 10  ? 9.765  2.339   38.780 1.00 8.90  ? 10   ARG A HD2  1 
ATOM   171  H HD3  . ARG A 1 10  ? 9.657  3.427   39.949 1.00 8.90  ? 10   ARG A HD3  1 
ATOM   172  H HE   . ARG A 1 10  ? 9.172  4.978   38.454 1.00 8.75  ? 10   ARG A HE   1 
ATOM   173  H HH11 . ARG A 1 10  ? 10.003 2.406   36.494 1.00 10.50 ? 10   ARG A HH11 1 
ATOM   174  H HH12 . ARG A 1 10  ? 9.184  2.883   35.300 1.00 10.50 ? 10   ARG A HH12 1 
ATOM   175  H HH21 . ARG A 1 10  ? 7.827  5.540   36.758 1.00 9.45  ? 10   ARG A HH21 1 
ATOM   176  H HH22 . ARG A 1 10  ? 7.891  4.753   35.455 1.00 9.45  ? 10   ARG A HH22 1 
ATOM   177  N N    . GLN A 1 11  ? 14.101 5.215   37.459 1.00 4.65  ? 11   GLN A N    1 
ATOM   178  C CA   . GLN A 1 11  ? 14.555 4.692   36.183 1.00 4.73  ? 11   GLN A CA   1 
ATOM   179  C C    . GLN A 1 11  ? 16.069 4.647   36.070 1.00 4.86  ? 11   GLN A C    1 
ATOM   180  O O    . GLN A 1 11  ? 16.565 3.884   35.249 1.00 6.39  ? 11   GLN A O    1 
ATOM   181  C CB   A GLN A 1 11  ? 13.881 5.480   35.069 0.65 5.55  ? 11   GLN A CB   1 
ATOM   182  C CB   B GLN A 1 11  ? 14.129 5.590   35.010 0.35 6.70  ? 11   GLN A CB   1 
ATOM   183  C CG   A GLN A 1 11  ? 12.345 5.428   35.127 0.65 4.99  ? 11   GLN A CG   1 
ATOM   184  C CG   B GLN A 1 11  ? 12.669 5.460   34.670 0.35 5.29  ? 11   GLN A CG   1 
ATOM   185  C CD   A GLN A 1 11  ? 11.635 6.035   33.971 0.65 6.29  ? 11   GLN A CD   1 
ATOM   186  C CD   B GLN A 1 11  ? 12.424 5.861   33.233 0.35 8.34  ? 11   GLN A CD   1 
ATOM   187  O OE1  A GLN A 1 11  ? 10.601 5.499   33.474 0.65 10.46 ? 11   GLN A OE1  1 
ATOM   188  O OE1  B GLN A 1 11  ? 12.211 4.991   32.430 0.35 11.20 ? 11   GLN A OE1  1 
ATOM   189  N NE2  A GLN A 1 11  ? 12.104 7.146   33.529 0.65 7.61  ? 11   GLN A NE2  1 
ATOM   190  N NE2  B GLN A 1 11  ? 12.509 7.124   32.972 0.35 12.34 ? 11   GLN A NE2  1 
ATOM   191  H H    . GLN A 1 11  ? 13.837 6.052   37.526 1.00 5.59  ? 11   GLN A H    1 
ATOM   192  H HA   A GLN A 1 11  ? 14.226 3.749   36.117 1.00 5.68  ? 11   GLN A HA   1 
ATOM   193  H HB2  A GLN A 1 11  ? 14.172 6.425   35.123 0.65 6.67  ? 11   GLN A HB2  1 
ATOM   194  H HB2  B GLN A 1 11  ? 14.324 6.533   35.239 0.35 8.04  ? 11   GLN A HB2  1 
ATOM   195  H HB3  A GLN A 1 11  ? 14.181 5.122   34.196 0.65 6.67  ? 11   GLN A HB3  1 
ATOM   196  H HB3  B GLN A 1 11  ? 14.667 5.355   34.213 0.35 8.04  ? 11   GLN A HB3  1 
ATOM   197  H HG2  A GLN A 1 11  ? 12.068 4.480   35.200 0.65 5.98  ? 11   GLN A HG2  1 
ATOM   198  H HG2  B GLN A 1 11  ? 12.378 4.524   34.808 0.35 6.35  ? 11   GLN A HG2  1 
ATOM   199  H HG3  A GLN A 1 11  ? 12.048 5.888   35.952 0.65 5.98  ? 11   GLN A HG3  1 
ATOM   200  H HG3  B GLN A 1 11  ? 12.136 6.039   35.271 0.35 6.35  ? 11   GLN A HG3  1 
ATOM   201  H HE21 A GLN A 1 11  ? 12.824 7.496   33.894 0.65 9.13  ? 11   GLN A HE21 1 
ATOM   202  H HE21 B GLN A 1 11  ? 12.669 7.697   33.620 0.35 14.81 ? 11   GLN A HE21 1 
ATOM   203  H HE22 A GLN A 1 11  ? 11.704 7.557   32.861 0.65 9.13  ? 11   GLN A HE22 1 
ATOM   204  H HE22 B GLN A 1 11  ? 12.407 7.411   32.146 0.35 14.81 ? 11   GLN A HE22 1 
ATOM   205  N N    . HIS A 1 12  ? 16.785 5.513   36.805 1.00 4.19  ? 12   HIS A N    1 
ATOM   206  C CA   . HIS A 1 12  ? 18.193 5.733   36.489 1.00 4.61  ? 12   HIS A CA   1 
ATOM   207  C C    . HIS A 1 12  ? 19.156 5.698   37.669 1.00 4.68  ? 12   HIS A C    1 
ATOM   208  O O    . HIS A 1 12  ? 20.348 5.728   37.391 1.00 7.42  ? 12   HIS A O    1 
ATOM   209  C CB   . HIS A 1 12  ? 18.401 7.054   35.731 1.00 5.19  ? 12   HIS A CB   1 
ATOM   210  C CG   . HIS A 1 12  ? 17.684 7.082   34.448 1.00 5.27  ? 12   HIS A CG   1 
ATOM   211  N ND1  . HIS A 1 12  ? 18.016 6.259   33.408 1.00 5.12  ? 12   HIS A ND1  1 
ATOM   212  C CD2  . HIS A 1 12  ? 16.584 7.774   34.038 1.00 6.63  ? 12   HIS A CD2  1 
ATOM   213  C CE1  . HIS A 1 12  ? 17.172 6.441   32.398 1.00 6.03  ? 12   HIS A CE1  1 
ATOM   214  N NE2  . HIS A 1 12  ? 16.293 7.364   32.762 1.00 6.94  ? 12   HIS A NE2  1 
ATOM   215  H H    . HIS A 1 12  ? 16.409 5.944   37.473 1.00 5.03  ? 12   HIS A H    1 
ATOM   216  H HA   . HIS A 1 12  ? 18.468 4.997   35.869 1.00 5.53  ? 12   HIS A HA   1 
ATOM   217  H HB2  . HIS A 1 12  ? 18.085 7.805   36.294 1.00 6.22  ? 12   HIS A HB2  1 
ATOM   218  H HB3  . HIS A 1 12  ? 19.368 7.185   35.565 1.00 6.22  ? 12   HIS A HB3  1 
ATOM   219  H HD1  . HIS A 1 12  ? 18.689 5.693   33.408 1.00 6.15  ? 12   HIS A HD1  1 
ATOM   220  H HD2  . HIS A 1 12  ? 16.106 8.421   34.543 1.00 7.95  ? 12   HIS A HD2  1 
ATOM   221  H HE1  . HIS A 1 12  ? 17.195 5.989   31.562 1.00 7.24  ? 12   HIS A HE1  1 
ATOM   222  N N    . MET A 1 13  ? 18.702 5.661   38.913 1.00 4.25  ? 13   MET A N    1 
ATOM   223  C CA   . MET A 1 13  ? 19.656 5.668   40.028 1.00 4.26  ? 13   MET A CA   1 
ATOM   224  C C    . MET A 1 13  ? 19.728 4.312   40.705 1.00 4.22  ? 13   MET A C    1 
ATOM   225  O O    . MET A 1 13  ? 18.719 3.723   41.075 1.00 5.31  ? 13   MET A O    1 
ATOM   226  C CB   . MET A 1 13  ? 19.219 6.692   41.083 1.00 4.51  ? 13   MET A CB   1 
ATOM   227  C CG   . MET A 1 13  ? 19.350 8.128   40.647 1.00 4.89  ? 13   MET A CG   1 
ATOM   228  S SD   . MET A 1 13  ? 21.033 8.677   40.288 1.00 5.42  ? 13   MET A SD   1 
ATOM   229  C CE   . MET A 1 13  ? 21.821 8.288   41.849 1.00 7.55  ? 13   MET A CE   1 
ATOM   230  H H    . MET A 1 13  ? 17.837 5.631   39.069 1.00 5.10  ? 13   MET A H    1 
ATOM   231  H HA   . MET A 1 13  ? 20.562 5.914   39.685 1.00 5.12  ? 13   MET A HA   1 
ATOM   232  H HB2  . MET A 1 13  ? 18.274 6.518   41.322 1.00 5.41  ? 13   MET A HB2  1 
ATOM   233  H HB3  . MET A 1 13  ? 19.764 6.558   41.899 1.00 5.41  ? 13   MET A HB3  1 
ATOM   234  H HG2  . MET A 1 13  ? 18.798 8.260   39.835 1.00 5.87  ? 13   MET A HG2  1 
ATOM   235  H HG3  . MET A 1 13  ? 18.976 8.707   41.358 1.00 5.87  ? 13   MET A HG3  1 
ATOM   236  H HE1  . MET A 1 13  ? 21.741 7.328   42.025 1.00 11.33 ? 13   MET A HE1  1 
ATOM   237  H HE2  . MET A 1 13  ? 22.768 8.535   41.807 1.00 11.33 ? 13   MET A HE2  1 
ATOM   238  H HE3  . MET A 1 13  ? 21.384 8.790   42.569 1.00 11.33 ? 13   MET A HE3  1 
ATOM   239  N N    . ASP A 1 14  ? 20.957 3.835   40.916 1.00 4.19  ? 14   ASP A N    1 
ATOM   240  C CA   . ASP A 1 14  ? 21.134 2.678   41.804 1.00 4.09  ? 14   ASP A CA   1 
ATOM   241  C C    . ASP A 1 14  ? 22.435 2.838   42.564 1.00 3.98  ? 14   ASP A C    1 
ATOM   242  O O    . ASP A 1 14  ? 23.490 2.295   42.229 1.00 4.52  ? 14   ASP A O    1 
ATOM   243  C CB   . ASP A 1 14  ? 21.106 1.332   41.085 1.00 4.89  ? 14   ASP A CB   1 
ATOM   244  C CG   . ASP A 1 14  ? 21.199 0.163   42.057 1.00 5.31  ? 14   ASP A CG   1 
ATOM   245  O OD1  . ASP A 1 14  ? 21.086 0.432   43.312 1.00 5.86  ? 14   ASP A OD1  1 
ATOM   246  O OD2  . ASP A 1 14  ? 21.408 -0.962  41.608 1.00 6.83  ? 14   ASP A OD2  1 
ATOM   247  H H    . ASP A 1 14  ? 21.652 4.209   40.528 1.00 5.02  ? 14   ASP A H    1 
ATOM   248  H HA   . ASP A 1 14  ? 20.387 2.685   42.469 1.00 4.91  ? 14   ASP A HA   1 
ATOM   249  H HB2  . ASP A 1 14  ? 20.266 1.258   40.565 1.00 5.87  ? 14   ASP A HB2  1 
ATOM   250  H HB3  . ASP A 1 14  ? 21.863 1.288   40.448 1.00 5.87  ? 14   ASP A HB3  1 
ATOM   251  N N    . SER A 1 15  ? 22.334 3.597   43.685 1.00 4.99  ? 15   SER A N    1 
ATOM   252  C CA   . SER A 1 15  ? 23.451 3.826   44.553 1.00 5.45  ? 15   SER A CA   1 
ATOM   253  C C    . SER A 1 15  ? 23.793 2.623   45.443 1.00 5.41  ? 15   SER A C    1 
ATOM   254  O O    . SER A 1 15  ? 24.769 2.705   46.195 1.00 6.84  ? 15   SER A O    1 
ATOM   255  C CB   A SER A 1 15  ? 22.993 4.979   45.474 0.59 6.39  ? 15   SER A CB   1 
ATOM   256  C CB   B SER A 1 15  ? 23.396 5.148   45.341 0.41 7.57  ? 15   SER A CB   1 
ATOM   257  O OG   A SER A 1 15  ? 22.508 6.154   44.837 0.59 7.34  ? 15   SER A OG   1 
ATOM   258  O OG   B SER A 1 15  ? 22.286 4.933   46.186 0.41 10.42 ? 15   SER A OG   1 
ATOM   259  H H    . SER A 1 15  ? 21.557 3.959   43.885 1.00 5.99  ? 15   SER A H    1 
ATOM   260  H HA   A SER A 1 15  ? 24.252 4.104   44.022 1.00 6.54  ? 15   SER A HA   1 
ATOM   261  H HB2  A SER A 1 15  ? 22.280 4.633   46.067 0.59 7.67  ? 15   SER A HB2  1 
ATOM   262  H HB2  B SER A 1 15  ? 24.225 5.294   45.862 0.41 9.08  ? 15   SER A HB2  1 
ATOM   263  H HB3  A SER A 1 15  ? 23.757 5.234   46.050 0.59 7.67  ? 15   SER A HB3  1 
ATOM   264  H HB3  B SER A 1 15  ? 23.248 5.921   44.740 0.41 9.08  ? 15   SER A HB3  1 
ATOM   265  H HG   A SER A 1 15  ? 23.120 6.492   44.371 0.59 11.01 ? 15   SER A HG   1 
ATOM   266  H HG   B SER A 1 15  ? 21.603 4.784   45.720 0.41 15.63 ? 15   SER A HG   1 
ATOM   267  N N    . SER A 1 16  ? 23.034 1.532   45.359 1.00 5.40  ? 16   SER A N    1 
ATOM   268  C CA   . SER A 1 16  ? 23.177 0.412   46.253 1.00 5.76  ? 16   SER A CA   1 
ATOM   269  C C    . SER A 1 16  ? 24.253 -0.609  45.817 1.00 5.33  ? 16   SER A C    1 
ATOM   270  O O    . SER A 1 16  ? 24.496 -1.600  46.524 1.00 6.73  ? 16   SER A O    1 
ATOM   271  C CB   . SER A 1 16  ? 21.862 -0.328  46.426 1.00 7.34  ? 16   SER A CB   1 
ATOM   272  O OG   . SER A 1 16  ? 21.545 -1.210  45.395 1.00 7.98  ? 16   SER A OG   1 
ATOM   273  H H    . SER A 1 16  ? 22.420 1.494   44.730 1.00 6.48  ? 16   SER A H    1 
ATOM   274  H HA   . SER A 1 16  ? 23.443 0.770   47.148 1.00 6.91  ? 16   SER A HA   1 
ATOM   275  H HB2  . SER A 1 16  ? 21.895 -0.836  47.275 1.00 8.80  ? 16   SER A HB2  1 
ATOM   276  H HB3  . SER A 1 16  ? 21.134 0.338   46.505 1.00 8.80  ? 16   SER A HB3  1 
ATOM   277  H HG   . SER A 1 16  ? 21.509 -0.789  44.668 1.00 11.96 ? 16   SER A HG   1 
ATOM   278  N N    . THR A 1 17  ? 24.876 -0.366  44.686 1.00 5.20  ? 17   THR A N    1 
ATOM   279  C CA   . THR A 1 17  ? 25.990 -1.204  44.207 1.00 5.40  ? 17   THR A CA   1 
ATOM   280  C C    . THR A 1 17  ? 26.986 -0.218  43.573 1.00 5.27  ? 17   THR A C    1 
ATOM   281  O O    . THR A 1 17  ? 26.613 0.828   43.087 1.00 6.29  ? 17   THR A O    1 
ATOM   282  C CB   . THR A 1 17  ? 25.489 -2.280  43.227 1.00 5.58  ? 17   THR A CB   1 
ATOM   283  O OG1  . THR A 1 17  ? 26.600 -3.138  42.916 1.00 6.72  ? 17   THR A OG1  1 
ATOM   284  C CG2  . THR A 1 17  ? 24.855 -1.705  41.967 1.00 6.36  ? 17   THR A CG2  1 
ATOM   285  H H    . THR A 1 17  ? 24.619 0.320   44.198 1.00 6.24  ? 17   THR A H    1 
ATOM   286  H HA   . THR A 1 17  ? 26.424 -1.650  44.990 1.00 6.48  ? 17   THR A HA   1 
ATOM   287  H HB   . THR A 1 17  ? 24.798 -2.829  43.697 1.00 6.69  ? 17   THR A HB   1 
ATOM   288  H HG1  . THR A 1 17  ? 26.695 -3.182  42.082 1.00 10.07 ? 17   THR A HG1  1 
ATOM   289  H HG21 . THR A 1 17  ? 25.511 -1.149  41.496 1.00 9.54  ? 17   THR A HG21 1 
ATOM   290  H HG22 . THR A 1 17  ? 24.568 -2.437  41.383 1.00 9.54  ? 17   THR A HG22 1 
ATOM   291  H HG23 . THR A 1 17  ? 24.080 -1.158  42.212 1.00 9.54  ? 17   THR A HG23 1 
ATOM   292  N N    . SER A 1 18  ? 28.278 -0.614  43.565 1.00 5.02  ? 18   SER A N    1 
ATOM   293  C CA   . SER A 1 18  ? 29.261 0.314   43.012 1.00 4.88  ? 18   SER A CA   1 
ATOM   294  C C    . SER A 1 18  ? 29.375 0.267   41.491 1.00 4.37  ? 18   SER A C    1 
ATOM   295  O O    . SER A 1 18  ? 30.005 1.159   40.908 1.00 4.63  ? 18   SER A O    1 
ATOM   296  C CB   . SER A 1 18  ? 30.626 0.022   43.641 1.00 5.46  ? 18   SER A CB   1 
ATOM   297  O OG   . SER A 1 18  ? 31.054 -1.271  43.188 1.00 6.41  ? 18   SER A OG   1 
ATOM   298  H H    . SER A 1 18  ? 28.518 -1.400  43.881 1.00 6.03  ? 18   SER A H    1 
ATOM   299  H HA   . SER A 1 18  ? 28.992 1.241   43.273 1.00 5.85  ? 18   SER A HA   1 
ATOM   300  H HB2  . SER A 1 18  ? 31.281 0.712   43.368 1.00 6.56  ? 18   SER A HB2  1 
ATOM   301  H HB3  . SER A 1 18  ? 30.555 0.030   44.628 1.00 6.56  ? 18   SER A HB3  1 
ATOM   302  H HG   . SER A 1 18  ? 31.806 -1.448  43.516 1.00 9.61  ? 18   SER A HG   1 
ATOM   303  N N    . ALA A 1 19  ? 28.798 -0.749  40.893 1.00 4.68  ? 19   ALA A N    1 
ATOM   304  C CA   . ALA A 1 19  ? 28.845 -1.066  39.477 1.00 4.54  ? 19   ALA A CA   1 
ATOM   305  C C    . ALA A 1 19  ? 27.854 -2.185  39.258 1.00 4.56  ? 19   ALA A C    1 
ATOM   306  O O    . ALA A 1 19  ? 27.370 -2.796  40.231 1.00 5.06  ? 19   ALA A O    1 
ATOM   307  C CB   . ALA A 1 19  ? 30.244 -1.503  39.035 1.00 5.78  ? 19   ALA A CB   1 
ATOM   308  H H    . ALA A 1 19  ? 28.333 -1.295  41.403 1.00 5.61  ? 19   ALA A H    1 
ATOM   309  H HA   . ALA A 1 19  ? 28.565 -0.265  38.948 1.00 5.45  ? 19   ALA A HA   1 
ATOM   310  H HB1  . ALA A 1 19  ? 30.526 -2.278  39.564 1.00 8.66  ? 19   ALA A HB1  1 
ATOM   311  H HB2  . ALA A 1 19  ? 30.876 -0.767  39.172 1.00 8.66  ? 19   ALA A HB2  1 
ATOM   312  H HB3  . ALA A 1 19  ? 30.226 -1.745  38.085 1.00 8.66  ? 19   ALA A HB3  1 
ATOM   313  N N    . ALA A 1 20  ? 27.535 -2.503  38.002 1.00 4.71  ? 20   ALA A N    1 
ATOM   314  C CA   . ALA A 1 20  ? 26.626 -3.620  37.777 1.00 4.89  ? 20   ALA A CA   1 
ATOM   315  C C    . ALA A 1 20  ? 27.170 -4.824  38.536 1.00 4.72  ? 20   ALA A C    1 
ATOM   316  O O    . ALA A 1 20  ? 28.332 -5.185  38.409 1.00 5.68  ? 20   ALA A O    1 
ATOM   317  C CB   . ALA A 1 20  ? 26.541 -3.970  36.284 1.00 6.07  ? 20   ALA A CB   1 
ATOM   318  H H    . ALA A 1 20  ? 27.867 -2.050  37.325 1.00 5.66  ? 20   ALA A H    1 
ATOM   319  H HA   . ALA A 1 20  ? 25.716 -3.388  38.121 1.00 5.86  ? 20   ALA A HA   1 
ATOM   320  H HB1  . ALA A 1 20  ? 25.943 -4.736  36.161 1.00 9.10  ? 20   ALA A HB1  1 
ATOM   321  H HB2  . ALA A 1 20  ? 27.435 -4.196  35.951 1.00 9.10  ? 20   ALA A HB2  1 
ATOM   322  H HB3  . ALA A 1 20  ? 26.193 -3.200  35.787 1.00 9.10  ? 20   ALA A HB3  1 
ATOM   323  N N    . SER A 1 21  ? 26.278 -5.520  39.267 1.00 4.80  ? 21   SER A N    1 
ATOM   324  C CA   . SER A 1 21  ? 26.761 -6.551  40.191 1.00 5.15  ? 21   SER A CA   1 
ATOM   325  C C    . SER A 1 21  ? 27.214 -7.805  39.462 1.00 4.68  ? 21   SER A C    1 
ATOM   326  O O    . SER A 1 21  ? 28.043 -8.554  40.014 1.00 5.91  ? 21   SER A O    1 
ATOM   327  C CB   A SER A 1 21  ? 25.788 -6.843  41.301 0.71 6.45  ? 21   SER A CB   1 
ATOM   328  C CB   B SER A 1 21  ? 25.473 -6.868  41.028 0.29 5.89  ? 21   SER A CB   1 
ATOM   329  O OG   A SER A 1 21  ? 24.507 -6.856  40.739 0.71 6.36  ? 21   SER A OG   1 
ATOM   330  O OG   B SER A 1 21  ? 24.794 -5.751  41.613 0.29 7.12  ? 21   SER A OG   1 
ATOM   331  H H    . SER A 1 21  ? 25.417 -5.358  39.191 1.00 5.76  ? 21   SER A H    1 
ATOM   332  H HA   A SER A 1 21  ? 27.577 -6.173  40.628 1.00 6.19  ? 21   SER A HA   1 
ATOM   333  H HB2  A SER A 1 21  ? 25.991 -7.720  41.713 0.71 7.74  ? 21   SER A HB2  1 
ATOM   334  H HB2  B SER A 1 21  ? 24.834 -7.344  40.440 0.29 7.06  ? 21   SER A HB2  1 
ATOM   335  H HB3  A SER A 1 21  ? 25.849 -6.146  42.002 0.71 7.74  ? 21   SER A HB3  1 
ATOM   336  H HB3  B SER A 1 21  ? 25.725 -7.491  41.755 0.29 7.06  ? 21   SER A HB3  1 
ATOM   337  H HG   A SER A 1 21  ? 24.463 -7.457  40.155 0.71 9.53  ? 21   SER A HG   1 
ATOM   338  H HG   B SER A 1 21  ? 25.354 -5.164  41.830 0.29 10.68 ? 21   SER A HG   1 
ATOM   339  N N    . SER A 1 22  ? 26.653 -8.078  38.299 1.00 4.75  ? 22   SER A N    1 
ATOM   340  C CA   . SER A 1 22  ? 27.015 -9.242  37.483 1.00 4.77  ? 22   SER A CA   1 
ATOM   341  C C    . SER A 1 22  ? 26.394 -9.016  36.093 1.00 4.58  ? 22   SER A C    1 
ATOM   342  O O    . SER A 1 22  ? 25.636 -8.045  35.908 1.00 4.70  ? 22   SER A O    1 
ATOM   343  C CB   . SER A 1 22  ? 26.505 -10.547 38.056 1.00 5.40  ? 22   SER A CB   1 
ATOM   344  O OG   . SER A 1 22  ? 25.131 -10.701 37.817 1.00 5.90  ? 22   SER A OG   1 
ATOM   345  H H    . SER A 1 22  ? 26.031 -7.534  37.997 1.00 5.70  ? 22   SER A H    1 
ATOM   346  H HA   . SER A 1 22  ? 28.010 -9.287  37.396 1.00 5.73  ? 22   SER A HA   1 
ATOM   347  H HB2  . SER A 1 22  ? 26.997 -11.301 37.644 1.00 6.48  ? 22   SER A HB2  1 
ATOM   348  H HB3  . SER A 1 22  ? 26.673 -10.567 39.031 1.00 6.48  ? 22   SER A HB3  1 
ATOM   349  H HG   . SER A 1 22  ? 24.987 -10.686 36.989 1.00 8.85  ? 22   SER A HG   1 
ATOM   350  N N    . SER A 1 23  ? 26.604 -9.977  35.223 1.00 4.43  ? 23   SER A N    1 
ATOM   351  C CA   . SER A 1 23  ? 26.020 -9.939  33.899 1.00 4.76  ? 23   SER A CA   1 
ATOM   352  C C    . SER A 1 23  ? 24.507 -10.069 33.886 1.00 4.22  ? 23   SER A C    1 
ATOM   353  O O    . SER A 1 23  ? 23.888 -9.818  32.844 1.00 4.90  ? 23   SER A O    1 
ATOM   354  C CB   . SER A 1 23  ? 26.600 -11.028 33.025 1.00 5.19  ? 23   SER A CB   1 
ATOM   355  O OG   . SER A 1 23  ? 26.101 -12.281 33.435 1.00 5.73  ? 23   SER A OG   1 
ATOM   356  H H    . SER A 1 23  ? 27.111 -10.660 35.450 1.00 5.32  ? 23   SER A H    1 
ATOM   357  H HA   . SER A 1 23  ? 26.254 -9.059  33.487 1.00 5.71  ? 23   SER A HA   1 
ATOM   358  H HB2  . SER A 1 23  ? 26.356 -10.864 32.080 1.00 6.23  ? 23   SER A HB2  1 
ATOM   359  H HB3  . SER A 1 23  ? 27.588 -11.022 33.095 1.00 6.23  ? 23   SER A HB3  1 
ATOM   360  H HG   . SER A 1 23  ? 26.424 -12.884 32.948 1.00 8.59  ? 23   SER A HG   1 
ATOM   361  N N    . ASN A 1 24  ? 23.894 -10.455 35.012 1.00 4.46  ? 24   ASN A N    1 
ATOM   362  C CA   . ASN A 1 24  ? 22.448 -10.546 35.083 1.00 4.60  ? 24   ASN A CA   1 
ATOM   363  C C    . ASN A 1 24  ? 21.781 -9.229  35.533 1.00 4.49  ? 24   ASN A C    1 
ATOM   364  O O    . ASN A 1 24  ? 20.545 -9.154  35.572 1.00 4.94  ? 24   ASN A O    1 
ATOM   365  C CB   . ASN A 1 24  ? 21.980 -11.699 36.010 1.00 4.97  ? 24   ASN A CB   1 
ATOM   366  C CG   . ASN A 1 24  ? 22.173 -11.463 37.490 1.00 5.32  ? 24   ASN A CG   1 
ATOM   367  O OD1  . ASN A 1 24  ? 22.018 -10.342 37.985 1.00 6.09  ? 24   ASN A OD1  1 
ATOM   368  N ND2  . ASN A 1 24  ? 22.407 -12.568 38.198 1.00 5.87  ? 24   ASN A ND2  1 
ATOM   369  H H    . ASN A 1 24  ? 24.376 -10.655 35.720 1.00 5.36  ? 24   ASN A H    1 
ATOM   370  H HA   . ASN A 1 24  ? 22.116 -10.750 34.162 1.00 5.52  ? 24   ASN A HA   1 
ATOM   371  H HB2  . ASN A 1 24  ? 21.018 -11.864 35.843 1.00 5.97  ? 24   ASN A HB2  1 
ATOM   372  H HB3  . ASN A 1 24  ? 22.470 -12.521 35.758 1.00 5.97  ? 24   ASN A HB3  1 
ATOM   373  H HD21 . ASN A 1 24  ? 22.510 -13.340 37.787 1.00 7.04  ? 24   ASN A HD21 1 
ATOM   374  H HD22 . ASN A 1 24  ? 22.460 -12.526 39.075 1.00 7.04  ? 24   ASN A HD22 1 
ATOM   375  N N    . TYR A 1 25  ? 22.584 -8.207  35.822 1.00 4.48  ? 25   TYR A N    1 
ATOM   376  C CA   . TYR A 1 25  ? 22.078 -7.016  36.493 1.00 4.48  ? 25   TYR A CA   1 
ATOM   377  C C    . TYR A 1 25  ? 20.926 -6.387  35.724 1.00 4.14  ? 25   TYR A C    1 
ATOM   378  O O    . TYR A 1 25  ? 19.862 -6.117  36.292 1.00 4.62  ? 25   TYR A O    1 
ATOM   379  C CB   . TYR A 1 25  ? 23.222 -6.028  36.686 1.00 4.83  ? 25   TYR A CB   1 
ATOM   380  C CG   . TYR A 1 25  ? 22.812 -4.734  37.329 1.00 4.76  ? 25   TYR A CG   1 
ATOM   381  C CD1  . TYR A 1 25  ? 22.748 -4.578  38.703 1.00 5.29  ? 25   TYR A CD1  1 
ATOM   382  C CD2  . TYR A 1 25  ? 22.517 -3.620  36.528 1.00 5.48  ? 25   TYR A CD2  1 
ATOM   383  C CE1  . TYR A 1 25  ? 22.384 -3.359  39.289 1.00 5.67  ? 25   TYR A CE1  1 
ATOM   384  C CE2  . TYR A 1 25  ? 22.162 -2.397  37.110 1.00 6.13  ? 25   TYR A CE2  1 
ATOM   385  C CZ   . TYR A 1 25  ? 22.081 -2.295  38.485 1.00 5.98  ? 25   TYR A CZ   1 
ATOM   386  O OH   . TYR A 1 25  ? 21.707 -1.077  38.989 1.00 6.97  ? 25   TYR A OH   1 
ATOM   387  H H    . TYR A 1 25  ? 23.436 -8.252  35.605 1.00 5.38  ? 25   TYR A H    1 
ATOM   388  H HA   . TYR A 1 25  ? 21.742 -7.285  37.395 1.00 5.38  ? 25   TYR A HA   1 
ATOM   389  H HB2  . TYR A 1 25  ? 23.919 -6.454  37.244 1.00 5.80  ? 25   TYR A HB2  1 
ATOM   390  H HB3  . TYR A 1 25  ? 23.624 -5.831  35.803 1.00 5.80  ? 25   TYR A HB3  1 
ATOM   391  H HD1  . TYR A 1 25  ? 22.955 -5.318  39.262 1.00 6.34  ? 25   TYR A HD1  1 
ATOM   392  H HD2  . TYR A 1 25  ? 22.558 -3.697  35.582 1.00 6.57  ? 25   TYR A HD2  1 
ATOM   393  H HE1  . TYR A 1 25  ? 22.349 -3.272  40.234 1.00 6.80  ? 25   TYR A HE1  1 
ATOM   394  H HE2  . TYR A 1 25  ? 21.979 -1.642  36.562 1.00 7.35  ? 25   TYR A HE2  1 
ATOM   395  H HH   . TYR A 1 25  ? 21.712 -1.107  39.829 1.00 10.46 ? 25   TYR A HH   1 
ATOM   396  N N    . CYS A 1 26  ? 21.129 -6.109  34.429 1.00 4.21  ? 26   CYS A N    1 
ATOM   397  C CA   . CYS A 1 26  ? 20.061 -5.459  33.689 1.00 4.17  ? 26   CYS A CA   1 
ATOM   398  C C    . CYS A 1 26  ? 18.827 -6.331  33.559 1.00 4.48  ? 26   CYS A C    1 
ATOM   399  O O    . CYS A 1 26  ? 17.694 -5.822  33.620 1.00 4.90  ? 26   CYS A O    1 
ATOM   400  C CB   . CYS A 1 26  ? 20.554 -5.076  32.290 1.00 4.37  ? 26   CYS A CB   1 
ATOM   401  S SG   . CYS A 1 26  ? 21.811 -3.780  32.291 1.00 4.75  ? 26   CYS A SG   1 
ATOM   402  H H    . CYS A 1 26  ? 21.889 -6.315  34.036 1.00 5.05  ? 26   CYS A H    1 
ATOM   403  H HA   . CYS A 1 26  ? 19.806 -4.622  34.173 1.00 5.01  ? 26   CYS A HA   1 
ATOM   404  H HB2  . CYS A 1 26  ? 20.927 -5.881  31.852 1.00 5.24  ? 26   CYS A HB2  1 
ATOM   405  H HB3  . CYS A 1 26  ? 19.782 -4.771  31.752 1.00 5.24  ? 26   CYS A HB3  1 
ATOM   406  N N    . ASN A 1 27  ? 19.008 -7.633  33.365 1.00 4.35  ? 27   ASN A N    1 
ATOM   407  C CA   . ASN A 1 27  ? 17.845 -8.529  33.284 1.00 4.69  ? 27   ASN A CA   1 
ATOM   408  C C    . ASN A 1 27  ? 16.993 -8.399  34.537 1.00 5.06  ? 27   ASN A C    1 
ATOM   409  O O    . ASN A 1 27  ? 15.747 -8.375  34.447 1.00 6.31  ? 27   ASN A O    1 
ATOM   410  C CB   . ASN A 1 27  ? 18.299 -9.953  33.045 1.00 5.31  ? 27   ASN A CB   1 
ATOM   411  C CG   . ASN A 1 27  ? 18.716 -10.179 31.592 1.00 4.92  ? 27   ASN A CG   1 
ATOM   412  O OD1  . ASN A 1 27  ? 18.236 -9.468  30.720 1.00 6.03  ? 27   ASN A OD1  1 
ATOM   413  N ND2  . ASN A 1 27  ? 19.603 -11.117 31.325 1.00 5.51  ? 27   ASN A ND2  1 
ATOM   414  H H    . ASN A 1 27  ? 19.821 -7.958  33.285 1.00 5.22  ? 27   ASN A H    1 
ATOM   415  H HA   . ASN A 1 27  ? 17.290 -8.245  32.501 1.00 5.62  ? 27   ASN A HA   1 
ATOM   416  H HB2  . ASN A 1 27  ? 19.063 -10.157 33.640 1.00 6.37  ? 27   ASN A HB2  1 
ATOM   417  H HB3  . ASN A 1 27  ? 17.561 -10.573 33.273 1.00 6.37  ? 27   ASN A HB3  1 
ATOM   418  H HD21 . ASN A 1 27  ? 19.930 -11.612 31.976 1.00 6.61  ? 27   ASN A HD21 1 
ATOM   419  H HD22 . ASN A 1 27  ? 19.869 -11.249 30.497 1.00 6.61  ? 27   ASN A HD22 1 
ATOM   420  N N    . GLN A 1 28  ? 17.615 -8.318  35.715 1.00 4.60  ? 28   GLN A N    1 
ATOM   421  C CA   . GLN A 1 28  ? 16.867 -8.153  36.947 1.00 4.84  ? 28   GLN A CA   1 
ATOM   422  C C    . GLN A 1 28  ? 16.291 -6.745  37.112 1.00 4.65  ? 28   GLN A C    1 
ATOM   423  O O    . GLN A 1 28  ? 15.137 -6.572  37.537 1.00 5.48  ? 28   GLN A O    1 
ATOM   424  C CB   . GLN A 1 28  ? 17.687 -8.511  38.168 1.00 5.31  ? 28   GLN A CB   1 
ATOM   425  C CG   . GLN A 1 28  ? 18.178 -9.968  38.174 1.00 6.16  ? 28   GLN A CG   1 
ATOM   426  C CD   . GLN A 1 28  ? 18.537 -10.421 39.533 1.00 6.43  ? 28   GLN A CD   1 
ATOM   427  O OE1  . GLN A 1 28  ? 17.621 -10.499 40.408 1.00 7.68  ? 28   GLN A OE1  1 
ATOM   428  N NE2  . GLN A 1 28  ? 19.785 -10.710 39.825 1.00 8.64  ? 28   GLN A NE2  1 
ATOM   429  H H    . GLN A 1 28  ? 18.493 -8.366  35.745 1.00 5.52  ? 28   GLN A H    1 
ATOM   430  H HA   . GLN A 1 28  ? 16.094 -8.788  36.912 1.00 5.80  ? 28   GLN A HA   1 
ATOM   431  H HB2  . GLN A 1 28  ? 18.471 -7.909  38.215 1.00 6.37  ? 28   GLN A HB2  1 
ATOM   432  H HB3  . GLN A 1 28  ? 17.139 -8.355  38.978 1.00 6.37  ? 28   GLN A HB3  1 
ATOM   433  H HG2  . GLN A 1 28  ? 17.467 -10.553 37.812 1.00 7.39  ? 28   GLN A HG2  1 
ATOM   434  H HG3  . GLN A 1 28  ? 18.969 -10.048 37.583 1.00 7.39  ? 28   GLN A HG3  1 
ATOM   435  H HE21 . GLN A 1 28  ? 20.407 -10.651 39.206 1.00 10.37 ? 28   GLN A HE21 1 
ATOM   436  H HE22 . GLN A 1 28  ? 19.998 -10.964 40.640 1.00 10.37 ? 28   GLN A HE22 1 
ATOM   437  N N    . MET A 1 29  ? 17.136 -5.733  36.849 1.00 4.65  ? 29   MET A N    1 
ATOM   438  C CA   . MET A 1 29  ? 16.786 -4.346  37.182 1.00 4.89  ? 29   MET A CA   1 
ATOM   439  C C    . MET A 1 29  ? 15.778 -3.721  36.219 1.00 5.00  ? 29   MET A C    1 
ATOM   440  O O    . MET A 1 29  ? 14.964 -2.901  36.640 1.00 5.19  ? 29   MET A O    1 
ATOM   441  C CB   A MET A 1 29  ? 18.081 -3.512  37.157 0.77 5.42  ? 29   MET A CB   1 
ATOM   442  C CB   B MET A 1 29  ? 18.010 -3.446  37.417 0.22 6.86  ? 29   MET A CB   1 
ATOM   443  C CG   A MET A 1 29  ? 18.933 -3.776  38.345 0.77 6.50  ? 29   MET A CG   1 
ATOM   444  C CG   B MET A 1 29  ? 17.893 -2.185  38.247 0.22 10.35 ? 29   MET A CG   1 
ATOM   445  S SD   A MET A 1 29  ? 18.307 -3.159  39.861 0.77 8.88  ? 29   MET A SD   1 
ATOM   446  S SD   B MET A 1 29  ? 17.229 -2.374  39.935 0.22 11.29 ? 29   MET A SD   1 
ATOM   447  C CE   A MET A 1 29  ? 18.385 -1.418  39.636 0.77 10.95 ? 29   MET A CE   1 
ATOM   448  C CE   B MET A 1 29  ? 17.967 -3.922  40.329 0.22 11.27 ? 29   MET A CE   1 
ATOM   449  H H    . MET A 1 29  ? 17.912 -5.904  36.470 1.00 5.58  ? 29   MET A H    1 
ATOM   450  H HA   A MET A 1 29  ? 16.406 -4.323  38.106 1.00 5.87  ? 29   MET A HA   1 
ATOM   451  H HB2  A MET A 1 29  ? 18.591 -3.726  36.336 0.77 6.50  ? 29   MET A HB2  1 
ATOM   452  H HB2  B MET A 1 29  ? 18.709 -4.008  37.836 0.22 8.24  ? 29   MET A HB2  1 
ATOM   453  H HB3  A MET A 1 29  ? 17.849 -2.550  37.129 0.77 6.50  ? 29   MET A HB3  1 
ATOM   454  H HB3  B MET A 1 29  ? 18.352 -3.179  36.527 0.22 8.24  ? 29   MET A HB3  1 
ATOM   455  H HG2  A MET A 1 29  ? 19.056 -4.755  38.432 0.77 7.80  ? 29   MET A HG2  1 
ATOM   456  H HG2  B MET A 1 29  ? 18.791 -1.776  38.314 0.22 12.42 ? 29   MET A HG2  1 
ATOM   457  H HG3  A MET A 1 29  ? 19.824 -3.376  38.188 0.77 7.80  ? 29   MET A HG3  1 
ATOM   458  H HG3  B MET A 1 29  ? 17.314 -1.548  37.758 0.22 12.42 ? 29   MET A HG3  1 
ATOM   459  H HE1  A MET A 1 29  ? 17.841 -1.164  38.861 0.77 16.42 ? 29   MET A HE1  1 
ATOM   460  H HE1  B MET A 1 29  ? 18.941 -3.850  40.248 0.22 16.90 ? 29   MET A HE1  1 
ATOM   461  H HE2  A MET A 1 29  ? 18.041 -0.969  40.437 0.77 16.42 ? 29   MET A HE2  1 
ATOM   462  H HE2  B MET A 1 29  ? 17.733 -4.172  41.247 0.22 16.90 ? 29   MET A HE2  1 
ATOM   463  H HE3  A MET A 1 29  ? 19.315 -1.149  39.485 0.77 16.42 ? 29   MET A HE3  1 
ATOM   464  H HE3  B MET A 1 29  ? 17.638 -4.608  39.710 0.22 16.90 ? 29   MET A HE3  1 
ATOM   465  N N    . MET A 1 30  ? 15.834 -4.092  34.947 1.00 4.87  ? 30   MET A N    1 
ATOM   466  C CA   . MET A 1 30  ? 14.819 -3.565  34.037 1.00 4.88  ? 30   MET A CA   1 
ATOM   467  C C    . MET A 1 30  ? 13.440 -4.010  34.483 1.00 5.12  ? 30   MET A C    1 
ATOM   468  O O    . MET A 1 30  ? 12.446 -3.272  34.374 1.00 6.01  ? 30   MET A O    1 
ATOM   469  C CB   . MET A 1 30  ? 15.134 -3.999  32.592 1.00 4.91  ? 30   MET A CB   1 
ATOM   470  C CG   . MET A 1 30  ? 16.413 -3.358  32.043 1.00 4.99  ? 30   MET A CG   1 
ATOM   471  S SD   . MET A 1 30  ? 16.376 -1.560  31.938 1.00 5.32  ? 30   MET A SD   1 
ATOM   472  C CE   . MET A 1 30  ? 15.233 -1.325  30.581 1.00 5.89  ? 30   MET A CE   1 
ATOM   473  H H    . MET A 1 30  ? 16.463 -4.637  34.661 1.00 5.84  ? 30   MET A H    1 
ATOM   474  H HA   . MET A 1 30  ? 14.853 -2.567  34.077 1.00 5.86  ? 30   MET A HA   1 
ATOM   475  H HB2  . MET A 1 30  ? 15.230 -4.984  32.565 1.00 5.89  ? 30   MET A HB2  1 
ATOM   476  H HB3  . MET A 1 30  ? 14.373 -3.753  32.009 1.00 5.89  ? 30   MET A HB3  1 
ATOM   477  H HG2  . MET A 1 30  ? 17.171 -3.624  32.621 1.00 5.99  ? 30   MET A HG2  1 
ATOM   478  H HG3  . MET A 1 30  ? 16.584 -3.722  31.139 1.00 5.99  ? 30   MET A HG3  1 
ATOM   479  H HE1  . MET A 1 30  ? 14.368 -1.724  30.810 1.00 8.83  ? 30   MET A HE1  1 
ATOM   480  H HE2  . MET A 1 30  ? 15.118 -0.367  30.414 1.00 8.83  ? 30   MET A HE2  1 
ATOM   481  H HE3  . MET A 1 30  ? 15.589 -1.757  29.776 1.00 8.83  ? 30   MET A HE3  1 
ATOM   482  N N    . LYS A 1 31  ? 13.329 -5.226  34.992 1.00 5.02  ? 31   LYS A N    1 
ATOM   483  C CA   . LYS A 1 31  ? 12.076 -5.730  35.550 1.00 5.32  ? 31   LYS A CA   1 
ATOM   484  C C    . LYS A 1 31  ? 11.757 -5.018  36.869 1.00 5.37  ? 31   LYS A C    1 
ATOM   485  O O    . LYS A 1 31  ? 10.624 -4.502  37.037 1.00 5.78  ? 31   LYS A O    1 
ATOM   486  C CB   . LYS A 1 31  ? 12.154 -7.249  35.742 1.00 6.70  ? 31   LYS A CB   1 
ATOM   487  C CG   . LYS A 1 31  ? 10.965 -7.898  36.431 1.00 9.07  ? 31   LYS A CG   1 
ATOM   488  C CD   . LYS A 1 31  ? 9.705  -7.808  35.684 1.00 13.35 ? 31   LYS A CD   1 
ATOM   489  C CE   . LYS A 1 31  ? 8.683  -8.741  36.318 1.00 19.20 ? 31   LYS A CE   1 
ATOM   490  N NZ   . LYS A 1 31  ? 7.382  -8.419  35.573 1.00 28.69 ? 31   LYS A NZ   1 
ATOM   491  H H    . LYS A 1 31  ? 14.035 -5.751  34.994 1.00 6.03  ? 31   LYS A H    1 
ATOM   492  H HA   . LYS A 1 31  ? 11.342 -5.533  34.901 1.00 6.38  ? 31   LYS A HA   1 
ATOM   493  H HB2  . LYS A 1 31  ? 12.264 -7.669  34.852 1.00 8.04  ? 31   LYS A HB2  1 
ATOM   494  H HB3  . LYS A 1 31  ? 12.967 -7.454  36.268 1.00 8.04  ? 31   LYS A HB3  1 
ATOM   495  H HG2  . LYS A 1 31  ? 11.173 -8.853  36.587 1.00 10.89 ? 31   LYS A HG2  1 
ATOM   496  H HG3  . LYS A 1 31  ? 10.840 -7.471  37.315 1.00 10.89 ? 31   LYS A HG3  1 
ATOM   497  H HD2  . LYS A 1 31  ? 9.367  -6.877  35.703 1.00 16.02 ? 31   LYS A HD2  1 
ATOM   498  H HD3  . LYS A 1 31  ? 9.854  -8.064  34.739 1.00 16.02 ? 31   LYS A HD3  1 
ATOM   499  H HE2  . LYS A 1 31  ? 8.941  -9.689  36.189 1.00 23.04 ? 31   LYS A HE2  1 
ATOM   500  H HE3  . LYS A 1 31  ? 8.592  -8.561  37.287 1.00 23.04 ? 31   LYS A HE3  1 
ATOM   501  H HZ1  . LYS A 1 31  ? 7.505  -8.542  34.680 1.00 43.03 ? 31   LYS A HZ1  1 
ATOM   502  H HZ2  . LYS A 1 31  ? 6.720  -8.970  35.867 1.00 43.03 ? 31   LYS A HZ2  1 
ATOM   503  H HZ3  . LYS A 1 31  ? 7.148  -7.554  35.731 1.00 43.03 ? 31   LYS A HZ3  1 
ATOM   504  N N    . SER A 1 32  ? 12.692 -5.013  37.818 1.00 5.30  ? 32   SER A N    1 
ATOM   505  C CA   . SER A 1 32  ? 12.386 -4.493  39.151 1.00 5.95  ? 32   SER A CA   1 
ATOM   506  C C    . SER A 1 32  ? 12.080 -3.025  39.176 1.00 6.34  ? 32   SER A C    1 
ATOM   507  O O    . SER A 1 32  ? 11.309 -2.557  40.026 1.00 7.99  ? 32   SER A O    1 
ATOM   508  C CB   A SER A 1 32  ? 13.464 -4.865  40.167 0.69 7.25  ? 32   SER A CB   1 
ATOM   509  C CB   B SER A 1 32  ? 13.686 -4.686  39.991 0.31 7.00  ? 32   SER A CB   1 
ATOM   510  O OG   A SER A 1 32  ? 14.689 -4.236  39.804 0.69 7.71  ? 32   SER A OG   1 
ATOM   511  O OG   B SER A 1 32  ? 13.408 -4.220  41.335 0.31 9.64  ? 32   SER A OG   1 
ATOM   512  H H    . SER A 1 32  ? 13.497 -5.323  37.643 1.00 6.36  ? 32   SER A H    1 
ATOM   513  H HA   A SER A 1 32  ? 11.551 -4.957  39.446 1.00 7.14  ? 32   SER A HA   1 
ATOM   514  H HB2  A SER A 1 32  ? 13.189 -4.569  41.071 0.69 8.70  ? 32   SER A HB2  1 
ATOM   515  H HB2  B SER A 1 32  ? 13.945 -5.641  40.006 0.31 8.40  ? 32   SER A HB2  1 
ATOM   516  H HB3  A SER A 1 32  ? 13.583 -5.848  40.185 0.69 8.70  ? 32   SER A HB3  1 
ATOM   517  H HB3  B SER A 1 32  ? 14.429 -4.165  39.595 0.31 8.40  ? 32   SER A HB3  1 
ATOM   518  H HG   A SER A 1 32  ? 14.896 -4.457  39.020 0.69 11.56 ? 32   SER A HG   1 
ATOM   519  H HG   B SER A 1 32  ? 12.683 -4.550  41.602 0.31 14.46 ? 32   SER A HG   1 
ATOM   520  N N    . ARG A 1 33  ? 12.668 -2.252  38.260 1.00 5.69  ? 33   ARG A N    1 
ATOM   521  C CA   . ARG A 1 33  ? 12.395 -0.840  38.176 1.00 6.05  ? 33   ARG A CA   1 
ATOM   522  C C    . ARG A 1 33  ? 11.220 -0.477  37.256 1.00 6.60  ? 33   ARG A C    1 
ATOM   523  O O    . ARG A 1 33  ? 11.010 0.676   36.922 1.00 7.48  ? 33   ARG A O    1 
ATOM   524  C CB   . ARG A 1 33  ? 13.672 -0.050  37.763 1.00 6.04  ? 33   ARG A CB   1 
ATOM   525  C CG   . ARG A 1 33  ? 14.771 -0.175  38.808 1.00 6.42  ? 33   ARG A CG   1 
ATOM   526  C CD   . ARG A 1 33  ? 14.363 0.334   40.187 1.00 6.15  ? 33   ARG A CD   1 
ATOM   527  N NE   . ARG A 1 33  ? 15.481 0.372   41.135 1.00 6.66  ? 33   ARG A NE   1 
ATOM   528  C CZ   . ARG A 1 33  ? 16.389 1.346   41.178 1.00 5.60  ? 33   ARG A CZ   1 
ATOM   529  N NH1  . ARG A 1 33  ? 16.284 2.397   40.445 1.00 5.35  ? 33   ARG A NH1  1 
ATOM   530  N NH2  . ARG A 1 33  ? 17.427 1.239   42.036 1.00 7.16  ? 33   ARG A NH2  1 
ATOM   531  H H    . ARG A 1 33  ? 13.237 -2.614  37.694 1.00 6.83  ? 33   ARG A H    1 
ATOM   532  H HA   . ARG A 1 33  ? 12.149 -0.536  39.096 1.00 7.26  ? 33   ARG A HA   1 
ATOM   533  H HB2  . ARG A 1 33  ? 14.003 -0.395  36.896 1.00 7.25  ? 33   ARG A HB2  1 
ATOM   534  H HB3  . ARG A 1 33  ? 13.441 0.905   37.643 1.00 7.25  ? 33   ARG A HB3  1 
ATOM   535  H HG2  . ARG A 1 33  ? 15.033 -1.127  38.883 1.00 7.71  ? 33   ARG A HG2  1 
ATOM   536  H HG3  . ARG A 1 33  ? 15.563 0.332   38.501 1.00 7.71  ? 33   ARG A HG3  1 
ATOM   537  H HD2  . ARG A 1 33  ? 13.986 1.245   40.096 1.00 7.38  ? 33   ARG A HD2  1 
ATOM   538  H HD3  . ARG A 1 33  ? 13.652 -0.252  40.550 1.00 7.38  ? 33   ARG A HD3  1 
ATOM   539  H HE   . ARG A 1 33  ? 15.556 -0.289  41.710 1.00 7.99  ? 33   ARG A HE   1 
ATOM   540  H HH11 . ARG A 1 33  ? 15.600 2.486   39.898 1.00 6.42  ? 33   ARG A HH11 1 
ATOM   541  H HH12 . ARG A 1 33  ? 16.896 3.028   40.490 1.00 6.42  ? 33   ARG A HH12 1 
ATOM   542  H HH21 . ARG A 1 33  ? 17.508 0.523   42.542 1.00 8.60  ? 33   ARG A HH21 1 
ATOM   543  H HH22 . ARG A 1 33  ? 18.022 1.885   42.088 1.00 8.60  ? 33   ARG A HH22 1 
ATOM   544  N N    . ASN A 1 34  ? 10.410 -1.504  36.899 1.00 6.24  ? 34   ASN A N    1 
ATOM   545  C CA   . ASN A 1 34  ? 9.147  -1.261  36.234 1.00 6.64  ? 34   ASN A CA   1 
ATOM   546  C C    . ASN A 1 34  ? 9.340  -0.665  34.844 1.00 6.84  ? 34   ASN A C    1 
ATOM   547  O O    . ASN A 1 34  ? 8.528  0.136   34.407 1.00 9.83  ? 34   ASN A O    1 
ATOM   548  C CB   . ASN A 1 34  ? 8.181  -0.469  37.082 1.00 9.04  ? 34   ASN A CB   1 
ATOM   549  C CG   A ASN A 1 34  ? 7.727  -1.329  38.264 0.64 10.81 ? 34   ASN A CG   1 
ATOM   550  C CG   B ASN A 1 34  ? 6.760  -1.070  36.883 0.35 9.01  ? 34   ASN A CG   1 
ATOM   551  O OD1  A ASN A 1 34  ? 7.345  -2.448  37.955 0.64 14.88 ? 34   ASN A OD1  1 
ATOM   552  O OD1  B ASN A 1 34  ? 6.486  -2.256  36.643 0.35 13.63 ? 34   ASN A OD1  1 
ATOM   553  N ND2  A ASN A 1 34  ? 7.880  -0.900  39.487 0.64 19.31 ? 34   ASN A ND2  1 
ATOM   554  N ND2  B ASN A 1 34  ? 5.796  -0.122  37.006 0.35 15.24 ? 34   ASN A ND2  1 
ATOM   555  H H    . ASN A 1 34  ? 10.656 -2.331  37.074 1.00 7.49  ? 34   ASN A H    1 
ATOM   556  H HA   . ASN A 1 34  ? 8.727  -2.158  36.097 1.00 7.97  ? 34   ASN A HA   1 
ATOM   557  H HB2  A ASN A 1 34  ? 8.620  0.353   37.414 1.00 10.85 ? 34   ASN A HB2  1 
ATOM   558  H HB3  A ASN A 1 34  ? 7.397  -0.204  36.538 1.00 10.85 ? 34   ASN A HB3  1 
ATOM   559  H HD21 A ASN A 1 34  ? 8.160  -0.078  39.633 0.64 23.17 ? 34   ASN A HD21 1 
ATOM   560  H HD21 B ASN A 1 34  ? 6.018  0.712   37.176 0.35 18.28 ? 34   ASN A HD21 1 
ATOM   561  H HD22 A ASN A 1 34  ? 7.704  -1.432  40.166 0.64 23.17 ? 34   ASN A HD22 1 
ATOM   562  H HD22 B ASN A 1 34  ? 4.949  -0.342  36.916 0.35 18.28 ? 34   ASN A HD22 1 
ATOM   563  N N    . LEU A 1 35  ? 10.371 -1.109  34.145 1.00 6.04  ? 35   LEU A N    1 
ATOM   564  C CA   . LEU A 1 35  ? 10.677 -0.660  32.812 1.00 6.42  ? 35   LEU A CA   1 
ATOM   565  C C    . LEU A 1 35  ? 10.261 -1.661  31.740 1.00 6.59  ? 35   LEU A C    1 
ATOM   566  O O    . LEU A 1 35  ? 10.460 -1.397  30.554 1.00 8.76  ? 35   LEU A O    1 
ATOM   567  C CB   . LEU A 1 35  ? 12.152 -0.282  32.652 1.00 6.31  ? 35   LEU A CB   1 
ATOM   568  C CG   . LEU A 1 35  ? 12.617 0.755   33.662 1.00 9.49  ? 35   LEU A CG   1 
ATOM   569  C CD1  . LEU A 1 35  ? 14.094 1.020   33.483 1.00 10.24 ? 35   LEU A CD1  1 
ATOM   570  C CD2  . LEU A 1 35  ? 11.865 2.011   33.549 1.00 19.72 ? 35   LEU A CD2  1 
ATOM   571  H H    . LEU A 1 35  ? 10.897 -1.710  34.514 1.00 7.24  ? 35   LEU A H    1 
ATOM   572  H HA   . LEU A 1 35  ? 10.145 0.172   32.656 1.00 7.71  ? 35   LEU A HA   1 
ATOM   573  H HB2  . LEU A 1 35  ? 12.705 -1.097  32.750 1.00 7.57  ? 35   LEU A HB2  1 
ATOM   574  H HB3  . LEU A 1 35  ? 12.295 0.072   31.739 1.00 7.57  ? 35   LEU A HB3  1 
ATOM   575  H HG   . LEU A 1 35  ? 12.473 0.385   34.579 1.00 11.38 ? 35   LEU A HG   1 
ATOM   576  H HD11 . LEU A 1 35  ? 14.593 0.186   33.610 1.00 15.36 ? 35   LEU A HD11 1 
ATOM   577  H HD12 . LEU A 1 35  ? 14.257 1.365   32.581 1.00 15.36 ? 35   LEU A HD12 1 
ATOM   578  H HD13 . LEU A 1 35  ? 14.389 1.680   34.144 1.00 15.36 ? 35   LEU A HD13 1 
ATOM   579  H HD21 . LEU A 1 35  ? 10.909 1.832   33.672 1.00 29.58 ? 35   LEU A HD21 1 
ATOM   580  H HD22 . LEU A 1 35  ? 12.171 2.638   34.237 1.00 29.58 ? 35   LEU A HD22 1 
ATOM   581  H HD23 . LEU A 1 35  ? 12.012 2.402   32.662 1.00 29.58 ? 35   LEU A HD23 1 
ATOM   582  N N    . THR A 1 36  ? 9.619  -2.751  32.148 1.00 5.82  ? 36   THR A N    1 
ATOM   583  C CA   . THR A 1 36  ? 9.233  -3.804  31.242 1.00 6.51  ? 36   THR A CA   1 
ATOM   584  C C    . THR A 1 36  ? 7.760  -4.167  31.401 1.00 7.01  ? 36   THR A C    1 
ATOM   585  O O    . THR A 1 36  ? 7.333  -5.232  31.003 1.00 9.21  ? 36   THR A O    1 
ATOM   586  C CB   . THR A 1 36  ? 10.130 -5.012  31.308 1.00 6.89  ? 36   THR A CB   1 
ATOM   587  O OG1  . THR A 1 36  ? 10.019 -5.638  32.578 1.00 7.63  ? 36   THR A OG1  1 
ATOM   588  C CG2  . THR A 1 36  ? 11.583 -4.663  31.019 1.00 8.47  ? 36   THR A CG2  1 
ATOM   589  H H    . THR A 1 36  ? 9.423  -2.834  33.002 1.00 6.98  ? 36   THR A H    1 
ATOM   590  H HA   . THR A 1 36  ? 9.332  -3.430  30.319 1.00 7.81  ? 36   THR A HA   1 
ATOM   591  H HB   . THR A 1 36  ? 9.824  -5.663  30.614 1.00 8.26  ? 36   THR A HB   1 
ATOM   592  H HG1  . THR A 1 36  ? 10.519 -6.313  32.602 1.00 11.44 ? 36   THR A HG1  1 
ATOM   593  H HG21 . THR A 1 36  ? 11.900 -4.011  31.679 1.00 12.70 ? 36   THR A HG21 1 
ATOM   594  H HG22 . THR A 1 36  ? 12.131 -5.474  31.072 1.00 12.70 ? 36   THR A HG22 1 
ATOM   595  H HG23 . THR A 1 36  ? 11.654 -4.279  30.120 1.00 12.70 ? 36   THR A HG23 1 
ATOM   596  N N    . LYS A 1 37  ? 6.935  -3.231  31.991 1.00 7.75  ? 37   LYS A N    1 
ATOM   597  C CA   . LYS A 1 37  ? 5.539  -3.554  32.261 1.00 8.59  ? 37   LYS A CA   1 
ATOM   598  C C    . LYS A 1 37  ? 4.684  -3.716  31.005 1.00 9.52  ? 37   LYS A C    1 
ATOM   599  O O    . LYS A 1 37  ? 3.918  -4.720  30.934 1.00 10.13 ? 37   LYS A O    1 
ATOM   600  C CB   . LYS A 1 37  ? 4.875  -2.490  33.223 1.00 9.38  ? 37   LYS A CB   1 
ATOM   601  C CG   A LYS A 1 37  ? 5.476  -2.521  34.612 0.64 7.62  ? 37   LYS A CG   1 
ATOM   602  C CD   A LYS A 1 37  ? 5.179  -1.345  35.485 0.64 8.18  ? 37   LYS A CD   1 
ATOM   603  C CE   A LYS A 1 37  ? 3.716  -1.189  35.670 0.64 7.73  ? 37   LYS A CE   1 
ATOM   604  N NZ   A LYS A 1 37  ? 3.419  -0.178  36.765 0.64 8.47  ? 37   LYS A NZ   1 
ATOM   605  H H    . LYS A 1 37  ? 7.252  -2.438  32.204 1.00 9.30  ? 37   LYS A H    1 
ATOM   606  H HA   . LYS A 1 37  ? 5.527  -4.432  32.740 1.00 10.30 ? 37   LYS A HA   1 
ATOM   607  H HB2  A LYS A 1 37  ? 4.993  -1.585  32.838 1.00 11.25 ? 37   LYS A HB2  1 
ATOM   608  H HB3  A LYS A 1 37  ? 3.903  -2.669  33.285 1.00 11.25 ? 37   LYS A HB3  1 
ATOM   609  H HG2  A LYS A 1 37  ? 5.153  -3.337  35.071 0.64 9.15  ? 37   LYS A HG2  1 
ATOM   610  H HG3  A LYS A 1 37  ? 6.458  -2.602  34.523 0.64 9.15  ? 37   LYS A HG3  1 
ATOM   611  H HD2  A LYS A 1 37  ? 5.613  -1.469  36.366 0.64 9.82  ? 37   LYS A HD2  1 
ATOM   612  H HD3  A LYS A 1 37  ? 5.550  -0.525  35.072 0.64 9.82  ? 37   LYS A HD3  1 
ATOM   613  H HE2  A LYS A 1 37  ? 3.305  -0.887  34.821 0.64 9.28  ? 37   LYS A HE2  1 
ATOM   614  H HE3  A LYS A 1 37  ? 3.318  -2.063  35.910 0.64 9.28  ? 37   LYS A HE3  1 
ATOM   615  H HZ1  A LYS A 1 37  ? 3.795  -0.457  37.546 0.64 12.71 ? 37   LYS A HZ1  1 
ATOM   616  H HZ2  A LYS A 1 37  ? 3.766  0.631   36.534 0.64 12.71 ? 37   LYS A HZ2  1 
ATOM   617  H HZ3  A LYS A 1 37  ? 2.518  -0.102  36.872 0.64 12.71 ? 37   LYS A HZ3  1 
ATOM   618  N N    . ASP A 1 38  ? 4.799  -2.804  30.130 1.00 9.50  ? 38   ASP A N    1 
ATOM   619  C CA   . ASP A 1 38  ? 3.941  -2.698  28.982 1.00 8.89  ? 38   ASP A CA   1 
ATOM   620  C C    . ASP A 1 38  ? 4.674  -2.951  27.678 1.00 9.80  ? 38   ASP A C    1 
ATOM   621  O O    . ASP A 1 38  ? 4.069  -2.983  26.615 1.00 13.77 ? 38   ASP A O    1 
ATOM   622  C CB   . ASP A 1 38  ? 3.262  -1.304  28.947 1.00 9.67  ? 38   ASP A CB   1 
ATOM   623  C CG   . ASP A 1 38  ? 4.152  -0.109  29.067 1.00 9.87  ? 38   ASP A CG   1 
ATOM   624  O OD1  . ASP A 1 38  ? 5.320  -0.232  29.456 1.00 11.44 ? 38   ASP A OD1  1 
ATOM   625  O OD2  . ASP A 1 38  ? 3.673  0.967   28.854 1.00 16.63 ? 38   ASP A OD2  1 
ATOM   626  H H    . ASP A 1 38  ? 5.437  -2.207  30.231 1.00 11.41 ? 38   ASP A H    1 
ATOM   627  H HA   . ASP A 1 38  ? 3.223  -3.388  29.070 1.00 10.67 ? 38   ASP A HA   1 
ATOM   628  H HB2  . ASP A 1 38  ? 2.761  -1.229  28.097 1.00 11.61 ? 38   ASP A HB2  1 
ATOM   629  H HB3  . ASP A 1 38  ? 2.600  -1.268  29.683 1.00 11.61 ? 38   ASP A HB3  1 
ATOM   630  N N    . ARG A 1 39  ? 6.012  -3.032  27.755 1.00 7.10  ? 39   ARG A N    1 
ATOM   631  C CA   . ARG A 1 39  ? 6.872  -3.185  26.593 1.00 6.59  ? 39   ARG A CA   1 
ATOM   632  C C    . ARG A 1 39  ? 8.251  -3.486  27.161 1.00 6.49  ? 39   ARG A C    1 
ATOM   633  O O    . ARG A 1 39  ? 8.501  -3.200  28.333 1.00 9.35  ? 39   ARG A O    1 
ATOM   634  C CB   . ARG A 1 39  ? 6.971  -1.968  25.717 1.00 9.05  ? 39   ARG A CB   1 
ATOM   635  C CG   . ARG A 1 39  ? 7.488  -0.741  26.432 1.00 11.21 ? 39   ARG A CG   1 
ATOM   636  C CD   A ARG A 1 39  ? 8.014  0.390   25.702 0.66 14.93 ? 39   ARG A CD   1 
ATOM   637  C CD   B ARG A 1 39  ? 8.372  0.115   25.631 0.34 6.59  ? 39   ARG A CD   1 
ATOM   638  N NE   A ARG A 1 39  ? 8.580  1.399   26.518 0.66 15.52 ? 39   ARG A NE   1 
ATOM   639  N NE   B ARG A 1 39  ? 7.617  0.821   24.491 0.34 6.47  ? 39   ARG A NE   1 
ATOM   640  C CZ   A ARG A 1 39  ? 9.592  2.159   26.138 0.66 12.42 ? 39   ARG A CZ   1 
ATOM   641  C CZ   B ARG A 1 39  ? 6.868  1.920   24.579 0.34 5.61  ? 39   ARG A CZ   1 
ATOM   642  N NH1  A ARG A 1 39  ? 10.400 2.201   24.970 0.66 14.10 ? 39   ARG A NH1  1 
ATOM   643  N NH1  B ARG A 1 39  ? 6.737  2.518   25.756 0.34 6.38  ? 39   ARG A NH1  1 
ATOM   644  N NH2  A ARG A 1 39  ? 9.922  3.052   27.115 0.66 10.99 ? 39   ARG A NH2  1 
ATOM   645  N NH2  B ARG A 1 39  ? 6.386  2.436   23.496 0.34 6.01  ? 39   ARG A NH2  1 
ATOM   646  H H    . ARG A 1 39  ? 6.387  -2.991  28.550 1.00 8.53  ? 39   ARG A H    1 
ATOM   647  H HA   . ARG A 1 39  ? 6.560  -3.963  26.047 1.00 7.91  ? 39   ARG A HA   1 
ATOM   648  H HB2  . ARG A 1 39  ? 7.572  -2.171  24.956 1.00 10.86 ? 39   ARG A HB2  1 
ATOM   649  H HB3  . ARG A 1 39  ? 6.075  -1.768  25.347 1.00 10.86 ? 39   ARG A HB3  1 
ATOM   650  H HG2  A ARG A 1 39  ? 6.749  -0.403  26.997 1.00 13.45 ? 39   ARG A HG2  1 
ATOM   651  H HG3  A ARG A 1 39  ? 8.202  -1.045  27.048 1.00 13.45 ? 39   ARG A HG3  1 
ATOM   652  H HD2  A ARG A 1 39  ? 8.706  0.067   25.072 0.66 17.91 ? 39   ARG A HD2  1 
ATOM   653  H HD2  B ARG A 1 39  ? 8.784  0.797   26.219 0.34 7.91  ? 39   ARG A HD2  1 
ATOM   654  H HD3  A ARG A 1 39  ? 7.284  0.789   25.166 0.66 17.91 ? 39   ARG A HD3  1 
ATOM   655  H HD3  B ARG A 1 39  ? 9.099  -0.436  25.247 0.34 7.91  ? 39   ARG A HD3  1 
ATOM   656  H HE   A ARG A 1 39  ? 8.240  1.527   27.319 0.66 18.62 ? 39   ARG A HE   1 
ATOM   657  H HE   B ARG A 1 39  ? 7.687  0.458   23.692 0.34 7.77  ? 39   ARG A HE   1 
ATOM   658  H HH11 A ARG A 1 39  ? 10.257 1.630   24.315 0.66 16.92 ? 39   ARG A HH11 1 
ATOM   659  H HH11 B ARG A 1 39  ? 7.075  2.145   26.478 0.34 7.66  ? 39   ARG A HH11 1 
ATOM   660  H HH12 A ARG A 1 39  ? 11.044 2.797   24.902 0.66 16.92 ? 39   ARG A HH12 1 
ATOM   661  H HH12 B ARG A 1 39  ? 6.313  3.286   25.814 0.34 7.66  ? 39   ARG A HH12 1 
ATOM   662  H HH21 A ARG A 1 39  ? 9.474  3.061   27.873 0.66 13.19 ? 39   ARG A HH21 1 
ATOM   663  H HH21 B ARG A 1 39  ? 6.487  2.018   22.728 0.34 7.21  ? 39   ARG A HH21 1 
ATOM   664  H HH22 A ARG A 1 39  ? 10.583 3.619   26.988 0.66 13.19 ? 39   ARG A HH22 1 
ATOM   665  H HH22 B ARG A 1 39  ? 5.958  3.204   23.527 0.34 7.21  ? 39   ARG A HH22 1 
ATOM   666  N N    . CYS A 1 40  ? 9.150  -3.979  26.324 1.00 5.70  ? 40   CYS A N    1 
ATOM   667  C CA   . CYS A 1 40  ? 10.579 -3.993  26.695 1.00 5.82  ? 40   CYS A CA   1 
ATOM   668  C C    . CYS A 1 40  ? 11.160 -2.646  26.305 1.00 5.98  ? 40   CYS A C    1 
ATOM   669  O O    . CYS A 1 40  ? 11.293 -2.309  25.130 1.00 7.76  ? 40   CYS A O    1 
ATOM   670  C CB   . CYS A 1 40  ? 11.351 -5.068  25.975 1.00 6.03  ? 40   CYS A CB   1 
ATOM   671  S SG   . CYS A 1 40  ? 10.716 -6.753  26.112 1.00 6.42  ? 40   CYS A SG   1 
ATOM   672  H H    . CYS A 1 40  ? 8.895  -4.299  25.545 1.00 6.84  ? 40   CYS A H    1 
ATOM   673  H HA   . CYS A 1 40  ? 10.667 -4.123  27.682 1.00 6.98  ? 40   CYS A HA   1 
ATOM   674  H HB2  . CYS A 1 40  ? 11.387 -4.830  25.015 1.00 7.24  ? 40   CYS A HB2  1 
ATOM   675  H HB3  . CYS A 1 40  ? 12.280 -5.060  26.316 1.00 7.24  ? 40   CYS A HB3  1 
ATOM   676  N N    . LYS A 1 41  ? 11.546 -1.809  27.302 1.00 6.74  ? 41   LYS A N    1 
ATOM   677  C CA   . LYS A 1 41  ? 12.238 -0.577  26.983 1.00 6.55  ? 41   LYS A CA   1 
ATOM   678  C C    . LYS A 1 41  ? 13.576 -0.943  26.373 1.00 6.20  ? 41   LYS A C    1 
ATOM   679  O O    . LYS A 1 41  ? 14.308 -1.735  26.949 1.00 6.86  ? 41   LYS A O    1 
ATOM   680  C CB   . LYS A 1 41  ? 12.459 0.251   28.274 1.00 7.28  ? 41   LYS A CB   1 
ATOM   681  C CG   . LYS A 1 41  ? 13.159 1.566   28.004 1.00 7.57  ? 41   LYS A CG   1 
ATOM   682  C CD   . LYS A 1 41  ? 13.255 2.429   29.263 1.00 9.12  ? 41   LYS A CD   1 
ATOM   683  C CE   . LYS A 1 41  ? 13.855 3.787   28.891 1.00 9.54  ? 41   LYS A CE   1 
ATOM   684  N NZ   . LYS A 1 41  ? 13.987 4.634   30.086 1.00 10.89 ? 41   LYS A NZ   1 
ATOM   685  H H    . LYS A 1 41  ? 11.377 -2.015  28.140 1.00 8.09  ? 41   LYS A H    1 
ATOM   686  H HA   . LYS A 1 41  ? 11.700 -0.046  26.327 1.00 7.85  ? 41   LYS A HA   1 
ATOM   687  H HB2  . LYS A 1 41  ? 11.583 0.431   28.698 1.00 8.73  ? 41   LYS A HB2  1 
ATOM   688  H HB3  . LYS A 1 41  ? 13.001 -0.280  28.911 1.00 8.73  ? 41   LYS A HB3  1 
ATOM   689  H HG2  . LYS A 1 41  ? 14.071 1.386   27.662 1.00 9.09  ? 41   LYS A HG2  1 
ATOM   690  H HG3  . LYS A 1 41  ? 12.664 2.062   27.306 1.00 9.09  ? 41   LYS A HG3  1 
ATOM   691  H HD2  . LYS A 1 41  ? 12.354 2.554   29.655 1.00 10.94 ? 41   LYS A HD2  1 
ATOM   692  H HD3  . LYS A 1 41  ? 13.826 1.981   29.936 1.00 10.94 ? 41   LYS A HD3  1 
ATOM   693  H HE2  . LYS A 1 41  ? 14.745 3.655   28.479 1.00 11.45 ? 41   LYS A HE2  1 
ATOM   694  H HE3  . LYS A 1 41  ? 13.273 4.237   28.229 1.00 11.45 ? 41   LYS A HE3  1 
ATOM   695  H HZ1  . LYS A 1 41  ? 14.526 4.221   30.693 1.00 16.34 ? 41   LYS A HZ1  1 
ATOM   696  H HZ2  . LYS A 1 41  ? 14.351 5.434   29.852 1.00 16.34 ? 41   LYS A HZ2  1 
ATOM   697  H HZ3  . LYS A 1 41  ? 13.166 4.770   30.454 1.00 16.34 ? 41   LYS A HZ3  1 
ATOM   698  N N    . PRO A 1 42  ? 13.942 -0.412  25.208 1.00 6.60  ? 42   PRO A N    1 
ATOM   699  C CA   . PRO A 1 42  ? 15.142 -0.956  24.522 1.00 6.31  ? 42   PRO A CA   1 
ATOM   700  C C    . PRO A 1 42  ? 16.462 -0.616  25.139 1.00 6.02  ? 42   PRO A C    1 
ATOM   701  O O    . PRO A 1 42  ? 17.399 -1.407  25.029 1.00 7.35  ? 42   PRO A O    1 
ATOM   702  C CB   A PRO A 1 42  ? 15.064 -0.492  23.057 0.64 7.90  ? 42   PRO A CB   1 
ATOM   703  C CB   B PRO A 1 42  ? 14.969 -0.235  23.165 0.36 8.41  ? 42   PRO A CB   1 
ATOM   704  C CG   A PRO A 1 42  ? 13.622 -0.331  22.801 0.64 8.05  ? 42   PRO A CG   1 
ATOM   705  C CG   B PRO A 1 42  ? 14.155 0.967   23.441 0.36 9.34  ? 42   PRO A CG   1 
ATOM   706  C CD   A PRO A 1 42  ? 13.088 0.237   24.123 0.64 6.00  ? 42   PRO A CD   1 
ATOM   707  C CD   B PRO A 1 42  ? 13.197 0.698   24.567 0.36 8.65  ? 42   PRO A CD   1 
ATOM   708  H HA   A PRO A 1 42  ? 15.060 -1.953  24.523 1.00 7.58  ? 42   PRO A HA   1 
ATOM   709  H HB2  A PRO A 1 42  ? 15.542 0.366   22.933 0.64 9.48  ? 42   PRO A HB2  1 
ATOM   710  H HB2  B PRO A 1 42  ? 15.850 0.020   22.793 0.36 10.10 ? 42   PRO A HB2  1 
ATOM   711  H HB3  A PRO A 1 42  ? 15.457 -1.168  22.451 0.64 9.48  ? 42   PRO A HB3  1 
ATOM   712  H HB3  B PRO A 1 42  ? 14.509 -0.824  22.516 0.36 10.10 ? 42   PRO A HB3  1 
ATOM   713  H HG2  A PRO A 1 42  ? 13.461 0.297   22.053 0.64 9.67  ? 42   PRO A HG2  1 
ATOM   714  H HG2  B PRO A 1 42  ? 14.749 1.721   23.682 0.36 11.21 ? 42   PRO A HG2  1 
ATOM   715  H HG3  A PRO A 1 42  ? 13.198 -1.201  22.590 0.64 9.67  ? 42   PRO A HG3  1 
ATOM   716  H HG3  B PRO A 1 42  ? 13.650 1.220   22.628 0.36 11.21 ? 42   PRO A HG3  1 
ATOM   717  H HD2  A PRO A 1 42  ? 13.183 1.222   24.144 0.64 7.20  ? 42   PRO A HD2  1 
ATOM   718  H HD2  B PRO A 1 42  ? 13.098 1.478   25.168 0.36 10.38 ? 42   PRO A HD2  1 
ATOM   719  H HD3  A PRO A 1 42  ? 12.133 0.005   24.243 0.64 7.20  ? 42   PRO A HD3  1 
ATOM   720  H HD3  B PRO A 1 42  ? 12.307 0.412   24.240 0.36 10.38 ? 42   PRO A HD3  1 
ATOM   721  N N    . VAL A 1 43  ? 16.597 0.557   25.731 1.00 5.53  ? 43   VAL A N    1 
ATOM   722  C CA   . VAL A 1 43  ? 17.851 1.039   26.282 1.00 5.83  ? 43   VAL A CA   1 
ATOM   723  C C    . VAL A 1 43  ? 17.563 1.782   27.577 1.00 6.02  ? 43   VAL A C    1 
ATOM   724  O O    . VAL A 1 43  ? 16.621 2.570   27.641 1.00 9.15  ? 43   VAL A O    1 
ATOM   725  C CB   A VAL A 1 43  ? 18.592 1.869   25.281 0.50 7.94  ? 43   VAL A CB   1 
ATOM   726  C CB   B VAL A 1 43  ? 18.620 2.009   25.411 0.50 9.20  ? 43   VAL A CB   1 
ATOM   727  C CG1  A VAL A 1 43  ? 18.629 1.285   23.849 0.50 19.64 ? 43   VAL A CG1  1 
ATOM   728  C CG1  B VAL A 1 43  ? 19.899 2.651   25.936 0.50 12.40 ? 43   VAL A CG1  1 
ATOM   729  C CG2  A VAL A 1 43  ? 17.851 3.222   25.010 0.50 11.25 ? 43   VAL A CG2  1 
ATOM   730  C CG2  B VAL A 1 43  ? 19.009 1.359   24.063 0.50 8.12  ? 43   VAL A CG2  1 
ATOM   731  H H    . VAL A 1 43  ? 15.889 1.075   25.794 1.00 6.64  ? 43   VAL A H    1 
ATOM   732  H HA   A VAL A 1 43  ? 18.417 0.244   26.502 1.00 7.00  ? 43   VAL A HA   1 
ATOM   733  H HB   A VAL A 1 43  ? 19.522 2.047   25.603 0.50 9.52  ? 43   VAL A HB   1 
ATOM   734  H HB   B VAL A 1 43  ? 17.993 2.758   25.196 0.50 11.03 ? 43   VAL A HB   1 
ATOM   735  H HG11 A VAL A 1 43  ? 17.714 1.113   23.543 0.50 29.45 ? 43   VAL A HG11 1 
ATOM   736  H HG11 B VAL A 1 43  ? 19.709 3.116   26.777 0.50 18.59 ? 43   VAL A HG11 1 
ATOM   737  H HG12 A VAL A 1 43  ? 19.060 1.926   23.246 0.50 29.45 ? 43   VAL A HG12 1 
ATOM   738  H HG12 B VAL A 1 43  ? 20.572 1.956   26.092 0.50 18.59 ? 43   VAL A HG12 1 
ATOM   739  H HG13 A VAL A 1 43  ? 19.136 0.447   23.852 0.50 29.45 ? 43   VAL A HG13 1 
ATOM   740  H HG13 B VAL A 1 43  ? 20.237 3.292   25.277 0.50 18.59 ? 43   VAL A HG13 1 
ATOM   741  H HG21 A VAL A 1 43  ? 17.725 3.701   25.855 0.50 16.88 ? 43   VAL A HG21 1 
ATOM   742  H HG21 B VAL A 1 43  ? 18.199 1.059   23.600 0.50 12.18 ? 43   VAL A HG21 1 
ATOM   743  H HG22 A VAL A 1 43  ? 18.386 3.771   24.399 0.50 16.88 ? 43   VAL A HG22 1 
ATOM   744  H HG22 B VAL A 1 43  ? 19.479 2.015   23.508 0.50 12.18 ? 43   VAL A HG22 1 
ATOM   745  H HG23 A VAL A 1 43  ? 16.977 3.040   24.604 0.50 16.88 ? 43   VAL A HG23 1 
ATOM   746  H HG23 B VAL A 1 43  ? 19.595 0.591   24.228 0.50 12.18 ? 43   VAL A HG23 1 
ATOM   747  N N    . ASN A 1 44  ? 18.425 1.629   28.557 1.00 5.13  ? 44   ASN A N    1 
ATOM   748  C CA   . ASN A 1 44  ? 18.291 2.386   29.800 1.00 5.28  ? 44   ASN A CA   1 
ATOM   749  C C    . ASN A 1 44  ? 19.611 2.347   30.539 1.00 5.70  ? 44   ASN A C    1 
ATOM   750  O O    . ASN A 1 44  ? 20.239 1.322   30.591 1.00 10.68 ? 44   ASN A O    1 
ATOM   751  C CB   . ASN A 1 44  ? 17.195 1.754   30.660 1.00 5.82  ? 44   ASN A CB   1 
ATOM   752  C CG   . ASN A 1 44  ? 16.833 2.614   31.848 1.00 6.41  ? 44   ASN A CG   1 
ATOM   753  O OD1  . ASN A 1 44  ? 16.105 3.619   31.647 1.00 9.22  ? 44   ASN A OD1  1 
ATOM   754  N ND2  . ASN A 1 44  ? 17.274 2.279   33.033 1.00 6.22  ? 44   ASN A ND2  1 
ATOM   755  H H    . ASN A 1 44  ? 19.092 1.063   28.464 1.00 6.16  ? 44   ASN A H    1 
ATOM   756  H HA   . ASN A 1 44  ? 18.050 3.335   29.592 1.00 6.34  ? 44   ASN A HA   1 
ATOM   757  H HB2  . ASN A 1 44  ? 16.388 1.611   30.105 1.00 6.98  ? 44   ASN A HB2  1 
ATOM   758  H HB3  . ASN A 1 44  ? 17.504 0.870   30.982 1.00 6.98  ? 44   ASN A HB3  1 
ATOM   759  H HD21 . ASN A 1 44  ? 17.781 1.567   33.129 1.00 7.46  ? 44   ASN A HD21 1 
ATOM   760  H HD22 . ASN A 1 44  ? 17.063 2.767   33.735 1.00 7.46  ? 44   ASN A HD22 1 
ATOM   761  N N    . THR A 1 45  ? 19.988 3.484   31.120 1.00 4.69  ? 45   THR A N    1 
ATOM   762  C CA   . THR A 1 45  ? 21.217 3.560   31.879 1.00 4.41  ? 45   THR A CA   1 
ATOM   763  C C    . THR A 1 45  ? 20.947 3.740   33.370 1.00 4.22  ? 45   THR A C    1 
ATOM   764  O O    . THR A 1 45  ? 20.099 4.559   33.775 1.00 5.31  ? 45   THR A O    1 
ATOM   765  C CB   . THR A 1 45  ? 22.070 4.743   31.371 1.00 5.46  ? 45   THR A CB   1 
ATOM   766  O OG1  . THR A 1 45  ? 22.364 4.526   30.008 1.00 6.79  ? 45   THR A OG1  1 
ATOM   767  C CG2  . THR A 1 45  ? 23.371 4.904   32.135 1.00 6.05  ? 45   THR A CG2  1 
ATOM   768  H H    . THR A 1 45  ? 19.482 4.199   31.042 1.00 5.63  ? 45   THR A H    1 
ATOM   769  H HA   . THR A 1 45  ? 21.731 2.712   31.746 1.00 5.29  ? 45   THR A HA   1 
ATOM   770  H HB   . THR A 1 45  ? 21.538 5.586   31.456 1.00 6.55  ? 45   THR A HB   1 
ATOM   771  H HG1  . THR A 1 45  ? 21.648 4.447   29.576 1.00 10.19 ? 45   THR A HG1  1 
ATOM   772  H HG21 . THR A 1 45  ? 23.176 5.057   33.083 1.00 9.08  ? 45   THR A HG21 1 
ATOM   773  H HG22 . THR A 1 45  ? 23.909 4.091   32.040 1.00 9.08  ? 45   THR A HG22 1 
ATOM   774  H HG23 . THR A 1 45  ? 23.868 5.669   31.777 1.00 9.08  ? 45   THR A HG23 1 
ATOM   775  N N    . PHE A 1 46  ? 21.699 3.005   34.203 1.00 3.91  ? 46   PHE A N    1 
ATOM   776  C CA   . PHE A 1 46  ? 21.671 3.186   35.654 1.00 4.20  ? 46   PHE A CA   1 
ATOM   777  C C    . PHE A 1 46  ? 22.998 3.829   36.098 1.00 3.95  ? 46   PHE A C    1 
ATOM   778  O O    . PHE A 1 46  ? 24.055 3.557   35.539 1.00 4.84  ? 46   PHE A O    1 
ATOM   779  C CB   . PHE A 1 46  ? 21.491 1.839   36.372 1.00 4.38  ? 46   PHE A CB   1 
ATOM   780  C CG   . PHE A 1 46  ? 20.126 1.253   36.133 1.00 4.77  ? 46   PHE A CG   1 
ATOM   781  C CD1  . PHE A 1 46  ? 19.032 1.729   36.862 1.00 5.97  ? 46   PHE A CD1  1 
ATOM   782  C CD2  . PHE A 1 46  ? 19.915 0.248   35.201 1.00 5.12  ? 46   PHE A CD2  1 
ATOM   783  C CE1  . PHE A 1 46  ? 17.754 1.216   36.654 1.00 7.36  ? 46   PHE A CE1  1 
ATOM   784  C CE2  . PHE A 1 46  ? 18.653 -0.258  34.990 1.00 6.15  ? 46   PHE A CE2  1 
ATOM   785  C CZ   . PHE A 1 46  ? 17.568 0.198   35.735 1.00 6.75  ? 46   PHE A CZ   1 
ATOM   786  H H    . PHE A 1 46  ? 22.230 2.391   33.863 1.00 4.69  ? 46   PHE A H    1 
ATOM   787  H HA   . PHE A 1 46  ? 20.914 3.792   35.896 1.00 5.04  ? 46   PHE A HA   1 
ATOM   788  H HB2  . PHE A 1 46  ? 22.180 1.204   36.051 1.00 5.26  ? 46   PHE A HB2  1 
ATOM   789  H HB3  . PHE A 1 46  ? 21.626 1.968   37.344 1.00 5.26  ? 46   PHE A HB3  1 
ATOM   790  H HD1  . PHE A 1 46  ? 19.162 2.413   37.508 1.00 7.16  ? 46   PHE A HD1  1 
ATOM   791  H HD2  . PHE A 1 46  ? 20.649 -0.093  34.703 1.00 6.15  ? 46   PHE A HD2  1 
ATOM   792  H HE1  . PHE A 1 46  ? 17.015 1.562   37.140 1.00 8.83  ? 46   PHE A HE1  1 
ATOM   793  H HE2  . PHE A 1 46  ? 18.521 -0.927  34.328 1.00 7.38  ? 46   PHE A HE2  1 
ATOM   794  H HZ   . PHE A 1 46  ? 16.708 -0.187  35.613 1.00 8.11  ? 46   PHE A HZ   1 
ATOM   795  N N    . VAL A 1 47  ? 22.875 4.676   37.131 1.00 4.10  ? 47   VAL A N    1 
ATOM   796  C CA   . VAL A 1 47  ? 24.010 5.419   37.665 1.00 3.79  ? 47   VAL A CA   1 
ATOM   797  C C    . VAL A 1 47  ? 24.290 4.952   39.091 1.00 3.65  ? 47   VAL A C    1 
ATOM   798  O O    . VAL A 1 47  ? 23.403 4.995   39.975 1.00 4.25  ? 47   VAL A O    1 
ATOM   799  C CB   . VAL A 1 47  ? 23.718 6.934   37.650 1.00 4.17  ? 47   VAL A CB   1 
ATOM   800  C CG1  . VAL A 1 47  ? 24.933 7.701   38.170 1.00 5.14  ? 47   VAL A CG1  1 
ATOM   801  C CG2  . VAL A 1 47  ? 23.348 7.390   36.257 1.00 5.30  ? 47   VAL A CG2  1 
ATOM   802  H H    . VAL A 1 47  ? 22.083 4.787   37.498 1.00 4.92  ? 47   VAL A H    1 
ATOM   803  H HA   . VAL A 1 47  ? 24.814 5.237   37.099 1.00 4.55  ? 47   VAL A HA   1 
ATOM   804  H HB   . VAL A 1 47  ? 22.945 7.114   38.258 1.00 5.00  ? 47   VAL A HB   1 
ATOM   805  H HG11 . VAL A 1 47  ? 25.153 7.391   39.073 1.00 7.71  ? 47   VAL A HG11 1 
ATOM   806  H HG12 . VAL A 1 47  ? 25.696 7.546   37.576 1.00 7.71  ? 47   VAL A HG12 1 
ATOM   807  H HG13 . VAL A 1 47  ? 24.728 8.659   38.195 1.00 7.71  ? 47   VAL A HG13 1 
ATOM   808  H HG21 . VAL A 1 47  ? 22.565 6.889   35.947 1.00 7.96  ? 47   VAL A HG21 1 
ATOM   809  H HG22 . VAL A 1 47  ? 23.138 8.347   36.271 1.00 7.96  ? 47   VAL A HG22 1 
ATOM   810  H HG23 . VAL A 1 47  ? 24.100 7.229   35.650 1.00 7.96  ? 47   VAL A HG23 1 
ATOM   811  N N    . HIS A 1 48  ? 25.541 4.532   39.326 1.00 3.65  ? 48   HIS A N    1 
ATOM   812  C CA   . HIS A 1 48  ? 25.968 3.961   40.609 1.00 3.99  ? 48   HIS A CA   1 
ATOM   813  C C    . HIS A 1 48  ? 26.763 5.011   41.391 1.00 4.23  ? 48   HIS A C    1 
ATOM   814  O O    . HIS A 1 48  ? 27.987 4.914   41.569 1.00 5.15  ? 48   HIS A O    1 
ATOM   815  C CB   . HIS A 1 48  ? 26.826 2.724   40.361 1.00 4.42  ? 48   HIS A CB   1 
ATOM   816  C CG   . HIS A 1 48  ? 26.113 1.757   39.492 1.00 4.42  ? 48   HIS A CG   1 
ATOM   817  N ND1  . HIS A 1 48  ? 24.878 1.202   39.835 1.00 5.26  ? 48   HIS A ND1  1 
ATOM   818  C CD2  . HIS A 1 48  ? 26.391 1.314   38.232 1.00 5.09  ? 48   HIS A CD2  1 
ATOM   819  C CE1  . HIS A 1 48  ? 24.485 0.440   38.776 1.00 6.08  ? 48   HIS A CE1  1 
ATOM   820  N NE2  . HIS A 1 48  ? 25.393 0.459   37.808 1.00 5.69  ? 48   HIS A NE2  1 
ATOM   821  H H    . HIS A 1 48  ? 26.134 4.601   38.680 1.00 4.38  ? 48   HIS A H    1 
ATOM   822  H HA   . HIS A 1 48  ? 25.161 3.700   41.138 1.00 4.78  ? 48   HIS A HA   1 
ATOM   823  H HB2  . HIS A 1 48  ? 27.676 2.992   39.930 1.00 5.30  ? 48   HIS A HB2  1 
ATOM   824  H HB3  . HIS A 1 48  ? 27.043 2.293   41.226 1.00 5.30  ? 48   HIS A HB3  1 
ATOM   825  H HD1  . HIS A 1 48  ? 24.439 1.321   40.588 1.00 6.32  ? 48   HIS A HD1  1 
ATOM   826  H HD2  . HIS A 1 48  ? 27.155 1.558   37.722 1.00 6.11  ? 48   HIS A HD2  1 
ATOM   827  H HE1  . HIS A 1 48  ? 23.668 -0.042  38.736 1.00 7.29  ? 48   HIS A HE1  1 
ATOM   828  N N    . GLU A 1 49  ? 26.044 6.059   41.791 1.00 4.48  ? 49   GLU A N    1 
ATOM   829  C CA   . GLU A 1 49  ? 26.624 7.177   42.499 1.00 4.46  ? 49   GLU A CA   1 
ATOM   830  C C    . GLU A 1 49  ? 25.594 7.669   43.501 1.00 4.34  ? 49   GLU A C    1 
ATOM   831  O O    . GLU A 1 49  ? 24.406 7.385   43.392 1.00 5.49  ? 49   GLU A O    1 
ATOM   832  C CB   . GLU A 1 49  ? 26.969 8.334   41.538 1.00 4.99  ? 49   GLU A CB   1 
ATOM   833  C CG   . GLU A 1 49  ? 27.983 7.953   40.468 1.00 5.22  ? 49   GLU A CG   1 
ATOM   834  C CD   . GLU A 1 49  ? 29.391 7.736   40.961 1.00 5.66  ? 49   GLU A CD   1 
ATOM   835  O OE1  . GLU A 1 49  ? 29.731 8.111   42.102 1.00 8.11  ? 49   GLU A OE1  1 
ATOM   836  O OE2  . GLU A 1 49  ? 30.215 7.205   40.137 1.00 6.10  ? 49   GLU A OE2  1 
ATOM   837  H H    . GLU A 1 49  ? 25.181 6.070   41.618 1.00 5.37  ? 49   GLU A H    1 
ATOM   838  H HA   . GLU A 1 49  ? 27.449 6.881   42.980 1.00 5.36  ? 49   GLU A HA   1 
ATOM   839  H HB2  . GLU A 1 49  ? 26.138 8.642   41.096 1.00 5.99  ? 49   GLU A HB2  1 
ATOM   840  H HB3  . GLU A 1 49  ? 27.328 9.092   42.064 1.00 5.99  ? 49   GLU A HB3  1 
ATOM   841  H HG2  . GLU A 1 49  ? 27.674 7.122   40.027 1.00 6.26  ? 49   GLU A HG2  1 
ATOM   842  H HG3  . GLU A 1 49  ? 27.998 8.666   39.782 1.00 6.26  ? 49   GLU A HG3  1 
ATOM   843  N N    . SER A 1 50  ? 26.065 8.451   44.470 1.00 4.33  ? 50   SER A N    1 
ATOM   844  C CA   . SER A 1 50  ? 25.164 9.148   45.365 1.00 4.70  ? 50   SER A CA   1 
ATOM   845  C C    . SER A 1 50  ? 24.238 10.077  44.578 1.00 4.61  ? 50   SER A C    1 
ATOM   846  O O    . SER A 1 50  ? 24.677 10.780  43.646 1.00 4.96  ? 50   SER A O    1 
ATOM   847  C CB   A SER A 1 50  ? 26.035 10.008  46.279 0.68 5.21  ? 50   SER A CB   1 
ATOM   848  C CB   B SER A 1 50  ? 25.885 9.918   46.464 0.32 5.35  ? 50   SER A CB   1 
ATOM   849  O OG   A SER A 1 50  ? 25.196 10.855  47.067 0.68 5.52  ? 50   SER A OG   1 
ATOM   850  O OG   B SER A 1 50  ? 26.342 11.156  45.994 0.32 6.29  ? 50   SER A OG   1 
ATOM   851  H H    . SER A 1 50  ? 26.934 8.546   44.568 1.00 5.20  ? 50   SER A H    1 
ATOM   852  H HA   A SER A 1 50  ? 24.631 8.495   45.903 1.00 5.64  ? 50   SER A HA   1 
ATOM   853  H HB2  A SER A 1 50  ? 26.576 9.428   46.871 0.68 6.25  ? 50   SER A HB2  1 
ATOM   854  H HB2  B SER A 1 50  ? 25.267 10.061  47.224 0.32 6.42  ? 50   SER A HB2  1 
ATOM   855  H HB3  A SER A 1 50  ? 26.652 10.559  45.735 0.68 6.25  ? 50   SER A HB3  1 
ATOM   856  H HB3  B SER A 1 50  ? 26.653 9.385   46.789 0.32 6.42  ? 50   SER A HB3  1 
ATOM   857  H HG   A SER A 1 50  ? 25.438 11.654  46.974 0.68 8.28  ? 50   SER A HG   1 
ATOM   858  H HG   B SER A 1 50  ? 27.072 11.051  45.591 0.32 9.44  ? 50   SER A HG   1 
ATOM   859  N N    . LEU A 1 51  ? 23.004 10.176  45.026 1.00 5.58  ? 51   LEU A N    1 
ATOM   860  C CA   . LEU A 1 51  ? 22.120 11.131  44.438 1.00 6.46  ? 51   LEU A CA   1 
ATOM   861  C C    . LEU A 1 51  ? 22.686 12.575  44.563 1.00 5.36  ? 51   LEU A C    1 
ATOM   862  O O    . LEU A 1 51  ? 22.467 13.397  43.672 1.00 5.91  ? 51   LEU A O    1 
ATOM   863  C CB   . LEU A 1 51  ? 20.743 11.030  45.120 1.00 9.09  ? 51   LEU A CB   1 
ATOM   864  C CG   . LEU A 1 51  ? 19.673 11.904  44.485 1.00 11.71 ? 51   LEU A CG   1 
ATOM   865  C CD1  . LEU A 1 51  ? 19.436 11.642  43.018 1.00 15.62 ? 51   LEU A CD1  1 
ATOM   866  C CD2  . LEU A 1 51  ? 18.379 11.748  45.247 1.00 15.31 ? 51   LEU A CD2  1 
ATOM   867  H H    . LEU A 1 51  ? 22.726 9.658   45.681 1.00 6.69  ? 51   LEU A H    1 
ATOM   868  H HA   . LEU A 1 51  ? 22.013 10.912  43.468 1.00 7.76  ? 51   LEU A HA   1 
ATOM   869  H HB2  . LEU A 1 51  ? 20.442 10.088  45.092 1.00 10.91 ? 51   LEU A HB2  1 
ATOM   870  H HB3  . LEU A 1 51  ? 20.840 11.287  46.071 1.00 10.91 ? 51   LEU A HB3  1 
ATOM   871  H HG   . LEU A 1 51  ? 19.965 12.855  44.579 1.00 14.05 ? 51   LEU A HG   1 
ATOM   872  H HD11 . LEU A 1 51  ? 19.169 10.708  42.892 1.00 23.44 ? 51   LEU A HD11 1 
ATOM   873  H HD12 . LEU A 1 51  ? 18.725 12.232  42.692 1.00 23.44 ? 51   LEU A HD12 1 
ATOM   874  H HD13 . LEU A 1 51  ? 20.261 11.817  42.518 1.00 23.44 ? 51   LEU A HD13 1 
ATOM   875  H HD21 . LEU A 1 51  ? 18.098 10.809  45.225 1.00 22.96 ? 51   LEU A HD21 1 
ATOM   876  H HD22 . LEU A 1 51  ? 18.512 12.028  46.177 1.00 22.96 ? 51   LEU A HD22 1 
ATOM   877  H HD23 . LEU A 1 51  ? 17.687 12.306  44.834 1.00 22.96 ? 51   LEU A HD23 1 
ATOM   878  N N    . ALA A 1 52  ? 23.423 12.886  45.643 1.00 5.63  ? 52   ALA A N    1 
ATOM   879  C CA   . ALA A 1 52  ? 23.969 14.250  45.815 1.00 5.55  ? 52   ALA A CA   1 
ATOM   880  C C    . ALA A 1 52  ? 25.018 14.574  44.745 1.00 5.37  ? 52   ALA A C    1 
ATOM   881  O O    . ALA A 1 52  ? 25.092 15.723  44.285 1.00 5.82  ? 52   ALA A O    1 
ATOM   882  C CB   . ALA A 1 52  ? 24.580 14.387  47.208 1.00 6.54  ? 52   ALA A CB   1 
ATOM   883  H H    . ALA A 1 52  ? 23.582 12.273  46.254 1.00 6.76  ? 52   ALA A H    1 
ATOM   884  H HA   . ALA A 1 52  ? 23.218 14.905  45.732 1.00 6.67  ? 52   ALA A HA   1 
ATOM   885  H HB1  . ALA A 1 52  ? 24.898 15.305  47.336 1.00 9.81  ? 52   ALA A HB1  1 
ATOM   886  H HB2  . ALA A 1 52  ? 25.332 13.765  47.297 1.00 9.81  ? 52   ALA A HB2  1 
ATOM   887  H HB3  . ALA A 1 52  ? 23.902 14.179  47.884 1.00 9.81  ? 52   ALA A HB3  1 
ATOM   888  N N    . ASP A 1 53  ? 25.824 13.574  44.357 1.00 5.23  ? 53   ASP A N    1 
ATOM   889  C CA   . ASP A 1 53  ? 26.774 13.785  43.304 1.00 4.94  ? 53   ASP A CA   1 
ATOM   890  C C    . ASP A 1 53  ? 26.066 13.995  41.960 1.00 4.61  ? 53   ASP A C    1 
ATOM   891  O O    . ASP A 1 53  ? 26.494 14.810  41.139 1.00 5.32  ? 53   ASP A O    1 
ATOM   892  C CB   . ASP A 1 53  ? 27.761 12.630  43.211 1.00 5.38  ? 53   ASP A CB   1 
ATOM   893  C CG   . ASP A 1 53  ? 28.841 12.642  44.314 1.00 6.42  ? 53   ASP A CG   1 
ATOM   894  O OD1  . ASP A 1 53  ? 29.481 13.713  44.465 1.00 7.27  ? 53   ASP A OD1  1 
ATOM   895  O OD2  . ASP A 1 53  ? 29.051 11.604  44.912 1.00 7.63  ? 53   ASP A OD2  1 
ATOM   896  H H    . ASP A 1 53  ? 25.770 12.788  44.749 1.00 6.28  ? 53   ASP A H    1 
ATOM   897  H HA   . ASP A 1 53  ? 27.289 14.616  43.515 1.00 5.93  ? 53   ASP A HA   1 
ATOM   898  H HB2  . ASP A 1 53  ? 27.261 11.778  43.264 1.00 6.46  ? 53   ASP A HB2  1 
ATOM   899  H HB3  . ASP A 1 53  ? 28.207 12.663  42.328 1.00 6.46  ? 53   ASP A HB3  1 
ATOM   900  N N    . VAL A 1 54  ? 24.982 13.229  41.721 1.00 4.52  ? 54   VAL A N    1 
ATOM   901  C CA   . VAL A 1 54  ? 24.248 13.389  40.449 1.00 4.41  ? 54   VAL A CA   1 
ATOM   902  C C    . VAL A 1 54  ? 23.534 14.729  40.395 1.00 4.66  ? 54   VAL A C    1 
ATOM   903  O O    . VAL A 1 54  ? 23.515 15.404  39.391 1.00 4.96  ? 54   VAL A O    1 
ATOM   904  C CB   . VAL A 1 54  ? 23.348 12.161  40.237 1.00 4.82  ? 54   VAL A CB   1 
ATOM   905  C CG1  . VAL A 1 54  ? 22.537 12.327  38.937 1.00 6.09  ? 54   VAL A CG1  1 
ATOM   906  C CG2  . VAL A 1 54  ? 24.178 10.885  40.167 1.00 5.35  ? 54   VAL A CG2  1 
ATOM   907  H H    . VAL A 1 54  ? 24.715 12.640  42.317 1.00 5.42  ? 54   VAL A H    1 
ATOM   908  H HA   . VAL A 1 54  ? 24.927 13.387  39.715 1.00 5.29  ? 54   VAL A HA   1 
ATOM   909  H HB   . VAL A 1 54  ? 22.713 12.091  41.006 1.00 5.78  ? 54   VAL A HB   1 
ATOM   910  H HG11 . VAL A 1 54  ? 23.150 12.422  38.179 1.00 9.14  ? 54   VAL A HG11 1 
ATOM   911  H HG12 . VAL A 1 54  ? 21.971 11.538  38.802 1.00 9.14  ? 54   VAL A HG12 1 
ATOM   912  H HG13 . VAL A 1 54  ? 21.973 13.126  39.003 1.00 9.14  ? 54   VAL A HG13 1 
ATOM   913  H HG21 . VAL A 1 54  ? 24.817 10.950  39.427 1.00 8.02  ? 54   VAL A HG21 1 
ATOM   914  H HG22 . VAL A 1 54  ? 24.665 10.765  41.009 1.00 8.02  ? 54   VAL A HG22 1 
ATOM   915  H HG23 . VAL A 1 54  ? 23.585 10.118  40.020 1.00 8.02  ? 54   VAL A HG23 1 
ATOM   916  N N    . GLN A 1 55  ? 22.896 15.133  41.538 1.00 5.14  ? 55   GLN A N    1 
ATOM   917  C CA   . GLN A 1 55  ? 22.246 16.428  41.569 1.00 5.74  ? 55   GLN A CA   1 
ATOM   918  C C    . GLN A 1 55  ? 23.167 17.566  41.217 1.00 5.56  ? 55   GLN A C    1 
ATOM   919  O O    . GLN A 1 55  ? 22.773 18.527  40.543 1.00 6.23  ? 55   GLN A O    1 
ATOM   920  C CB   . GLN A 1 55  ? 21.672 16.707  42.964 1.00 6.51  ? 55   GLN A CB   1 
ATOM   921  C CG   . GLN A 1 55  ? 20.439 15.886  43.241 1.00 7.10  ? 55   GLN A CG   1 
ATOM   922  C CD   . GLN A 1 55  ? 19.935 16.039  44.692 1.00 9.78  ? 55   GLN A CD   1 
ATOM   923  O OE1  . GLN A 1 55  ? 20.632 16.516  45.535 1.00 13.15 ? 55   GLN A OE1  1 
ATOM   924  N NE2  . GLN A 1 55  ? 18.652 15.732  44.785 1.00 13.34 ? 55   GLN A NE2  1 
ATOM   925  H H    . GLN A 1 55  ? 22.881 14.612  42.246 1.00 6.17  ? 55   GLN A H    1 
ATOM   926  H HA   . GLN A 1 55  ? 21.492 16.418  40.913 1.00 6.89  ? 55   GLN A HA   1 
ATOM   927  H HB2  . GLN A 1 55  ? 22.360 16.503  43.646 1.00 7.81  ? 55   GLN A HB2  1 
ATOM   928  H HB3  . GLN A 1 55  ? 21.446 17.668  43.037 1.00 7.81  ? 55   GLN A HB3  1 
ATOM   929  H HG2  . GLN A 1 55  ? 19.720 16.163  42.619 1.00 8.52  ? 55   GLN A HG2  1 
ATOM   930  H HG3  . GLN A 1 55  ? 20.641 14.933  43.067 1.00 8.52  ? 55   GLN A HG3  1 
ATOM   931  H HE21 . GLN A 1 55  ? 18.232 15.382  44.096 1.00 16.01 ? 55   GLN A HE21 1 
ATOM   932  H HE22 . GLN A 1 55  ? 18.219 15.879  45.537 1.00 16.01 ? 55   GLN A HE22 1 
ATOM   933  N N    . ALA A 1 56  ? 24.438 17.493  41.698 1.00 5.11  ? 56   ALA A N    1 
ATOM   934  C CA   . ALA A 1 56  ? 25.389 18.570  41.420 1.00 5.12  ? 56   ALA A CA   1 
ATOM   935  C C    . ALA A 1 56  ? 25.705 18.701  39.945 1.00 4.78  ? 56   ALA A C    1 
ATOM   936  O O    . ALA A 1 56  ? 26.170 19.771  39.522 1.00 5.09  ? 56   ALA A O    1 
ATOM   937  C CB   . ALA A 1 56  ? 26.680 18.345  42.205 1.00 6.25  ? 56   ALA A CB   1 
ATOM   938  H H    . ALA A 1 56  ? 24.688 16.798  42.177 1.00 6.13  ? 56   ALA A H    1 
ATOM   939  H HA   . ALA A 1 56  ? 24.984 19.430  41.729 1.00 6.15  ? 56   ALA A HA   1 
ATOM   940  H HB1  . ALA A 1 56  ? 26.471 18.253  43.158 1.00 9.37  ? 56   ALA A HB1  1 
ATOM   941  H HB2  . ALA A 1 56  ? 27.279 19.109  42.074 1.00 9.37  ? 56   ALA A HB2  1 
ATOM   942  H HB3  . ALA A 1 56  ? 27.117 17.528  41.886 1.00 9.37  ? 56   ALA A HB3  1 
ATOM   943  N N    . VAL A 1 57  ? 25.486 17.652  39.146 1.00 4.62  ? 57   VAL A N    1 
ATOM   944  C CA   . VAL A 1 57  ? 25.752 17.763  37.717 1.00 4.27  ? 57   VAL A CA   1 
ATOM   945  C C    . VAL A 1 57  ? 24.934 18.886  37.085 1.00 4.47  ? 57   VAL A C    1 
ATOM   946  O O    . VAL A 1 57  ? 25.391 19.480  36.113 1.00 4.56  ? 57   VAL A O    1 
ATOM   947  C CB   . VAL A 1 57  ? 25.527 16.384  37.029 1.00 4.47  ? 57   VAL A CB   1 
ATOM   948  C CG1  . VAL A 1 57  ? 25.759 16.511  35.526 1.00 4.66  ? 57   VAL A CG1  1 
ATOM   949  C CG2  . VAL A 1 57  ? 26.480 15.356  37.621 1.00 4.85  ? 57   VAL A CG2  1 
ATOM   950  H H    . VAL A 1 57  ? 25.182 16.897  39.481 1.00 5.54  ? 57   VAL A H    1 
ATOM   951  H HA   . VAL A 1 57  ? 26.718 17.998  37.609 1.00 5.12  ? 57   VAL A HA   1 
ATOM   952  H HB   . VAL A 1 57  ? 24.586 16.088  37.191 1.00 5.37  ? 57   VAL A HB   1 
ATOM   953  H HG11 . VAL A 1 57  ? 25.141 17.174  35.155 1.00 6.99  ? 57   VAL A HG11 1 
ATOM   954  H HG12 . VAL A 1 57  ? 26.682 16.796  35.361 1.00 6.99  ? 57   VAL A HG12 1 
ATOM   955  H HG13 . VAL A 1 57  ? 25.604 15.643  35.097 1.00 6.99  ? 57   VAL A HG13 1 
ATOM   956  H HG21 . VAL A 1 57  ? 26.329 15.289  38.587 1.00 7.27  ? 57   VAL A HG21 1 
ATOM   957  H HG22 . VAL A 1 57  ? 26.319 14.483  37.204 1.00 7.27  ? 57   VAL A HG22 1 
ATOM   958  H HG23 . VAL A 1 57  ? 27.405 15.632  37.453 1.00 7.27  ? 57   VAL A HG23 1 
ATOM   959  N N    . CYS A 1 58  ? 23.768 19.192  37.655 1.00 4.62  ? 58   CYS A N    1 
ATOM   960  C CA   . CYS A 1 58  ? 22.926 20.263  37.135 1.00 4.97  ? 58   CYS A CA   1 
ATOM   961  C C    . CYS A 1 58  ? 23.586 21.642  37.211 1.00 5.05  ? 58   CYS A C    1 
ATOM   962  O O    . CYS A 1 58  ? 23.019 22.591  36.662 1.00 5.76  ? 58   CYS A O    1 
ATOM   963  C CB   . CYS A 1 58  ? 21.626 20.332  37.913 1.00 5.66  ? 58   CYS A CB   1 
ATOM   964  S SG   . CYS A 1 58  ? 20.589 18.843  37.789 1.00 6.32  ? 58   CYS A SG   1 
ATOM   965  H H    . CYS A 1 58  ? 23.500 18.739  38.360 1.00 5.54  ? 58   CYS A H    1 
ATOM   966  H HA   . CYS A 1 58  ? 22.714 20.064  36.178 1.00 5.96  ? 58   CYS A HA   1 
ATOM   967  H HB2  . CYS A 1 58  ? 21.836 20.492  38.867 1.00 6.79  ? 58   CYS A HB2  1 
ATOM   968  H HB3  . CYS A 1 58  ? 21.104 21.109  37.589 1.00 6.79  ? 58   CYS A HB3  1 
ATOM   969  N N    . SER A 1 59  ? 24.755 21.785  37.863 1.00 4.75  ? 59   SER A N    1 
ATOM   970  C CA   . SER A 1 59  ? 25.523 23.024  37.920 1.00 4.80  ? 59   SER A CA   1 
ATOM   971  C C    . SER A 1 59  ? 26.860 22.925  37.176 1.00 4.71  ? 59   SER A C    1 
ATOM   972  O O    . SER A 1 59  ? 27.698 23.789  37.363 1.00 5.76  ? 59   SER A O    1 
ATOM   973  C CB   A SER A 1 59  ? 25.700 23.560  39.332 0.55 5.42  ? 59   SER A CB   1 
ATOM   974  C CB   B SER A 1 59  ? 25.769 23.288  39.431 0.45 5.28  ? 59   SER A CB   1 
ATOM   975  O OG   A SER A 1 59  ? 26.357 22.661  40.147 0.55 8.68  ? 59   SER A OG   1 
ATOM   976  O OG   B SER A 1 59  ? 24.550 23.525  40.140 0.45 7.08  ? 59   SER A OG   1 
ATOM   977  H H    . SER A 1 59  ? 25.079 21.083  38.283 1.00 5.70  ? 59   SER A H    1 
ATOM   978  H HA   A SER A 1 59  ? 24.983 23.708  37.429 1.00 5.76  ? 59   SER A HA   1 
ATOM   979  H HB2  A SER A 1 59  ? 26.214 24.405  39.298 0.55 6.50  ? 59   SER A HB2  1 
ATOM   980  H HB2  B SER A 1 59  ? 26.229 22.507  39.828 0.45 6.34  ? 59   SER A HB2  1 
ATOM   981  H HB3  A SER A 1 59  ? 24.810 23.761  39.718 0.55 6.50  ? 59   SER A HB3  1 
ATOM   982  H HB3  B SER A 1 59  ? 26.361 24.075  39.532 0.45 6.34  ? 59   SER A HB3  1 
ATOM   983  H HG   A SER A 1 59  ? 25.959 21.921  40.125 0.55 13.02 ? 59   SER A HG   1 
ATOM   984  H HG   B SER A 1 59  ? 24.079 22.829  40.127 0.45 10.62 ? 59   SER A HG   1 
ATOM   985  N N    . GLN A 1 60  ? 27.053 21.878  36.373 1.00 4.76  ? 60   GLN A N    1 
ATOM   986  C CA   . GLN A 1 60  ? 28.344 21.627  35.749 1.00 4.72  ? 60   GLN A CA   1 
ATOM   987  C C    . GLN A 1 60  ? 28.304 22.119  34.288 1.00 4.97  ? 60   GLN A C    1 
ATOM   988  O O    . GLN A 1 60  ? 27.943 23.277  34.098 1.00 6.49  ? 60   GLN A O    1 
ATOM   989  C CB   . GLN A 1 60  ? 28.786 20.175  36.032 1.00 4.69  ? 60   GLN A CB   1 
ATOM   990  C CG   . GLN A 1 60  ? 28.964 20.035  37.542 1.00 5.20  ? 60   GLN A CG   1 
ATOM   991  C CD   . GLN A 1 60  ? 29.337 18.672  38.038 1.00 5.25  ? 60   GLN A CD   1 
ATOM   992  O OE1  . GLN A 1 60  ? 29.661 17.753  37.298 1.00 4.91  ? 60   GLN A OE1  1 
ATOM   993  N NE2  . GLN A 1 60  ? 29.187 18.462  39.338 1.00 6.90  ? 60   GLN A NE2  1 
ATOM   994  H H    . GLN A 1 60  ? 26.385 21.327  36.216 1.00 5.72  ? 60   GLN A H    1 
ATOM   995  H HA   . GLN A 1 60  ? 29.000 22.215  36.222 1.00 5.66  ? 60   GLN A HA   1 
ATOM   996  H HB2  . GLN A 1 60  ? 28.100 19.539  35.708 1.00 5.63  ? 60   GLN A HB2  1 
ATOM   997  H HB3  . GLN A 1 60  ? 29.639 19.980  35.568 1.00 5.63  ? 60   GLN A HB3  1 
ATOM   998  H HG2  . GLN A 1 60  ? 29.664 20.673  37.833 1.00 6.24  ? 60   GLN A HG2  1 
ATOM   999  H HG3  . GLN A 1 60  ? 28.118 20.304  37.980 1.00 6.24  ? 60   GLN A HG3  1 
ATOM   1000 H HE21 . GLN A 1 60  ? 28.953 19.126  39.867 1.00 8.28  ? 60   GLN A HE21 1 
ATOM   1001 H HE22 . GLN A 1 60  ? 29.321 17.659  39.673 1.00 8.28  ? 60   GLN A HE22 1 
ATOM   1002 N N    . LYS A 1 61  ? 28.768 21.353  33.298 1.00 4.99  ? 61   LYS A N    1 
ATOM   1003 C CA   . LYS A 1 61  ? 28.957 21.909  31.954 1.00 5.27  ? 61   LYS A CA   1 
ATOM   1004 C C    . LYS A 1 61  ? 27.611 21.888  31.205 1.00 4.98  ? 61   LYS A C    1 
ATOM   1005 O O    . LYS A 1 61  ? 27.057 20.847  30.948 1.00 5.95  ? 61   LYS A O    1 
ATOM   1006 C CB   . LYS A 1 61  ? 29.958 21.096  31.198 1.00 6.70  ? 61   LYS A CB   1 
ATOM   1007 C CG   . LYS A 1 61  ? 30.175 21.656  29.791 1.00 9.28  ? 61   LYS A CG   1 
ATOM   1008 C CD   . LYS A 1 61  ? 31.153 20.884  28.978 1.00 14.04 ? 61   LYS A CD   1 
ATOM   1009 C CE   . LYS A 1 61  ? 31.461 21.473  27.610 1.00 20.97 ? 61   LYS A CE   1 
ATOM   1010 N NZ   . LYS A 1 61  ? 32.324 20.578  26.793 1.00 27.72 ? 61   LYS A NZ   1 
ATOM   1011 H H    . LYS A 1 61  ? 28.962 20.508  33.453 1.00 5.99  ? 61   LYS A H    1 
ATOM   1012 H HA   . LYS A 1 61  ? 29.282 22.852  32.027 1.00 6.33  ? 61   LYS A HA   1 
ATOM   1013 H HB2  . LYS A 1 61  ? 30.819 21.096  31.688 1.00 8.04  ? 61   LYS A HB2  1 
ATOM   1014 H HB3  . LYS A 1 61  ? 29.642 20.161  31.135 1.00 8.04  ? 61   LYS A HB3  1 
ATOM   1015 H HG2  . LYS A 1 61  ? 29.306 21.669  29.317 1.00 11.13 ? 61   LYS A HG2  1 
ATOM   1016 H HG3  . LYS A 1 61  ? 30.491 22.591  29.866 1.00 11.13 ? 61   LYS A HG3  1 
ATOM   1017 H HD2  . LYS A 1 61  ? 31.999 20.813  29.487 1.00 16.85 ? 61   LYS A HD2  1 
ATOM   1018 H HD3  . LYS A 1 61  ? 30.803 19.966  28.853 1.00 16.85 ? 61   LYS A HD3  1 
ATOM   1019 H HE2  . LYS A 1 61  ? 30.612 21.635  27.127 1.00 25.16 ? 61   LYS A HE2  1 
ATOM   1020 H HE3  . LYS A 1 61  ? 31.916 22.345  27.726 1.00 25.16 ? 61   LYS A HE3  1 
ATOM   1021 H HZ1  . LYS A 1 61  ? 31.936 19.757  26.729 1.00 41.59 ? 61   LYS A HZ1  1 
ATOM   1022 H HZ2  . LYS A 1 61  ? 32.426 20.931  25.961 1.00 41.59 ? 61   LYS A HZ2  1 
ATOM   1023 H HZ3  . LYS A 1 61  ? 33.139 20.497  27.191 1.00 41.59 ? 61   LYS A HZ3  1 
ATOM   1024 N N    . ASN A 1 62  ? 27.135 23.084  30.810 1.00 5.18  ? 62   ASN A N    1 
ATOM   1025 C CA   . ASN A 1 62  ? 25.881 23.115  30.100 1.00 4.80  ? 62   ASN A CA   1 
ATOM   1026 C C    . ASN A 1 62  ? 26.079 22.691  28.629 1.00 5.21  ? 62   ASN A C    1 
ATOM   1027 O O    . ASN A 1 62  ? 26.960 23.198  27.977 1.00 6.38  ? 62   ASN A O    1 
ATOM   1028 C CB   . ASN A 1 62  ? 25.322 24.561  30.201 1.00 5.34  ? 62   ASN A CB   1 
ATOM   1029 C CG   . ASN A 1 62  ? 23.931 24.784  29.679 1.00 5.30  ? 62   ASN A CG   1 
ATOM   1030 O OD1  . ASN A 1 62  ? 23.614 25.876  29.188 1.00 6.52  ? 62   ASN A OD1  1 
ATOM   1031 N ND2  . ASN A 1 62  ? 23.042 23.821  29.820 1.00 6.33  ? 62   ASN A ND2  1 
ATOM   1032 H H    . ASN A 1 62  ? 27.577 23.826  30.980 1.00 6.22  ? 62   ASN A H    1 
ATOM   1033 H HA   . ASN A 1 62  ? 25.240 22.485  30.539 1.00 5.76  ? 62   ASN A HA   1 
ATOM   1034 H HB2  . ASN A 1 62  ? 25.341 24.833  31.153 1.00 6.41  ? 62   ASN A HB2  1 
ATOM   1035 H HB3  . ASN A 1 62  ? 25.935 25.164  29.710 1.00 6.41  ? 62   ASN A HB3  1 
ATOM   1036 H HD21 . ASN A 1 62  ? 23.281 23.050  30.171 1.00 7.60  ? 62   ASN A HD21 1 
ATOM   1037 H HD22 . ASN A 1 62  ? 22.210 23.949  29.563 1.00 7.60  ? 62   ASN A HD22 1 
ATOM   1038 N N    . VAL A 1 63  ? 25.204 21.778  28.171 1.00 5.13  ? 63   VAL A N    1 
ATOM   1039 C CA   . VAL A 1 63  ? 25.263 21.241  26.835 1.00 5.76  ? 63   VAL A CA   1 
ATOM   1040 C C    . VAL A 1 63  ? 23.843 21.128  26.285 1.00 5.70  ? 63   VAL A C    1 
ATOM   1041 O O    . VAL A 1 63  ? 22.855 21.077  27.012 1.00 6.64  ? 63   VAL A O    1 
ATOM   1042 C CB   . VAL A 1 63  ? 25.956 19.861  26.792 1.00 6.15  ? 63   VAL A CB   1 
ATOM   1043 C CG1  . VAL A 1 63  ? 27.404 19.958  27.299 1.00 7.57  ? 63   VAL A CG1  1 
ATOM   1044 C CG2  . VAL A 1 63  ? 25.193 18.799  27.583 1.00 7.08  ? 63   VAL A CG2  1 
ATOM   1045 H H    . VAL A 1 63  ? 24.568 21.497  28.710 1.00 6.16  ? 63   VAL A H    1 
ATOM   1046 H HA   . VAL A 1 63  ? 25.779 21.875  26.259 1.00 6.91  ? 63   VAL A HA   1 
ATOM   1047 H HB   . VAL A 1 63  ? 25.987 19.566  25.837 1.00 7.39  ? 63   VAL A HB   1 
ATOM   1048 H HG11 . VAL A 1 63  ? 27.885 20.640  26.785 1.00 11.35 ? 63   VAL A HG11 1 
ATOM   1049 H HG12 . VAL A 1 63  ? 27.403 20.204  28.247 1.00 11.35 ? 63   VAL A HG12 1 
ATOM   1050 H HG13 . VAL A 1 63  ? 27.848 19.091  27.187 1.00 11.35 ? 63   VAL A HG13 1 
ATOM   1051 H HG21 . VAL A 1 63  ? 24.269 18.753  27.260 1.00 10.61 ? 63   VAL A HG21 1 
ATOM   1052 H HG22 . VAL A 1 63  ? 25.625 17.928  27.462 1.00 10.61 ? 63   VAL A HG22 1 
ATOM   1053 H HG23 . VAL A 1 63  ? 25.195 19.036  28.534 1.00 10.61 ? 63   VAL A HG23 1 
ATOM   1054 N N    . ALA A 1 64  ? 23.745 21.053  24.955 1.00 6.63  ? 64   ALA A N    1 
ATOM   1055 C CA   . ALA A 1 64  ? 22.447 20.828  24.336 1.00 6.84  ? 64   ALA A CA   1 
ATOM   1056 C C    . ALA A 1 64  ? 21.957 19.414  24.606 1.00 6.42  ? 64   ALA A C    1 
ATOM   1057 O O    . ALA A 1 64  ? 22.758 18.465  24.602 1.00 8.29  ? 64   ALA A O    1 
ATOM   1058 C CB   . ALA A 1 64  ? 22.579 21.042  22.818 1.00 9.91  ? 64   ALA A CB   1 
ATOM   1059 H H    . ALA A 1 64  ? 24.464 21.139  24.454 1.00 7.96  ? 64   ALA A H    1 
ATOM   1060 H HA   . ALA A 1 64  ? 21.787 21.482  24.706 1.00 8.21  ? 64   ALA A HA   1 
ATOM   1061 H HB1  . ALA A 1 64  ? 21.706 20.908  22.392 1.00 14.86 ? 64   ALA A HB1  1 
ATOM   1062 H HB2  . ALA A 1 64  ? 22.890 21.955  22.643 1.00 14.86 ? 64   ALA A HB2  1 
ATOM   1063 H HB3  . ALA A 1 64  ? 23.223 20.401  22.452 1.00 14.86 ? 64   ALA A HB3  1 
ATOM   1064 N N    . CYS A 1 65  ? 20.671 19.275  24.807 1.00 7.13  ? 65   CYS A N    1 
ATOM   1065 C CA   . CYS A 1 65  ? 20.074 17.950  25.025 1.00 6.56  ? 65   CYS A CA   1 
ATOM   1066 C C    . CYS A 1 65  ? 19.830 17.204  23.721 1.00 6.71  ? 65   CYS A C    1 
ATOM   1067 O O    . CYS A 1 65  ? 19.351 17.808  22.720 1.00 8.98  ? 65   CYS A O    1 
ATOM   1068 C CB   . CYS A 1 65  ? 18.701 18.112  25.649 1.00 7.39  ? 65   CYS A CB   1 
ATOM   1069 S SG   . CYS A 1 65  ? 18.704 18.965  27.251 1.00 8.63  ? 65   CYS A SG   1 
ATOM   1070 H H    . CYS A 1 65  ? 20.155 19.987  24.811 1.00 8.55  ? 65   CYS A H    1 
ATOM   1071 H HA   . CYS A 1 65  ? 20.660 17.406  25.625 1.00 7.87  ? 65   CYS A HA   1 
ATOM   1072 H HB2  . CYS A 1 65  ? 18.126 18.617  25.022 1.00 8.87  ? 65   CYS A HB2  1 
ATOM   1073 H HB3  . CYS A 1 65  ? 18.299 17.215  25.768 1.00 8.87  ? 65   CYS A HB3  1 
ATOM   1074 N N    . LYS A 1 66  ? 20.081 15.899  23.717 1.00 6.33  ? 66   LYS A N    1 
ATOM   1075 C CA   . LYS A 1 66  ? 19.764 15.029  22.612 1.00 6.55  ? 66   LYS A CA   1 
ATOM   1076 C C    . LYS A 1 66  ? 18.248 14.723  22.536 1.00 6.34  ? 66   LYS A C    1 
ATOM   1077 O O    . LYS A 1 66  ? 17.709 14.571  21.429 1.00 7.41  ? 66   LYS A O    1 
ATOM   1078 C CB   . LYS A 1 66  ? 20.523 13.733  22.701 1.00 7.85  ? 66   LYS A CB   1 
ATOM   1079 C CG   A LYS A 1 66  ? 22.038 13.855  22.534 0.56 8.00  ? 66   LYS A CG   1 
ATOM   1080 C CG   B LYS A 1 66  ? 21.947 13.980  22.110 0.44 11.41 ? 66   LYS A CG   1 
ATOM   1081 C CD   A LYS A 1 66  ? 22.282 14.237  21.064 0.56 14.16 ? 66   LYS A CD   1 
ATOM   1082 C CD   B LYS A 1 66  ? 22.769 12.726  22.150 0.44 17.11 ? 66   LYS A CD   1 
ATOM   1083 C CE   A LYS A 1 66  ? 23.690 14.015  20.498 0.56 19.57 ? 66   LYS A CE   1 
ATOM   1084 C CE   B LYS A 1 66  ? 24.280 12.855  22.034 0.44 21.61 ? 66   LYS A CE   1 
ATOM   1085 N NZ   A LYS A 1 66  ? 24.565 15.038  21.018 0.56 24.39 ? 66   LYS A NZ   1 
ATOM   1086 N NZ   B LYS A 1 66  ? 25.080 11.732  22.626 0.44 20.95 ? 66   LYS A NZ   1 
ATOM   1087 H H    . LYS A 1 66  ? 20.462 15.546  24.428 1.00 7.60  ? 66   LYS A H    1 
ATOM   1088 H HA   . LYS A 1 66  ? 20.032 15.490  21.766 1.00 7.86  ? 66   LYS A HA   1 
ATOM   1089 H HB2  A LYS A 1 66  ? 20.336 13.319  23.580 1.00 9.42  ? 66   LYS A HB2  1 
ATOM   1090 H HB3  A LYS A 1 66  ? 20.178 13.120  22.004 1.00 9.42  ? 66   LYS A HB3  1 
ATOM   1091 H HG2  A LYS A 1 66  ? 22.398 14.552  23.137 0.56 9.60  ? 66   LYS A HG2  1 
ATOM   1092 H HG2  B LYS A 1 66  ? 21.867 14.292  21.174 0.44 13.70 ? 66   LYS A HG2  1 
ATOM   1093 H HG3  A LYS A 1 66  ? 22.479 12.994  22.745 0.56 9.60  ? 66   LYS A HG3  1 
ATOM   1094 H HG3  B LYS A 1 66  ? 22.402 14.688  22.632 0.44 13.70 ? 66   LYS A HG3  1 
ATOM   1095 H HD2  A LYS A 1 66  ? 21.645 13.724  20.506 0.56 16.99 ? 66   LYS A HD2  1 
ATOM   1096 H HD2  B LYS A 1 66  ? 22.570 12.260  23.001 0.44 20.54 ? 66   LYS A HD2  1 
ATOM   1097 H HD3  A LYS A 1 66  ? 22.058 15.195  20.957 0.56 16.99 ? 66   LYS A HD3  1 
ATOM   1098 H HD3  B LYS A 1 66  ? 22.459 12.137  21.417 0.44 20.54 ? 66   LYS A HD3  1 
ATOM   1099 H HE2  A LYS A 1 66  ? 24.022 13.120  20.761 0.56 23.49 ? 66   LYS A HE2  1 
ATOM   1100 H HE2  B LYS A 1 66  ? 24.514 12.931  21.075 0.44 25.94 ? 66   LYS A HE2  1 
ATOM   1101 H HE3  A LYS A 1 66  ? 23.667 14.060  19.509 0.56 23.49 ? 66   LYS A HE3  1 
ATOM   1102 H HE3  B LYS A 1 66  ? 24.555 13.698  22.474 0.44 25.94 ? 66   LYS A HE3  1 
ATOM   1103 H HZ1  A LYS A 1 66  ? 24.549 15.017  21.928 0.56 36.58 ? 66   LYS A HZ1  1 
ATOM   1104 H HZ1  B LYS A 1 66  ? 24.746 10.937  22.338 0.44 31.42 ? 66   LYS A HZ1  1 
ATOM   1105 H HZ2  A LYS A 1 66  ? 25.413 14.888  20.726 0.56 36.58 ? 66   LYS A HZ2  1 
ATOM   1106 H HZ2  B LYS A 1 66  ? 25.949 11.809  22.366 0.44 31.42 ? 66   LYS A HZ2  1 
ATOM   1107 H HZ3  A LYS A 1 66  ? 24.284 15.853  20.729 0.56 36.58 ? 66   LYS A HZ3  1 
ATOM   1108 H HZ3  B LYS A 1 66  ? 25.031 11.770  23.534 0.44 31.42 ? 66   LYS A HZ3  1 
HETATM 1109 N N    . IAS A 1 67  ? 17.591 14.578  23.693 1.00 6.83  ? 67   IAS A N    1 
HETATM 1110 C CA   . IAS A 1 67  ? 16.197 14.149  23.690 1.00 7.04  ? 67   IAS A CA   1 
HETATM 1111 C C    . IAS A 1 67  ? 16.002 12.802  22.992 1.00 8.16  ? 67   IAS A C    1 
HETATM 1112 O O    . IAS A 1 67  ? 14.886 12.566  22.453 1.00 11.70 ? 67   IAS A O    1 
HETATM 1113 C CB   . IAS A 1 67  ? 15.245 15.271  23.159 1.00 7.60  ? 67   IAS A CB   1 
HETATM 1114 C CG   . IAS A 1 67  ? 14.992 16.345  24.177 1.00 8.11  ? 67   IAS A CG   1 
HETATM 1115 O OD1  . IAS A 1 67  ? 14.476 16.045  25.286 1.00 9.75  ? 67   IAS A OD1  1 
HETATM 1116 H H    . IAS A 1 67  ? 18.000 14.742  24.455 1.00 8.20  ? 67   IAS A H    1 
HETATM 1117 H HA   . IAS A 1 67  ? 15.949 14.005  24.647 1.00 8.44  ? 67   IAS A HA   1 
HETATM 1118 H HB2  . IAS A 1 67  ? 15.646 15.679  22.351 1.00 9.12  ? 67   IAS A HB2  1 
HETATM 1119 H HB3  . IAS A 1 67  ? 14.382 14.864  22.896 1.00 9.12  ? 67   IAS A HB3  1 
ATOM   1120 N N    . GLY A 1 68  ? 15.227 17.597  23.854 1.00 8.29  ? 68   GLY A N    1 
ATOM   1121 C CA   . GLY A 1 68  ? 14.997 18.659  24.817 1.00 8.56  ? 68   GLY A CA   1 
ATOM   1122 C C    . GLY A 1 68  ? 15.477 19.981  24.264 1.00 8.05  ? 68   GLY A C    1 
ATOM   1123 O O    . GLY A 1 68  ? 15.653 20.154  23.076 1.00 10.44 ? 68   GLY A O    1 
ATOM   1124 H H    . GLY A 1 68  ? 15.524 17.793  23.049 1.00 9.94  ? 68   GLY A H    1 
ATOM   1125 H HA2  . GLY A 1 68  ? 14.031 18.716  25.025 1.00 10.27 ? 68   GLY A HA2  1 
ATOM   1126 H HA3  . GLY A 1 68  ? 15.481 18.456  25.657 1.00 10.27 ? 68   GLY A HA3  1 
ATOM   1127 N N    . GLN A 1 69  ? 15.724 20.903  25.187 1.00 7.57  ? 69   GLN A N    1 
ATOM   1128 C CA   . GLN A 1 69  ? 16.239 22.223  24.893 1.00 7.42  ? 69   GLN A CA   1 
ATOM   1129 C C    . GLN A 1 69  ? 17.720 22.207  25.202 1.00 7.70  ? 69   GLN A C    1 
ATOM   1130 O O    . GLN A 1 69  ? 18.457 21.326  24.719 1.00 9.92  ? 69   GLN A O    1 
ATOM   1131 C CB   . GLN A 1 69  ? 15.415 23.341  25.567 1.00 9.31  ? 69   GLN A CB   1 
ATOM   1132 C CG   . GLN A 1 69  ? 13.962 23.336  25.242 1.00 9.23  ? 69   GLN A CG   1 
ATOM   1133 C CD   . GLN A 1 69  ? 13.208 22.168  25.908 1.00 9.83  ? 69   GLN A CD   1 
ATOM   1134 O OE1  . GLN A 1 69  ? 13.476 21.940  27.075 1.00 10.94 ? 69   GLN A OE1  1 
ATOM   1135 N NE2  . GLN A 1 69  ? 12.332 21.536  25.237 1.00 11.04 ? 69   GLN A NE2  1 
ATOM   1136 H H    . GLN A 1 69  ? 15.565 20.699  26.028 1.00 9.09  ? 69   GLN A H    1 
ATOM   1137 H HA   . GLN A 1 69  ? 16.151 22.354  23.906 1.00 8.90  ? 69   GLN A HA   1 
ATOM   1138 H HB2  . GLN A 1 69  ? 15.518 23.260  26.548 1.00 11.18 ? 69   GLN A HB2  1 
ATOM   1139 H HB3  . GLN A 1 69  ? 15.794 24.216  25.299 1.00 11.18 ? 69   GLN A HB3  1 
ATOM   1140 H HG2  . GLN A 1 69  ? 13.562 24.191  25.540 1.00 11.08 ? 69   GLN A HG2  1 
ATOM   1141 H HG3  . GLN A 1 69  ? 13.851 23.275  24.261 1.00 11.08 ? 69   GLN A HG3  1 
ATOM   1142 H HE21 . GLN A 1 69  ? 12.184 21.748  24.396 1.00 13.25 ? 69   GLN A HE21 1 
ATOM   1143 H HE22 . GLN A 1 69  ? 11.874 20.886  25.614 1.00 13.25 ? 69   GLN A HE22 1 
ATOM   1144 N N    . THR A 1 70  ? 18.249 23.190  25.913 1.00 6.43  ? 70   THR A N    1 
ATOM   1145 C CA   . THR A 1 70  ? 19.639 23.201  26.346 1.00 6.19  ? 70   THR A CA   1 
ATOM   1146 C C    . THR A 1 70  ? 19.732 23.138  27.881 1.00 6.14  ? 70   THR A C    1 
ATOM   1147 O O    . THR A 1 70  ? 20.748 23.543  28.427 1.00 8.52  ? 70   THR A O    1 
ATOM   1148 C CB   . THR A 1 70  ? 20.428 24.381  25.805 1.00 6.46  ? 70   THR A CB   1 
ATOM   1149 O OG1  . THR A 1 70  ? 19.811 25.598  26.263 1.00 6.59  ? 70   THR A OG1  1 
ATOM   1150 C CG2  . THR A 1 70  ? 20.444 24.400  24.295 1.00 7.78  ? 70   THR A CG2  1 
ATOM   1151 H H    . THR A 1 70  ? 17.736 23.870  26.134 1.00 7.72  ? 70   THR A H    1 
ATOM   1152 H HA   . THR A 1 70  ? 20.067 22.370  25.989 1.00 7.43  ? 70   THR A HA   1 
ATOM   1153 H HB   . THR A 1 70  ? 21.368 24.337  26.146 1.00 7.75  ? 70   THR A HB   1 
ATOM   1154 H HG1  . THR A 1 70  ? 19.591 26.066  25.602 1.00 9.88  ? 70   THR A HG1  1 
ATOM   1155 H HG21 . THR A 1 70  ? 19.525 24.463  23.959 1.00 11.67 ? 70   THR A HG21 1 
ATOM   1156 H HG22 . THR A 1 70  ? 20.959 25.173  23.983 1.00 11.67 ? 70   THR A HG22 1 
ATOM   1157 H HG23 . THR A 1 70  ? 20.857 23.576  23.962 1.00 11.67 ? 70   THR A HG23 1 
ATOM   1158 N N    . ASN A 1 71  ? 18.750 22.606  28.568 1.00 6.13  ? 71   ASN A N    1 
ATOM   1159 C CA   . ASN A 1 71  ? 18.806 22.385  29.994 1.00 6.87  ? 71   ASN A CA   1 
ATOM   1160 C C    . ASN A 1 71  ? 19.449 21.037  30.364 1.00 5.46  ? 71   ASN A C    1 
ATOM   1161 O O    . ASN A 1 71  ? 19.004 20.376  31.283 1.00 6.24  ? 71   ASN A O    1 
ATOM   1162 C CB   . ASN A 1 71  ? 17.440 22.527  30.653 1.00 8.86  ? 71   ASN A CB   1 
ATOM   1163 C CG   . ASN A 1 71  ? 16.488 21.498  30.150 1.00 10.82 ? 71   ASN A CG   1 
ATOM   1164 O OD1  . ASN A 1 71  ? 16.396 21.274  28.919 1.00 12.01 ? 71   ASN A OD1  1 
ATOM   1165 N ND2  . ASN A 1 71  ? 15.736 20.845  31.012 1.00 14.86 ? 71   ASN A ND2  1 
ATOM   1166 H H    . ASN A 1 71  ? 18.019 22.372  28.138 1.00 7.35  ? 71   ASN A H    1 
ATOM   1167 H HA   . ASN A 1 71  ? 19.390 23.101  30.377 1.00 8.25  ? 71   ASN A HA   1 
ATOM   1168 H HB2  . ASN A 1 71  ? 17.537 22.434  31.634 1.00 10.63 ? 71   ASN A HB2  1 
ATOM   1169 H HB3  . ASN A 1 71  ? 17.077 23.429  30.466 1.00 10.63 ? 71   ASN A HB3  1 
ATOM   1170 H HD21 . ASN A 1 71  ? 15.809 21.010  31.874 1.00 17.83 ? 71   ASN A HD21 1 
ATOM   1171 H HD22 . ASN A 1 71  ? 15.161 20.243  30.727 1.00 17.83 ? 71   ASN A HD22 1 
ATOM   1172 N N    . CYS A 1 72  ? 20.518 20.673  29.627 1.00 5.72  ? 72   CYS A N    1 
ATOM   1173 C CA   . CYS A 1 72  ? 21.283 19.505  29.917 1.00 5.04  ? 72   CYS A CA   1 
ATOM   1174 C C    . CYS A 1 72  ? 22.674 19.899  30.415 1.00 4.58  ? 72   CYS A C    1 
ATOM   1175 O O    . CYS A 1 72  ? 23.188 20.964  30.070 1.00 4.86  ? 72   CYS A O    1 
ATOM   1176 C CB   . CYS A 1 72  ? 21.380 18.562  28.727 1.00 5.62  ? 72   CYS A CB   1 
ATOM   1177 S SG   . CYS A 1 72  ? 19.816 17.668  28.441 1.00 7.41  ? 72   CYS A SG   1 
ATOM   1178 H H    . CYS A 1 72  ? 20.752 21.175  28.942 1.00 6.86  ? 72   CYS A H    1 
ATOM   1179 H HA   . CYS A 1 72  ? 20.822 19.015  30.657 1.00 6.05  ? 72   CYS A HA   1 
ATOM   1180 H HB2  . CYS A 1 72  ? 21.612 19.082  27.917 1.00 6.74  ? 72   CYS A HB2  1 
ATOM   1181 H HB3  . CYS A 1 72  ? 22.105 17.908  28.887 1.00 6.74  ? 72   CYS A HB3  1 
ATOM   1182 N N    . TYR A 1 73  ? 23.234 19.020  31.224 1.00 4.39  ? 73   TYR A N    1 
ATOM   1183 C CA   . TYR A 1 73  ? 24.514 19.311  31.879 1.00 4.42  ? 73   TYR A CA   1 
ATOM   1184 C C    . TYR A 1 73  ? 25.343 18.034  31.933 1.00 4.44  ? 73   TYR A C    1 
ATOM   1185 O O    . TYR A 1 73  ? 24.820 16.955  32.253 1.00 4.74  ? 73   TYR A O    1 
ATOM   1186 C CB   . TYR A 1 73  ? 24.272 19.830  33.319 1.00 5.25  ? 73   TYR A CB   1 
ATOM   1187 C CG   . TYR A 1 73  ? 23.391 21.055  33.329 1.00 5.00  ? 73   TYR A CG   1 
ATOM   1188 C CD1  . TYR A 1 73  ? 21.990 20.929  33.321 1.00 4.95  ? 73   TYR A CD1  1 
ATOM   1189 C CD2  . TYR A 1 73  ? 23.943 22.333  33.310 1.00 5.07  ? 73   TYR A CD2  1 
ATOM   1190 C CE1  . TYR A 1 73  ? 21.188 22.048  33.290 1.00 4.91  ? 73   TYR A CE1  1 
ATOM   1191 C CE2  . TYR A 1 73  ? 23.129 23.473  33.256 1.00 5.01  ? 73   TYR A CE2  1 
ATOM   1192 C CZ   . TYR A 1 73  ? 21.739 23.318  33.244 1.00 4.88  ? 73   TYR A CZ   1 
ATOM   1193 O OH   . TYR A 1 73  ? 20.956 24.447  33.218 1.00 5.36  ? 73   TYR A OH   1 
ATOM   1194 H H    . TYR A 1 73  ? 22.835 18.250  31.372 1.00 5.26  ? 73   TYR A H    1 
ATOM   1195 H HA   . TYR A 1 73  ? 25.006 20.005  31.353 1.00 5.30  ? 73   TYR A HA   1 
ATOM   1196 H HB2  . TYR A 1 73  ? 23.845 19.116  33.856 1.00 6.30  ? 73   TYR A HB2  1 
ATOM   1197 H HB3  . TYR A 1 73  ? 25.142 20.049  33.738 1.00 6.30  ? 73   TYR A HB3  1 
ATOM   1198 H HD1  . TYR A 1 73  ? 21.595 20.065  33.338 1.00 5.94  ? 73   TYR A HD1  1 
ATOM   1199 H HD2  . TYR A 1 73  ? 24.888 22.434  33.334 1.00 6.08  ? 73   TYR A HD2  1 
ATOM   1200 H HE1  . TYR A 1 73  ? 20.243 21.948  33.299 1.00 5.89  ? 73   TYR A HE1  1 
ATOM   1201 H HE2  . TYR A 1 73  ? 23.516 24.340  33.229 1.00 6.01  ? 73   TYR A HE2  1 
ATOM   1202 H HH   . TYR A 1 73  ? 20.145 24.226  33.233 1.00 8.03  ? 73   TYR A HH   1 
ATOM   1203 N N    . GLN A 1 74  ? 26.616 18.206  31.632 1.00 4.93  ? 74   GLN A N    1 
ATOM   1204 C CA   . GLN A 1 74  ? 27.589 17.122  31.575 1.00 4.85  ? 74   GLN A CA   1 
ATOM   1205 C C    . GLN A 1 74  ? 28.483 17.183  32.801 1.00 4.88  ? 74   GLN A C    1 
ATOM   1206 O O    . GLN A 1 74  ? 28.996 18.228  33.184 1.00 5.38  ? 74   GLN A O    1 
ATOM   1207 C CB   . GLN A 1 74  ? 28.452 17.301  30.322 1.00 5.49  ? 74   GLN A CB   1 
ATOM   1208 C CG   . GLN A 1 74  ? 29.483 16.197  30.103 1.00 6.41  ? 74   GLN A CG   1 
ATOM   1209 C CD   . GLN A 1 74  ? 30.204 16.436  28.734 1.00 11.04 ? 74   GLN A CD   1 
ATOM   1210 O OE1  . GLN A 1 74  ? 29.530 16.623  27.763 1.00 14.88 ? 74   GLN A OE1  1 
ATOM   1211 N NE2  . GLN A 1 74  ? 31.467 16.435  28.749 1.00 22.22 ? 74   GLN A NE2  1 
ATOM   1212 H H    . GLN A 1 74  ? 26.894 19.022  31.454 1.00 5.91  ? 74   GLN A H    1 
ATOM   1213 H HA   . GLN A 1 74  ? 27.116 16.242  31.541 1.00 5.82  ? 74   GLN A HA   1 
ATOM   1214 H HB2  . GLN A 1 74  ? 27.858 17.341  29.531 1.00 6.58  ? 74   GLN A HB2  1 
ATOM   1215 H HB3  . GLN A 1 74  ? 28.926 18.169  30.385 1.00 6.58  ? 74   GLN A HB3  1 
ATOM   1216 H HG2  . GLN A 1 74  ? 30.146 16.205  30.838 1.00 7.70  ? 74   GLN A HG2  1 
ATOM   1217 H HG3  . GLN A 1 74  ? 29.035 15.314  30.098 1.00 7.70  ? 74   GLN A HG3  1 
ATOM   1218 H HE21 . GLN A 1 74  ? 31.898 16.290  29.502 1.00 26.67 ? 74   GLN A HE21 1 
ATOM   1219 H HE22 . GLN A 1 74  ? 31.916 16.580  28.006 1.00 26.67 ? 74   GLN A HE22 1 
ATOM   1220 N N    . SER A 1 75  ? 28.672 16.010  33.420 1.00 4.62  ? 75   SER A N    1 
ATOM   1221 C CA   . SER A 1 75  ? 29.452 15.924  34.641 1.00 4.38  ? 75   SER A CA   1 
ATOM   1222 C C    . SER A 1 75  ? 30.932 16.177  34.355 1.00 4.88  ? 75   SER A C    1 
ATOM   1223 O O    . SER A 1 75  ? 31.496 15.702  33.376 1.00 6.13  ? 75   SER A O    1 
ATOM   1224 C CB   . SER A 1 75  ? 29.237 14.581  35.306 1.00 4.56  ? 75   SER A CB   1 
ATOM   1225 O OG   . SER A 1 75  ? 29.687 13.454  34.547 1.00 4.82  ? 75   SER A OG   1 
ATOM   1226 H H    . SER A 1 75  ? 28.318 15.280  33.080 1.00 5.54  ? 75   SER A H    1 
ATOM   1227 H HA   . SER A 1 75  ? 29.130 16.635  35.266 1.00 5.25  ? 75   SER A HA   1 
ATOM   1228 H HB2  . SER A 1 75  ? 29.708 14.582  36.177 1.00 5.47  ? 75   SER A HB2  1 
ATOM   1229 H HB3  . SER A 1 75  ? 28.271 14.471  35.490 1.00 5.47  ? 75   SER A HB3  1 
ATOM   1230 H HG   . SER A 1 75  ? 30.513 13.522  34.409 1.00 7.24  ? 75   SER A HG   1 
ATOM   1231 N N    . TYR A 1 76  ? 31.554 16.887  35.316 1.00 4.86  ? 76   TYR A N    1 
ATOM   1232 C CA   . TYR A 1 76  ? 33.013 17.109  35.223 1.00 6.18  ? 76   TYR A CA   1 
ATOM   1233 C C    . TYR A 1 76  ? 33.772 15.794  35.483 1.00 6.48  ? 76   TYR A C    1 
ATOM   1234 O O    . TYR A 1 76  ? 34.744 15.518  34.789 1.00 9.22  ? 76   TYR A O    1 
ATOM   1235 C CB   . TYR A 1 76  ? 33.432 18.163  36.194 1.00 6.99  ? 76   TYR A CB   1 
ATOM   1236 C CG   . TYR A 1 76  ? 32.888 19.558  35.954 1.00 7.30  ? 76   TYR A CG   1 
ATOM   1237 C CD1  . TYR A 1 76  ? 32.748 20.072  34.712 1.00 8.38  ? 76   TYR A CD1  1 
ATOM   1238 C CD2  . TYR A 1 76  ? 32.533 20.354  37.033 1.00 8.73  ? 76   TYR A CD2  1 
ATOM   1239 C CE1  . TYR A 1 76  ? 32.259 21.387  34.548 1.00 9.64  ? 76   TYR A CE1  1 
ATOM   1240 C CE2  . TYR A 1 76  ? 32.071 21.655  36.892 1.00 9.94  ? 76   TYR A CE2  1 
ATOM   1241 C CZ   . TYR A 1 76  ? 31.974 22.165  35.616 1.00 9.40  ? 76   TYR A CZ   1 
ATOM   1242 O OH   . TYR A 1 76  ? 31.470 23.435  35.436 1.00 11.44 ? 76   TYR A OH   1 
ATOM   1243 H H    . TYR A 1 76  ? 31.097 17.216  35.992 1.00 5.83  ? 76   TYR A H    1 
ATOM   1244 H HA   . TYR A 1 76  ? 33.229 17.424  34.299 1.00 7.42  ? 76   TYR A HA   1 
ATOM   1245 H HB2  . TYR A 1 76  ? 33.155 17.876  37.100 1.00 8.39  ? 76   TYR A HB2  1 
ATOM   1246 H HB3  . TYR A 1 76  ? 34.420 18.212  36.190 1.00 8.39  ? 76   TYR A HB3  1 
ATOM   1247 H HD1  . TYR A 1 76  ? 32.976 19.550  33.952 1.00 10.06 ? 76   TYR A HD1  1 
ATOM   1248 H HD2  . TYR A 1 76  ? 32.609 19.992  37.908 1.00 10.48 ? 76   TYR A HD2  1 
ATOM   1249 H HE1  . TYR A 1 76  ? 32.129 21.731  33.672 1.00 11.56 ? 76   TYR A HE1  1 
ATOM   1250 H HE2  . TYR A 1 76  ? 31.830 22.175  37.649 1.00 11.93 ? 76   TYR A HE2  1 
ATOM   1251 H HH   . TYR A 1 76  ? 31.326 23.788  36.184 1.00 17.16 ? 76   TYR A HH   1 
ATOM   1252 N N    . SER A 1 77  ? 33.362 15.055  36.482 1.00 6.08  ? 77   SER A N    1 
ATOM   1253 C CA   . SER A 1 77  ? 33.947 13.763  36.793 1.00 6.20  ? 77   SER A CA   1 
ATOM   1254 C C    . SER A 1 77  ? 33.278 12.671  35.961 1.00 5.45  ? 77   SER A C    1 
ATOM   1255 O O    . SER A 1 77  ? 32.134 12.832  35.544 1.00 6.68  ? 77   SER A O    1 
ATOM   1256 C CB   . SER A 1 77  ? 33.788 13.448  38.288 1.00 7.42  ? 77   SER A CB   1 
ATOM   1257 O OG   . SER A 1 77  ? 34.583 14.304  39.063 1.00 14.24 ? 77   SER A OG   1 
ATOM   1258 H H    . SER A 1 77  ? 32.704 15.352  36.985 1.00 7.29  ? 77   SER A H    1 
ATOM   1259 H HA   . SER A 1 77  ? 34.921 13.787  36.570 1.00 7.44  ? 77   SER A HA   1 
ATOM   1260 H HB2  . SER A 1 77  ? 32.839 13.553  38.548 1.00 8.90  ? 77   SER A HB2  1 
ATOM   1261 H HB3  . SER A 1 77  ? 34.051 12.509  38.457 1.00 8.90  ? 77   SER A HB3  1 
ATOM   1262 H HG   . SER A 1 77  ? 34.349 15.100  38.932 1.00 21.35 ? 77   SER A HG   1 
ATOM   1263 N N    . THR A 1 78  ? 33.943 11.537  35.799 1.00 5.26  ? 78   THR A N    1 
ATOM   1264 C CA   . THR A 1 78  ? 33.208 10.379  35.299 1.00 5.13  ? 78   THR A CA   1 
ATOM   1265 C C    . THR A 1 78  ? 32.479 9.725   36.450 1.00 4.84  ? 78   THR A C    1 
ATOM   1266 O O    . THR A 1 78  ? 32.804 9.915   37.631 1.00 5.61  ? 78   THR A O    1 
ATOM   1267 C CB   . THR A 1 78  ? 34.099 9.358   34.580 1.00 5.88  ? 78   THR A CB   1 
ATOM   1268 O OG1  . THR A 1 78  ? 35.005 8.823   35.527 1.00 6.82  ? 78   THR A OG1  1 
ATOM   1269 C CG2  . THR A 1 78  ? 34.849 9.976   33.421 1.00 7.97  ? 78   THR A CG2  1 
ATOM   1270 H H    . THR A 1 78  ? 34.801 11.483  35.987 1.00 6.31  ? 78   THR A H    1 
ATOM   1271 H HA   . THR A 1 78  ? 32.524 10.705  34.647 1.00 6.16  ? 78   THR A HA   1 
ATOM   1272 H HB   . THR A 1 78  ? 33.523 8.618   34.232 1.00 7.05  ? 78   THR A HB   1 
ATOM   1273 H HG1  . THR A 1 78  ? 34.865 9.173   36.277 1.00 10.22 ? 78   THR A HG1  1 
ATOM   1274 H HG21 . THR A 1 78  ? 35.411 10.709  33.748 1.00 11.95 ? 78   THR A HG21 1 
ATOM   1275 H HG22 . THR A 1 78  ? 35.414 9.295   32.998 1.00 11.95 ? 78   THR A HG22 1 
ATOM   1276 H HG23 . THR A 1 78  ? 34.209 10.323  32.765 1.00 11.95 ? 78   THR A HG23 1 
ATOM   1277 N N    . MET A 1 79  ? 31.463 8.953   36.065 1.00 4.83  ? 79   MET A N    1 
ATOM   1278 C CA   . MET A 1 79  ? 30.635 8.227   37.008 1.00 4.60  ? 79   MET A CA   1 
ATOM   1279 C C    . MET A 1 79  ? 30.527 6.778   36.584 1.00 4.46  ? 79   MET A C    1 
ATOM   1280 O O    . MET A 1 79  ? 30.573 6.427   35.406 1.00 4.85  ? 79   MET A O    1 
ATOM   1281 C CB   A MET A 1 79  ? 29.269 8.910   37.158 0.82 5.10  ? 79   MET A CB   1 
ATOM   1282 C CB   B MET A 1 79  ? 29.200 8.805   36.792 0.18 5.23  ? 79   MET A CB   1 
ATOM   1283 C CG   A MET A 1 79  ? 29.459 10.273  37.818 0.82 5.02  ? 79   MET A CG   1 
ATOM   1284 C CG   B MET A 1 79  ? 28.890 10.256  37.087 0.18 5.21  ? 79   MET A CG   1 
ATOM   1285 S SD   A MET A 1 79  ? 27.865 11.061  38.091 0.82 5.91  ? 79   MET A SD   1 
ATOM   1286 S SD   B MET A 1 79  ? 29.316 10.795  38.773 0.18 6.95  ? 79   MET A SD   1 
ATOM   1287 C CE   A MET A 1 79  ? 28.426 12.495  39.008 0.82 7.14  ? 79   MET A CE   1 
ATOM   1288 C CE   B MET A 1 79  ? 28.933 12.512  38.624 0.18 11.01 ? 79   MET A CE   1 
ATOM   1289 H H    . MET A 1 79  ? 31.288 8.880   35.206 1.00 5.79  ? 79   MET A H    1 
ATOM   1290 H HA   A MET A 1 79  ? 31.090 8.253   37.899 1.00 5.53  ? 79   MET A HA   1 
ATOM   1291 H HB2  A MET A 1 79  ? 28.850 9.023   36.268 0.82 6.12  ? 79   MET A HB2  1 
ATOM   1292 H HB2  B MET A 1 79  ? 28.962 8.645   35.844 0.18 6.28  ? 79   MET A HB2  1 
ATOM   1293 H HB3  A MET A 1 79  ? 28.672 8.348   37.713 0.82 6.12  ? 79   MET A HB3  1 
ATOM   1294 H HB3  B MET A 1 79  ? 28.581 8.259   37.338 0.18 6.28  ? 79   MET A HB3  1 
ATOM   1295 H HG2  A MET A 1 79  ? 29.926 10.161  38.683 0.82 6.02  ? 79   MET A HG2  1 
ATOM   1296 H HG2  B MET A 1 79  ? 29.382 10.821  36.440 0.18 6.25  ? 79   MET A HG2  1 
ATOM   1297 H HG3  A MET A 1 79  ? 30.018 10.847  37.238 0.82 6.02  ? 79   MET A HG3  1 
ATOM   1298 H HG3  B MET A 1 79  ? 27.923 10.408  36.941 0.18 6.25  ? 79   MET A HG3  1 
ATOM   1299 H HE1  A MET A 1 79  ? 28.882 12.203  39.825 0.82 10.71 ? 79   MET A HE1  1 
ATOM   1300 H HE1  B MET A 1 79  ? 29.481 12.908  37.915 0.18 16.52 ? 79   MET A HE1  1 
ATOM   1301 H HE2  A MET A 1 79  ? 29.047 13.014  38.456 0.82 10.71 ? 79   MET A HE2  1 
ATOM   1302 H HE2  B MET A 1 79  ? 27.985 12.617  38.402 0.18 16.52 ? 79   MET A HE2  1 
ATOM   1303 H HE3  A MET A 1 79  ? 27.656 13.053  39.246 0.82 10.71 ? 79   MET A HE3  1 
ATOM   1304 H HE3  B MET A 1 79  ? 29.122 12.963  39.473 0.18 16.52 ? 79   MET A HE3  1 
ATOM   1305 N N    . SER A 1 80  ? 30.336 5.923   37.607 1.00 4.58  ? 80   SER A N    1 
ATOM   1306 C CA   . SER A 1 80  ? 30.087 4.516   37.361 1.00 4.44  ? 80   SER A CA   1 
ATOM   1307 C C    . SER A 1 80  ? 28.645 4.347   36.890 1.00 4.40  ? 80   SER A C    1 
ATOM   1308 O O    . SER A 1 80  ? 27.699 4.747   37.592 1.00 4.78  ? 80   SER A O    1 
ATOM   1309 C CB   . SER A 1 80  ? 30.290 3.775   38.677 1.00 5.13  ? 80   SER A CB   1 
ATOM   1310 O OG   . SER A 1 80  ? 29.966 2.390   38.437 1.00 5.56  ? 80   SER A OG   1 
ATOM   1311 H H    . SER A 1 80  ? 30.363 6.221   38.434 1.00 5.49  ? 80   SER A H    1 
ATOM   1312 H HA   . SER A 1 80  ? 30.720 4.170   36.668 1.00 5.32  ? 80   SER A HA   1 
ATOM   1313 H HB2  . SER A 1 80  ? 31.229 3.861   38.978 1.00 6.16  ? 80   SER A HB2  1 
ATOM   1314 H HB3  . SER A 1 80  ? 29.699 4.150   39.377 1.00 6.16  ? 80   SER A HB3  1 
ATOM   1315 H HG   . SER A 1 80  ? 30.080 1.950   39.143 1.00 8.35  ? 80   SER A HG   1 
ATOM   1316 N N    . ILE A 1 81  ? 28.482 3.785   35.688 1.00 4.10  ? 81   ILE A N    1 
ATOM   1317 C CA   . ILE A 1 81  ? 27.160 3.600   35.084 1.00 4.11  ? 81   ILE A CA   1 
ATOM   1318 C C    . ILE A 1 81  ? 27.086 2.203   34.483 1.00 4.16  ? 81   ILE A C    1 
ATOM   1319 O O    . ILE A 1 81  ? 28.089 1.550   34.215 1.00 4.75  ? 81   ILE A O    1 
ATOM   1320 C CB   . ILE A 1 81  ? 26.843 4.681   34.028 1.00 4.89  ? 81   ILE A CB   1 
ATOM   1321 C CG1  . ILE A 1 81  ? 27.741 4.546   32.787 1.00 5.74  ? 81   ILE A CG1  1 
ATOM   1322 C CG2  . ILE A 1 81  ? 26.925 6.071   34.624 1.00 5.62  ? 81   ILE A CG2  1 
ATOM   1323 C CD1  . ILE A 1 81  ? 27.399 5.489   31.653 1.00 7.88  ? 81   ILE A CD1  1 
ATOM   1324 H H    . ILE A 1 81  ? 29.193 3.516   35.245 1.00 4.91  ? 81   ILE A H    1 
ATOM   1325 H HA   . ILE A 1 81  ? 26.475 3.664   35.809 1.00 4.93  ? 81   ILE A HA   1 
ATOM   1326 H HB   . ILE A 1 81  ? 25.899 4.540   33.730 1.00 5.87  ? 81   ILE A HB   1 
ATOM   1327 H HG12 . ILE A 1 81  ? 28.680 4.706   33.058 1.00 6.88  ? 81   ILE A HG12 1 
ATOM   1328 H HG13 . ILE A 1 81  ? 27.680 3.616   32.453 1.00 6.88  ? 81   ILE A HG13 1 
ATOM   1329 H HG21 . ILE A 1 81  ? 26.343 6.123   35.411 1.00 8.44  ? 81   ILE A HG21 1 
ATOM   1330 H HG22 . ILE A 1 81  ? 27.850 6.259   34.888 1.00 8.44  ? 81   ILE A HG22 1 
ATOM   1331 H HG23 . ILE A 1 81  ? 26.634 6.729   33.959 1.00 8.44  ? 81   ILE A HG23 1 
ATOM   1332 H HD11 . ILE A 1 81  ? 27.475 6.415   31.965 1.00 11.82 ? 81   ILE A HD11 1 
ATOM   1333 H HD12 . ILE A 1 81  ? 28.019 5.343   30.908 1.00 11.82 ? 81   ILE A HD12 1 
ATOM   1334 H HD13 . ILE A 1 81  ? 26.482 5.320   31.353 1.00 11.82 ? 81   ILE A HD13 1 
ATOM   1335 N N    . THR A 1 82  ? 25.836 1.785   34.258 1.00 4.24  ? 82   THR A N    1 
ATOM   1336 C CA   . THR A 1 82  ? 25.567 0.547   33.572 1.00 4.18  ? 82   THR A CA   1 
ATOM   1337 C C    . THR A 1 82  ? 24.627 0.859   32.403 1.00 4.31  ? 82   THR A C    1 
ATOM   1338 O O    . THR A 1 82  ? 23.561 1.447   32.582 1.00 4.78  ? 82   THR A O    1 
ATOM   1339 C CB   . THR A 1 82  ? 24.921 -0.486  34.500 1.00 4.65  ? 82   THR A CB   1 
ATOM   1340 O OG1  . THR A 1 82  ? 25.827 -0.812  35.509 1.00 5.09  ? 82   THR A OG1  1 
ATOM   1341 C CG2  . THR A 1 82  ? 24.528 -1.742  33.721 1.00 5.20  ? 82   THR A CG2  1 
ATOM   1342 H H    . THR A 1 82  ? 25.162 2.278   34.536 1.00 5.09  ? 82   THR A H    1 
ATOM   1343 H HA   . THR A 1 82  ? 26.424 0.177   33.215 1.00 5.02  ? 82   THR A HA   1 
ATOM   1344 H HB   . THR A 1 82  ? 24.101 -0.088  34.913 1.00 5.58  ? 82   THR A HB   1 
ATOM   1345 H HG1  . THR A 1 82  ? 25.974 -1.639  35.498 1.00 7.63  ? 82   THR A HG1  1 
ATOM   1346 H HG21 . THR A 1 82  ? 23.892 -1.502  33.014 1.00 7.81  ? 82   THR A HG21 1 
ATOM   1347 H HG22 . THR A 1 82  ? 25.328 -2.140  33.319 1.00 7.81  ? 82   THR A HG22 1 
ATOM   1348 H HG23 . THR A 1 82  ? 24.113 -2.387  34.329 1.00 7.81  ? 82   THR A HG23 1 
ATOM   1349 N N    . ASP A 1 83  ? 25.066 0.438   31.218 1.00 5.01  ? 83   ASP A N    1 
ATOM   1350 C CA   . ASP A 1 83  ? 24.222 0.494   30.032 1.00 5.39  ? 83   ASP A CA   1 
ATOM   1351 C C    . ASP A 1 83  ? 23.466 -0.835  29.913 1.00 4.99  ? 83   ASP A C    1 
ATOM   1352 O O    . ASP A 1 83  ? 24.078 -1.923  29.935 1.00 6.61  ? 83   ASP A O    1 
ATOM   1353 C CB   A ASP A 1 83  ? 25.174 0.561   28.816 0.67 6.80  ? 83   ASP A CB   1 
ATOM   1354 C CB   B ASP A 1 83  ? 24.977 1.040   28.840 0.33 7.71  ? 83   ASP A CB   1 
ATOM   1355 C CG   A ASP A 1 83  ? 24.454 0.605   27.499 0.67 6.49  ? 83   ASP A CG   1 
ATOM   1356 C CG   B ASP A 1 83  ? 25.380 2.512   28.763 0.33 7.79  ? 83   ASP A CG   1 
ATOM   1357 O OD1  A ASP A 1 83  ? 24.019 1.702   27.101 0.67 10.41 ? 83   ASP A OD1  1 
ATOM   1358 O OD1  B ASP A 1 83  ? 24.737 3.585   29.080 0.33 14.13 ? 83   ASP A OD1  1 
ATOM   1359 O OD2  A ASP A 1 83  ? 24.275 -0.437  26.814 0.67 8.33  ? 83   ASP A OD2  1 
ATOM   1360 O OD2  B ASP A 1 83  ? 26.503 2.689   28.218 0.33 14.85 ? 83   ASP A OD2  1 
ATOM   1361 H H    . ASP A 1 83  ? 25.884 0.119   31.150 1.00 6.02  ? 83   ASP A H    1 
ATOM   1362 H HA   A ASP A 1 83  ? 23.598 1.275   30.058 1.00 6.47  ? 83   ASP A HA   1 
ATOM   1363 H HB2  A ASP A 1 83  ? 25.742 1.367   28.898 0.67 8.16  ? 83   ASP A HB2  1 
ATOM   1364 H HB2  B ASP A 1 83  ? 25.808 0.508   28.755 0.33 9.25  ? 83   ASP A HB2  1 
ATOM   1365 H HB3  A ASP A 1 83  ? 25.768 -0.230  28.831 0.67 8.16  ? 83   ASP A HB3  1 
ATOM   1366 H HB3  B ASP A 1 83  ? 24.431 0.847   28.038 0.33 9.25  ? 83   ASP A HB3  1 
ATOM   1367 N N    . CYS A 1 84  ? 22.160 -0.746  29.799 1.00 4.91  ? 84   CYS A N    1 
ATOM   1368 C CA   . CYS A 1 84  ? 21.299 -1.884  29.587 1.00 5.23  ? 84   CYS A CA   1 
ATOM   1369 C C    . CYS A 1 84  ? 20.727 -1.769  28.160 1.00 5.71  ? 84   CYS A C    1 
ATOM   1370 O O    . CYS A 1 84  ? 20.064 -0.772  27.876 1.00 7.43  ? 84   CYS A O    1 
ATOM   1371 C CB   . CYS A 1 84  ? 20.151 -1.930  30.554 1.00 5.45  ? 84   CYS A CB   1 
ATOM   1372 S SG   . CYS A 1 84  ? 20.664 -2.084  32.297 1.00 5.40  ? 84   CYS A SG   1 
ATOM   1373 H H    . CYS A 1 84  ? 21.791 0.050   29.855 1.00 5.89  ? 84   CYS A H    1 
ATOM   1374 H HA   . CYS A 1 84  ? 21.834 -2.725  29.664 1.00 6.28  ? 84   CYS A HA   1 
ATOM   1375 H HB2  . CYS A 1 84  ? 19.613 -1.106  30.451 1.00 6.54  ? 84   CYS A HB2  1 
ATOM   1376 H HB3  . CYS A 1 84  ? 19.571 -2.699  30.323 1.00 6.54  ? 84   CYS A HB3  1 
ATOM   1377 N N    . ARG A 1 85  ? 20.944 -2.786  27.327 1.00 5.70  ? 85   ARG A N    1 
ATOM   1378 C CA   . ARG A 1 85  ? 20.508 -2.693  25.925 1.00 5.76  ? 85   ARG A CA   1 
ATOM   1379 C C    . ARG A 1 85  ? 19.873 -4.024  25.538 1.00 5.26  ? 85   ARG A C    1 
ATOM   1380 O O    . ARG A 1 85  ? 20.433 -5.102  25.738 1.00 5.72  ? 85   ARG A O    1 
ATOM   1381 C CB   . ARG A 1 85  ? 21.743 -2.429  25.049 1.00 10.12 ? 85   ARG A CB   1 
ATOM   1382 C CG   . ARG A 1 85  ? 21.537 -2.044  23.691 1.00 15.37 ? 85   ARG A CG   1 
ATOM   1383 C CD   . ARG A 1 85  ? 22.997 -1.467  23.292 1.00 20.64 ? 85   ARG A CD   1 
ATOM   1384 N NE   . ARG A 1 85  ? 23.474 -0.333  24.068 1.00 22.90 ? 85   ARG A NE   1 
ATOM   1385 C CZ   . ARG A 1 85  ? 23.330 0.911   23.584 1.00 28.29 ? 85   ARG A CZ   1 
ATOM   1386 N NH1  . ARG A 1 85  ? 22.654 1.239   22.506 1.00 34.20 ? 85   ARG A NH1  1 
ATOM   1387 N NH2  . ARG A 1 85  ? 23.850 1.876   24.363 1.00 40.38 ? 85   ARG A NH2  1 
ATOM   1388 H H    . ARG A 1 85  ? 21.347 -3.513  27.616 1.00 6.83  ? 85   ARG A H    1 
ATOM   1389 H HA   . ARG A 1 85  ? 19.846 -1.951  25.819 1.00 6.91  ? 85   ARG A HA   1 
ATOM   1390 H HB2  . ARG A 1 85  ? 22.277 -1.720  25.486 1.00 12.15 ? 85   ARG A HB2  1 
ATOM   1391 H HB3  . ARG A 1 85  ? 22.294 -3.251  25.049 1.00 12.15 ? 85   ARG A HB3  1 
ATOM   1392 H HG2  . ARG A 1 85  ? 21.288 -2.820  23.129 1.00 18.44 ? 85   ARG A HG2  1 
ATOM   1393 H HG3  . ARG A 1 85  ? 20.839 -1.347  23.615 1.00 18.44 ? 85   ARG A HG3  1 
ATOM   1394 H HD2  . ARG A 1 85  ? 23.655 -2.201  23.381 1.00 24.77 ? 85   ARG A HD2  1 
ATOM   1395 H HD3  . ARG A 1 85  ? 22.975 -1.202  22.339 1.00 24.77 ? 85   ARG A HD3  1 
ATOM   1396 H HE   . ARG A 1 85  ? 23.854 -0.462  24.851 1.00 27.48 ? 85   ARG A HE   1 
ATOM   1397 H HH11 . ARG A 1 85  ? 22.248 0.617   22.035 1.00 41.04 ? 85   ARG A HH11 1 
ATOM   1398 H HH12 . ARG A 1 85  ? 22.608 2.082   22.255 1.00 41.04 ? 85   ARG A HH12 1 
ATOM   1399 H HH21 . ARG A 1 85  ? 24.303 1.662   25.087 1.00 48.46 ? 85   ARG A HH21 1 
ATOM   1400 H HH22 . ARG A 1 85  ? 23.737 2.723   24.150 1.00 48.46 ? 85   ARG A HH22 1 
ATOM   1401 N N    . GLU A 1 86  ? 18.664 -3.940  25.001 1.00 5.60  ? 86   GLU A N    1 
ATOM   1402 C CA   . GLU A 1 86  ? 17.914 -5.124  24.683 1.00 5.73  ? 86   GLU A CA   1 
ATOM   1403 C C    . GLU A 1 86  ? 18.647 -5.974  23.665 1.00 5.97  ? 86   GLU A C    1 
ATOM   1404 O O    . GLU A 1 86  ? 19.160 -5.454  22.673 1.00 7.87  ? 86   GLU A O    1 
ATOM   1405 C CB   . GLU A 1 86  ? 16.531 -4.711  24.153 1.00 7.68  ? 86   GLU A CB   1 
ATOM   1406 C CG   . GLU A 1 86  ? 15.620 -5.855  23.996 1.00 8.76  ? 86   GLU A CG   1 
ATOM   1407 C CD   . GLU A 1 86  ? 14.222 -5.487  23.579 1.00 8.06  ? 86   GLU A CD   1 
ATOM   1408 O OE1  . GLU A 1 86  ? 13.926 -4.375  23.145 1.00 11.11 ? 86   GLU A OE1  1 
ATOM   1409 O OE2  . GLU A 1 86  ? 13.360 -6.412  23.600 1.00 8.57  ? 86   GLU A OE2  1 
ATOM   1410 H H    . GLU A 1 86  ? 18.316 -3.148  24.837 1.00 6.72  ? 86   GLU A H    1 
ATOM   1411 H HA   . GLU A 1 86  ? 17.791 -5.660  25.519 1.00 6.87  ? 86   GLU A HA   1 
ATOM   1412 H HB2  . GLU A 1 86  ? 16.126 -4.059  24.780 1.00 9.21  ? 86   GLU A HB2  1 
ATOM   1413 H HB3  . GLU A 1 86  ? 16.641 -4.262  23.278 1.00 9.21  ? 86   GLU A HB3  1 
ATOM   1414 H HG2  . GLU A 1 86  ? 16.000 -6.471  23.320 1.00 10.51 ? 86   GLU A HG2  1 
ATOM   1415 H HG3  . GLU A 1 86  ? 15.575 -6.344  24.855 1.00 10.51 ? 86   GLU A HG3  1 
ATOM   1416 N N    . THR A 1 87  ? 18.647 -7.289  23.866 1.00 5.62  ? 87   THR A N    1 
ATOM   1417 C CA   . THR A 1 87  ? 19.284 -8.212  22.963 1.00 5.72  ? 87   THR A CA   1 
ATOM   1418 C C    . THR A 1 87  ? 18.283 -8.621  21.846 1.00 6.99  ? 87   THR A C    1 
ATOM   1419 O O    . THR A 1 87  ? 17.089 -8.484  21.939 1.00 8.92  ? 87   THR A O    1 
ATOM   1420 C CB   . THR A 1 87  ? 19.825 -9.431  23.731 1.00 5.94  ? 87   THR A CB   1 
ATOM   1421 O OG1  . THR A 1 87  ? 18.726 -10.028 24.379 1.00 6.94  ? 87   THR A OG1  1 
ATOM   1422 C CG2  . THR A 1 87  ? 20.926 -9.027  24.688 1.00 7.70  ? 87   THR A CG2  1 
ATOM   1423 H H    . THR A 1 87  ? 18.242 -7.607  24.579 1.00 6.74  ? 87   THR A H    1 
ATOM   1424 H HA   . THR A 1 87  ? 20.057 -7.745  22.533 1.00 6.86  ? 87   THR A HA   1 
ATOM   1425 H HB   . THR A 1 87  ? 20.199 -10.083 23.071 1.00 7.13  ? 87   THR A HB   1 
ATOM   1426 H HG1  . THR A 1 87  ? 18.148 -10.245 23.808 1.00 10.41 ? 87   THR A HG1  1 
ATOM   1427 H HG21 . THR A 1 87  ? 20.576 -8.378  25.333 1.00 11.55 ? 87   THR A HG21 1 
ATOM   1428 H HG22 . THR A 1 87  ? 21.253 -9.818  25.164 1.00 11.55 ? 87   THR A HG22 1 
ATOM   1429 H HG23 . THR A 1 87  ? 21.663 -8.621  24.185 1.00 11.55 ? 87   THR A HG23 1 
ATOM   1430 N N    . GLY A 1 88  ? 18.882 -9.104  20.763 1.00 9.44  ? 88   GLY A N    1 
ATOM   1431 C CA   . GLY A 1 88  ? 18.111 -9.374  19.548 1.00 12.36 ? 88   GLY A CA   1 
ATOM   1432 C C    . GLY A 1 88  ? 17.072 -10.426 19.676 1.00 9.89  ? 88   GLY A C    1 
ATOM   1433 O O    . GLY A 1 88  ? 16.086 -10.441 18.949 1.00 13.59 ? 88   GLY A O    1 
ATOM   1434 H H    . GLY A 1 88  ? 19.748 -9.263  20.776 1.00 11.32 ? 88   GLY A H    1 
ATOM   1435 H HA2  . GLY A 1 88  ? 17.673 -8.533  19.263 1.00 14.83 ? 88   GLY A HA2  1 
ATOM   1436 H HA3  . GLY A 1 88  ? 18.740 -9.639  18.831 1.00 14.83 ? 88   GLY A HA3  1 
ATOM   1437 N N    . SER A 1 89  ? 17.298 -11.386 20.554 1.00 8.12  ? 89   SER A N    1 
ATOM   1438 C CA   . SER A 1 89  ? 16.340 -12.487 20.732 1.00 8.97  ? 89   SER A CA   1 
ATOM   1439 C C    . SER A 1 89  ? 15.263 -12.141 21.758 1.00 9.35  ? 89   SER A C    1 
ATOM   1440 O O    . SER A 1 89  ? 14.377 -12.979 22.002 1.00 11.75 ? 89   SER A O    1 
ATOM   1441 C CB   . SER A 1 89  ? 17.067 -13.747 21.072 1.00 10.06 ? 89   SER A CB   1 
ATOM   1442 O OG   . SER A 1 89  ? 17.801 -13.654 22.272 1.00 10.98 ? 89   SER A OG   1 
ATOM   1443 H H    . SER A 1 89  ? 18.032 -11.367 21.039 1.00 9.75  ? 89   SER A H    1 
ATOM   1444 H HA   . SER A 1 89  ? 15.883 -12.631 19.854 1.00 10.77 ? 89   SER A HA   1 
ATOM   1445 H HB2  . SER A 1 89  ? 16.411 -14.485 21.152 1.00 12.07 ? 89   SER A HB2  1 
ATOM   1446 H HB3  . SER A 1 89  ? 17.685 -13.972 20.333 1.00 12.07 ? 89   SER A HB3  1 
ATOM   1447 H HG   . SER A 1 89  ? 18.399 -13.070 22.189 1.00 16.47 ? 89   SER A HG   1 
ATOM   1448 N N    . SER A 1 90  ? 15.343 -10.994 22.433 1.00 8.84  ? 90   SER A N    1 
ATOM   1449 C CA   . SER A 1 90  ? 14.312 -10.551 23.331 1.00 9.15  ? 90   SER A CA   1 
ATOM   1450 C C    . SER A 1 90  ? 12.962 -10.305 22.609 1.00 8.87  ? 90   SER A C    1 
ATOM   1451 O O    . SER A 1 90  ? 12.947 -9.785  21.519 1.00 10.06 ? 90   SER A O    1 
ATOM   1452 C CB   A SER A 1 90  ? 14.840 -9.249  23.986 0.69 9.61  ? 90   SER A CB   1 
ATOM   1453 C CB   B SER A 1 90  ? 14.649 -9.181  23.956 0.31 10.09 ? 90   SER A CB   1 
ATOM   1454 O OG   A SER A 1 90  ? 14.048 -8.581  24.970 0.69 7.02  ? 90   SER A OG   1 
ATOM   1455 O OG   B SER A 1 90  ? 15.638 -9.740  24.801 0.31 7.24  ? 90   SER A OG   1 
ATOM   1456 H H    . SER A 1 90  ? 16.055 -10.489 22.324 1.00 10.61 ? 90   SER A H    1 
ATOM   1457 H HA   A SER A 1 90  ? 14.180 -11.243 24.041 1.00 10.98 ? 90   SER A HA   1 
ATOM   1458 H HB2  A SER A 1 90  ? 15.713 -9.460  24.403 0.69 11.53 ? 90   SER A HB2  1 
ATOM   1459 H HB2  B SER A 1 90  ? 15.015 -8.534  23.302 0.31 12.11 ? 90   SER A HB2  1 
ATOM   1460 H HB3  A SER A 1 90  ? 15.016 -8.602  23.259 0.69 11.53 ? 90   SER A HB3  1 
ATOM   1461 H HB3  B SER A 1 90  ? 13.891 -8.782  24.452 0.31 12.11 ? 90   SER A HB3  1 
ATOM   1462 H HG   A SER A 1 90  ? 13.896 -9.105  25.610 0.69 10.52 ? 90   SER A HG   1 
ATOM   1463 H HG   B SER A 1 90  ? 15.955 -9.139  25.295 0.31 10.87 ? 90   SER A HG   1 
ATOM   1464 N N    . LYS A 1 91  ? 11.884 -10.580 23.339 1.00 8.09  ? 91   LYS A N    1 
ATOM   1465 C CA   . LYS A 1 91  ? 10.565 -10.202 22.807 1.00 7.15  ? 91   LYS A CA   1 
ATOM   1466 C C    . LYS A 1 91  ? 9.629  -10.177 23.985 1.00 6.61  ? 91   LYS A C    1 
ATOM   1467 O O    . LYS A 1 91  ? 9.526  -11.146 24.733 1.00 7.82  ? 91   LYS A O    1 
ATOM   1468 C CB   . LYS A 1 91  ? 10.015 -11.148 21.739 1.00 8.72  ? 91   LYS A CB   1 
ATOM   1469 C CG   . LYS A 1 91  ? 8.797  -10.602 21.005 1.00 8.29  ? 91   LYS A CG   1 
ATOM   1470 C CD   . LYS A 1 91  ? 9.156  -9.528  19.992 1.00 9.02  ? 91   LYS A CD   1 
ATOM   1471 C CE   . LYS A 1 91  ? 7.985  -8.754  19.326 1.00 9.72  ? 91   LYS A CE   1 
ATOM   1472 N NZ   . LYS A 1 91  ? 7.300  -7.865  20.323 1.00 8.25  ? 91   LYS A NZ   1 
ATOM   1473 H H    . LYS A 1 91  ? 11.958 -10.979 24.120 1.00 9.71  ? 91   LYS A H    1 
ATOM   1474 H HA   . LYS A 1 91  ? 10.624 -9.281  22.422 1.00 8.59  ? 91   LYS A HA   1 
ATOM   1475 H HB2  . LYS A 1 91  ? 10.729 -11.334 21.079 1.00 10.47 ? 91   LYS A HB2  1 
ATOM   1476 H HB3  . LYS A 1 91  ? 9.772  -12.006 22.168 1.00 10.47 ? 91   LYS A HB3  1 
ATOM   1477 H HG2  . LYS A 1 91  ? 8.340  -11.346 20.539 1.00 9.94  ? 91   LYS A HG2  1 
ATOM   1478 H HG3  . LYS A 1 91  ? 8.163  -10.224 21.666 1.00 9.94  ? 91   LYS A HG3  1 
ATOM   1479 H HD2  . LYS A 1 91  ? 9.741  -8.867  20.442 1.00 10.82 ? 91   LYS A HD2  1 
ATOM   1480 H HD3  . LYS A 1 91  ? 9.690  -9.951  19.274 1.00 10.82 ? 91   LYS A HD3  1 
ATOM   1481 H HE2  . LYS A 1 91  ? 8.334  -8.206  18.579 1.00 11.67 ? 91   LYS A HE2  1 
ATOM   1482 H HE3  . LYS A 1 91  ? 7.333  -9.399  18.954 1.00 11.67 ? 91   LYS A HE3  1 
ATOM   1483 H HZ1  . LYS A 1 91  ? 7.901  -7.274  20.666 1.00 12.37 ? 91   LYS A HZ1  1 
ATOM   1484 H HZ2  . LYS A 1 91  ? 6.628  -7.409  19.911 1.00 12.37 ? 91   LYS A HZ2  1 
ATOM   1485 H HZ3  . LYS A 1 91  ? 6.955  -8.372  20.995 1.00 12.37 ? 91   LYS A HZ3  1 
ATOM   1486 N N    . TYR A 1 92  ? 8.936  -9.075  24.174 1.00 6.43  ? 92   TYR A N    1 
ATOM   1487 C CA   . TYR A 1 92  ? 7.972  -8.895  25.268 1.00 6.76  ? 92   TYR A CA   1 
ATOM   1488 C C    . TYR A 1 92  ? 7.026  -10.102 25.299 1.00 7.47  ? 92   TYR A C    1 
ATOM   1489 O O    . TYR A 1 92  ? 6.502  -10.519 24.277 1.00 8.77  ? 92   TYR A O    1 
ATOM   1490 C CB   . TYR A 1 92  ? 7.188  -7.598  25.012 1.00 7.25  ? 92   TYR A CB   1 
ATOM   1491 C CG   . TYR A 1 92  ? 6.194  -7.278  26.076 1.00 7.74  ? 92   TYR A CG   1 
ATOM   1492 C CD1  . TYR A 1 92  ? 6.542  -6.640  27.250 1.00 7.21  ? 92   TYR A CD1  1 
ATOM   1493 C CD2  . TYR A 1 92  ? 4.838  -7.634  25.900 1.00 11.86 ? 92   TYR A CD2  1 
ATOM   1494 C CE1  . TYR A 1 92  ? 5.579  -6.359  28.238 1.00 10.55 ? 92   TYR A CE1  1 
ATOM   1495 C CE2  . TYR A 1 92  ? 3.920  -7.315  26.849 1.00 15.10 ? 92   TYR A CE2  1 
ATOM   1496 C CZ   . TYR A 1 92  ? 4.273  -6.676  27.987 1.00 13.61 ? 92   TYR A CZ   1 
ATOM   1497 O OH   . TYR A 1 92  ? 3.318  -6.429  28.941 1.00 19.83 ? 92   TYR A OH   1 
ATOM   1498 H H    . TYR A 1 92  ? 9.056  -8.407  23.613 1.00 7.72  ? 92   TYR A H    1 
ATOM   1499 H HA   . TYR A 1 92  ? 8.459  -8.827  26.139 1.00 8.11  ? 92   TYR A HA   1 
ATOM   1500 H HB2  . TYR A 1 92  ? 7.829  -6.847  24.938 1.00 8.70  ? 92   TYR A HB2  1 
ATOM   1501 H HB3  . TYR A 1 92  ? 6.715  -7.677  24.146 1.00 8.70  ? 92   TYR A HB3  1 
ATOM   1502 H HD1  . TYR A 1 92  ? 7.446  -6.386  27.394 1.00 8.66  ? 92   TYR A HD1  1 
ATOM   1503 H HD2  . TYR A 1 92  ? 4.568  -8.097  25.116 1.00 14.23 ? 92   TYR A HD2  1 
ATOM   1504 H HE1  . TYR A 1 92  ? 5.831  -5.958  29.061 1.00 12.67 ? 92   TYR A HE1  1 
ATOM   1505 H HE2  . TYR A 1 92  ? 3.009  -7.546  26.710 1.00 18.11 ? 92   TYR A HE2  1 
ATOM   1506 H HH   . TYR A 1 92  ? 3.677  -6.072  29.611 1.00 29.74 ? 92   TYR A HH   1 
ATOM   1507 N N    . PRO A 1 93  ? 6.773  -10.683 26.461 1.00 8.39  ? 93   PRO A N    1 
ATOM   1508 C CA   . PRO A 1 93  ? 7.098  -10.166 27.801 1.00 9.12  ? 93   PRO A CA   1 
ATOM   1509 C C    . PRO A 1 93  ? 8.451  -10.707 28.348 1.00 8.74  ? 93   PRO A C    1 
ATOM   1510 O O    . PRO A 1 93  ? 8.731  -10.504 29.520 1.00 13.53 ? 93   PRO A O    1 
ATOM   1511 C CB   . PRO A 1 93  ? 5.931  -10.754 28.640 1.00 11.55 ? 93   PRO A CB   1 
ATOM   1512 C CG   . PRO A 1 93  ? 5.698  -12.071 28.024 1.00 14.39 ? 93   PRO A CG   1 
ATOM   1513 C CD   . PRO A 1 93  ? 5.841  -11.836 26.513 1.00 11.89 ? 93   PRO A CD   1 
ATOM   1514 H HA   . PRO A 1 93  ? 7.081  -9.167  27.814 1.00 10.94 ? 93   PRO A HA   1 
ATOM   1515 H HB2  . PRO A 1 93  ? 6.188  -10.846 29.592 1.00 13.86 ? 93   PRO A HB2  1 
ATOM   1516 H HB3  . PRO A 1 93  ? 5.125  -10.183 28.577 1.00 13.86 ? 93   PRO A HB3  1 
ATOM   1517 H HG2  . PRO A 1 93  ? 6.367  -12.729 28.341 1.00 17.27 ? 93   PRO A HG2  1 
ATOM   1518 H HG3  . PRO A 1 93  ? 4.792  -12.405 28.243 1.00 17.27 ? 93   PRO A HG3  1 
ATOM   1519 H HD2  . PRO A 1 93  ? 6.224  -12.629 26.060 1.00 14.27 ? 93   PRO A HD2  1 
ATOM   1520 H HD3  . PRO A 1 93  ? 4.969  -11.614 26.099 1.00 14.27 ? 93   PRO A HD3  1 
ATOM   1521 N N    . ASN A 1 94  ? 9.237  -11.349 27.507 1.00 7.15  ? 94   ASN A N    1 
ATOM   1522 C CA   . ASN A 1 94  ? 10.563 -11.898 27.896 1.00 7.65  ? 94   ASN A CA   1 
ATOM   1523 C C    . ASN A 1 94  ? 11.661 -10.957 27.418 1.00 7.21  ? 94   ASN A C    1 
ATOM   1524 O O    . ASN A 1 94  ? 12.250 -11.089 26.362 1.00 9.12  ? 94   ASN A O    1 
ATOM   1525 C CB   . ASN A 1 94  ? 10.722 -13.275 27.287 1.00 9.10  ? 94   ASN A CB   1 
ATOM   1526 C CG   . ASN A 1 94  ? 9.674  -14.225 27.816 1.00 10.37 ? 94   ASN A CG   1 
ATOM   1527 O OD1  . ASN A 1 94  ? 9.627  -14.463 28.998 1.00 14.03 ? 94   ASN A OD1  1 
ATOM   1528 N ND2  . ASN A 1 94  ? 8.858  -14.731 26.931 1.00 12.86 ? 94   ASN A ND2  1 
ATOM   1529 H H    . ASN A 1 94  ? 8.964  -11.458 26.678 1.00 8.58  ? 94   ASN A H    1 
ATOM   1530 H HA   . ASN A 1 94  ? 10.607 -11.974 28.892 1.00 9.18  ? 94   ASN A HA   1 
ATOM   1531 H HB2  . ASN A 1 94  ? 10.641 -13.211 26.302 1.00 10.92 ? 94   ASN A HB2  1 
ATOM   1532 H HB3  . ASN A 1 94  ? 11.623 -13.627 27.498 1.00 10.92 ? 94   ASN A HB3  1 
ATOM   1533 H HD21 . ASN A 1 94  ? 8.944  -14.519 26.082 1.00 15.43 ? 94   ASN A HD21 1 
ATOM   1534 H HD22 . ASN A 1 94  ? 8.223  -15.285 27.184 1.00 15.43 ? 94   ASN A HD22 1 
ATOM   1535 N N    . CYS A 1 95  ? 11.891 -9.951  28.269 1.00 6.77  ? 95   CYS A N    1 
ATOM   1536 C CA   . CYS A 1 95  ? 12.750 -8.848  27.966 1.00 5.78  ? 95   CYS A CA   1 
ATOM   1537 C C    . CYS A 1 95  ? 14.151 -9.162  28.480 1.00 5.68  ? 95   CYS A C    1 
ATOM   1538 O O    . CYS A 1 95  ? 14.306 -9.392  29.685 1.00 7.89  ? 95   CYS A O    1 
ATOM   1539 C CB   . CYS A 1 95  ? 12.278 -7.546  28.590 1.00 5.61  ? 95   CYS A CB   1 
ATOM   1540 S SG   . CYS A 1 95  ? 10.590 -7.058  28.124 1.00 6.25  ? 95   CYS A SG   1 
ATOM   1541 H H    . CYS A 1 95  ? 11.493 -9.968  29.054 1.00 8.12  ? 95   CYS A H    1 
ATOM   1542 H HA   . CYS A 1 95  ? 12.789 -8.734  26.973 1.00 6.94  ? 95   CYS A HA   1 
ATOM   1543 H HB2  . CYS A 1 95  ? 12.322 -7.633  29.575 1.00 6.74  ? 95   CYS A HB2  1 
ATOM   1544 H HB3  . CYS A 1 95  ? 12.902 -6.824  28.325 1.00 6.74  ? 95   CYS A HB3  1 
ATOM   1545 N N    . ALA A 1 96  ? 15.127 -9.186  27.612 1.00 5.66  ? 96   ALA A N    1 
ATOM   1546 C CA   . ALA A 1 96  ? 16.487 -9.562  27.937 1.00 5.58  ? 96   ALA A CA   1 
ATOM   1547 C C    . ALA A 1 96  ? 17.441 -8.475  27.433 1.00 4.87  ? 96   ALA A C    1 
ATOM   1548 O O    . ALA A 1 96  ? 17.215 -7.845  26.404 1.00 5.35  ? 96   ALA A O    1 
ATOM   1549 C CB   . ALA A 1 96  ? 16.811 -10.903 27.286 1.00 9.77  ? 96   ALA A CB   1 
ATOM   1550 H H    . ALA A 1 96  ? 14.947 -8.960  26.781 1.00 6.80  ? 96   ALA A H    1 
ATOM   1551 H HA   . ALA A 1 96  ? 16.578 -9.647  28.930 1.00 6.70  ? 96   ALA A HA   1 
ATOM   1552 H HB1  . ALA A 1 96  ? 16.195 -11.587 27.623 1.00 14.65 ? 96   ALA A HB1  1 
ATOM   1553 H HB2  . ALA A 1 96  ? 16.714 -10.826 26.314 1.00 14.65 ? 96   ALA A HB2  1 
ATOM   1554 H HB3  . ALA A 1 96  ? 17.732 -11.157 27.504 1.00 14.65 ? 96   ALA A HB3  1 
ATOM   1555 N N    . TYR A 1 97  ? 18.520 -8.314  28.208 1.00 4.95  ? 97   TYR A N    1 
ATOM   1556 C CA   . TYR A 1 97  ? 19.387 -7.160  28.083 1.00 4.85  ? 97   TYR A CA   1 
ATOM   1557 C C    . TYR A 1 97  ? 20.850 -7.535  28.234 1.00 5.19  ? 97   TYR A C    1 
ATOM   1558 O O    . TYR A 1 97  ? 21.216 -8.338  29.135 1.00 5.63  ? 97   TYR A O    1 
ATOM   1559 C CB   . TYR A 1 97  ? 19.072 -6.140  29.234 1.00 5.10  ? 97   TYR A CB   1 
ATOM   1560 C CG   . TYR A 1 97  ? 17.711 -5.538  29.076 1.00 4.78  ? 97   TYR A CG   1 
ATOM   1561 C CD1  . TYR A 1 97  ? 17.527 -4.414  28.277 1.00 4.90  ? 97   TYR A CD1  1 
ATOM   1562 C CD2  . TYR A 1 97  ? 16.585 -6.110  29.644 1.00 5.18  ? 97   TYR A CD2  1 
ATOM   1563 C CE1  . TYR A 1 97  ? 16.282 -3.871  28.055 1.00 5.19  ? 97   TYR A CE1  1 
ATOM   1564 C CE2  . TYR A 1 97  ? 15.315 -5.584  29.433 1.00 5.21  ? 97   TYR A CE2  1 
ATOM   1565 C CZ   . TYR A 1 97  ? 15.168 -4.464  28.615 1.00 5.19  ? 97   TYR A CZ   1 
ATOM   1566 O OH   . TYR A 1 97  ? 13.890 -3.985  28.413 1.00 6.14  ? 97   TYR A OH   1 
ATOM   1567 H H    . TYR A 1 97  ? 18.708 -8.927  28.811 1.00 5.94  ? 97   TYR A H    1 
ATOM   1568 H HA   . TYR A 1 97  ? 19.241 -6.722  27.195 1.00 5.82  ? 97   TYR A HA   1 
ATOM   1569 H HB2  . TYR A 1 97  ? 19.126 -6.604  30.107 1.00 6.12  ? 97   TYR A HB2  1 
ATOM   1570 H HB3  . TYR A 1 97  ? 19.751 -5.420  29.229 1.00 6.12  ? 97   TYR A HB3  1 
ATOM   1571 H HD1  . TYR A 1 97  ? 18.285 -4.008  27.872 1.00 5.88  ? 97   TYR A HD1  1 
ATOM   1572 H HD2  . TYR A 1 97  ? 16.683 -6.881  30.190 1.00 6.21  ? 97   TYR A HD2  1 
ATOM   1573 H HE1  . TYR A 1 97  ? 16.190 -3.092  27.520 1.00 6.22  ? 97   TYR A HE1  1 
ATOM   1574 H HE2  . TYR A 1 97  ? 14.556 -5.983  29.842 1.00 6.25  ? 97   TYR A HE2  1 
ATOM   1575 H HH   . TYR A 1 97  ? 13.919 -3.317  27.904 1.00 9.20  ? 97   TYR A HH   1 
ATOM   1576 N N    . LYS A 1 98  ? 21.702 -6.914  27.453 1.00 4.99  ? 98   LYS A N    1 
ATOM   1577 C CA   . LYS A 1 98  ? 23.135 -6.942  27.695 1.00 5.21  ? 98   LYS A CA   1 
ATOM   1578 C C    . LYS A 1 98  ? 23.450 -5.889  28.758 1.00 4.82  ? 98   LYS A C    1 
ATOM   1579 O O    . LYS A 1 98  ? 23.047 -4.740  28.650 1.00 5.69  ? 98   LYS A O    1 
ATOM   1580 C CB   . LYS A 1 98  ? 23.882 -6.607  26.402 1.00 6.54  ? 98   LYS A CB   1 
ATOM   1581 C CG   . LYS A 1 98  ? 25.388 -6.537  26.558 1.00 8.72  ? 98   LYS A CG   1 
ATOM   1582 C CD   . LYS A 1 98  ? 26.118 -7.721  26.947 1.00 20.93 ? 98   LYS A CD   1 
ATOM   1583 C CE   . LYS A 1 98  ? 27.613 -7.334  26.682 1.00 27.85 ? 98   LYS A CE   1 
ATOM   1584 N NZ   . LYS A 1 98  ? 28.588 -8.011  27.614 1.00 34.24 ? 98   LYS A NZ   1 
ATOM   1585 H H    . LYS A 1 98  ? 21.396 -6.465  26.761 1.00 5.99  ? 98   LYS A H    1 
ATOM   1586 H HA   . LYS A 1 98  ? 23.408 -7.848  28.020 1.00 6.25  ? 98   LYS A HA   1 
ATOM   1587 H HB2  . LYS A 1 98  ? 23.664 -7.292  25.721 1.00 7.85  ? 98   LYS A HB2  1 
ATOM   1588 H HB3  . LYS A 1 98  ? 23.556 -5.735  26.063 1.00 7.85  ? 98   LYS A HB3  1 
ATOM   1589 H HG2  . LYS A 1 98  ? 25.762 -6.228  25.695 1.00 10.47 ? 98   LYS A HG2  1 
ATOM   1590 H HG3  . LYS A 1 98  ? 25.584 -5.833  27.226 1.00 10.47 ? 98   LYS A HG3  1 
ATOM   1591 H HD2  . LYS A 1 98  ? 25.969 -7.932  27.903 1.00 25.12 ? 98   LYS A HD2  1 
ATOM   1592 H HD3  . LYS A 1 98  ? 25.849 -8.501  26.399 1.00 25.12 ? 98   LYS A HD3  1 
ATOM   1593 H HE2  . LYS A 1 98  ? 27.844 -7.573  25.750 1.00 33.42 ? 98   LYS A HE2  1 
ATOM   1594 H HE3  . LYS A 1 98  ? 27.710 -6.354  26.775 1.00 33.42 ? 98   LYS A HE3  1 
ATOM   1595 H HZ1  . LYS A 1 98  ? 28.298 -8.854  27.797 1.00 51.36 ? 98   LYS A HZ1  1 
ATOM   1596 H HZ2  . LYS A 1 98  ? 29.407 -8.051  27.220 1.00 51.36 ? 98   LYS A HZ2  1 
ATOM   1597 H HZ3  . LYS A 1 98  ? 28.647 -7.536  28.388 1.00 51.36 ? 98   LYS A HZ3  1 
ATOM   1598 N N    . THR A 1 99  ? 24.188 -6.320  29.786 1.00 4.71  ? 99   THR A N    1 
ATOM   1599 C CA   . THR A 1 99  ? 24.717 -5.440  30.819 1.00 4.55  ? 99   THR A CA   1 
ATOM   1600 C C    . THR A 1 99  ? 26.147 -5.040  30.442 1.00 5.05  ? 99   THR A C    1 
ATOM   1601 O O    . THR A 1 99  ? 27.001 -5.921  30.293 1.00 6.39  ? 99   THR A O    1 
ATOM   1602 C CB   . THR A 1 99  ? 24.726 -6.196  32.171 1.00 4.73  ? 99   THR A CB   1 
ATOM   1603 O OG1  . THR A 1 99  ? 23.396 -6.445  32.584 1.00 5.10  ? 99   THR A OG1  1 
ATOM   1604 C CG2  . THR A 1 99  ? 25.410 -5.418  33.270 1.00 5.41  ? 99   THR A CG2  1 
ATOM   1605 H H    . THR A 1 99  ? 24.363 -7.181  29.841 1.00 5.65  ? 99   THR A H    1 
ATOM   1606 H HA   . THR A 1 99  ? 24.145 -4.623  30.893 1.00 5.46  ? 99   THR A HA   1 
ATOM   1607 H HB   . THR A 1 99  ? 25.197 -7.070  32.051 1.00 5.67  ? 99   THR A HB   1 
ATOM   1608 H HG1  . THR A 1 99  ? 22.996 -6.883  31.989 1.00 7.65  ? 99   THR A HG1  1 
ATOM   1609 H HG21 . THR A 1 99  ? 26.337 -5.236  33.013 1.00 8.12  ? 99   THR A HG21 1 
ATOM   1610 H HG22 . THR A 1 99  ? 24.938 -4.571  33.413 1.00 8.12  ? 99   THR A HG22 1 
ATOM   1611 H HG23 . THR A 1 99  ? 25.398 -5.943  34.098 1.00 8.12  ? 99   THR A HG23 1 
ATOM   1612 N N    . THR A 1 100 ? 26.388 -3.749  30.330 1.00 5.66  ? 100  THR A N    1 
ATOM   1613 C CA   . THR A 1 100 ? 27.737 -3.232  30.051 1.00 6.78  ? 100  THR A CA   1 
ATOM   1614 C C    . THR A 1 100 ? 28.104 -2.235  31.144 1.00 6.20  ? 100  THR A C    1 
ATOM   1615 O O    . THR A 1 100 ? 27.426 -1.217  31.319 1.00 6.60  ? 100  THR A O    1 
ATOM   1616 C CB   . THR A 1 100 ? 27.822 -2.586  28.690 1.00 8.21  ? 100  THR A CB   1 
ATOM   1617 O OG1  . THR A 1 100 ? 27.424 -3.506  27.685 1.00 9.41  ? 100  THR A OG1  1 
ATOM   1618 C CG2  . THR A 1 100 ? 29.273 -2.181  28.427 1.00 14.72 ? 100  THR A CG2  1 
ATOM   1619 H H    . THR A 1 100 ? 25.723 -3.180  30.426 1.00 6.80  ? 100  THR A H    1 
ATOM   1620 H HA   . THR A 1 100 ? 28.384 -3.994  30.083 1.00 8.14  ? 100  THR A HA   1 
ATOM   1621 H HB   . THR A 1 100 ? 27.234 -1.778  28.661 1.00 9.86  ? 100  THR A HB   1 
ATOM   1622 H HG1  . THR A 1 100 ? 27.229 -4.242  28.041 1.00 14.11 ? 100  THR A HG1  1 
ATOM   1623 H HG21 . THR A 1 100 ? 29.570 -1.558  29.123 1.00 22.09 ? 100  THR A HG21 1 
ATOM   1624 H HG22 . THR A 1 100 ? 29.842 -2.979  28.438 1.00 22.09 ? 100  THR A HG22 1 
ATOM   1625 H HG23 . THR A 1 100 ? 29.338 -1.747  27.550 1.00 22.09 ? 100  THR A HG23 1 
ATOM   1626 N N    . GLN A 1 101 ? 29.172 -2.499  31.858 1.00 6.70  ? 101  GLN A N    1 
ATOM   1627 C CA   . GLN A 1 101 ? 29.716 -1.551  32.827 1.00 6.32  ? 101  GLN A CA   1 
ATOM   1628 C C    . GLN A 1 101 ? 30.477 -0.453  32.114 1.00 5.98  ? 101  GLN A C    1 
ATOM   1629 O O    . GLN A 1 101 ? 31.187 -0.708  31.135 1.00 7.77  ? 101  GLN A O    1 
ATOM   1630 C CB   . GLN A 1 101 ? 30.677 -2.267  33.793 1.00 7.47  ? 101  GLN A CB   1 
ATOM   1631 C CG   . GLN A 1 101 ? 30.073 -3.408  34.620 1.00 8.73  ? 101  GLN A CG   1 
ATOM   1632 C CD   . GLN A 1 101 ? 31.091 -4.012  35.550 1.00 10.46 ? 101  GLN A CD   1 
ATOM   1633 O OE1  . GLN A 1 101 ? 32.239 -4.200  35.149 1.00 13.56 ? 101  GLN A OE1  1 
ATOM   1634 N NE2  . GLN A 1 101 ? 30.696 -4.417  36.761 1.00 10.78 ? 101  GLN A NE2  1 
ATOM   1635 H H    . GLN A 1 101 ? 29.575 -3.274  31.749 1.00 8.04  ? 101  GLN A H    1 
ATOM   1636 H HA   . GLN A 1 101 ? 28.965 -1.146  33.349 1.00 7.59  ? 101  GLN A HA   1 
ATOM   1637 H HB2  . GLN A 1 101 ? 31.432 -2.631  33.266 1.00 8.96  ? 101  GLN A HB2  1 
ATOM   1638 H HB3  . GLN A 1 101 ? 31.049 -1.594  34.417 1.00 8.96  ? 101  GLN A HB3  1 
ATOM   1639 H HG2  . GLN A 1 101 ? 29.311 -3.062  35.149 1.00 10.48 ? 101  GLN A HG2  1 
ATOM   1640 H HG3  . GLN A 1 101 ? 29.729 -4.108  34.011 1.00 10.48 ? 101  GLN A HG3  1 
ATOM   1641 H HE21 . GLN A 1 101 ? 29.870 -4.270  37.026 1.00 12.93 ? 101  GLN A HE21 1 
ATOM   1642 H HE22 . GLN A 1 101 ? 31.262 -4.829  37.293 1.00 12.93 ? 101  GLN A HE22 1 
ATOM   1643 N N    . ALA A 1 102 ? 30.396 0.766   32.624 1.00 5.67  ? 102  ALA A N    1 
ATOM   1644 C CA   . ALA A 1 102 ? 31.139 1.872   32.046 1.00 5.89  ? 102  ALA A CA   1 
ATOM   1645 C C    . ALA A 1 102 ? 31.481 2.883   33.129 1.00 5.12  ? 102  ALA A C    1 
ATOM   1646 O O    . ALA A 1 102 ? 30.928 2.909   34.229 1.00 5.24  ? 102  ALA A O    1 
ATOM   1647 C CB   . ALA A 1 102 ? 30.347 2.533   30.915 1.00 8.03  ? 102  ALA A CB   1 
ATOM   1648 H H    . ALA A 1 102 ? 29.884 0.909   33.325 1.00 6.80  ? 102  ALA A H    1 
ATOM   1649 H HA   . ALA A 1 102 ? 31.993 1.515   31.666 1.00 7.07  ? 102  ALA A HA   1 
ATOM   1650 H HB1  . ALA A 1 102 ? 29.514 2.905   31.274 1.00 12.04 ? 102  ALA A HB1  1 
ATOM   1651 H HB2  . ALA A 1 102 ? 30.882 3.252   30.519 1.00 12.04 ? 102  ALA A HB2  1 
ATOM   1652 H HB3  . ALA A 1 102 ? 30.137 1.865   30.229 1.00 12.04 ? 102  ALA A HB3  1 
ATOM   1653 N N    . ASN A 1 103 ? 32.427 3.771   32.776 1.00 5.68  ? 103  ASN A N    1 
ATOM   1654 C CA   . ASN A 1 103 ? 32.829 4.896   33.645 1.00 5.89  ? 103  ASN A CA   1 
ATOM   1655 C C    . ASN A 1 103 ? 32.946 6.103   32.712 1.00 6.26  ? 103  ASN A C    1 
ATOM   1656 O O    . ASN A 1 103 ? 33.919 6.206   31.975 1.00 9.51  ? 103  ASN A O    1 
ATOM   1657 C CB   A ASN A 1 103 ? 34.076 4.659   34.435 0.67 7.48  ? 103  ASN A CB   1 
ATOM   1658 C CB   B ASN A 1 103 ? 34.217 4.533   34.154 0.33 5.65  ? 103  ASN A CB   1 
ATOM   1659 C CG   A ASN A 1 103 ? 33.867 3.650   35.499 0.67 9.04  ? 103  ASN A CG   1 
ATOM   1660 C CG   B ASN A 1 103 ? 34.929 5.513   35.060 0.33 6.29  ? 103  ASN A CG   1 
ATOM   1661 O OD1  A ASN A 1 103 ? 34.160 2.442   35.175 0.67 11.60 ? 103  ASN A OD1  1 
ATOM   1662 O OD1  B ASN A 1 103 ? 34.288 6.422   35.585 0.33 6.01  ? 103  ASN A OD1  1 
ATOM   1663 N ND2  A ASN A 1 103 ? 33.399 4.098   36.653 0.67 9.21  ? 103  ASN A ND2  1 
ATOM   1664 N ND2  B ASN A 1 103 ? 36.221 5.333   35.311 0.33 7.91  ? 103  ASN A ND2  1 
ATOM   1665 H H    . ASN A 1 103 ? 32.823 3.677   31.996 1.00 6.82  ? 103  ASN A H    1 
ATOM   1666 H HA   A ASN A 1 103 ? 32.084 5.072   34.288 1.00 7.07  ? 103  ASN A HA   1 
ATOM   1667 H HB2  A ASN A 1 103 ? 34.794 4.350   33.828 0.67 8.98  ? 103  ASN A HB2  1 
ATOM   1668 H HB2  B ASN A 1 103 ? 34.144 3.672   34.639 0.33 6.78  ? 103  ASN A HB2  1 
ATOM   1669 H HB3  A ASN A 1 103 ? 34.369 5.511   34.846 0.67 8.98  ? 103  ASN A HB3  1 
ATOM   1670 H HB3  B ASN A 1 103 ? 34.796 4.375   33.366 0.33 6.78  ? 103  ASN A HB3  1 
ATOM   1671 H HD21 A ASN A 1 103 ? 33.233 4.956   36.758 0.67 11.05 ? 103  ASN A HD21 1 
ATOM   1672 H HD21 B ASN A 1 103 ? 36.658 4.676   34.923 0.33 9.49  ? 103  ASN A HD21 1 
ATOM   1673 H HD22 A ASN A 1 103 ? 33.253 3.537   37.316 0.67 11.05 ? 103  ASN A HD22 1 
ATOM   1674 H HD22 B ASN A 1 103 ? 36.641 5.872   35.867 0.33 9.49  ? 103  ASN A HD22 1 
ATOM   1675 N N    . LYS A 1 104 ? 31.899 6.926   32.695 1.00 5.42  ? 104  LYS A N    1 
ATOM   1676 C CA   . LYS A 1 104 ? 31.751 7.963   31.672 1.00 5.53  ? 104  LYS A CA   1 
ATOM   1677 C C    . LYS A 1 104 ? 31.234 9.222   32.305 1.00 5.11  ? 104  LYS A C    1 
ATOM   1678 O O    . LYS A 1 104 ? 30.632 9.219   33.402 1.00 5.33  ? 104  LYS A O    1 
ATOM   1679 C CB   . LYS A 1 104 ? 30.815 7.513   30.579 1.00 6.99  ? 104  LYS A CB   1 
ATOM   1680 C CG   A LYS A 1 104 ? 31.106 6.210   29.834 0.49 8.51  ? 104  LYS A CG   1 
ATOM   1681 C CG   B LYS A 1 104 ? 31.537 6.464   29.668 0.51 9.47  ? 104  LYS A CG   1 
ATOM   1682 C CD   A LYS A 1 104 ? 32.195 6.540   28.779 0.49 11.51 ? 104  LYS A CD   1 
ATOM   1683 C CD   B LYS A 1 104 ? 30.574 5.902   28.621 0.51 11.29 ? 104  LYS A CD   1 
ATOM   1684 C CE   A LYS A 1 104 ? 32.535 5.278   28.001 0.49 14.88 ? 104  LYS A CE   1 
ATOM   1685 C CE   B LYS A 1 104 ? 30.427 6.804   27.460 0.51 15.02 ? 104  LYS A CE   1 
ATOM   1686 N NZ   A LYS A 1 104 ? 33.775 5.604   27.158 0.49 24.37 ? 104  LYS A NZ   1 
ATOM   1687 N NZ   B LYS A 1 104 ? 29.549 6.173   26.432 0.51 18.97 ? 104  LYS A NZ   1 
ATOM   1688 H H    . LYS A 1 104 ? 31.280 6.844   33.315 1.00 6.50  ? 104  LYS A H    1 
ATOM   1689 H HA   . LYS A 1 104 ? 32.648 8.150   31.271 1.00 6.64  ? 104  LYS A HA   1 
ATOM   1690 H HB2  A LYS A 1 104 ? 29.911 7.435   30.975 1.00 8.39  ? 104  LYS A HB2  1 
ATOM   1691 H HB3  A LYS A 1 104 ? 30.774 8.238   29.906 1.00 8.39  ? 104  LYS A HB3  1 
ATOM   1692 H HG2  A LYS A 1 104 ? 31.432 5.518   30.463 0.49 10.22 ? 104  LYS A HG2  1 
ATOM   1693 H HG2  B LYS A 1 104 ? 32.305 6.894   29.213 0.51 11.36 ? 104  LYS A HG2  1 
ATOM   1694 H HG3  A LYS A 1 104 ? 30.286 5.875   29.392 0.49 10.22 ? 104  LYS A HG3  1 
ATOM   1695 H HG3  B LYS A 1 104 ? 31.886 5.725   30.227 0.51 11.36 ? 104  LYS A HG3  1 
ATOM   1696 H HD2  A LYS A 1 104 ? 31.862 7.237   28.159 0.49 13.81 ? 104  LYS A HD2  1 
ATOM   1697 H HD2  B LYS A 1 104 ? 30.908 5.023   28.310 0.51 13.55 ? 104  LYS A HD2  1 
ATOM   1698 H HD3  A LYS A 1 104 ? 33.005 6.887   29.229 0.49 13.81 ? 104  LYS A HD3  1 
ATOM   1699 H HD3  B LYS A 1 104 ? 29.687 5.760   29.037 0.51 13.55 ? 104  LYS A HD3  1 
ATOM   1700 H HE2  A LYS A 1 104 ? 32.727 4.531   28.622 0.49 17.86 ? 104  LYS A HE2  1 
ATOM   1701 H HE2  B LYS A 1 104 ? 30.032 7.663   27.753 0.51 18.03 ? 104  LYS A HE2  1 
ATOM   1702 H HE3  A LYS A 1 104 ? 31.779 5.017   27.418 0.49 17.86 ? 104  LYS A HE3  1 
ATOM   1703 H HE3  B LYS A 1 104 ? 31.317 6.991   27.068 0.51 18.03 ? 104  LYS A HE3  1 
ATOM   1704 H HZ1  B LYS A 1 104 ? 29.854 5.337   26.243 0.51 28.45 ? 104  LYS A HZ1  1 
ATOM   1705 H HZ2  B LYS A 1 104 ? 28.698 6.120   26.750 0.51 28.45 ? 104  LYS A HZ2  1 
ATOM   1706 H HZ3  B LYS A 1 104 ? 29.558 6.677   25.674 0.51 28.45 ? 104  LYS A HZ3  1 
ATOM   1707 N N    . HIS A 1 105 ? 31.407 10.331  31.618 1.00 5.65  ? 105  HIS A N    1 
ATOM   1708 C CA   . HIS A 1 105 ? 30.691 11.560  31.994 1.00 5.69  ? 105  HIS A CA   1 
ATOM   1709 C C    . HIS A 1 105 ? 29.251 11.390  31.639 1.00 6.55  ? 105  HIS A C    1 
ATOM   1710 O O    . HIS A 1 105 ? 28.925 10.883  30.583 1.00 10.73 ? 105  HIS A O    1 
ATOM   1711 C CB   . HIS A 1 105 ? 31.288 12.779  31.262 1.00 6.75  ? 105  HIS A CB   1 
ATOM   1712 C CG   . HIS A 1 105 ? 32.740 12.929  31.447 1.00 6.99  ? 105  HIS A CG   1 
ATOM   1713 N ND1  . HIS A 1 105 ? 33.356 13.553  32.424 1.00 8.29  ? 105  HIS A ND1  1 
ATOM   1714 C CD2  . HIS A 1 105 ? 33.715 12.387  30.636 1.00 9.31  ? 105  HIS A CD2  1 
ATOM   1715 C CE1  . HIS A 1 105 ? 34.718 13.493  32.268 1.00 9.65  ? 105  HIS A CE1  1 
ATOM   1716 N NE2  . HIS A 1 105 ? 34.908 12.772  31.196 1.00 12.16 ? 105  HIS A NE2  1 
ATOM   1717 H H    . HIS A 1 105 ? 31.955 10.338  30.929 1.00 6.78  ? 105  HIS A H    1 
ATOM   1718 H HA   . HIS A 1 105 ? 30.771 11.698  32.981 1.00 6.83  ? 105  HIS A HA   1 
ATOM   1719 H HB2  . HIS A 1 105 ? 31.097 12.696  30.294 1.00 8.09  ? 105  HIS A HB2  1 
ATOM   1720 H HB3  . HIS A 1 105 ? 30.839 13.599  31.588 1.00 8.09  ? 105  HIS A HB3  1 
ATOM   1721 H HD1  . HIS A 1 105 ? 32.949 13.957  33.091 1.00 9.95  ? 105  HIS A HD1  1 
ATOM   1722 H HD2  . HIS A 1 105 ? 33.587 11.860  29.856 1.00 11.17 ? 105  HIS A HD2  1 
ATOM   1723 H HE1  . HIS A 1 105 ? 35.380 13.891  32.821 1.00 11.59 ? 105  HIS A HE1  1 
ATOM   1724 N N    . ILE A 1 106 ? 28.348 11.750  32.557 1.00 5.49  ? 106  ILE A N    1 
ATOM   1725 C CA   . ILE A 1 106 ? 26.928 11.636  32.325 1.00 5.50  ? 106  ILE A CA   1 
ATOM   1726 C C    . ILE A 1 106 ? 26.392 13.024  31.915 1.00 4.76  ? 106  ILE A C    1 
ATOM   1727 O O    . ILE A 1 106 ? 26.897 14.055  32.321 1.00 5.02  ? 106  ILE A O    1 
ATOM   1728 C CB   . ILE A 1 106 ? 26.142 11.059  33.522 1.00 5.71  ? 106  ILE A CB   1 
ATOM   1729 C CG1  . ILE A 1 106 ? 26.147 11.969  34.729 1.00 6.14  ? 106  ILE A CG1  1 
ATOM   1730 C CG2  . ILE A 1 106 ? 26.672 9.652   33.828 1.00 8.22  ? 106  ILE A CG2  1 
ATOM   1731 C CD1  . ILE A 1 106 ? 25.163 11.554  35.825 1.00 7.57  ? 106  ILE A CD1  1 
ATOM   1732 H H    . ILE A 1 106 ? 28.629 12.067  33.329 1.00 6.59  ? 106  ILE A H    1 
ATOM   1733 H HA   . ILE A 1 106 ? 26.796 11.018  31.549 1.00 6.60  ? 106  ILE A HA   1 
ATOM   1734 H HB   . ILE A 1 106 ? 25.190 10.959  33.231 1.00 6.85  ? 106  ILE A HB   1 
ATOM   1735 H HG12 . ILE A 1 106 ? 27.060 11.987  35.110 1.00 7.37  ? 106  ILE A HG12 1 
ATOM   1736 H HG13 . ILE A 1 106 ? 25.927 12.888  34.435 1.00 7.37  ? 106  ILE A HG13 1 
ATOM   1737 H HG21 . ILE A 1 106 ? 26.639 9.107   33.015 1.00 12.33 ? 106  ILE A HG21 1 
ATOM   1738 H HG22 . ILE A 1 106 ? 27.598 9.713   34.143 1.00 12.33 ? 106  ILE A HG22 1 
ATOM   1739 H HG23 . ILE A 1 106 ? 26.117 9.238   34.522 1.00 12.33 ? 106  ILE A HG23 1 
ATOM   1740 H HD11 . ILE A 1 106 ? 25.384 10.651  36.136 1.00 11.35 ? 106  ILE A HD11 1 
ATOM   1741 H HD12 . ILE A 1 106 ? 25.225 12.182  36.574 1.00 11.35 ? 106  ILE A HD12 1 
ATOM   1742 H HD13 . ILE A 1 106 ? 24.252 11.562  35.465 1.00 11.35 ? 106  ILE A HD13 1 
ATOM   1743 N N    . ILE A 1 107 ? 25.286 12.975  31.162 1.00 4.80  ? 107  ILE A N    1 
ATOM   1744 C CA   . ILE A 1 107 ? 24.577 14.172  30.754 1.00 4.63  ? 107  ILE A CA   1 
ATOM   1745 C C    . ILE A 1 107 ? 23.115 13.998  31.168 1.00 4.61  ? 107  ILE A C    1 
ATOM   1746 O O    . ILE A 1 107 ? 22.461 13.047  30.745 1.00 5.13  ? 107  ILE A O    1 
ATOM   1747 C CB   . ILE A 1 107 ? 24.668 14.462  29.226 1.00 5.20  ? 107  ILE A CB   1 
ATOM   1748 C CG1  A ILE A 1 107 ? 26.134 14.599  28.816 0.77 6.59  ? 107  ILE A CG1  1 
ATOM   1749 C CG1  B ILE A 1 107 ? 26.092 14.779  28.773 0.23 6.57  ? 107  ILE A CG1  1 
ATOM   1750 C CG2  . ILE A 1 107 ? 23.837 15.692  28.911 1.00 5.60  ? 107  ILE A CG2  1 
ATOM   1751 C CD1  A ILE A 1 107 ? 26.407 14.614  27.356 0.77 8.12  ? 107  ILE A CD1  1 
ATOM   1752 C CD1  B ILE A 1 107 ? 26.869 13.526  28.475 0.23 7.65  ? 107  ILE A CD1  1 
ATOM   1753 H H    . ILE A 1 107 ? 24.980 12.191  30.907 1.00 5.76  ? 107  ILE A H    1 
ATOM   1754 H HA   . ILE A 1 107 ? 24.957 14.953  31.250 1.00 5.55  ? 107  ILE A HA   1 
ATOM   1755 H HB   A ILE A 1 107 ? 24.275 13.685  28.735 1.00 6.24  ? 107  ILE A HB   1 
ATOM   1756 H HG12 A ILE A 1 107 ? 26.489 15.437  29.206 0.77 7.91  ? 107  ILE A HG12 1 
ATOM   1757 H HG12 B ILE A 1 107 ? 26.059 15.345  27.962 0.23 7.89  ? 107  ILE A HG12 1 
ATOM   1758 H HG13 A ILE A 1 107 ? 26.640 13.848  29.218 0.77 7.91  ? 107  ILE A HG13 1 
ATOM   1759 H HG13 B ILE A 1 107 ? 26.555 15.290  29.483 0.23 7.89  ? 107  ILE A HG13 1 
ATOM   1760 H HG21 . ILE A 1 107 ? 24.179 16.456  29.421 1.00 8.41  ? 107  ILE A HG21 1 
ATOM   1761 H HG22 . ILE A 1 107 ? 23.894 15.888  27.952 1.00 8.41  ? 107  ILE A HG22 1 
ATOM   1762 H HG23 . ILE A 1 107 ? 22.903 15.527  29.157 1.00 8.41  ? 107  ILE A HG23 1 
ATOM   1763 H HD11 A ILE A 1 107 ? 25.919 15.355  26.940 0.77 12.18 ? 107  ILE A HD11 1 
ATOM   1764 H HD11 B ILE A 1 107 ? 26.879 12.951  29.268 0.23 11.47 ? 107  ILE A HD11 1 
ATOM   1765 H HD12 A ILE A 1 107 ? 27.368 14.729  27.204 0.77 12.18 ? 107  ILE A HD12 1 
ATOM   1766 H HD12 B ILE A 1 107 ? 26.445 13.048  27.731 0.23 11.47 ? 107  ILE A HD12 1 
ATOM   1767 H HD13 A ILE A 1 107 ? 26.113 13.767  26.960 0.77 12.18 ? 107  ILE A HD13 1 
ATOM   1768 H HD13 B ILE A 1 107 ? 27.788 13.761  28.230 0.23 11.47 ? 107  ILE A HD13 1 
ATOM   1769 N N    . VAL A 1 108 ? 22.672 14.910  32.045 1.00 4.98  ? 108  VAL A N    1 
ATOM   1770 C CA   . VAL A 1 108 ? 21.292 14.868  32.546 1.00 5.08  ? 108  VAL A CA   1 
ATOM   1771 C C    . VAL A 1 108 ? 20.598 16.171  32.164 1.00 5.33  ? 108  VAL A C    1 
ATOM   1772 O O    . VAL A 1 108 ? 21.200 17.239  32.136 1.00 5.84  ? 108  VAL A O    1 
ATOM   1773 C CB   . VAL A 1 108 ? 21.256 14.650  34.073 1.00 5.62  ? 108  VAL A CB   1 
ATOM   1774 C CG1  . VAL A 1 108 ? 21.725 13.221  34.389 1.00 6.91  ? 108  VAL A CG1  1 
ATOM   1775 C CG2  . VAL A 1 108 ? 22.055 15.688  34.851 1.00 6.37  ? 108  VAL A CG2  1 
ATOM   1776 H H    . VAL A 1 108 ? 23.216 15.543  32.324 1.00 5.97  ? 108  VAL A H    1 
ATOM   1777 H HA   . VAL A 1 108 ? 20.814 14.110  32.103 1.00 6.09  ? 108  VAL A HA   1 
ATOM   1778 H HB   . VAL A 1 108 ? 20.302 14.724  34.365 1.00 6.75  ? 108  VAL A HB   1 
ATOM   1779 H HG11 . VAL A 1 108 ? 21.181 12.580  33.885 1.00 10.36 ? 108  VAL A HG11 1 
ATOM   1780 H HG12 . VAL A 1 108 ? 22.666 13.123  34.134 1.00 10.36 ? 108  VAL A HG12 1 
ATOM   1781 H HG13 . VAL A 1 108 ? 21.627 13.050  35.349 1.00 10.36 ? 108  VAL A HG13 1 
ATOM   1782 H HG21 . VAL A 1 108 ? 21.702 16.582  34.659 1.00 9.56  ? 108  VAL A HG21 1 
ATOM   1783 H HG22 . VAL A 1 108 ? 21.980 15.506  35.811 1.00 9.56  ? 108  VAL A HG22 1 
ATOM   1784 H HG23 . VAL A 1 108 ? 22.996 15.643  34.582 1.00 9.56  ? 108  VAL A HG23 1 
ATOM   1785 N N    . ALA A 1 109 ? 19.297 16.065  31.955 1.00 5.35  ? 109  ALA A N    1 
ATOM   1786 C CA   . ALA A 1 109 ? 18.420 17.217  31.878 1.00 5.99  ? 109  ALA A CA   1 
ATOM   1787 C C    . ALA A 1 109 ? 17.959 17.579  33.275 1.00 5.89  ? 109  ALA A C    1 
ATOM   1788 O O    . ALA A 1 109 ? 17.621 16.657  34.022 1.00 6.21  ? 109  ALA A O    1 
ATOM   1789 C CB   . ALA A 1 109 ? 17.202 16.943  30.974 1.00 8.00  ? 109  ALA A CB   1 
ATOM   1790 H H    . ALA A 1 109 ? 18.949 15.263  31.859 1.00 6.43  ? 109  ALA A H    1 
ATOM   1791 H HA   . ALA A 1 109 ? 18.934 17.987  31.500 1.00 7.19  ? 109  ALA A HA   1 
ATOM   1792 H HB1  . ALA A 1 109 ? 17.509 16.718  30.071 1.00 11.99 ? 109  ALA A HB1  1 
ATOM   1793 H HB2  . ALA A 1 109 ? 16.685 16.194  31.339 1.00 11.99 ? 109  ALA A HB2  1 
ATOM   1794 H HB3  . ALA A 1 109 ? 16.636 17.742  30.937 1.00 11.99 ? 109  ALA A HB3  1 
ATOM   1795 N N    . CYS A 1 110 ? 17.947 18.866  33.612 1.00 5.89  ? 110  CYS A N    1 
ATOM   1796 C CA   . CYS A 1 110 ? 17.543 19.338  34.909 1.00 6.12  ? 110  CYS A CA   1 
ATOM   1797 C C    . CYS A 1 110 ? 16.414 20.352  34.818 1.00 6.37  ? 110  CYS A C    1 
ATOM   1798 O O    . CYS A 1 110 ? 16.347 21.148  33.863 1.00 9.23  ? 110  CYS A O    1 
ATOM   1799 C CB   . CYS A 1 110 ? 18.695 19.961  35.671 1.00 6.39  ? 110  CYS A CB   1 
ATOM   1800 S SG   . CYS A 1 110 ? 20.089 18.780  35.804 1.00 6.03  ? 110  CYS A SG   1 
ATOM   1801 H H    . CYS A 1 110 ? 18.199 19.459  33.012 1.00 7.07  ? 110  CYS A H    1 
ATOM   1802 H HA   . CYS A 1 110 ? 17.212 18.554  35.435 1.00 7.35  ? 110  CYS A HA   1 
ATOM   1803 H HB2  . CYS A 1 110 ? 18.998 20.779  35.203 1.00 7.66  ? 110  CYS A HB2  1 
ATOM   1804 H HB3  . CYS A 1 110 ? 18.392 20.220  36.577 1.00 7.66  ? 110  CYS A HB3  1 
ATOM   1805 N N    . GLU A 1 111 ? 15.550 20.366  35.815 1.00 6.59  ? 111  GLU A N    1 
ATOM   1806 C CA   . GLU A 1 111 ? 14.409 21.271  35.868 1.00 8.39  ? 111  GLU A CA   1 
ATOM   1807 C C    . GLU A 1 111 ? 13.979 21.474  37.309 1.00 8.08  ? 111  GLU A C    1 
ATOM   1808 O O    . GLU A 1 111 ? 14.232 20.628  38.142 1.00 9.05  ? 111  GLU A O    1 
ATOM   1809 C CB   . GLU A 1 111 ? 13.221 20.731  35.049 1.00 12.35 ? 111  GLU A CB   1 
ATOM   1810 C CG   . GLU A 1 111 ? 13.439 20.559  33.603 1.00 22.94 ? 111  GLU A CG   1 
ATOM   1811 C CD   . GLU A 1 111 ? 13.209 21.733  32.624 1.00 48.38 ? 111  GLU A CD   1 
ATOM   1812 O OE1  . GLU A 1 111 ? 13.884 22.794  32.963 1.00 33.04 ? 111  GLU A OE1  1 
ATOM   1813 O OE2  . GLU A 1 111 ? 12.408 21.572  31.620 1.00 33.65 ? 111  GLU A OE2  1 
ATOM   1814 H H    . GLU A 1 111 ? 15.668 19.802  36.480 1.00 7.91  ? 111  GLU A H    1 
ATOM   1815 H HA   . GLU A 1 111 ? 14.684 22.154  35.489 1.00 10.06 ? 111  GLU A HA   1 
ATOM   1816 H HB2  . GLU A 1 111 ? 12.958 19.855  35.428 1.00 14.82 ? 111  GLU A HB2  1 
ATOM   1817 H HB3  . GLU A 1 111 ? 12.456 21.347  35.174 1.00 14.82 ? 111  GLU A HB3  1 
ATOM   1818 N N    . GLY A 1 112 ? 13.270 22.555  37.505 1.00 10.17 ? 112  GLY A N    1 
ATOM   1819 C CA   . GLY A 1 112 ? 12.518 22.800  38.749 1.00 13.67 ? 112  GLY A CA   1 
ATOM   1820 C C    . GLY A 1 112 ? 13.223 23.746  39.720 1.00 12.41 ? 112  GLY A C    1 
ATOM   1821 O O    . GLY A 1 112 ? 14.261 24.213  39.471 1.00 10.53 ? 112  GLY A O    1 
ATOM   1822 H H    . GLY A 1 112 ? 13.241 23.162  36.868 1.00 12.21 ? 112  GLY A H    1 
ATOM   1823 H HA2  . GLY A 1 112 ? 11.634 23.181  38.517 1.00 16.41 ? 112  GLY A HA2  1 
ATOM   1824 H HA3  . GLY A 1 112 ? 12.362 21.934  39.203 1.00 16.41 ? 112  GLY A HA3  1 
ATOM   1825 N N    . ASN A 1 113 ? 12.498 23.969  40.878 1.00 14.94 ? 113  ASN A N    1 
ATOM   1826 C CA   . ASN A 1 113 ? 13.140 24.668  42.054 1.00 17.23 ? 113  ASN A CA   1 
ATOM   1827 C C    . ASN A 1 113 ? 12.714 23.820  43.210 1.00 20.31 ? 113  ASN A C    1 
ATOM   1828 O O    . ASN A 1 113 ? 11.547 23.722  43.561 1.00 23.11 ? 113  ASN A O    1 
ATOM   1829 C CB   . ASN A 1 113 ? 12.651 26.088  42.217 1.00 19.21 ? 113  ASN A CB   1 
ATOM   1830 C CG   . ASN A 1 113 ? 13.486 26.754  43.327 1.00 17.57 ? 113  ASN A CG   1 
ATOM   1831 O OD1  . ASN A 1 113 ? 14.537 26.544  43.938 1.00 16.95 ? 113  ASN A OD1  1 
ATOM   1832 N ND2  . ASN A 1 113 ? 12.876 27.967  43.532 1.00 42.93 ? 113  ASN A ND2  1 
ATOM   1833 H H    . ASN A 1 113 ? 11.661 23.703  40.930 1.00 17.93 ? 113  ASN A H    1 
ATOM   1834 H HA   . ASN A 1 113 ? 14.136 24.653  41.964 1.00 20.68 ? 113  ASN A HA   1 
ATOM   1835 H HB2  . ASN A 1 113 ? 12.757 26.584  41.367 1.00 23.06 ? 113  ASN A HB2  1 
ATOM   1836 H HB3  . ASN A 1 113 ? 11.693 26.091  42.464 1.00 23.06 ? 113  ASN A HB3  1 
ATOM   1837 H HD21 . ASN A 1 113 ? 12.125 28.158  43.116 1.00 51.52 ? 113  ASN A HD21 1 
ATOM   1838 H HD22 . ASN A 1 113 ? 13.237 28.553  44.080 1.00 51.52 ? 113  ASN A HD22 1 
ATOM   1839 N N    . PRO A 1 114 ? 13.602 22.997  43.742 1.00 18.72 ? 114  PRO A N    1 
ATOM   1840 C CA   . PRO A 1 114 ? 15.005 22.978  43.380 1.00 14.43 ? 114  PRO A CA   1 
ATOM   1841 C C    . PRO A 1 114 ? 15.321 22.410  42.035 1.00 10.96 ? 114  PRO A C    1 
ATOM   1842 O O    . PRO A 1 114 ? 14.532 21.606  41.463 1.00 11.61 ? 114  PRO A O    1 
ATOM   1843 C CB   . PRO A 1 114 ? 15.561 22.078  44.507 1.00 17.16 ? 114  PRO A CB   1 
ATOM   1844 C CG   . PRO A 1 114 ? 14.431 21.131  44.853 1.00 16.38 ? 114  PRO A CG   1 
ATOM   1845 C CD   . PRO A 1 114 ? 13.246 22.060  44.833 1.00 18.71 ? 114  PRO A CD   1 
ATOM   1846 H HA   . PRO A 1 114 ? 15.388 23.898  43.459 1.00 17.31 ? 114  PRO A HA   1 
ATOM   1847 H HB2  . PRO A 1 114 ? 16.355 21.576  44.195 1.00 20.59 ? 114  PRO A HB2  1 
ATOM   1848 H HB3  . PRO A 1 114 ? 15.816 22.620  45.295 1.00 20.59 ? 114  PRO A HB3  1 
ATOM   1849 H HG2  . PRO A 1 114 ? 14.340 20.413  44.177 1.00 19.66 ? 114  PRO A HG2  1 
ATOM   1850 H HG3  . PRO A 1 114 ? 14.559 20.725  45.747 1.00 19.66 ? 114  PRO A HG3  1 
ATOM   1851 H HD2  . PRO A 1 114 ? 12.409 21.572  44.630 1.00 22.45 ? 114  PRO A HD2  1 
ATOM   1852 H HD3  . PRO A 1 114 ? 13.146 22.535  45.696 1.00 22.45 ? 114  PRO A HD3  1 
ATOM   1853 N N    . TYR A 1 115 ? 16.468 22.766  41.480 1.00 9.08  ? 115  TYR A N    1 
ATOM   1854 C CA   . TYR A 1 115 ? 16.845 22.429  40.109 1.00 7.80  ? 115  TYR A CA   1 
ATOM   1855 C C    . TYR A 1 115 ? 17.578 21.095  40.126 1.00 7.00  ? 115  TYR A C    1 
ATOM   1856 O O    . TYR A 1 115 ? 18.732 21.047  40.601 1.00 8.95  ? 115  TYR A O    1 
ATOM   1857 C CB   . TYR A 1 115 ? 17.714 23.579  39.623 1.00 7.57  ? 115  TYR A CB   1 
ATOM   1858 C CG   . TYR A 1 115 ? 17.890 23.587  38.112 1.00 6.69  ? 115  TYR A CG   1 
ATOM   1859 C CD1  . TYR A 1 115 ? 16.835 23.912  37.270 1.00 7.63  ? 115  TYR A CD1  1 
ATOM   1860 C CD2  . TYR A 1 115 ? 19.137 23.356  37.505 1.00 5.87  ? 115  TYR A CD2  1 
ATOM   1861 C CE1  . TYR A 1 115 ? 16.981 24.004  35.920 1.00 7.40  ? 115  TYR A CE1  1 
ATOM   1862 C CE2  . TYR A 1 115 ? 19.311 23.437  36.146 1.00 5.60  ? 115  TYR A CE2  1 
ATOM   1863 C CZ   . TYR A 1 115 ? 18.238 23.764  35.342 1.00 6.00  ? 115  TYR A CZ   1 
ATOM   1864 O OH   . TYR A 1 115 ? 18.431 23.892  34.002 1.00 6.36  ? 115  TYR A OH   1 
ATOM   1865 H H    . TYR A 1 115 ? 17.036 23.232  41.965 1.00 10.90 ? 115  TYR A H    1 
ATOM   1866 H HA   . TYR A 1 115 ? 16.026 22.359  39.539 1.00 9.36  ? 115  TYR A HA   1 
ATOM   1867 H HB2  . TYR A 1 115 ? 17.305 24.435  39.905 1.00 9.09  ? 115  TYR A HB2  1 
ATOM   1868 H HB3  . TYR A 1 115 ? 18.605 23.514  40.051 1.00 9.09  ? 115  TYR A HB3  1 
ATOM   1869 H HD1  . TYR A 1 115 ? 15.980 24.077  37.650 1.00 9.16  ? 115  TYR A HD1  1 
ATOM   1870 H HD2  . TYR A 1 115 ? 19.883 23.138  38.052 1.00 7.05  ? 115  TYR A HD2  1 
ATOM   1871 H HE1  . TYR A 1 115 ? 16.238 24.230  35.373 1.00 8.88  ? 115  TYR A HE1  1 
ATOM   1872 H HE2  . TYR A 1 115 ? 20.163 23.268  35.762 1.00 6.72  ? 115  TYR A HE2  1 
ATOM   1873 H HH   . TYR A 1 115 ? 17.699 24.071  33.630 1.00 9.54  ? 115  TYR A HH   1 
ATOM   1874 N N    . VAL A 1 116 ? 16.927 20.043  39.668 1.00 6.30  ? 116  VAL A N    1 
ATOM   1875 C CA   . VAL A 1 116 ? 17.386 18.674  39.876 1.00 6.11  ? 116  VAL A CA   1 
ATOM   1876 C C    . VAL A 1 116 ? 17.268 17.860  38.603 1.00 5.72  ? 116  VAL A C    1 
ATOM   1877 O O    . VAL A 1 116 ? 16.557 18.209  37.660 1.00 5.52  ? 116  VAL A O    1 
ATOM   1878 C CB   . VAL A 1 116 ? 16.611 18.007  41.033 1.00 7.51  ? 116  VAL A CB   1 
ATOM   1879 C CG1  . VAL A 1 116 ? 16.868 18.734  42.364 1.00 9.51  ? 116  VAL A CG1  1 
ATOM   1880 C CG2  . VAL A 1 116 ? 15.094 17.996  40.712 1.00 9.88  ? 116  VAL A CG2  1 
ATOM   1881 H H    . VAL A 1 116 ? 16.182 20.173  39.218 1.00 7.56  ? 116  VAL A H    1 
ATOM   1882 H HA   . VAL A 1 116 ? 18.352 18.708  40.132 1.00 7.33  ? 116  VAL A HA   1 
ATOM   1883 H HB   . VAL A 1 116 ? 16.924 17.061  41.122 1.00 9.01  ? 116  VAL A HB   1 
ATOM   1884 H HG11 . VAL A 1 116 ? 17.830 18.748  42.548 1.00 14.27 ? 116  VAL A HG11 1 
ATOM   1885 H HG12 . VAL A 1 116 ? 16.533 19.653  42.303 1.00 14.27 ? 116  VAL A HG12 1 
ATOM   1886 H HG13 . VAL A 1 116 ? 16.403 18.265  43.088 1.00 14.27 ? 116  VAL A HG13 1 
ATOM   1887 H HG21 . VAL A 1 116 ? 14.943 17.524  39.866 1.00 14.82 ? 116  VAL A HG21 1 
ATOM   1888 H HG22 . VAL A 1 116 ? 14.611 17.540  41.432 1.00 14.82 ? 116  VAL A HG22 1 
ATOM   1889 H HG23 . VAL A 1 116 ? 14.771 18.918  40.633 1.00 14.82 ? 116  VAL A HG23 1 
ATOM   1890 N N    . PRO A 1 117 ? 17.941 16.704  38.571 1.00 6.17  ? 117  PRO A N    1 
ATOM   1891 C CA   . PRO A 1 117 ? 17.878 15.851  37.365 1.00 5.80  ? 117  PRO A CA   1 
ATOM   1892 C C    . PRO A 1 117 ? 16.481 15.277  37.150 1.00 6.05  ? 117  PRO A C    1 
ATOM   1893 O O    . PRO A 1 117 ? 15.858 14.730  38.073 1.00 6.91  ? 117  PRO A O    1 
ATOM   1894 C CB   . PRO A 1 117 ? 18.902 14.723  37.656 1.00 8.27  ? 117  PRO A CB   1 
ATOM   1895 C CG   . PRO A 1 117 ? 19.842 15.364  38.646 1.00 9.70  ? 117  PRO A CG   1 
ATOM   1896 C CD   . PRO A 1 117 ? 18.917 16.189  39.537 1.00 8.05  ? 117  PRO A CD   1 
ATOM   1897 H HA   . PRO A 1 117 ? 18.162 16.372  36.561 1.00 6.96  ? 117  PRO A HA   1 
ATOM   1898 H HB2  . PRO A 1 117 ? 18.458 13.930  38.047 1.00 9.92  ? 117  PRO A HB2  1 
ATOM   1899 H HB3  . PRO A 1 117 ? 19.381 14.454  36.832 1.00 9.92  ? 117  PRO A HB3  1 
ATOM   1900 H HG2  . PRO A 1 117 ? 20.324 14.678  39.172 1.00 11.65 ? 117  PRO A HG2  1 
ATOM   1901 H HG3  . PRO A 1 117 ? 20.502 15.942  38.187 1.00 11.65 ? 117  PRO A HG3  1 
ATOM   1902 H HD2  . PRO A 1 117 ? 18.482 15.626  40.225 1.00 9.66  ? 117  PRO A HD2  1 
ATOM   1903 H HD3  . PRO A 1 117 ? 19.408 16.926  39.982 1.00 9.66  ? 117  PRO A HD3  1 
ATOM   1904 N N    . VAL A 1 118 ? 16.038 15.340  35.893 1.00 6.66  ? 118  VAL A N    1 
ATOM   1905 C CA   . VAL A 1 118 ? 14.758 14.777  35.481 1.00 7.43  ? 118  VAL A CA   1 
ATOM   1906 C C    . VAL A 1 118 ? 14.874 13.848  34.313 1.00 7.09  ? 118  VAL A C    1 
ATOM   1907 O O    . VAL A 1 118 ? 13.923 13.050  34.047 1.00 9.91  ? 118  VAL A O    1 
ATOM   1908 C CB   . VAL A 1 118 ? 13.726 15.893  35.230 1.00 8.53  ? 118  VAL A CB   1 
ATOM   1909 C CG1  . VAL A 1 118 ? 13.423 16.591  36.565 1.00 9.70  ? 118  VAL A CG1  1 
ATOM   1910 C CG2  . VAL A 1 118 ? 14.107 16.870  34.129 1.00 9.81  ? 118  VAL A CG2  1 
ATOM   1911 H H    . VAL A 1 118 ? 16.538 15.738  35.288 1.00 7.99  ? 118  VAL A H    1 
ATOM   1912 H HA   . VAL A 1 118 ? 14.418 14.235  36.250 1.00 8.91  ? 118  VAL A HA   1 
ATOM   1913 H HB   . VAL A 1 118 ? 12.881 15.445  34.939 1.00 10.24 ? 118  VAL A HB   1 
ATOM   1914 H HG11 . VAL A 1 118 ? 13.174 15.921  37.235 1.00 14.55 ? 118  VAL A HG11 1 
ATOM   1915 H HG12 . VAL A 1 118 ? 14.219 17.075  36.868 1.00 14.55 ? 118  VAL A HG12 1 
ATOM   1916 H HG13 . VAL A 1 118 ? 12.683 17.222  36.443 1.00 14.55 ? 118  VAL A HG13 1 
ATOM   1917 H HG21 . VAL A 1 118 ? 14.275 16.378  33.299 1.00 14.72 ? 118  VAL A HG21 1 
ATOM   1918 H HG22 . VAL A 1 118 ? 13.375 17.506  33.990 1.00 14.72 ? 118  VAL A HG22 1 
ATOM   1919 H HG23 . VAL A 1 118 ? 14.917 17.356  34.391 1.00 14.72 ? 118  VAL A HG23 1 
ATOM   1920 N N    . HIS A 1 119 ? 15.927 13.859  33.512 1.00 7.00  ? 119  HIS A N    1 
ATOM   1921 C CA   . HIS A 1 119 ? 16.075 12.904  32.428 1.00 6.82  ? 119  HIS A CA   1 
ATOM   1922 C C    . HIS A 1 119 ? 17.544 12.498  32.356 1.00 6.51  ? 119  HIS A C    1 
ATOM   1923 O O    . HIS A 1 119 ? 18.427 13.336  32.580 1.00 6.72  ? 119  HIS A O    1 
ATOM   1924 C CB   . HIS A 1 119 ? 15.652 13.336  31.027 1.00 9.73  ? 119  HIS A CB   1 
ATOM   1925 C CG   . HIS A 1 119 ? 14.280 13.808  30.940 1.00 13.41 ? 119  HIS A CG   1 
ATOM   1926 N ND1  . HIS A 1 119 ? 13.221 12.963  31.058 1.00 16.91 ? 119  HIS A ND1  1 
ATOM   1927 C CD2  . HIS A 1 119 ? 13.757 15.079  30.907 1.00 18.29 ? 119  HIS A CD2  1 
ATOM   1928 C CE1  . HIS A 1 119 ? 12.050 13.633  31.025 1.00 21.63 ? 119  HIS A CE1  1 
ATOM   1929 N NE2  . HIS A 1 119 ? 12.349 14.916  30.972 1.00 23.13 ? 119  HIS A NE2  1 
ATOM   1930 H H    . HIS A 1 119 ? 16.556 14.461  33.640 1.00 8.40  ? 119  HIS A H    1 
ATOM   1931 H HA   . HIS A 1 119 ? 15.546 12.090  32.667 1.00 8.19  ? 119  HIS A HA   1 
ATOM   1932 H HB2  . HIS A 1 119 ? 16.257 14.058  30.721 1.00 11.67 ? 119  HIS A HB2  1 
ATOM   1933 H HB3  . HIS A 1 119 ? 15.764 12.570  30.411 1.00 11.67 ? 119  HIS A HB3  1 
ATOM   1934 H HD1  . HIS A 1 119 ? 13.290 12.090  31.144 1.00 20.29 ? 119  HIS A HD1  1 
ATOM   1935 H HD2  . HIS A 1 119 ? 14.238 15.896  30.851 1.00 21.95 ? 119  HIS A HD2  1 
ATOM   1936 H HE1  . HIS A 1 119 ? 11.178 13.255  31.037 1.00 25.96 ? 119  HIS A HE1  1 
ATOM   1937 N N    . PHE A 1 120 ? 17.802 11.262  31.998 1.00 6.65  ? 120  PHE A N    1 
ATOM   1938 C CA   . PHE A 1 120 ? 19.139 10.801  31.608 1.00 6.37  ? 120  PHE A CA   1 
ATOM   1939 C C    . PHE A 1 120 ? 19.281 10.967  30.111 1.00 5.95  ? 120  PHE A C    1 
ATOM   1940 O O    . PHE A 1 120 ? 18.572 10.323  29.360 1.00 8.45  ? 120  PHE A O    1 
ATOM   1941 C CB   . PHE A 1 120 ? 19.382 9.354   32.018 1.00 6.77  ? 120  PHE A CB   1 
ATOM   1942 C CG   . PHE A 1 120 ? 20.838 8.973   31.866 1.00 6.92  ? 120  PHE A CG   1 
ATOM   1943 C CD1  . PHE A 1 120 ? 21.334 8.568   30.655 1.00 7.59  ? 120  PHE A CD1  1 
ATOM   1944 C CD2  . PHE A 1 120 ? 21.686 9.123   32.956 1.00 7.58  ? 120  PHE A CD2  1 
ATOM   1945 C CE1  . PHE A 1 120 ? 22.720 8.343   30.548 1.00 8.68  ? 120  PHE A CE1  1 
ATOM   1946 C CE2  . PHE A 1 120 ? 23.018 8.898   32.861 1.00 8.49  ? 120  PHE A CE2  1 
ATOM   1947 C CZ   . PHE A 1 120 ? 23.559 8.472   31.634 1.00 8.56  ? 120  PHE A CZ   1 
ATOM   1948 H H    . PHE A 1 120 ? 17.141 10.681  31.992 1.00 7.98  ? 120  PHE A H    1 
ATOM   1949 H HA   . PHE A 1 120 ? 19.819 11.379  32.059 1.00 7.65  ? 120  PHE A HA   1 
ATOM   1950 H HB2  . PHE A 1 120 ? 19.107 9.230   32.961 1.00 8.12  ? 120  PHE A HB2  1 
ATOM   1951 H HB3  . PHE A 1 120 ? 18.826 8.757   31.457 1.00 8.12  ? 120  PHE A HB3  1 
ATOM   1952 H HD1  . PHE A 1 120 ? 20.759 8.443   29.908 1.00 9.11  ? 120  PHE A HD1  1 
ATOM   1953 H HD2  . PHE A 1 120 ? 21.321 9.390   33.792 1.00 9.09  ? 120  PHE A HD2  1 
ATOM   1954 H HE1  . PHE A 1 120 ? 23.086 8.096   29.707 1.00 10.42 ? 120  PHE A HE1  1 
ATOM   1955 H HE2  . PHE A 1 120 ? 23.581 9.028   33.615 1.00 10.19 ? 120  PHE A HE2  1 
ATOM   1956 H HZ   . PHE A 1 120 ? 24.485 8.276   31.555 1.00 10.27 ? 120  PHE A HZ   1 
ATOM   1957 N N    . ASP A 1 121 ? 20.129 11.904  29.686 1.00 5.51  ? 121  ASP A N    1 
ATOM   1958 C CA   . ASP A 1 121 ? 20.210 12.248  28.270 1.00 5.68  ? 121  ASP A CA   1 
ATOM   1959 C C    . ASP A 1 121 ? 21.222 11.392  27.524 1.00 6.74  ? 121  ASP A C    1 
ATOM   1960 O O    . ASP A 1 121 ? 20.898 10.928  26.452 1.00 10.75 ? 121  ASP A O    1 
ATOM   1961 C CB   . ASP A 1 121 ? 20.448 13.754  28.091 1.00 6.54  ? 121  ASP A CB   1 
ATOM   1962 C CG   . ASP A 1 121 ? 20.197 14.200  26.646 1.00 6.96  ? 121  ASP A CG   1 
ATOM   1963 O OD1  . ASP A 1 121 ? 19.049 13.965  26.178 1.00 8.93  ? 121  ASP A OD1  1 
ATOM   1964 O OD2  . ASP A 1 121 ? 21.112 14.733  26.003 1.00 6.83  ? 121  ASP A OD2  1 
ATOM   1965 H H    . ASP A 1 121 ? 20.645 12.319  30.265 1.00 6.61  ? 121  ASP A H    1 
ATOM   1966 H HA   . ASP A 1 121 ? 19.314 12.048  27.872 1.00 6.82  ? 121  ASP A HA   1 
ATOM   1967 H HB2  . ASP A 1 121 ? 19.845 14.254  28.697 1.00 7.84  ? 121  ASP A HB2  1 
ATOM   1968 H HB3  . ASP A 1 121 ? 21.381 13.969  28.343 1.00 7.84  ? 121  ASP A HB3  1 
ATOM   1969 N N    . ALA A 1 122 ? 22.425 11.256  28.052 1.00 6.04  ? 122  ALA A N    1 
ATOM   1970 C CA   . ALA A 1 122 ? 23.513 10.666  27.288 1.00 6.96  ? 122  ALA A CA   1 
ATOM   1971 C C    . ALA A 1 122 ? 24.690 10.434  28.231 1.00 6.26  ? 122  ALA A C    1 
ATOM   1972 O O    . ALA A 1 122 ? 24.708 10.907  29.343 1.00 5.99  ? 122  ALA A O    1 
ATOM   1973 C CB   . ALA A 1 122 ? 23.913 11.592  26.153 1.00 11.28 ? 122  ALA A CB   1 
ATOM   1974 H H    . ALA A 1 122 ? 22.570 11.526  28.877 1.00 7.25  ? 122  ALA A H    1 
ATOM   1975 H HA   . ALA A 1 122 ? 23.214 9.790   26.909 1.00 8.35  ? 122  ALA A HA   1 
ATOM   1976 H HB1  . ALA A 1 122 ? 23.148 11.726  25.555 1.00 16.92 ? 122  ALA A HB1  1 
ATOM   1977 H HB2  . ALA A 1 122 ? 24.196 12.456  26.520 1.00 16.92 ? 122  ALA A HB2  1 
ATOM   1978 H HB3  . ALA A 1 122 ? 24.654 11.192  25.651 1.00 16.92 ? 122  ALA A HB3  1 
ATOM   1979 N N    . SER A 1 123 ? 25.721 9.754   27.687 1.00 8.84  ? 123  SER A N    1 
ATOM   1980 C CA   . SER A 1 123 ? 26.999 9.689   28.368 1.00 8.07  ? 123  SER A CA   1 
ATOM   1981 C C    . SER A 1 123 ? 28.062 9.930   27.310 1.00 9.33  ? 123  SER A C    1 
ATOM   1982 O O    . SER A 1 123 ? 27.817 9.721   26.130 1.00 12.09 ? 123  SER A O    1 
ATOM   1983 C CB   . SER A 1 123 ? 27.220 8.399   29.107 1.00 11.84 ? 123  SER A CB   1 
ATOM   1984 O OG   . SER A 1 123 ? 27.274 7.281   28.252 1.00 15.16 ? 123  SER A OG   1 
ATOM   1985 H H    . SER A 1 123 ? 25.618 9.348   26.913 1.00 10.61 ? 123  SER A H    1 
ATOM   1986 H HA   . SER A 1 123 ? 27.040 10.438  29.029 1.00 9.68  ? 123  SER A HA   1 
ATOM   1987 H HB2  . SER A 1 123 ? 28.069 8.459   29.614 1.00 14.21 ? 123  SER A HB2  1 
ATOM   1988 H HB3  . SER A 1 123 ? 26.487 8.271   29.760 1.00 14.21 ? 123  SER A HB3  1 
ATOM   1989 H HG   . SER A 1 123 ? 27.910 7.374   27.710 1.00 22.74 ? 123  SER A HG   1 
ATOM   1990 N N    . VAL A 1 124 ? 29.237 10.354  27.739 1.00 7.80  ? 124  VAL A N    1 
ATOM   1991 C CA   . VAL A 1 124 ? 30.327 10.670  26.847 1.00 9.32  ? 124  VAL A CA   1 
ATOM   1992 C C    . VAL A 1 124 ? 31.647 10.305  27.511 1.00 10.61 ? 124  VAL A C    1 
ATOM   1993 O O    . VAL A 1 124 ? 32.625 10.164  26.754 1.00 17.78 ? 124  VAL A O    1 
ATOM   1994 C CB   . VAL A 1 124 ? 30.275 12.081  26.273 1.00 12.24 ? 124  VAL A CB   1 
ATOM   1995 C CG1  . VAL A 1 124 ? 29.049 12.380  25.417 1.00 29.08 ? 124  VAL A CG1  1 
ATOM   1996 C CG2  . VAL A 1 124 ? 30.456 13.058  27.355 1.00 13.41 ? 124  VAL A CG2  1 
ATOM   1997 O OXT  . VAL A 1 124 ? 31.755 10.312  28.733 1.00 11.94 ? 124  VAL A OXT  1 
ATOM   1998 H H    . VAL A 1 124 ? 29.360 10.448  28.605 1.00 9.36  ? 124  VAL A H    1 
ATOM   1999 H HA   . VAL A 1 124 ? 30.232 10.052  26.067 1.00 11.19 ? 124  VAL A HA   1 
ATOM   2000 H HB   . VAL A 1 124 ? 31.069 12.173  25.672 1.00 14.69 ? 124  VAL A HB   1 
ATOM   2001 H HG11 . VAL A 1 124 ? 28.974 11.708  24.707 1.00 43.62 ? 124  VAL A HG11 1 
ATOM   2002 H HG12 . VAL A 1 124 ? 28.245 12.354  25.977 1.00 43.62 ? 124  VAL A HG12 1 
ATOM   2003 H HG13 . VAL A 1 124 ? 29.139 13.270  25.016 1.00 43.62 ? 124  VAL A HG13 1 
ATOM   2004 H HG21 . VAL A 1 124 ? 31.225 12.798  27.905 1.00 20.11 ? 124  VAL A HG21 1 
ATOM   2005 H HG22 . VAL A 1 124 ? 30.615 13.946  26.970 1.00 20.11 ? 124  VAL A HG22 1 
ATOM   2006 H HG23 . VAL A 1 124 ? 29.650 13.083  27.911 1.00 20.11 ? 124  VAL A HG23 1 
ATOM   2007 N N    . LYS B 1 1   ? 32.475 8.617   42.072 1.00 14.37 ? 1    LYS B N    1 
ATOM   2008 C CA   . LYS B 1 1   ? 32.859 9.360   40.786 1.00 9.57  ? 1    LYS B CA   1 
ATOM   2009 C C    . LYS B 1 1   ? 34.384 9.404   40.725 1.00 9.15  ? 1    LYS B C    1 
ATOM   2010 O O    . LYS B 1 1   ? 35.042 9.156   41.725 1.00 15.42 ? 1    LYS B O    1 
ATOM   2011 C CB   . LYS B 1 1   ? 32.191 10.729  40.907 1.00 9.48  ? 1    LYS B CB   1 
ATOM   2012 C CG   . LYS B 1 1   ? 32.713 11.651  41.879 1.00 11.49 ? 1    LYS B CG   1 
ATOM   2013 C CD   . LYS B 1 1   ? 31.913 12.973  42.004 1.00 14.76 ? 1    LYS B CD   1 
ATOM   2014 C CE   . LYS B 1 1   ? 32.529 13.666  43.221 1.00 11.04 ? 1    LYS B CE   1 
ATOM   2015 N NZ   . LYS B 1 1   ? 31.811 14.858  43.426 1.00 11.15 ? 1    LYS B NZ   1 
ATOM   2016 H H1   . LYS B 1 1   ? 32.833 7.781   42.057 1.00 21.56 ? 1    LYS B H1   1 
ATOM   2017 H H2   . LYS B 1 1   ? 32.796 9.071   42.792 1.00 21.56 ? 1    LYS B H2   1 
ATOM   2018 H H3   . LYS B 1 1   ? 31.569 8.558   42.129 1.00 21.56 ? 1    LYS B H3   1 
ATOM   2019 H HA   . LYS B 1 1   ? 32.499 8.874   39.990 1.00 11.48 ? 1    LYS B HA   1 
ATOM   2020 H HB2  . LYS B 1 1   ? 32.236 11.167  40.020 1.00 11.37 ? 1    LYS B HB2  1 
ATOM   2021 H HB3  . LYS B 1 1   ? 31.234 10.582  41.112 1.00 11.37 ? 1    LYS B HB3  1 
ATOM   2022 H HG2  . LYS B 1 1   ? 32.727 11.205  42.763 1.00 13.79 ? 1    LYS B HG2  1 
ATOM   2023 H HG3  . LYS B 1 1   ? 33.649 11.868  41.639 1.00 13.79 ? 1    LYS B HG3  1 
ATOM   2024 H HD2  . LYS B 1 1   ? 32.018 13.527  41.190 1.00 17.72 ? 1    LYS B HD2  1 
ATOM   2025 H HD3  . LYS B 1 1   ? 30.951 12.792  42.149 1.00 17.72 ? 1    LYS B HD3  1 
ATOM   2026 H HE2  . LYS B 1 1   ? 32.462 13.084  44.019 1.00 13.25 ? 1    LYS B HE2  1 
ATOM   2027 H HE3  . LYS B 1 1   ? 33.485 13.866  43.056 1.00 13.25 ? 1    LYS B HE3  1 
ATOM   2028 H HZ1  . LYS B 1 1   ? 30.931 14.663  43.554 1.00 16.72 ? 1    LYS B HZ1  1 
ATOM   2029 H HZ2  . LYS B 1 1   ? 32.137 15.286  44.160 1.00 16.72 ? 1    LYS B HZ2  1 
ATOM   2030 H HZ3  . LYS B 1 1   ? 31.899 15.395  42.697 1.00 16.72 ? 1    LYS B HZ3  1 
ATOM   2031 N N    . GLU B 1 2   ? 34.920 9.792   39.545 1.00 6.52  ? 2    GLU B N    1 
ATOM   2032 C CA   . GLU B 1 2   ? 36.376 9.834   39.372 1.00 7.39  ? 2    GLU B CA   1 
ATOM   2033 C C    . GLU B 1 2   ? 36.766 11.160  38.652 1.00 7.79  ? 2    GLU B C    1 
ATOM   2034 O O    . GLU B 1 2   ? 36.367 11.449  37.539 1.00 7.57  ? 2    GLU B O    1 
ATOM   2035 C CB   . GLU B 1 2   ? 36.856 8.621   38.588 1.00 6.86  ? 2    GLU B CB   1 
ATOM   2036 C CG   . GLU B 1 2   ? 38.395 8.556   38.602 1.00 8.52  ? 2    GLU B CG   1 
ATOM   2037 C CD   . GLU B 1 2   ? 38.921 7.290   37.955 1.00 8.48  ? 2    GLU B CD   1 
ATOM   2038 O OE1  . GLU B 1 2   ? 38.625 7.102   36.735 1.00 10.22 ? 2    GLU B OE1  1 
ATOM   2039 O OE2  . GLU B 1 2   ? 39.709 6.556   38.562 1.00 8.95  ? 2    GLU B OE2  1 
ATOM   2040 H H    . GLU B 1 2   ? 34.394 10.021  38.878 1.00 7.83  ? 2    GLU B H    1 
ATOM   2041 H HA   . GLU B 1 2   ? 36.806 9.821   40.275 1.00 8.86  ? 2    GLU B HA   1 
ATOM   2042 H HB2  . GLU B 1 2   ? 36.485 7.797   38.990 1.00 8.23  ? 2    GLU B HB2  1 
ATOM   2043 H HB3  . GLU B 1 2   ? 36.534 8.681   37.654 1.00 8.23  ? 2    GLU B HB3  1 
ATOM   2044 H HG2  . GLU B 1 2   ? 38.758 9.342   38.121 1.00 10.23 ? 2    GLU B HG2  1 
ATOM   2045 H HG3  . GLU B 1 2   ? 38.714 8.599   39.538 1.00 10.23 ? 2    GLU B HG3  1 
ATOM   2046 N N    . THR B 1 3   ? 37.614 11.908  39.404 1.00 9.32  ? 3    THR B N    1 
ATOM   2047 C CA   . THR B 1 3   ? 38.178 13.102  38.808 1.00 9.89  ? 3    THR B CA   1 
ATOM   2048 C C    . THR B 1 3   ? 39.305 12.737  37.843 1.00 9.66  ? 3    THR B C    1 
ATOM   2049 O O    . THR B 1 3   ? 39.896 11.644  37.966 1.00 7.78  ? 3    THR B O    1 
ATOM   2050 C CB   . THR B 1 3   ? 38.719 14.098  39.857 1.00 13.07 ? 3    THR B CB   1 
ATOM   2051 O OG1  . THR B 1 3   ? 39.865 13.460  40.409 1.00 14.03 ? 3    THR B OG1  1 
ATOM   2052 C CG2  . THR B 1 3   ? 37.692 14.392  40.949 1.00 17.31 ? 3    THR B CG2  1 
ATOM   2053 H H    . THR B 1 3   ? 37.815 11.674  40.228 1.00 11.18 ? 3    THR B H    1 
ATOM   2054 H HA   . THR B 1 3   ? 37.458 13.560  38.287 1.00 11.86 ? 3    THR B HA   1 
ATOM   2055 H HB   . THR B 1 3   ? 38.989 14.949  39.408 1.00 15.68 ? 3    THR B HB   1 
ATOM   2056 H HG1  . THR B 1 3   ? 40.427 13.317  39.801 1.00 21.05 ? 3    THR B HG1  1 
ATOM   2057 H HG21 . THR B 1 3   ? 37.447 13.557  41.401 1.00 25.96 ? 3    THR B HG21 1 
ATOM   2058 H HG22 . THR B 1 3   ? 38.076 15.015  41.600 1.00 25.96 ? 3    THR B HG22 1 
ATOM   2059 H HG23 . THR B 1 3   ? 36.892 14.791  40.546 1.00 25.96 ? 3    THR B HG23 1 
ATOM   2060 N N    . ALA B 1 4   ? 39.692 13.692  36.990 1.00 10.99 ? 4    ALA B N    1 
ATOM   2061 C CA   . ALA B 1 4   ? 40.821 13.390  36.117 1.00 10.81 ? 4    ALA B CA   1 
ATOM   2062 C C    . ALA B 1 4   ? 42.097 13.138  36.990 1.00 9.19  ? 4    ALA B C    1 
ATOM   2063 O O    . ALA B 1 4   ? 42.906 12.291  36.532 1.00 8.08  ? 4    ALA B O    1 
ATOM   2064 C CB   . ALA B 1 4   ? 41.046 14.523  35.108 1.00 13.96 ? 4    ALA B CB   1 
ATOM   2065 H H    . ALA B 1 4   ? 39.283 14.470  36.956 1.00 13.19 ? 4    ALA B H    1 
ATOM   2066 H HA   . ALA B 1 4   ? 40.613 12.552  35.611 1.00 12.97 ? 4    ALA B HA   1 
ATOM   2067 H HB1  . ALA B 1 4   ? 41.278 15.346  35.587 1.00 20.94 ? 4    ALA B HB1  1 
ATOM   2068 H HB2  . ALA B 1 4   ? 40.227 14.667  34.589 1.00 20.94 ? 4    ALA B HB2  1 
ATOM   2069 H HB3  . ALA B 1 4   ? 41.778 14.281  34.503 1.00 20.94 ? 4    ALA B HB3  1 
ATOM   2070 N N    . ALA B 1 5   ? 42.309 13.847  38.034 1.00 9.14  ? 5    ALA B N    1 
ATOM   2071 C CA   . ALA B 1 5   ? 43.513 13.637  38.844 1.00 8.65  ? 5    ALA B CA   1 
ATOM   2072 C C    . ALA B 1 5   ? 43.504 12.224  39.401 1.00 7.51  ? 5    ALA B C    1 
ATOM   2073 O O    . ALA B 1 5   ? 44.559 11.549  39.468 1.00 6.31  ? 5    ALA B O    1 
ATOM   2074 C CB   . ALA B 1 5   ? 43.580 14.671  39.919 1.00 11.30 ? 5    ALA B CB   1 
ATOM   2075 H H    . ALA B 1 5   ? 41.728 14.465  38.267 1.00 10.97 ? 5    ALA B H    1 
ATOM   2076 H HA   . ALA B 1 5   ? 44.314 13.740  38.254 1.00 10.39 ? 5    ALA B HA   1 
ATOM   2077 H HB1  . ALA B 1 5   ? 43.577 15.564  39.514 1.00 16.95 ? 5    ALA B HB1  1 
ATOM   2078 H HB2  . ALA B 1 5   ? 42.805 14.578  40.511 1.00 16.95 ? 5    ALA B HB2  1 
ATOM   2079 H HB3  . ALA B 1 5   ? 44.403 14.551  40.437 1.00 16.95 ? 5    ALA B HB3  1 
ATOM   2080 N N    . ALA B 1 6   ? 42.356 11.751  39.889 1.00 7.90  ? 6    ALA B N    1 
ATOM   2081 C CA   . ALA B 1 6   ? 42.248 10.432  40.400 1.00 7.25  ? 6    ALA B CA   1 
ATOM   2082 C C    . ALA B 1 6   ? 42.432 9.353   39.326 1.00 5.94  ? 6    ALA B C    1 
ATOM   2083 O O    . ALA B 1 6   ? 43.045 8.312   39.578 1.00 6.37  ? 6    ALA B O    1 
ATOM   2084 C CB   . ALA B 1 6   ? 40.925 10.232  41.136 1.00 9.09  ? 6    ALA B CB   1 
ATOM   2085 H H    . ALA B 1 6   ? 41.647 12.271  39.895 1.00 9.48  ? 6    ALA B H    1 
ATOM   2086 H HA   . ALA B 1 6   ? 42.981 10.312  41.069 1.00 8.71  ? 6    ALA B HA   1 
ATOM   2087 H HB1  . ALA B 1 6   ? 40.184 10.295  40.498 1.00 13.64 ? 6    ALA B HB1  1 
ATOM   2088 H HB2  . ALA B 1 6   ? 40.918 9.348   41.559 1.00 13.64 ? 6    ALA B HB2  1 
ATOM   2089 H HB3  . ALA B 1 6   ? 40.825 10.924  41.823 1.00 13.64 ? 6    ALA B HB3  1 
ATOM   2090 N N    . LYS B 1 7   ? 41.919 9.622   38.150 1.00 5.71  ? 7    LYS B N    1 
ATOM   2091 C CA   . LYS B 1 7   ? 42.116 8.704   37.043 1.00 5.58  ? 7    LYS B CA   1 
ATOM   2092 C C    . LYS B 1 7   ? 43.602 8.559   36.729 1.00 5.03  ? 7    LYS B C    1 
ATOM   2093 O O    . LYS B 1 7   ? 44.071 7.458   36.451 1.00 5.21  ? 7    LYS B O    1 
ATOM   2094 C CB   . LYS B 1 7   ? 41.341 9.225   35.800 1.00 7.11  ? 7    LYS B CB   1 
ATOM   2095 C CG   . LYS B 1 7   ? 41.586 8.385   34.545 1.00 9.86  ? 7    LYS B CG   1 
ATOM   2096 C CD   . LYS B 1 7   ? 40.819 8.853   33.305 1.00 12.11 ? 7    LYS B CD   1 
ATOM   2097 C CE   . LYS B 1 7   ? 41.042 8.075   32.056 1.00 16.46 ? 7    LYS B CE   1 
ATOM   2098 N NZ   . LYS B 1 7   ? 40.250 8.545   30.914 1.00 31.98 ? 7    LYS B NZ   1 
ATOM   2099 H H    . LYS B 1 7   ? 41.455 10.360  38.031 1.00 6.86  ? 7    LYS B H    1 
ATOM   2100 H HA   . LYS B 1 7   ? 41.752 7.808   37.298 1.00 6.70  ? 7    LYS B HA   1 
ATOM   2101 H HB2  . LYS B 1 7   ? 40.372 9.225   36.002 1.00 8.54  ? 7    LYS B HB2  1 
ATOM   2102 H HB3  . LYS B 1 7   ? 41.612 10.159  35.619 1.00 8.54  ? 7    LYS B HB3  1 
ATOM   2103 H HG2  . LYS B 1 7   ? 42.555 8.398   34.341 1.00 11.83 ? 7    LYS B HG2  1 
ATOM   2104 H HG3  . LYS B 1 7   ? 41.334 7.447   34.738 1.00 11.83 ? 7    LYS B HG3  1 
ATOM   2105 H HD2  . LYS B 1 7   ? 39.852 8.832   33.514 1.00 14.53 ? 7    LYS B HD2  1 
ATOM   2106 H HD3  . LYS B 1 7   ? 41.063 9.796   33.129 1.00 14.53 ? 7    LYS B HD3  1 
ATOM   2107 H HE2  . LYS B 1 7   ? 42.002 8.122   31.818 1.00 19.75 ? 7    LYS B HE2  1 
ATOM   2108 H HE3  . LYS B 1 7   ? 40.821 7.126   32.228 1.00 19.75 ? 7    LYS B HE3  1 
ATOM   2109 H HZ1  . LYS B 1 7   ? 39.368 8.547   31.138 1.00 47.97 ? 7    LYS B HZ1  1 
ATOM   2110 H HZ2  . LYS B 1 7   ? 40.509 9.388   30.692 1.00 47.97 ? 7    LYS B HZ2  1 
ATOM   2111 H HZ3  . LYS B 1 7   ? 40.382 7.990   30.205 1.00 47.97 ? 7    LYS B HZ3  1 
ATOM   2112 N N    . PHE B 1 8   ? 44.352 9.657   36.781 1.00 5.00  ? 8    PHE B N    1 
ATOM   2113 C CA   . PHE B 1 8   ? 45.789 9.547   36.564 1.00 4.59  ? 8    PHE B CA   1 
ATOM   2114 C C    . PHE B 1 8   ? 46.452 8.666   37.613 1.00 4.33  ? 8    PHE B C    1 
ATOM   2115 O O    . PHE B 1 8   ? 47.302 7.834   37.296 1.00 4.50  ? 8    PHE B O    1 
ATOM   2116 C CB   . PHE B 1 8   ? 46.413 10.962  36.568 1.00 4.85  ? 8    PHE B CB   1 
ATOM   2117 C CG   . PHE B 1 8   ? 47.914 10.923  36.451 1.00 4.20  ? 8    PHE B CG   1 
ATOM   2118 C CD1  . PHE B 1 8   ? 48.709 10.810  37.601 1.00 4.49  ? 8    PHE B CD1  1 
ATOM   2119 C CD2  . PHE B 1 8   ? 48.550 10.956  35.225 1.00 4.62  ? 8    PHE B CD2  1 
ATOM   2120 C CE1  . PHE B 1 8   ? 50.086 10.712  37.502 1.00 4.17  ? 8    PHE B CE1  1 
ATOM   2121 C CE2  . PHE B 1 8   ? 49.935 10.875  35.119 1.00 4.88  ? 8    PHE B CE2  1 
ATOM   2122 C CZ   . PHE B 1 8   ? 50.712 10.729  36.254 1.00 4.55  ? 8    PHE B CZ   1 
ATOM   2123 H H    . PHE B 1 8   ? 43.984 10.440  36.944 1.00 6.00  ? 8    PHE B H    1 
ATOM   2124 H HA   . PHE B 1 8   ? 45.942 9.136   35.665 1.00 5.51  ? 8    PHE B HA   1 
ATOM   2125 H HB2  . PHE B 1 8   ? 46.041 11.483  35.812 1.00 5.82  ? 8    PHE B HB2  1 
ATOM   2126 H HB3  . PHE B 1 8   ? 46.164 11.424  37.407 1.00 5.82  ? 8    PHE B HB3  1 
ATOM   2127 H HD1  . PHE B 1 8   ? 48.298 10.802  38.458 1.00 5.39  ? 8    PHE B HD1  1 
ATOM   2128 H HD2  . PHE B 1 8   ? 48.029 11.037  34.434 1.00 5.54  ? 8    PHE B HD2  1 
ATOM   2129 H HE1  . PHE B 1 8   ? 50.611 10.632  38.290 1.00 5.00  ? 8    PHE B HE1  1 
ATOM   2130 H HE2  . PHE B 1 8   ? 50.348 10.919  34.265 1.00 5.85  ? 8    PHE B HE2  1 
ATOM   2131 H HZ   . PHE B 1 8   ? 51.655 10.642  36.185 1.00 5.46  ? 8    PHE B HZ   1 
ATOM   2132 N N    . GLU B 1 9   ? 46.066 8.838   38.887 1.00 4.45  ? 9    GLU B N    1 
ATOM   2133 C CA   . GLU B 1 9   ? 46.613 7.992   39.920 1.00 4.96  ? 9    GLU B CA   1 
ATOM   2134 C C    . GLU B 1 9   ? 46.314 6.513   39.672 1.00 4.73  ? 9    GLU B C    1 
ATOM   2135 O O    . GLU B 1 9   ? 47.189 5.637   39.815 1.00 5.03  ? 9    GLU B O    1 
ATOM   2136 C CB   . GLU B 1 9   ? 46.135 8.422   41.318 1.00 6.01  ? 9    GLU B CB   1 
ATOM   2137 C CG   A GLU B 1 9   ? 46.641 9.843   41.642 0.45 5.41  ? 9    GLU B CG   1 
ATOM   2138 C CG   B GLU B 1 9   ? 46.427 9.810   41.788 0.34 6.75  ? 9    GLU B CG   1 
ATOM   2139 C CG   C GLU B 1 9   ? 47.095 7.783   42.388 0.21 6.72  ? 9    GLU B CG   1 
ATOM   2140 C CD   A GLU B 1 9   ? 46.436 10.197  43.060 0.45 6.79  ? 9    GLU B CD   1 
ATOM   2141 C CD   B GLU B 1 9   ? 45.624 10.470  42.886 0.34 7.47  ? 9    GLU B CD   1 
ATOM   2142 C CD   C GLU B 1 9   ? 46.932 8.026   43.861 0.21 7.00  ? 9    GLU B CD   1 
ATOM   2143 O OE1  A GLU B 1 9   ? 46.511 9.290   43.944 0.45 9.10  ? 9    GLU B OE1  1 
ATOM   2144 O OE1  B GLU B 1 9   ? 44.676 9.852   43.384 0.34 11.73 ? 9    GLU B OE1  1 
ATOM   2145 O OE1  C GLU B 1 9   ? 45.912 8.447   44.418 0.21 13.61 ? 9    GLU B OE1  1 
ATOM   2146 O OE2  A GLU B 1 9   ? 46.147 11.411  43.335 0.45 7.06  ? 9    GLU B OE2  1 
ATOM   2147 O OE2  B GLU B 1 9   ? 45.966 11.633  43.270 0.34 10.12 ? 9    GLU B OE2  1 
ATOM   2148 O OE2  C GLU B 1 9   ? 47.859 7.823   44.701 0.21 8.20  ? 9    GLU B OE2  1 
ATOM   2149 H H    . GLU B 1 9   ? 45.481 9.463   39.091 1.00 5.34  ? 9    GLU B H    1 
ATOM   2150 H HA   . GLU B 1 9   ? 47.606 8.102   39.898 1.00 5.96  ? 9    GLU B HA   1 
ATOM   2151 H HB2  A GLU B 1 9   ? 45.145 8.406   41.351 1.00 7.21  ? 9    GLU B HB2  1 
ATOM   2152 H HB3  A GLU B 1 9   ? 46.475 7.785   41.996 1.00 7.21  ? 9    GLU B HB3  1 
ATOM   2153 H HG2  A GLU B 1 9   ? 47.606 9.901   41.428 0.45 6.49  ? 9    GLU B HG2  1 
ATOM   2154 H HG2  B GLU B 1 9   ? 47.373 9.821   42.079 0.34 8.10  ? 9    GLU B HG2  1 
ATOM   2155 H HG2  C GLU B 1 9   ? 47.058 6.803   42.255 0.21 8.07  ? 9    GLU B HG2  1 
ATOM   2156 H HG3  A GLU B 1 9   ? 46.164 10.496  41.071 0.45 6.49  ? 9    GLU B HG3  1 
ATOM   2157 H HG3  B GLU B 1 9   ? 46.367 10.400  40.995 0.34 8.10  ? 9    GLU B HG3  1 
ATOM   2158 H HG3  C GLU B 1 9   ? 48.014 8.066   42.152 0.21 8.07  ? 9    GLU B HG3  1 
ATOM   2159 N N    . ARG B 1 10  ? 45.066 6.209   39.310 1.00 4.60  ? 10   ARG B N    1 
ATOM   2160 C CA   . ARG B 1 10  ? 44.675 4.808   39.064 1.00 4.67  ? 10   ARG B CA   1 
ATOM   2161 C C    . ARG B 1 10  ? 45.405 4.230   37.872 1.00 4.33  ? 10   ARG B C    1 
ATOM   2162 O O    . ARG B 1 10  ? 45.848 3.079   37.880 1.00 4.88  ? 10   ARG B O    1 
ATOM   2163 C CB   . ARG B 1 10  ? 43.159 4.756   38.816 1.00 5.33  ? 10   ARG B CB   1 
ATOM   2164 C CG   . ARG B 1 10  ? 42.703 3.360   38.392 1.00 5.41  ? 10   ARG B CG   1 
ATOM   2165 C CD   . ARG B 1 10  ? 41.190 3.268   38.266 1.00 6.55  ? 10   ARG B CD   1 
ATOM   2166 N NE   . ARG B 1 10  ? 40.604 4.210   37.338 1.00 6.68  ? 10   ARG B NE   1 
ATOM   2167 C CZ   . ARG B 1 10  ? 40.468 4.018   36.037 1.00 7.56  ? 10   ARG B CZ   1 
ATOM   2168 N NH1  . ARG B 1 10  ? 40.929 2.944   35.429 1.00 8.80  ? 10   ARG B NH1  1 
ATOM   2169 N NH2  . ARG B 1 10  ? 39.879 4.951   35.309 1.00 10.00 ? 10   ARG B NH2  1 
ATOM   2170 H H    . ARG B 1 10  ? 44.470 6.850   39.217 1.00 5.51  ? 10   ARG B H    1 
ATOM   2171 H HA   . ARG B 1 10  ? 44.892 4.262   39.874 1.00 5.61  ? 10   ARG B HA   1 
ATOM   2172 H HB2  . ARG B 1 10  ? 42.683 5.017   39.644 1.00 6.40  ? 10   ARG B HB2  1 
ATOM   2173 H HB3  . ARG B 1 10  ? 42.921 5.406   38.109 1.00 6.40  ? 10   ARG B HB3  1 
ATOM   2174 H HG2  . ARG B 1 10  ? 43.117 3.133   37.522 1.00 6.49  ? 10   ARG B HG2  1 
ATOM   2175 H HG3  . ARG B 1 10  ? 43.015 2.699   39.060 1.00 6.49  ? 10   ARG B HG3  1 
ATOM   2176 H HD2  . ARG B 1 10  ? 40.953 2.352   37.977 1.00 7.86  ? 10   ARG B HD2  1 
ATOM   2177 H HD3  . ARG B 1 10  ? 40.789 3.414   39.159 1.00 7.86  ? 10   ARG B HD3  1 
ATOM   2178 H HE   . ARG B 1 10  ? 40.314 4.974   37.666 1.00 8.02  ? 10   ARG B HE   1 
ATOM   2179 H HH11 . ARG B 1 10  ? 41.345 2.321   35.890 1.00 10.56 ? 10   ARG B HH11 1 
ATOM   2180 H HH12 . ARG B 1 10  ? 40.820 2.849   34.561 1.00 10.56 ? 10   ARG B HH12 1 
ATOM   2181 H HH21 . ARG B 1 10  ? 39.564 5.676   35.694 1.00 12.00 ? 10   ARG B HH21 1 
ATOM   2182 H HH22 . ARG B 1 10  ? 39.801 4.846   34.438 1.00 12.00 ? 10   ARG B HH22 1 
ATOM   2183 N N    . GLN B 1 11  ? 45.481 4.993   36.770 1.00 4.26  ? 11   GLN B N    1 
ATOM   2184 C CA   . GLN B 1 11  ? 46.058 4.436   35.565 1.00 4.54  ? 11   GLN B CA   1 
ATOM   2185 C C    . GLN B 1 11  ? 47.611 4.390   35.600 1.00 4.43  ? 11   GLN B C    1 
ATOM   2186 O O    . GLN B 1 11  ? 48.186 3.554   34.925 1.00 5.50  ? 11   GLN B O    1 
ATOM   2187 C CB   . GLN B 1 11  ? 45.681 5.227   34.312 1.00 5.66  ? 11   GLN B CB   1 
ATOM   2188 C CG   . GLN B 1 11  ? 44.188 5.214   34.009 1.00 6.86  ? 11   GLN B CG   1 
ATOM   2189 C CD   . GLN B 1 11  ? 44.006 5.715   32.574 1.00 8.27  ? 11   GLN B CD   1 
ATOM   2190 O OE1  . GLN B 1 11  ? 43.737 4.920   31.663 1.00 11.77 ? 11   GLN B OE1  1 
ATOM   2191 N NE2  . GLN B 1 11  ? 44.278 6.944   32.324 1.00 10.09 ? 11   GLN B NE2  1 
ATOM   2192 H H    . GLN B 1 11  ? 45.184 5.821   36.780 1.00 5.11  ? 11   GLN B H    1 
ATOM   2193 H HA   . GLN B 1 11  ? 45.719 3.501   35.459 1.00 5.44  ? 11   GLN B HA   1 
ATOM   2194 H HB2  . GLN B 1 11  ? 45.977 6.165   34.424 1.00 6.79  ? 11   GLN B HB2  1 
ATOM   2195 H HB3  . GLN B 1 11  ? 46.168 4.849   33.537 1.00 6.79  ? 11   GLN B HB3  1 
ATOM   2196 H HG2  . GLN B 1 11  ? 43.828 4.296   34.099 1.00 8.24  ? 11   GLN B HG2  1 
ATOM   2197 H HG3  . GLN B 1 11  ? 43.705 5.804   34.641 1.00 8.24  ? 11   GLN B HG3  1 
ATOM   2198 H HE21 . GLN B 1 11  ? 44.467 7.495   32.983 1.00 12.10 ? 11   GLN B HE21 1 
ATOM   2199 H HE22 . GLN B 1 11  ? 44.276 7.234   31.494 1.00 12.10 ? 11   GLN B HE22 1 
ATOM   2200 N N    . HIS B 1 12  ? 48.221 5.333   36.316 1.00 3.87  ? 12   HIS B N    1 
ATOM   2201 C CA   . HIS B 1 12  ? 49.646 5.543   36.099 1.00 4.12  ? 12   HIS B CA   1 
ATOM   2202 C C    . HIS B 1 12  ? 50.536 5.527   37.319 1.00 4.48  ? 12   HIS B C    1 
ATOM   2203 O O    . HIS B 1 12  ? 51.740 5.577   37.130 1.00 6.42  ? 12   HIS B O    1 
ATOM   2204 C CB   . HIS B 1 12  ? 49.872 6.899   35.352 1.00 4.72  ? 12   HIS B CB   1 
ATOM   2205 C CG   . HIS B 1 12  ? 49.232 6.895   34.008 1.00 4.53  ? 12   HIS B CG   1 
ATOM   2206 N ND1  . HIS B 1 12  ? 49.613 6.036   33.001 1.00 4.62  ? 12   HIS B ND1  1 
ATOM   2207 C CD2  . HIS B 1 12  ? 48.238 7.650   33.547 1.00 5.74  ? 12   HIS B CD2  1 
ATOM   2208 C CE1  . HIS B 1 12  ? 48.844 6.268   31.966 1.00 5.48  ? 12   HIS B CE1  1 
ATOM   2209 N NE2  . HIS B 1 12  ? 48.020 7.254   32.239 1.00 6.45  ? 12   HIS B NE2  1 
ATOM   2210 H H    . HIS B 1 12  ? 47.776 5.814   36.903 1.00 4.65  ? 12   HIS B H    1 
ATOM   2211 H HA   . HIS B 1 12  ? 49.963 4.815   35.492 1.00 4.95  ? 12   HIS B HA   1 
ATOM   2212 H HB2  . HIS B 1 12  ? 49.495 7.638   35.892 1.00 5.66  ? 12   HIS B HB2  1 
ATOM   2213 H HB3  . HIS B 1 12  ? 50.844 7.059   35.251 1.00 5.66  ? 12   HIS B HB3  1 
ATOM   2214 H HD1  . HIS B 1 12  ? 50.258 5.438   33.045 1.00 5.55  ? 12   HIS B HD1  1 
ATOM   2215 H HD2  . HIS B 1 12  ? 47.771 8.328   34.022 1.00 6.89  ? 12   HIS B HD2  1 
ATOM   2216 H HE1  . HIS B 1 12  ? 48.877 5.795   31.143 1.00 6.57  ? 12   HIS B HE1  1 
ATOM   2217 N N    . MET B 1 13  ? 49.991 5.510   38.531 1.00 4.03  ? 13   MET B N    1 
ATOM   2218 C CA   . MET B 1 13  ? 50.863 5.531   39.707 1.00 3.85  ? 13   MET B CA   1 
ATOM   2219 C C    . MET B 1 13  ? 50.908 4.149   40.361 1.00 3.69  ? 13   MET B C    1 
ATOM   2220 O O    . MET B 1 13  ? 49.872 3.567   40.685 1.00 4.87  ? 13   MET B O    1 
ATOM   2221 C CB   . MET B 1 13  ? 50.336 6.536   40.736 1.00 4.23  ? 13   MET B CB   1 
ATOM   2222 C CG   . MET B 1 13  ? 50.467 7.970   40.300 1.00 4.65  ? 13   MET B CG   1 
ATOM   2223 S SD   . MET B 1 13  ? 52.162 8.536   40.005 1.00 5.04  ? 13   MET B SD   1 
ATOM   2224 C CE   . MET B 1 13  ? 52.915 8.065   41.571 1.00 6.47  ? 13   MET B CE   1 
ATOM   2225 H H    . MET B 1 13  ? 49.116 5.486   38.625 1.00 4.83  ? 13   MET B H    1 
ATOM   2226 H HA   . MET B 1 13  ? 51.786 5.795   39.429 1.00 4.62  ? 13   MET B HA   1 
ATOM   2227 H HB2  . MET B 1 13  ? 49.382 6.342   40.914 1.00 5.08  ? 13   MET B HB2  1 
ATOM   2228 H HB3  . MET B 1 13  ? 50.831 6.414   41.585 1.00 5.08  ? 13   MET B HB3  1 
ATOM   2229 H HG2  . MET B 1 13  ? 49.946 8.093   39.468 1.00 5.58  ? 13   MET B HG2  1 
ATOM   2230 H HG3  . MET B 1 13  ? 50.060 8.547   40.994 1.00 5.58  ? 13   MET B HG3  1 
ATOM   2231 H HE1  . MET B 1 13  ? 52.459 8.526   42.305 1.00 9.71  ? 13   MET B HE1  1 
ATOM   2232 H HE2  . MET B 1 13  ? 52.834 7.096   41.694 1.00 9.71  ? 13   MET B HE2  1 
ATOM   2233 H HE3  . MET B 1 13  ? 53.863 8.315   41.566 1.00 9.71  ? 13   MET B HE3  1 
ATOM   2234 N N    . ASP B 1 14  ? 52.124 3.677   40.634 1.00 3.57  ? 14   ASP B N    1 
ATOM   2235 C CA   . ASP B 1 14  ? 52.265 2.537   41.518 1.00 3.55  ? 14   ASP B CA   1 
ATOM   2236 C C    . ASP B 1 14  ? 53.538 2.691   42.352 1.00 3.45  ? 14   ASP B C    1 
ATOM   2237 O O    . ASP B 1 14  ? 54.599 2.140   42.062 1.00 3.68  ? 14   ASP B O    1 
ATOM   2238 C CB   . ASP B 1 14  ? 52.246 1.192   40.813 1.00 3.84  ? 14   ASP B CB   1 
ATOM   2239 C CG   . ASP B 1 14  ? 52.295 0.040   41.835 1.00 3.73  ? 14   ASP B CG   1 
ATOM   2240 O OD1  . ASP B 1 14  ? 52.162 0.331   43.052 1.00 4.42  ? 14   ASP B OD1  1 
ATOM   2241 O OD2  . ASP B 1 14  ? 52.436 -1.133  41.394 1.00 4.52  ? 14   ASP B OD2  1 
ATOM   2242 H H    . ASP B 1 14  ? 52.836 4.055   40.281 1.00 4.28  ? 14   ASP B H    1 
ATOM   2243 H HA   . ASP B 1 14  ? 51.490 2.552   42.150 1.00 4.26  ? 14   ASP B HA   1 
ATOM   2244 H HB2  . ASP B 1 14  ? 51.423 1.116   40.268 1.00 4.61  ? 14   ASP B HB2  1 
ATOM   2245 H HB3  . ASP B 1 14  ? 53.024 1.127   40.204 1.00 4.61  ? 14   ASP B HB3  1 
ATOM   2246 N N    . SER B 1 15  ? 53.393 3.473   43.419 1.00 3.99  ? 15   SER B N    1 
ATOM   2247 C CA   . SER B 1 15  ? 54.467 3.731   44.331 1.00 4.72  ? 15   SER B CA   1 
ATOM   2248 C C    . SER B 1 15  ? 54.785 2.542   45.240 1.00 4.86  ? 15   SER B C    1 
ATOM   2249 O O    . SER B 1 15  ? 55.715 2.613   46.042 1.00 6.40  ? 15   SER B O    1 
ATOM   2250 C CB   A SER B 1 15  ? 54.313 4.940   45.209 0.64 6.79  ? 15   SER B CB   1 
ATOM   2251 C CB   B SER B 1 15  ? 53.925 4.894   45.246 0.36 4.44  ? 15   SER B CB   1 
ATOM   2252 O OG   A SER B 1 15  ? 53.201 4.698   46.041 0.64 10.74 ? 15   SER B OG   1 
ATOM   2253 O OG   B SER B 1 15  ? 53.446 6.031   44.507 0.36 4.79  ? 15   SER B OG   1 
ATOM   2254 H H    . SER B 1 15  ? 52.609 3.844   43.569 1.00 4.78  ? 15   SER B H    1 
ATOM   2255 H HA   A SER B 1 15  ? 55.282 3.888   43.773 1.00 5.66  ? 15   SER B HA   1 
ATOM   2256 H HB2  A SER B 1 15  ? 55.128 5.077   45.753 0.64 8.15  ? 15   SER B HB2  1 
ATOM   2257 H HB2  B SER B 1 15  ? 53.188 4.543   45.806 0.36 5.33  ? 15   SER B HB2  1 
ATOM   2258 H HB3  A SER B 1 15  ? 54.161 5.749   44.658 0.64 8.15  ? 15   SER B HB3  1 
ATOM   2259 H HB3  B SER B 1 15  ? 54.650 5.188   45.852 0.36 5.33  ? 15   SER B HB3  1 
ATOM   2260 H HG   A SER B 1 15  ? 52.529 4.523   45.567 0.64 16.11 ? 15   SER B HG   1 
ATOM   2261 H HG   B SER B 1 15  ? 54.004 6.233   43.912 0.36 7.19  ? 15   SER B HG   1 
ATOM   2262 N N    . SER B 1 16  ? 54.007 1.451   45.131 1.00 4.41  ? 16   SER B N    1 
ATOM   2263 C CA   . SER B 1 16  ? 54.078 0.326   46.068 1.00 4.63  ? 16   SER B CA   1 
ATOM   2264 C C    . SER B 1 16  ? 55.110 -0.725  45.699 1.00 4.24  ? 16   SER B C    1 
ATOM   2265 O O    . SER B 1 16  ? 55.262 -1.717  46.422 1.00 5.17  ? 16   SER B O    1 
ATOM   2266 C CB   . SER B 1 16  ? 52.719 -0.319  46.246 1.00 5.92  ? 16   SER B CB   1 
ATOM   2267 O OG   . SER B 1 16  ? 52.394 -1.209  45.207 1.00 5.86  ? 16   SER B OG   1 
ATOM   2268 H H    . SER B 1 16  ? 53.430 1.410   44.468 1.00 5.29  ? 16   SER B H    1 
ATOM   2269 H HA   . SER B 1 16  ? 54.344 0.701   46.957 1.00 5.55  ? 16   SER B HA   1 
ATOM   2270 H HB2  . SER B 1 16  ? 52.705 -0.808  47.106 1.00 7.10  ? 16   SER B HB2  1 
ATOM   2271 H HB3  . SER B 1 16  ? 52.030 0.390   46.291 1.00 7.10  ? 16   SER B HB3  1 
ATOM   2272 H HG   . SER B 1 16  ? 52.405 -0.799  44.474 1.00 8.80  ? 16   SER B HG   1 
ATOM   2273 N N    . THR B 1 17  ? 55.821 -0.537  44.576 1.00 4.05  ? 17   THR B N    1 
ATOM   2274 C CA   . THR B 1 17  ? 56.905 -1.405  44.163 1.00 3.75  ? 17   THR B CA   1 
ATOM   2275 C C    . THR B 1 17  ? 57.978 -0.494  43.561 1.00 3.85  ? 17   THR B C    1 
ATOM   2276 O O    . THR B 1 17  ? 57.662 0.560   43.030 1.00 4.52  ? 17   THR B O    1 
ATOM   2277 C CB   . THR B 1 17  ? 56.404 -2.486  43.167 1.00 4.40  ? 17   THR B CB   1 
ATOM   2278 O OG1  . THR B 1 17  ? 57.484 -3.390  42.920 1.00 4.80  ? 17   THR B OG1  1 
ATOM   2279 C CG2  . THR B 1 17  ? 55.844 -1.915  41.880 1.00 4.77  ? 17   THR B CG2  1 
ATOM   2280 H H    . THR B 1 17  ? 55.618 0.150   44.064 1.00 4.85  ? 17   THR B H    1 
ATOM   2281 H HA   . THR B 1 17  ? 57.282 -1.859  44.970 1.00 4.49  ? 17   THR B HA   1 
ATOM   2282 H HB   . THR B 1 17  ? 55.673 -2.999  43.616 1.00 5.28  ? 17   THR B HB   1 
ATOM   2283 H HG1  . THR B 1 17  ? 57.615 -3.451  42.092 1.00 7.20  ? 17   THR B HG1  1 
ATOM   2284 H HG21 . THR B 1 17  ? 56.539 -1.394  41.424 1.00 7.16  ? 17   THR B HG21 1 
ATOM   2285 H HG22 . THR B 1 17  ? 55.550 -2.647  41.298 1.00 7.16  ? 17   THR B HG22 1 
ATOM   2286 H HG23 . THR B 1 17  ? 55.082 -1.334  42.084 1.00 7.16  ? 17   THR B HG23 1 
ATOM   2287 N N    . SER B 1 18  ? 59.261 -0.917  43.655 1.00 3.56  ? 18   SER B N    1 
ATOM   2288 C CA   . SER B 1 18  ? 60.314 -0.029  43.190 1.00 3.64  ? 18   SER B CA   1 
ATOM   2289 C C    . SER B 1 18  ? 60.499 -0.093  41.667 1.00 3.38  ? 18   SER B C    1 
ATOM   2290 O O    . SER B 1 18  ? 61.186 0.803   41.104 1.00 3.89  ? 18   SER B O    1 
ATOM   2291 C CB   . SER B 1 18  ? 61.627 -0.367  43.872 1.00 4.32  ? 18   SER B CB   1 
ATOM   2292 O OG   . SER B 1 18  ? 62.067 -1.642  43.432 1.00 4.79  ? 18   SER B OG   1 
ATOM   2293 H H    . SER B 1 18  ? 59.452 -1.709  43.988 1.00 4.27  ? 18   SER B H    1 
ATOM   2294 H HA   . SER B 1 18  ? 60.065 0.908   43.437 1.00 4.37  ? 18   SER B HA   1 
ATOM   2295 H HB2  . SER B 1 18  ? 62.306 0.318   43.650 1.00 5.19  ? 18   SER B HB2  1 
ATOM   2296 H HB3  . SER B 1 18  ? 61.503 -0.374  44.854 1.00 5.19  ? 18   SER B HB3  1 
ATOM   2297 H HG   . SER B 1 18  ? 62.798 -1.829  43.802 1.00 7.18  ? 18   SER B HG   1 
ATOM   2298 N N    . ALA B 1 19  ? 59.929 -1.092  41.034 1.00 3.41  ? 19   ALA B N    1 
ATOM   2299 C CA   . ALA B 1 19  ? 60.027 -1.394  39.615 1.00 3.60  ? 19   ALA B CA   1 
ATOM   2300 C C    . ALA B 1 19  ? 58.975 -2.481  39.360 1.00 3.60  ? 19   ALA B C    1 
ATOM   2301 O O    . ALA B 1 19  ? 58.458 -3.071  40.308 1.00 4.09  ? 19   ALA B O    1 
ATOM   2302 C CB   . ALA B 1 19  ? 61.432 -1.881  39.240 1.00 4.55  ? 19   ALA B CB   1 
ATOM   2303 H H    . ALA B 1 19  ? 59.436 -1.635  41.520 1.00 4.09  ? 19   ALA B H    1 
ATOM   2304 H HA   . ALA B 1 19  ? 59.802 -0.578  39.082 1.00 4.32  ? 19   ALA B HA   1 
ATOM   2305 H HB1  . ALA B 1 19  ? 61.663 -2.663  39.784 1.00 6.83  ? 19   ALA B HB1  1 
ATOM   2306 H HB2  . ALA B 1 19  ? 62.081 -1.166  39.405 1.00 6.83  ? 19   ALA B HB2  1 
ATOM   2307 H HB3  . ALA B 1 19  ? 61.451 -2.127  38.291 1.00 6.83  ? 19   ALA B HB3  1 
ATOM   2308 N N    . ALA B 1 20  ? 58.734 -2.808  38.103 1.00 3.75  ? 20   ALA B N    1 
ATOM   2309 C CA   . ALA B 1 20  ? 57.784 -3.898  37.844 1.00 3.87  ? 20   ALA B CA   1 
ATOM   2310 C C    . ALA B 1 20  ? 58.251 -5.117  38.626 1.00 4.00  ? 20   ALA B C    1 
ATOM   2311 O O    . ALA B 1 20  ? 59.408 -5.514  38.585 1.00 4.65  ? 20   ALA B O    1 
ATOM   2312 C CB   . ALA B 1 20  ? 57.768 -4.233  36.362 1.00 4.52  ? 20   ALA B CB   1 
ATOM   2313 H H    . ALA B 1 20  ? 59.131 -2.386  37.441 1.00 4.50  ? 20   ALA B H    1 
ATOM   2314 H HA   . ALA B 1 20  ? 56.868 -3.631  38.144 1.00 4.64  ? 20   ALA B HA   1 
ATOM   2315 H HB1  . ALA B 1 20  ? 57.148 -4.975  36.201 1.00 6.78  ? 20   ALA B HB1  1 
ATOM   2316 H HB2  . ALA B 1 20  ? 58.669 -4.492  36.076 1.00 6.78  ? 20   ALA B HB2  1 
ATOM   2317 H HB3  . ALA B 1 20  ? 57.477 -3.448  35.853 1.00 6.78  ? 20   ALA B HB3  1 
ATOM   2318 N N    . SER B 1 21  ? 57.295 -5.775  39.316 1.00 3.83  ? 21   SER B N    1 
ATOM   2319 C CA   . SER B 1 21  ? 57.695 -6.824  40.236 1.00 4.13  ? 21   SER B CA   1 
ATOM   2320 C C    . SER B 1 21  ? 58.154 -8.079  39.552 1.00 4.03  ? 21   SER B C    1 
ATOM   2321 O O    . SER B 1 21  ? 58.942 -8.840  40.126 1.00 5.63  ? 21   SER B O    1 
ATOM   2322 C CB   A SER B 1 21  ? 56.565 -7.066  41.254 0.85 5.41  ? 21   SER B CB   1 
ATOM   2323 C CB   B SER B 1 21  ? 56.438 -7.156  41.059 0.15 4.65  ? 21   SER B CB   1 
ATOM   2324 O OG   A SER B 1 21  ? 55.330 -7.093  40.637 0.85 5.46  ? 21   SER B OG   1 
ATOM   2325 O OG   B SER B 1 21  ? 55.817 -6.012  41.592 0.15 8.62  ? 21   SER B OG   1 
ATOM   2326 H H    . SER B 1 21  ? 56.445 -5.571  39.210 1.00 4.60  ? 21   SER B H    1 
ATOM   2327 H HA   A SER B 1 21  ? 58.477 -6.474  40.751 1.00 4.96  ? 21   SER B HA   1 
ATOM   2328 H HB2  A SER B 1 21  ? 56.719 -7.927  41.718 0.85 6.49  ? 21   SER B HB2  1 
ATOM   2329 H HB2  B SER B 1 21  ? 55.792 -7.635  40.481 0.15 5.58  ? 21   SER B HB2  1 
ATOM   2330 H HB3  A SER B 1 21  ? 56.576 -6.346  41.933 0.85 6.49  ? 21   SER B HB3  1 
ATOM   2331 H HB3  B SER B 1 21  ? 56.689 -7.763  41.800 0.15 5.58  ? 21   SER B HB3  1 
ATOM   2332 H HG   A SER B 1 21  ? 55.318 -7.706  40.062 0.85 8.19  ? 21   SER B HG   1 
ATOM   2333 H HG   B SER B 1 21  ? 56.404 -5.456  41.822 0.15 12.93 ? 21   SER B HG   1 
ATOM   2334 N N    . SER B 1 22  ? 57.677 -8.337  38.354 1.00 3.91  ? 22   SER B N    1 
ATOM   2335 C CA   . SER B 1 22  ? 58.090 -9.493  37.564 1.00 3.99  ? 22   SER B CA   1 
ATOM   2336 C C    . SER B 1 22  ? 57.522 -9.263  36.164 1.00 3.71  ? 22   SER B C    1 
ATOM   2337 O O    . SER B 1 22  ? 56.810 -8.294  35.891 1.00 3.86  ? 22   SER B O    1 
ATOM   2338 C CB   . SER B 1 22  ? 57.506 -10.798 38.103 1.00 4.56  ? 22   SER B CB   1 
ATOM   2339 O OG   . SER B 1 22  ? 56.142 -10.943 37.768 1.00 4.97  ? 22   SER B OG   1 
ATOM   2340 H H    . SER B 1 22  ? 57.082 -7.787  38.012 1.00 4.69  ? 22   SER B H    1 
ATOM   2341 H HA   . SER B 1 22  ? 59.088 -9.549  37.527 1.00 4.79  ? 22   SER B HA   1 
ATOM   2342 H HB2  . SER B 1 22  ? 58.016 -11.561 37.733 1.00 5.48  ? 22   SER B HB2  1 
ATOM   2343 H HB3  . SER B 1 22  ? 57.603 -10.816 39.088 1.00 5.48  ? 22   SER B HB3  1 
ATOM   2344 H HG   . SER B 1 22  ? 56.059 -10.953 36.932 1.00 7.46  ? 22   SER B HG   1 
ATOM   2345 N N    . SER B 1 23  ? 57.797 -10.238 35.268 1.00 3.91  ? 23   SER B N    1 
ATOM   2346 C CA   . SER B 1 23  ? 57.273 -10.193 33.931 1.00 4.08  ? 23   SER B CA   1 
ATOM   2347 C C    . SER B 1 23  ? 55.749 -10.313 33.842 1.00 3.83  ? 23   SER B C    1 
ATOM   2348 O O    . SER B 1 23  ? 55.201 -10.046 32.780 1.00 4.43  ? 23   SER B O    1 
ATOM   2349 C CB   . SER B 1 23  ? 57.906 -11.284 33.084 1.00 4.60  ? 23   SER B CB   1 
ATOM   2350 O OG   . SER B 1 23  ? 57.351 -12.529 33.483 1.00 5.25  ? 23   SER B OG   1 
ATOM   2351 H H    . SER B 1 23  ? 58.308 -10.913 35.508 1.00 4.69  ? 23   SER B H    1 
ATOM   2352 H HA   . SER B 1 23  ? 57.532 -9.312  33.534 1.00 4.89  ? 23   SER B HA   1 
ATOM   2353 H HB2  . SER B 1 23  ? 57.720 -11.121 32.126 1.00 5.52  ? 23   SER B HB2  1 
ATOM   2354 H HB3  . SER B 1 23  ? 58.887 -11.291 33.216 1.00 5.52  ? 23   SER B HB3  1 
ATOM   2355 H HG   . SER B 1 23  ? 57.695 -13.147 33.030 1.00 7.88  ? 23   SER B HG   1 
ATOM   2356 N N    . ASN B 1 24  ? 55.082 -10.707 34.943 1.00 3.71  ? 24   ASN B N    1 
ATOM   2357 C CA   . ASN B 1 24  ? 53.631 -10.761 34.961 1.00 3.98  ? 24   ASN B CA   1 
ATOM   2358 C C    . ASN B 1 24  ? 52.994 -9.445  35.381 1.00 4.02  ? 24   ASN B C    1 
ATOM   2359 O O    . ASN B 1 24  ? 51.751 -9.336  35.359 1.00 4.45  ? 24   ASN B O    1 
ATOM   2360 C CB   . ASN B 1 24  ? 53.111 -11.924 35.796 1.00 4.34  ? 24   ASN B CB   1 
ATOM   2361 C CG   . ASN B 1 24  ? 53.177 -11.737 37.287 1.00 4.54  ? 24   ASN B CG   1 
ATOM   2362 O OD1  . ASN B 1 24  ? 53.017 -10.619 37.826 1.00 5.33  ? 24   ASN B OD1  1 
ATOM   2363 N ND2  . ASN B 1 24  ? 53.339 -12.853 38.010 1.00 5.12  ? 24   ASN B ND2  1 
ATOM   2364 H H    . ASN B 1 24  ? 55.532 -10.936 35.664 1.00 4.45  ? 24   ASN B H    1 
ATOM   2365 H HA   . ASN B 1 24  ? 53.340 -10.932 34.020 1.00 4.78  ? 24   ASN B HA   1 
ATOM   2366 H HB2  . ASN B 1 24  ? 52.169 -12.093 35.544 1.00 5.21  ? 24   ASN B HB2  1 
ATOM   2367 H HB3  . ASN B 1 24  ? 53.630 -12.734 35.560 1.00 5.21  ? 24   ASN B HB3  1 
ATOM   2368 H HD21 . ASN B 1 24  ? 53.450 -13.627 37.607 1.00 6.15  ? 24   ASN B HD21 1 
ATOM   2369 H HD22 . ASN B 1 24  ? 53.334 -12.812 38.889 1.00 6.15  ? 24   ASN B HD22 1 
ATOM   2370 N N    . TYR B 1 25  ? 53.800 -8.439  35.732 1.00 3.97  ? 25   TYR B N    1 
ATOM   2371 C CA   . TYR B 1 25  ? 53.257 -7.256  36.388 1.00 3.85  ? 25   TYR B CA   1 
ATOM   2372 C C    . TYR B 1 25  ? 52.174 -6.590  35.566 1.00 3.71  ? 25   TYR B C    1 
ATOM   2373 O O    . TYR B 1 25  ? 51.101 -6.296  36.089 1.00 4.28  ? 25   TYR B O    1 
ATOM   2374 C CB   . TYR B 1 25  ? 54.432 -6.278  36.663 1.00 4.12  ? 25   TYR B CB   1 
ATOM   2375 C CG   . TYR B 1 25  ? 53.978 -4.969  37.245 1.00 3.84  ? 25   TYR B CG   1 
ATOM   2376 C CD1  . TYR B 1 25  ? 53.801 -4.800  38.623 1.00 4.09  ? 25   TYR B CD1  1 
ATOM   2377 C CD2  . TYR B 1 25  ? 53.736 -3.865  36.427 1.00 4.49  ? 25   TYR B CD2  1 
ATOM   2378 C CE1  . TYR B 1 25  ? 53.407 -3.575  39.167 1.00 4.38  ? 25   TYR B CE1  1 
ATOM   2379 C CE2  . TYR B 1 25  ? 53.310 -2.647  36.965 1.00 4.98  ? 25   TYR B CE2  1 
ATOM   2380 C CZ   . TYR B 1 25  ? 53.159 -2.495  38.317 1.00 4.29  ? 25   TYR B CZ   1 
ATOM   2381 O OH   . TYR B 1 25  ? 52.739 -1.296  38.795 1.00 4.98  ? 25   TYR B OH   1 
ATOM   2382 H H    . TYR B 1 25  ? 54.663 -8.492  35.566 1.00 4.76  ? 25   TYR B H    1 
ATOM   2383 H HA   . TYR B 1 25  ? 52.864 -7.532  37.265 1.00 4.62  ? 25   TYR B HA   1 
ATOM   2384 H HB2  . TYR B 1 25  ? 55.068 -6.706  37.289 1.00 4.94  ? 25   TYR B HB2  1 
ATOM   2385 H HB3  . TYR B 1 25  ? 54.912 -6.104  35.815 1.00 4.94  ? 25   TYR B HB3  1 
ATOM   2386 H HD1  . TYR B 1 25  ? 53.952 -5.536  39.204 1.00 4.91  ? 25   TYR B HD1  1 
ATOM   2387 H HD2  . TYR B 1 25  ? 53.863 -3.943  35.489 1.00 5.39  ? 25   TYR B HD2  1 
ATOM   2388 H HE1  . TYR B 1 25  ? 53.308 -3.477  40.107 1.00 5.26  ? 25   TYR B HE1  1 
ATOM   2389 H HE2  . TYR B 1 25  ? 53.122 -1.918  36.386 1.00 5.97  ? 25   TYR B HE2  1 
ATOM   2390 H HH   . TYR B 1 25  ? 52.666 -1.337  39.631 1.00 7.48  ? 25   TYR B HH   1 
ATOM   2391 N N    . CYS B 1 26  ? 52.447 -6.313  34.287 1.00 3.82  ? 26   CYS B N    1 
ATOM   2392 C CA   . CYS B 1 26  ? 51.429 -5.633  33.501 1.00 4.02  ? 26   CYS B CA   1 
ATOM   2393 C C    . CYS B 1 26  ? 50.173 -6.500  33.322 1.00 4.27  ? 26   CYS B C    1 
ATOM   2394 O O    . CYS B 1 26  ? 49.060 -5.994  33.367 1.00 5.01  ? 26   CYS B O    1 
ATOM   2395 C CB   . CYS B 1 26  ? 51.970 -5.256  32.123 1.00 4.23  ? 26   CYS B CB   1 
ATOM   2396 S SG   . CYS B 1 26  ? 53.289 -4.009  32.191 1.00 4.22  ? 26   CYS B SG   1 
ATOM   2397 H H    . CYS B 1 26  ? 53.220 -6.536  33.931 1.00 4.59  ? 26   CYS B H    1 
ATOM   2398 H HA   . CYS B 1 26  ? 51.168 -4.794  33.979 1.00 4.82  ? 26   CYS B HA   1 
ATOM   2399 H HB2  . CYS B 1 26  ? 52.320 -6.070  31.681 1.00 5.08  ? 26   CYS B HB2  1 
ATOM   2400 H HB3  . CYS B 1 26  ? 51.227 -4.907  31.570 1.00 5.08  ? 26   CYS B HB3  1 
ATOM   2401 N N    . ASN B 1 27  ? 50.376 -7.803  33.100 1.00 4.66  ? 27   ASN B N    1 
ATOM   2402 C CA   . ASN B 1 27  ? 49.238 -8.678  32.956 1.00 5.33  ? 27   ASN B CA   1 
ATOM   2403 C C    . ASN B 1 27  ? 48.294 -8.571  34.156 1.00 5.80  ? 27   ASN B C    1 
ATOM   2404 O O    . ASN B 1 27  ? 47.088 -8.595  34.018 1.00 8.53  ? 27   ASN B O    1 
ATOM   2405 C CB   . ASN B 1 27  ? 49.689 -10.123 32.691 1.00 5.85  ? 27   ASN B CB   1 
ATOM   2406 C CG   . ASN B 1 27  ? 50.164 -10.308 31.247 1.00 5.43  ? 27   ASN B CG   1 
ATOM   2407 O OD1  . ASN B 1 27  ? 49.684 -9.607  30.383 1.00 6.14  ? 27   ASN B OD1  1 
ATOM   2408 N ND2  . ASN B 1 27  ? 51.069 -11.258 31.002 1.00 6.23  ? 27   ASN B ND2  1 
ATOM   2409 H H    . ASN B 1 27  ? 51.193 -8.123  33.042 1.00 5.59  ? 27   ASN B H    1 
ATOM   2410 H HA   . ASN B 1 27  ? 48.729 -8.373  32.151 1.00 6.40  ? 27   ASN B HA   1 
ATOM   2411 H HB2  . ASN B 1 27  ? 50.427 -10.355 33.310 1.00 7.02  ? 27   ASN B HB2  1 
ATOM   2412 H HB3  . ASN B 1 27  ? 48.936 -10.740 32.870 1.00 7.02  ? 27   ASN B HB3  1 
ATOM   2413 H HD21 . ASN B 1 27  ? 51.388 -11.742 31.664 1.00 7.47  ? 27   ASN B HD21 1 
ATOM   2414 H HD22 . ASN B 1 27  ? 51.346 -11.400 30.180 1.00 7.47  ? 27   ASN B HD22 1 
ATOM   2415 N N    . GLN B 1 28  ? 48.870 -8.476  35.380 1.00 5.00  ? 28   GLN B N    1 
ATOM   2416 C CA   . GLN B 1 28  ? 48.069 -8.358  36.556 1.00 5.21  ? 28   GLN B CA   1 
ATOM   2417 C C    . GLN B 1 28  ? 47.553 -6.930  36.829 1.00 5.06  ? 28   GLN B C    1 
ATOM   2418 O O    . GLN B 1 28  ? 46.401 -6.728  37.206 1.00 6.53  ? 28   GLN B O    1 
ATOM   2419 C CB   . GLN B 1 28  ? 48.823 -8.830  37.815 1.00 5.43  ? 28   GLN B CB   1 
ATOM   2420 C CG   . GLN B 1 28  ? 49.215 -10.313 37.742 1.00 6.04  ? 28   GLN B CG   1 
ATOM   2421 C CD   . GLN B 1 28  ? 49.408 -10.858 39.150 1.00 6.37  ? 28   GLN B CD   1 
ATOM   2422 O OE1  . GLN B 1 28  ? 48.426 -11.025 39.865 1.00 7.91  ? 28   GLN B OE1  1 
ATOM   2423 N NE2  . GLN B 1 28  ? 50.640 -11.125 39.545 1.00 7.07  ? 28   GLN B NE2  1 
ATOM   2424 H H    . GLN B 1 28  ? 49.747 -8.488  35.450 1.00 6.00  ? 28   GLN B H    1 
ATOM   2425 H HA   . GLN B 1 28  ? 47.272 -8.951  36.440 1.00 6.25  ? 28   GLN B HA   1 
ATOM   2426 H HB2  . GLN B 1 28  ? 49.641 -8.284  37.927 1.00 6.51  ? 28   GLN B HB2  1 
ATOM   2427 H HB3  . GLN B 1 28  ? 48.250 -8.685  38.610 1.00 6.51  ? 28   GLN B HB3  1 
ATOM   2428 H HG2  . GLN B 1 28  ? 48.504 -10.825 37.280 1.00 7.25  ? 28   GLN B HG2  1 
ATOM   2429 H HG3  . GLN B 1 28  ? 50.053 -10.413 37.226 1.00 7.25  ? 28   GLN B HG3  1 
ATOM   2430 H HE21 . GLN B 1 28  ? 51.316 -10.990 38.998 1.00 8.48  ? 28   GLN B HE21 1 
ATOM   2431 H HE22 . GLN B 1 28  ? 50.784 -11.438 40.355 1.00 8.48  ? 28   GLN B HE22 1 
ATOM   2432 N N    . MET B 1 29  ? 48.426 -5.923  36.673 1.00 4.82  ? 29   MET B N    1 
ATOM   2433 C CA   . MET B 1 29  ? 48.095 -4.563  37.063 1.00 5.08  ? 29   MET B CA   1 
ATOM   2434 C C    . MET B 1 29  ? 47.159 -3.888  36.078 1.00 5.22  ? 29   MET B C    1 
ATOM   2435 O O    . MET B 1 29  ? 46.304 -3.087  36.480 1.00 5.82  ? 29   MET B O    1 
ATOM   2436 C CB   A MET B 1 29  ? 49.352 -3.680  37.119 0.61 5.62  ? 29   MET B CB   1 
ATOM   2437 C CB   B MET B 1 29  ? 49.400 -3.801  37.342 0.39 4.52  ? 29   MET B CB   1 
ATOM   2438 C CG   A MET B 1 29  ? 50.098 -4.078  38.317 0.61 7.63  ? 29   MET B CG   1 
ATOM   2439 C CG   B MET B 1 29  ? 49.226 -2.461  38.030 0.39 5.02  ? 29   MET B CG   1 
ATOM   2440 S SD   A MET B 1 29  ? 49.422 -3.573  39.903 0.61 12.57 ? 29   MET B SD   1 
ATOM   2441 S SD   B MET B 1 29  ? 48.425 -2.575  39.674 0.39 6.64  ? 29   MET B SD   1 
ATOM   2442 C CE   A MET B 1 29  ? 49.354 -1.822  39.825 0.61 16.72 ? 29   MET B CE   1 
ATOM   2443 C CE   B MET B 1 29  ? 49.790 -3.087  40.544 0.39 7.20  ? 29   MET B CE   1 
ATOM   2444 H H    . MET B 1 29  ? 49.218 -6.090  36.327 1.00 5.79  ? 29   MET B H    1 
ATOM   2445 H HA   A MET B 1 29  ? 47.665 -4.578  37.965 1.00 6.10  ? 29   MET B HA   1 
ATOM   2446 H HB2  A MET B 1 29  ? 49.905 -3.815  36.309 0.61 6.75  ? 29   MET B HB2  1 
ATOM   2447 H HB2  B MET B 1 29  ? 49.982 -4.370  37.906 0.39 5.43  ? 29   MET B HB2  1 
ATOM   2448 H HB3  A MET B 1 29  ? 49.099 -2.724  37.172 0.61 6.75  ? 29   MET B HB3  1 
ATOM   2449 H HB3  B MET B 1 29  ? 49.869 -3.654  36.483 0.39 5.43  ? 29   MET B HB3  1 
ATOM   2450 H HG2  A MET B 1 29  ? 50.176 -5.064  38.316 0.61 9.15  ? 29   MET B HG2  1 
ATOM   2451 H HG2  B MET B 1 29  ? 50.115 -2.039  38.136 0.39 6.02  ? 29   MET B HG2  1 
ATOM   2452 H HG3  A MET B 1 29  ? 51.015 -3.711  38.243 0.61 9.15  ? 29   MET B HG3  1 
ATOM   2453 H HG3  B MET B 1 29  ? 48.681 -1.872  37.449 0.39 6.02  ? 29   MET B HG3  1 
ATOM   2454 H HE1  A MET B 1 29  ? 48.789 -1.550  39.072 0.61 25.08 ? 29   MET B HE1  1 
ATOM   2455 H HE1  B MET B 1 29  ? 50.122 -3.928  40.165 0.39 10.79 ? 29   MET B HE1  1 
ATOM   2456 H HE2  A MET B 1 29  ? 48.977 -1.472  40.659 0.61 25.08 ? 29   MET B HE2  1 
ATOM   2457 H HE2  B MET B 1 29  ? 50.489 -2.403  40.486 0.39 10.79 ? 29   MET B HE2  1 
ATOM   2458 H HE3  A MET B 1 29  ? 50.258 -1.465  39.701 0.61 25.08 ? 29   MET B HE3  1 
ATOM   2459 H HE3  B MET B 1 29  ? 49.546 -3.226  41.483 0.39 10.79 ? 29   MET B HE3  1 
ATOM   2460 N N    . MET B 1 30  ? 47.296 -4.199  34.797 1.00 5.27  ? 30   MET B N    1 
ATOM   2461 C CA   . MET B 1 30  ? 46.325 -3.657  33.841 1.00 5.65  ? 30   MET B CA   1 
ATOM   2462 C C    . MET B 1 30  ? 44.931 -4.115  34.222 1.00 5.87  ? 30   MET B C    1 
ATOM   2463 O O    . MET B 1 30  ? 43.940 -3.355  34.081 1.00 7.66  ? 30   MET B O    1 
ATOM   2464 C CB   . MET B 1 30  ? 46.702 -4.060  32.411 1.00 5.47  ? 30   MET B CB   1 
ATOM   2465 C CG   . MET B 1 30  ? 47.972 -3.414  31.927 1.00 5.40  ? 30   MET B CG   1 
ATOM   2466 S SD   . MET B 1 30  ? 47.888 -1.621  31.761 1.00 5.54  ? 30   MET B SD   1 
ATOM   2467 C CE   . MET B 1 30  ? 46.873 -1.458  30.276 1.00 5.93  ? 30   MET B CE   1 
ATOM   2468 H H    . MET B 1 30  ? 47.954 -4.717  34.526 1.00 6.32  ? 30   MET B H    1 
ATOM   2469 H HA   . MET B 1 30  ? 46.353 -2.660  33.901 1.00 6.78  ? 30   MET B HA   1 
ATOM   2470 H HB2  . MET B 1 30  ? 46.807 -5.044  32.372 1.00 6.56  ? 30   MET B HB2  1 
ATOM   2471 H HB3  . MET B 1 30  ? 45.962 -3.811  31.802 1.00 6.56  ? 30   MET B HB3  1 
ATOM   2472 H HG2  . MET B 1 30  ? 48.701 -3.638  32.559 1.00 6.48  ? 30   MET B HG2  1 
ATOM   2473 H HG3  . MET B 1 30  ? 48.209 -3.802  31.048 1.00 6.48  ? 30   MET B HG3  1 
ATOM   2474 H HE1  . MET B 1 30  ? 47.320 -1.899  29.524 1.00 8.89  ? 30   MET B HE1  1 
ATOM   2475 H HE2  . MET B 1 30  ? 46.001 -1.877  30.429 1.00 8.89  ? 30   MET B HE2  1 
ATOM   2476 H HE3  . MET B 1 30  ? 46.747 -0.508  30.069 1.00 8.89  ? 30   MET B HE3  1 
ATOM   2477 N N    . LYS B 1 31  ? 44.794 -5.364  34.685 1.00 5.97  ? 31   LYS B N    1 
ATOM   2478 C CA   . LYS B 1 31  ? 43.491 -5.866  35.144 1.00 6.96  ? 31   LYS B CA   1 
ATOM   2479 C C    . LYS B 1 31  ? 43.067 -5.166  36.438 1.00 6.46  ? 31   LYS B C    1 
ATOM   2480 O O    . LYS B 1 31  ? 41.918 -4.673  36.557 1.00 7.25  ? 31   LYS B O    1 
ATOM   2481 C CB   . LYS B 1 31  ? 43.561 -7.362  35.277 1.00 8.91  ? 31   LYS B CB   1 
ATOM   2482 C CG   . LYS B 1 31  ? 42.276 -7.998  35.717 1.00 11.43 ? 31   LYS B CG   1 
ATOM   2483 C CD   . LYS B 1 31  ? 42.378 -9.519  35.746 1.00 26.14 ? 31   LYS B CD   1 
ATOM   2484 H H    . LYS B 1 31  ? 45.497 -5.893  34.714 1.00 7.16  ? 31   LYS B H    1 
ATOM   2485 H HA   . LYS B 1 31  ? 42.813 -5.651  34.441 1.00 8.35  ? 31   LYS B HA   1 
ATOM   2486 H HB2  . LYS B 1 31  ? 43.824 -7.746  34.403 1.00 10.69 ? 31   LYS B HB2  1 
ATOM   2487 H HB3  . LYS B 1 31  ? 44.269 -7.590  35.930 1.00 10.69 ? 31   LYS B HB3  1 
ATOM   2488 H HG2  . LYS B 1 31  ? 42.041 -7.670  36.621 1.00 13.72 ? 31   LYS B HG2  1 
ATOM   2489 H HG3  . LYS B 1 31  ? 41.550 -7.732  35.098 1.00 13.72 ? 31   LYS B HG3  1 
ATOM   2490 N N    . SER B 1 32  ? 43.943 -5.124  37.428 1.00 6.35  ? 32   SER B N    1 
ATOM   2491 C CA   . SER B 1 32  ? 43.532 -4.592  38.748 1.00 7.09  ? 32   SER B CA   1 
ATOM   2492 C C    . SER B 1 32  ? 43.167 -3.119  38.697 1.00 6.76  ? 32   SER B C    1 
ATOM   2493 O O    . SER B 1 32  ? 42.381 -2.659  39.486 1.00 8.91  ? 32   SER B O    1 
ATOM   2494 C CB   A SER B 1 32  ? 44.539 -4.895  39.827 0.70 8.38  ? 32   SER B CB   1 
ATOM   2495 C CB   B SER B 1 32  ? 44.787 -4.678  39.611 0.30 9.05  ? 32   SER B CB   1 
ATOM   2496 O OG   A SER B 1 32  ? 45.749 -4.263  39.571 0.70 9.93  ? 32   SER B OG   1 
ATOM   2497 O OG   B SER B 1 32  ? 44.476 -4.405  40.959 0.30 12.79 ? 32   SER B OG   1 
ATOM   2498 H H    . SER B 1 32  ? 44.765 -5.410  37.304 1.00 7.62  ? 32   SER B H    1 
ATOM   2499 H HA   A SER B 1 32  ? 42.695 -5.080  38.999 1.00 8.51  ? 32   SER B HA   1 
ATOM   2500 H HB2  A SER B 1 32  ? 44.187 -4.592  40.701 0.70 10.05 ? 32   SER B HB2  1 
ATOM   2501 H HB2  B SER B 1 32  ? 45.178 -5.585  39.538 0.30 10.86 ? 32   SER B HB2  1 
ATOM   2502 H HB3  A SER B 1 32  ? 44.683 -5.874  39.877 0.70 10.05 ? 32   SER B HB3  1 
ATOM   2503 H HB3  B SER B 1 32  ? 45.458 -4.027  39.287 0.30 10.86 ? 32   SER B HB3  1 
ATOM   2504 H HG   A SER B 1 32  ? 46.303 -4.464  40.170 0.70 14.89 ? 32   SER B HG   1 
ATOM   2505 H HG   B SER B 1 32  ? 45.140 -4.583  41.441 0.30 19.18 ? 32   SER B HG   1 
ATOM   2506 N N    . ARG B 1 33  ? 43.778 -2.363  37.794 1.00 6.05  ? 33   ARG B N    1 
ATOM   2507 C CA   . ARG B 1 33  ? 43.501 -0.937  37.642 1.00 6.36  ? 33   ARG B CA   1 
ATOM   2508 C C    . ARG B 1 33  ? 42.376 -0.643  36.651 1.00 6.74  ? 33   ARG B C    1 
ATOM   2509 O O    . ARG B 1 33  ? 42.161 0.520   36.305 1.00 8.26  ? 33   ARG B O    1 
ATOM   2510 C CB   . ARG B 1 33  ? 44.776 -0.180  37.296 1.00 6.41  ? 33   ARG B CB   1 
ATOM   2511 C CG   . ARG B 1 33  ? 45.842 -0.262  38.398 1.00 6.23  ? 33   ARG B CG   1 
ATOM   2512 C CD   . ARG B 1 33  ? 45.399 0.315   39.714 1.00 6.43  ? 33   ARG B CD   1 
ATOM   2513 N NE   . ARG B 1 33  ? 46.461 0.299   40.731 1.00 6.77  ? 33   ARG B NE   1 
ATOM   2514 C CZ   . ARG B 1 33  ? 47.426 1.224   40.818 1.00 6.38  ? 33   ARG B CZ   1 
ATOM   2515 N NH1  . ARG B 1 33  ? 47.454 2.269   40.014 1.00 5.41  ? 33   ARG B NH1  1 
ATOM   2516 N NH2  . ARG B 1 33  ? 48.403 1.103   41.722 1.00 8.13  ? 33   ARG B NH2  1 
ATOM   2517 H H    . ARG B 1 33  ? 44.374 -2.735  37.265 1.00 7.26  ? 33   ARG B H    1 
ATOM   2518 H HA   . ARG B 1 33  ? 43.198 -0.603  38.534 1.00 7.63  ? 33   ARG B HA   1 
ATOM   2519 H HB2  . ARG B 1 33  ? 45.151 -0.548  36.457 1.00 7.69  ? 33   ARG B HB2  1 
ATOM   2520 H HB3  . ARG B 1 33  ? 44.552 0.771   37.135 1.00 7.69  ? 33   ARG B HB3  1 
ATOM   2521 H HG2  . ARG B 1 33  ? 46.089 -1.211  38.532 1.00 7.48  ? 33   ARG B HG2  1 
ATOM   2522 H HG3  . ARG B 1 33  ? 46.652 0.220   38.095 1.00 7.48  ? 33   ARG B HG3  1 
ATOM   2523 H HD2  . ARG B 1 33  ? 45.102 1.249   39.573 1.00 7.72  ? 33   ARG B HD2  1 
ATOM   2524 H HD3  . ARG B 1 33  ? 44.624 -0.201  40.048 1.00 7.72  ? 33   ARG B HD3  1 
ATOM   2525 H HE   . ARG B 1 33  ? 46.463 -0.358  41.317 1.00 8.12  ? 33   ARG B HE   1 
ATOM   2526 H HH11 . ARG B 1 33  ? 46.824 2.376   39.408 1.00 6.49  ? 33   ARG B HH11 1 
ATOM   2527 H HH12 . ARG B 1 33  ? 48.103 2.860   40.082 1.00 6.49  ? 33   ARG B HH12 1 
ATOM   2528 H HH21 . ARG B 1 33  ? 48.411 0.416   42.272 1.00 9.76  ? 33   ARG B HH21 1 
ATOM   2529 H HH22 . ARG B 1 33  ? 49.039 1.710   41.766 1.00 9.76  ? 33   ARG B HH22 1 
ATOM   2530 N N    . ASN B 1 34  ? 41.642 -1.678  36.231 1.00 7.62  ? 34   ASN B N    1 
ATOM   2531 C CA   . ASN B 1 34  ? 40.417 -1.537  35.443 1.00 8.88  ? 34   ASN B CA   1 
ATOM   2532 C C    . ASN B 1 34  ? 40.736 -1.068  34.035 1.00 9.25  ? 34   ASN B C    1 
ATOM   2533 O O    . ASN B 1 34  ? 39.914 -0.501  33.340 1.00 17.89 ? 34   ASN B O    1 
ATOM   2534 C CB   A ASN B 1 34  ? 39.324 -0.704  36.099 0.61 12.47 ? 34   ASN B CB   1 
ATOM   2535 C CB   B ASN B 1 34  ? 39.472 -0.491  36.029 0.40 9.62  ? 34   ASN B CB   1 
ATOM   2536 C CG   A ASN B 1 34  ? 38.468 -1.540  36.993 0.61 18.65 ? 34   ASN B CG   1 
ATOM   2537 C CG   B ASN B 1 34  ? 38.056 -0.947  35.795 0.40 13.00 ? 34   ASN B CG   1 
ATOM   2538 O OD1  A ASN B 1 34  ? 38.648 -2.756  37.282 0.61 30.10 ? 34   ASN B OD1  1 
ATOM   2539 O OD1  B ASN B 1 34  ? 37.771 -2.135  35.787 0.40 17.10 ? 34   ASN B OD1  1 
ATOM   2540 N ND2  A ASN B 1 34  ? 37.393 -0.952  37.541 0.61 33.29 ? 34   ASN B ND2  1 
ATOM   2541 N ND2  B ASN B 1 34  ? 37.109 -0.026  35.702 0.40 21.24 ? 34   ASN B ND2  1 
ATOM   2542 H H    . ASN B 1 34  ? 41.911 -2.489  36.439 1.00 9.15  ? 34   ASN B H    1 
ATOM   2543 H HA   A ASN B 1 34  ? 40.043 -2.459  35.349 1.00 10.66 ? 34   ASN B HA   1 
ATOM   2544 H HB2  A ASN B 1 34  ? 39.737 0.024   36.627 0.61 14.96 ? 34   ASN B HB2  1 
ATOM   2545 H HB2  B ASN B 1 34  ? 39.639 -0.389  36.999 0.40 11.55 ? 34   ASN B HB2  1 
ATOM   2546 H HB3  A ASN B 1 34  ? 38.760 -0.291  35.397 0.61 14.96 ? 34   ASN B HB3  1 
ATOM   2547 H HB3  B ASN B 1 34  ? 39.623 0.384   35.592 0.40 11.55 ? 34   ASN B HB3  1 
ATOM   2548 H HD21 A ASN B 1 34  ? 37.221 -0.106  37.372 0.61 39.95 ? 34   ASN B HD21 1 
ATOM   2549 H HD21 B ASN B 1 34  ? 37.323 0.828   35.709 0.40 25.48 ? 34   ASN B HD21 1 
ATOM   2550 H HD22 A ASN B 1 34  ? 36.861 -1.413  38.068 0.61 39.95 ? 34   ASN B HD22 1 
ATOM   2551 H HD22 B ASN B 1 34  ? 36.266 -0.267  35.633 0.40 25.48 ? 34   ASN B HD22 1 
ATOM   2552 N N    . LEU B 1 35  ? 41.867 -1.479  33.483 1.00 8.28  ? 35   LEU B N    1 
ATOM   2553 C CA   . LEU B 1 35  ? 42.316 -1.155  32.137 1.00 8.30  ? 35   LEU B CA   1 
ATOM   2554 C C    . LEU B 1 35  ? 42.118 -2.298  31.163 1.00 8.87  ? 35   LEU B C    1 
ATOM   2555 O O    . LEU B 1 35  ? 42.554 -2.198  29.983 1.00 10.37 ? 35   LEU B O    1 
ATOM   2556 C CB   . LEU B 1 35  ? 43.733 -0.603  32.151 1.00 7.78  ? 35   LEU B CB   1 
ATOM   2557 C CG   . LEU B 1 35  ? 43.932 0.531   33.081 1.00 11.28 ? 35   LEU B CG   1 
ATOM   2558 C CD1  . LEU B 1 35  ? 45.363 0.984   33.058 1.00 11.69 ? 35   LEU B CD1  1 
ATOM   2559 C CD2  . LEU B 1 35  ? 42.962 1.667   32.699 1.00 15.83 ? 35   LEU B CD2  1 
ATOM   2560 H H    . LEU B 1 35  ? 42.391 -1.990  33.971 1.00 9.93  ? 35   LEU B H    1 
ATOM   2561 H HA   . LEU B 1 35  ? 41.729 -0.411  31.819 1.00 9.95  ? 35   LEU B HA   1 
ATOM   2562 H HB2  . LEU B 1 35  ? 44.355 -1.331  32.401 1.00 9.34  ? 35   LEU B HB2  1 
ATOM   2563 H HB3  . LEU B 1 35  ? 43.968 -0.308  31.236 1.00 9.34  ? 35   LEU B HB3  1 
ATOM   2564 H HG   . LEU B 1 35  ? 43.712 0.224   34.007 1.00 13.54 ? 35   LEU B HG   1 
ATOM   2565 H HD11 . LEU B 1 35  ? 45.945 0.243   33.327 1.00 17.54 ? 35   LEU B HD11 1 
ATOM   2566 H HD12 . LEU B 1 35  ? 45.600 1.272   32.151 1.00 17.54 ? 35   LEU B HD12 1 
ATOM   2567 H HD13 . LEU B 1 35  ? 45.479 1.733   33.679 1.00 17.54 ? 35   LEU B HD13 1 
ATOM   2568 H HD21 . LEU B 1 35  ? 42.039 1.342   32.756 1.00 23.74 ? 35   LEU B HD21 1 
ATOM   2569 H HD22 . LEU B 1 35  ? 43.082 2.419   33.316 1.00 23.74 ? 35   LEU B HD22 1 
ATOM   2570 H HD23 . LEU B 1 35  ? 43.149 1.962   31.784 1.00 23.74 ? 35   LEU B HD23 1 
ATOM   2571 N N    . THR B 1 36  ? 41.480 -3.387  31.596 1.00 9.14  ? 36   THR B N    1 
ATOM   2572 C CA   . THR B 1 36  ? 41.134 -4.480  30.713 1.00 10.00 ? 36   THR B CA   1 
ATOM   2573 C C    . THR B 1 36  ? 39.692 -4.908  30.751 1.00 10.30 ? 36   THR B C    1 
ATOM   2574 O O    . THR B 1 36  ? 39.297 -5.928  30.236 1.00 14.05 ? 36   THR B O    1 
ATOM   2575 C CB   . THR B 1 36  ? 41.962 -5.740  31.059 1.00 10.25 ? 36   THR B CB   1 
ATOM   2576 O OG1  . THR B 1 36  ? 41.584 -6.166  32.377 1.00 10.96 ? 36   THR B OG1  1 
ATOM   2577 C CG2  . THR B 1 36  ? 43.423 -5.446  31.041 1.00 11.08 ? 36   THR B CG2  1 
ATOM   2578 H H    . THR B 1 36  ? 41.263 -3.442  32.447 1.00 10.96 ? 36   THR B H    1 
ATOM   2579 H HA   . THR B 1 36  ? 41.355 -4.208  29.776 1.00 12.00 ? 36   THR B HA   1 
ATOM   2580 H HB   . THR B 1 36  ? 41.758 -6.465  30.402 1.00 12.30 ? 36   THR B HB   1 
ATOM   2581 H HG1  . THR B 1 36  ? 40.751 -6.276  32.407 1.00 16.43 ? 36   THR B HG1  1 
ATOM   2582 H HG21 . THR B 1 36  ? 43.622 -4.738  31.690 1.00 16.62 ? 36   THR B HG21 1 
ATOM   2583 H HG22 . THR B 1 36  ? 43.922 -6.255  31.277 1.00 16.62 ? 36   THR B HG22 1 
ATOM   2584 H HG23 . THR B 1 36  ? 43.686 -5.150  30.144 1.00 16.62 ? 36   THR B HG23 1 
ATOM   2585 N N    . LYS B 1 37  ? 38.904 -4.100  31.462 1.00 13.09 ? 37   LYS B N    1 
ATOM   2586 C CA   . LYS B 1 37  ? 37.512 -4.393  31.808 1.00 16.72 ? 37   LYS B CA   1 
ATOM   2587 C C    . LYS B 1 37  ? 36.580 -4.380  30.692 1.00 13.82 ? 37   LYS B C    1 
ATOM   2588 O O    . LYS B 1 37  ? 35.876 -5.420  30.455 1.00 17.32 ? 37   LYS B O    1 
ATOM   2589 C CB   . LYS B 1 37  ? 36.984 -3.428  32.903 1.00 20.50 ? 37   LYS B CB   1 
ATOM   2590 H H    . LYS B 1 37  ? 39.244 -3.338  31.743 1.00 15.71 ? 37   LYS B H    1 
ATOM   2591 H HA   . LYS B 1 37  ? 37.494 -5.314  32.196 1.00 20.07 ? 37   LYS B HA   1 
ATOM   2592 N N    . ASP B 1 38  ? 36.554 -3.240  30.058 1.00 13.80 ? 38   ASP B N    1 
ATOM   2593 C CA   . ASP B 1 38  ? 35.609 -3.096  28.902 1.00 16.83 ? 38   ASP B CA   1 
ATOM   2594 C C    . ASP B 1 38  ? 36.306 -3.134  27.584 1.00 12.15 ? 38   ASP B C    1 
ATOM   2595 O O    . ASP B 1 38  ? 35.661 -3.124  26.531 1.00 15.72 ? 38   ASP B O    1 
ATOM   2596 C CB   . ASP B 1 38  ? 34.766 -1.886  29.042 1.00 21.85 ? 38   ASP B CB   1 
ATOM   2597 C CG   . ASP B 1 38  ? 35.405 -0.529  28.952 1.00 27.37 ? 38   ASP B CG   1 
ATOM   2598 O OD1  . ASP B 1 38  ? 36.671 -0.601  28.992 1.00 29.56 ? 38   ASP B OD1  1 
ATOM   2599 O OD2  . ASP B 1 38  ? 34.674 0.553   28.882 1.00 28.10 ? 38   ASP B OD2  1 
ATOM   2600 H H    . ASP B 1 38  ? 37.076 -2.575  30.302 1.00 16.55 ? 38   ASP B H    1 
ATOM   2601 H HA   . ASP B 1 38  ? 34.993 -3.884  28.929 1.00 20.20 ? 38   ASP B HA   1 
ATOM   2602 H HB2  . ASP B 1 38  ? 34.063 -1.930  28.346 1.00 26.22 ? 38   ASP B HB2  1 
ATOM   2603 H HB3  . ASP B 1 38  ? 34.309 -1.941  29.919 1.00 26.22 ? 38   ASP B HB3  1 
ATOM   2604 N N    . ARG B 1 39  ? 37.624 -3.126  27.642 1.00 12.20 ? 39   ARG B N    1 
ATOM   2605 C CA   . ARG B 1 39  ? 38.458 -3.173  26.453 1.00 9.61  ? 39   ARG B CA   1 
ATOM   2606 C C    . ARG B 1 39  ? 39.857 -3.469  26.954 1.00 8.53  ? 39   ARG B C    1 
ATOM   2607 O O    . ARG B 1 39  ? 40.136 -3.262  28.149 1.00 10.91 ? 39   ARG B O    1 
ATOM   2608 C CB   . ARG B 1 39  ? 38.437 -1.866  25.716 1.00 10.54 ? 39   ARG B CB   1 
ATOM   2609 C CG   . ARG B 1 39  ? 39.142 -0.692  26.431 1.00 12.18 ? 39   ARG B CG   1 
ATOM   2610 C CD   . ARG B 1 39  ? 38.948 0.629   25.836 1.00 14.71 ? 39   ARG B CD   1 
ATOM   2611 N NE   . ARG B 1 39  ? 39.925 1.639   26.323 1.00 21.98 ? 39   ARG B NE   1 
ATOM   2612 C CZ   . ARG B 1 39  ? 41.118 2.116   25.762 1.00 14.83 ? 39   ARG B CZ   1 
ATOM   2613 N NH1  . ARG B 1 39  ? 41.774 1.688   24.689 1.00 11.83 ? 39   ARG B NH1  1 
ATOM   2614 N NH2  . ARG B 1 39  ? 41.743 3.040   26.481 1.00 17.64 ? 39   ARG B NH2  1 
ATOM   2615 H H    . ARG B 1 39  ? 38.012 -3.091  28.431 1.00 14.64 ? 39   ARG B H    1 
ATOM   2616 H HA   . ARG B 1 39  ? 38.149 -3.908  25.850 1.00 11.53 ? 39   ARG B HA   1 
ATOM   2617 H HB2  . ARG B 1 39  ? 38.865 -1.997  24.833 1.00 12.65 ? 39   ARG B HB2  1 
ATOM   2618 H HB3  . ARG B 1 39  ? 37.493 -1.613  25.554 1.00 12.65 ? 39   ARG B HB3  1 
ATOM   2619 H HG2  . ARG B 1 39  ? 38.822 -0.661  27.367 1.00 14.62 ? 39   ARG B HG2  1 
ATOM   2620 H HG3  . ARG B 1 39  ? 40.113 -0.882  26.457 1.00 14.62 ? 39   ARG B HG3  1 
ATOM   2621 H HD2  . ARG B 1 39  ? 39.029 0.553   24.852 1.00 17.65 ? 39   ARG B HD2  1 
ATOM   2622 H HD3  . ARG B 1 39  ? 38.032 0.943   26.040 1.00 17.65 ? 39   ARG B HD3  1 
ATOM   2623 H HE   . ARG B 1 39  ? 39.718 2.001   27.098 1.00 26.38 ? 39   ARG B HE   1 
ATOM   2624 H HH11 . ARG B 1 39  ? 41.416 1.075   24.169 1.00 14.19 ? 39   ARG B HH11 1 
ATOM   2625 H HH12 . ARG B 1 39  ? 42.568 2.018   24.498 1.00 14.19 ? 39   ARG B HH12 1 
ATOM   2626 H HH21 . ARG B 1 39  ? 41.363 3.366   27.205 1.00 21.17 ? 39   ARG B HH21 1 
ATOM   2627 H HH22 . ARG B 1 39  ? 42.537 3.327   26.234 1.00 21.17 ? 39   ARG B HH22 1 
ATOM   2628 N N    . CYS B 1 40  ? 40.739 -3.896  26.072 1.00 7.46  ? 40   CYS B N    1 
ATOM   2629 C CA   . CYS B 1 40  ? 42.160 -3.956  26.395 1.00 7.36  ? 40   CYS B CA   1 
ATOM   2630 C C    . CYS B 1 40  ? 42.771 -2.580  26.050 1.00 6.95  ? 40   CYS B C    1 
ATOM   2631 O O    . CYS B 1 40  ? 42.820 -2.225  24.863 1.00 8.94  ? 40   CYS B O    1 
ATOM   2632 C CB   . CYS B 1 40  ? 42.928 -5.007  25.602 1.00 7.65  ? 40   CYS B CB   1 
ATOM   2633 S SG   . CYS B 1 40  ? 42.316 -6.683  25.737 1.00 8.15  ? 40   CYS B SG   1 
ATOM   2634 H H    . CYS B 1 40  ? 40.466 -4.150  25.275 1.00 8.95  ? 40   CYS B H    1 
ATOM   2635 H HA   . CYS B 1 40  ? 42.270 -4.133  27.373 1.00 8.84  ? 40   CYS B HA   1 
ATOM   2636 H HB2  . CYS B 1 40  ? 42.916 -4.746  24.647 1.00 9.18  ? 40   CYS B HB2  1 
ATOM   2637 H HB3  . CYS B 1 40  ? 43.872 -4.994  25.901 1.00 9.18  ? 40   CYS B HB3  1 
ATOM   2638 N N    . LYS B 1 41  ? 43.276 -1.832  26.995 1.00 6.56  ? 41   LYS B N    1 
ATOM   2639 C CA   . LYS B 1 41  ? 44.005 -0.603  26.693 1.00 6.21  ? 41   LYS B CA   1 
ATOM   2640 C C    . LYS B 1 41  ? 45.358 -0.988  26.113 1.00 6.08  ? 41   LYS B C    1 
ATOM   2641 O O    . LYS B 1 41  ? 46.068 -1.746  26.738 1.00 7.09  ? 41   LYS B O    1 
ATOM   2642 C CB   . LYS B 1 41  ? 44.159 0.244   27.940 1.00 6.29  ? 41   LYS B CB   1 
ATOM   2643 C CG   . LYS B 1 41  ? 44.877 1.578   27.684 1.00 6.68  ? 41   LYS B CG   1 
ATOM   2644 C CD   . LYS B 1 41  ? 44.909 2.491   28.859 1.00 7.58  ? 41   LYS B CD   1 
ATOM   2645 C CE   . LYS B 1 41  ? 45.594 3.838   28.532 1.00 8.86  ? 41   LYS B CE   1 
ATOM   2646 N NZ   . LYS B 1 41  ? 45.785 4.705   29.671 1.00 8.37  ? 41   LYS B NZ   1 
ATOM   2647 H H    . LYS B 1 41  ? 43.173 -2.075  27.835 1.00 7.87  ? 41   LYS B H    1 
ATOM   2648 H HA   . LYS B 1 41  ? 43.494 -0.083  26.009 1.00 7.45  ? 41   LYS B HA   1 
ATOM   2649 H HB2  . LYS B 1 41  ? 43.261 0.430   28.315 1.00 7.55  ? 41   LYS B HB2  1 
ATOM   2650 H HB3  . LYS B 1 41  ? 44.667 -0.270  28.617 1.00 7.55  ? 41   LYS B HB3  1 
ATOM   2651 H HG2  . LYS B 1 41  ? 45.808 1.388   27.405 1.00 8.01  ? 41   LYS B HG2  1 
ATOM   2652 H HG3  . LYS B 1 41  ? 44.428 2.041   26.934 1.00 8.01  ? 41   LYS B HG3  1 
ATOM   2653 H HD2  . LYS B 1 41  ? 43.982 2.663   29.163 1.00 9.09  ? 41   LYS B HD2  1 
ATOM   2654 H HD3  . LYS B 1 41  ? 45.395 2.051   29.601 1.00 9.09  ? 41   LYS B HD3  1 
ATOM   2655 H HE2  . LYS B 1 41  ? 46.476 3.653   28.124 1.00 10.64 ? 41   LYS B HE2  1 
ATOM   2656 H HE3  . LYS B 1 41  ? 45.047 4.316   27.860 1.00 10.64 ? 41   LYS B HE3  1 
ATOM   2657 H HZ1  . LYS B 1 41  ? 44.981 4.871   30.064 1.00 12.56 ? 41   LYS B HZ1  1 
ATOM   2658 H HZ2  . LYS B 1 41  ? 46.338 4.301   30.271 1.00 12.56 ? 41   LYS B HZ2  1 
ATOM   2659 H HZ3  . LYS B 1 41  ? 46.156 5.489   29.397 1.00 12.56 ? 41   LYS B HZ3  1 
ATOM   2660 N N    . PRO B 1 42  ? 45.729 -0.518  24.910 1.00 6.32  ? 42   PRO B N    1 
ATOM   2661 C CA   . PRO B 1 42  ? 46.918 -1.090  24.269 1.00 6.55  ? 42   PRO B CA   1 
ATOM   2662 C C    . PRO B 1 42  ? 48.257 -0.747  24.920 1.00 5.89  ? 42   PRO B C    1 
ATOM   2663 O O    . PRO B 1 42  ? 49.186 -1.559  24.870 1.00 7.68  ? 42   PRO B O    1 
ATOM   2664 C CB   A PRO B 1 42  ? 46.899 -0.469  22.847 0.56 7.03  ? 42   PRO B CB   1 
ATOM   2665 C CB   B PRO B 1 42  ? 46.744 -0.690  22.808 0.44 9.49  ? 42   PRO B CB   1 
ATOM   2666 C CG   A PRO B 1 42  ? 45.456 -0.384  22.512 0.56 6.78  ? 42   PRO B CG   1 
ATOM   2667 C CG   B PRO B 1 42  ? 45.960 0.528   22.990 0.44 9.30  ? 42   PRO B CG   1 
ATOM   2668 C CD   A PRO B 1 42  ? 44.878 0.091   23.846 0.56 6.36  ? 42   PRO B CD   1 
ATOM   2669 C CD   B PRO B 1 42  ? 44.914 0.354   24.043 0.44 8.22  ? 42   PRO B CD   1 
ATOM   2670 H HA   A PRO B 1 42  ? 46.820 -2.083  24.203 1.00 7.85  ? 42   PRO B HA   1 
ATOM   2671 H HB2  A PRO B 1 42  ? 47.317 0.429   22.848 0.56 8.43  ? 42   PRO B HB2  1 
ATOM   2672 H HB2  B PRO B 1 42  ? 47.612 -0.508  22.368 0.44 11.39 ? 42   PRO B HB2  1 
ATOM   2673 H HB3  A PRO B 1 42  ? 47.379 -1.047  22.202 0.56 8.43  ? 42   PRO B HB3  1 
ATOM   2674 H HB3  B PRO B 1 42  ? 46.248 -1.375  22.293 0.44 11.39 ? 42   PRO B HB3  1 
ATOM   2675 H HG2  A PRO B 1 42  ? 45.289 0.271   21.788 0.56 8.13  ? 42   PRO B HG2  1 
ATOM   2676 H HG2  B PRO B 1 42  ? 46.563 1.270   23.247 0.44 11.16 ? 42   PRO B HG2  1 
ATOM   2677 H HG3  A PRO B 1 42  ? 45.091 -1.265  22.248 0.56 8.13  ? 42   PRO B HG3  1 
ATOM   2678 H HG3  B PRO B 1 42  ? 45.526 0.769   22.134 0.44 11.16 ? 42   PRO B HG3  1 
ATOM   2679 H HD2  A PRO B 1 42  ? 44.905 1.079   23.904 0.56 7.64  ? 42   PRO B HD2  1 
ATOM   2680 H HD2  B PRO B 1 42  ? 44.670 1.208   24.483 0.44 9.86  ? 42   PRO B HD2  1 
ATOM   2681 H HD3  A PRO B 1 42  ? 43.938 -0.207  23.942 0.56 7.64  ? 42   PRO B HD3  1 
ATOM   2682 H HD3  B PRO B 1 42  ? 44.102 -0.098  23.703 0.44 9.86  ? 42   PRO B HD3  1 
ATOM   2683 N N    . VAL B 1 43  ? 48.401 0.477   25.453 1.00 5.61  ? 43   VAL B N    1 
ATOM   2684 C CA   . VAL B 1 43  ? 49.686 0.956   25.979 1.00 6.42  ? 43   VAL B CA   1 
ATOM   2685 C C    . VAL B 1 43  ? 49.362 1.754   27.242 1.00 5.84  ? 43   VAL B C    1 
ATOM   2686 O O    . VAL B 1 43  ? 48.455 2.574   27.257 1.00 7.17  ? 43   VAL B O    1 
ATOM   2687 C CB   A VAL B 1 43  ? 50.331 1.955   24.978 0.67 7.48  ? 43   VAL B CB   1 
ATOM   2688 C CB   B VAL B 1 43  ? 50.560 1.670   24.954 0.33 8.55  ? 43   VAL B CB   1 
ATOM   2689 C CG1  A VAL B 1 43  ? 51.684 2.451   25.547 0.67 10.66 ? 43   VAL B CG1  1 
ATOM   2690 C CG1  B VAL B 1 43  ? 50.861 0.892   23.693 0.33 14.33 ? 43   VAL B CG1  1 
ATOM   2691 C CG2  A VAL B 1 43  ? 50.683 1.344   23.646 0.67 10.24 ? 43   VAL B CG2  1 
ATOM   2692 C CG2  B VAL B 1 43  ? 49.830 2.957   24.635 0.33 10.56 ? 43   VAL B CG2  1 
ATOM   2693 H H    . VAL B 1 43  ? 47.702 1.010   25.488 1.00 6.73  ? 43   VAL B H    1 
ATOM   2694 H HA   A VAL B 1 43  ? 50.302 0.195   26.180 1.00 7.70  ? 43   VAL B HA   1 
ATOM   2695 H HB   A VAL B 1 43  ? 49.719 2.734   24.839 0.67 8.98  ? 43   VAL B HB   1 
ATOM   2696 H HB   B VAL B 1 43  ? 51.428 1.903   25.393 0.33 10.26 ? 43   VAL B HB   1 
ATOM   2697 H HG11 A VAL B 1 43  ? 52.275 1.684   25.698 0.67 15.99 ? 43   VAL B HG11 1 
ATOM   2698 H HG11 B VAL B 1 43  ? 50.021 0.603   23.279 0.33 21.49 ? 43   VAL B HG11 1 
ATOM   2699 H HG12 A VAL B 1 43  ? 52.102 3.064   24.907 0.67 15.99 ? 43   VAL B HG12 1 
ATOM   2700 H HG12 B VAL B 1 43  ? 51.355 1.462   23.067 0.33 21.49 ? 43   VAL B HG12 1 
ATOM   2701 H HG13 A VAL B 1 43  ? 51.531 2.917   26.395 0.67 15.99 ? 43   VAL B HG13 1 
ATOM   2702 H HG13 B VAL B 1 43  ? 51.402 0.106   23.916 0.33 21.49 ? 43   VAL B HG13 1 
ATOM   2703 H HG21 A VAL B 1 43  ? 49.876 0.971   23.234 0.67 15.35 ? 43   VAL B HG21 1 
ATOM   2704 H HG21 B VAL B 1 43  ? 49.630 3.435   25.467 0.33 15.85 ? 43   VAL B HG21 1 
ATOM   2705 H HG22 A VAL B 1 43  ? 51.061 2.033   23.060 0.67 15.35 ? 43   VAL B HG22 1 
ATOM   2706 H HG22 B VAL B 1 43  ? 50.394 3.519   24.063 0.33 15.85 ? 43   VAL B HG22 1 
ATOM   2707 H HG23 A VAL B 1 43  ? 51.342 0.631   23.778 0.67 15.35 ? 43   VAL B HG23 1 
ATOM   2708 H HG23 B VAL B 1 43  ? 48.994 2.751   24.167 0.33 15.85 ? 43   VAL B HG23 1 
ATOM   2709 N N    . ASN B 1 44  ? 50.134 1.522   28.300 1.00 4.94  ? 44   ASN B N    1 
ATOM   2710 C CA   . ASN B 1 44  ? 49.915 2.249   29.537 1.00 5.13  ? 44   ASN B CA   1 
ATOM   2711 C C    . ASN B 1 44  ? 51.143 2.193   30.421 1.00 6.04  ? 44   ASN B C    1 
ATOM   2712 O O    . ASN B 1 44  ? 51.561 1.117   30.776 1.00 14.03 ? 44   ASN B O    1 
ATOM   2713 C CB   . ASN B 1 44  ? 48.701 1.624   30.290 1.00 6.07  ? 44   ASN B CB   1 
ATOM   2714 C CG   . ASN B 1 44  ? 48.342 2.446   31.496 1.00 6.52  ? 44   ASN B CG   1 
ATOM   2715 O OD1  . ASN B 1 44  ? 47.651 3.467   31.380 1.00 8.38  ? 44   ASN B OD1  1 
ATOM   2716 N ND2  . ASN B 1 44  ? 48.784 2.011   32.682 1.00 5.66  ? 44   ASN B ND2  1 
ATOM   2717 H H    . ASN B 1 44  ? 50.779 0.925   28.250 1.00 5.93  ? 44   ASN B H    1 
ATOM   2718 H HA   . ASN B 1 44  ? 49.709 3.204   29.323 1.00 6.16  ? 44   ASN B HA   1 
ATOM   2719 H HB2  . ASN B 1 44  ? 47.923 1.575   29.680 1.00 7.28  ? 44   ASN B HB2  1 
ATOM   2720 H HB3  . ASN B 1 44  ? 48.927 0.702   30.574 1.00 7.28  ? 44   ASN B HB3  1 
ATOM   2721 H HD21 . ASN B 1 44  ? 49.273 1.280   32.729 1.00 6.80  ? 44   ASN B HD21 1 
ATOM   2722 H HD22 . ASN B 1 44  ? 48.586 2.455   33.416 1.00 6.80  ? 44   ASN B HD22 1 
ATOM   2723 N N    . THR B 1 45  ? 51.659 3.321   30.865 1.00 4.13  ? 45   THR B N    1 
ATOM   2724 C CA   . THR B 1 45  ? 52.838 3.364   31.690 1.00 3.96  ? 45   THR B CA   1 
ATOM   2725 C C    . THR B 1 45  ? 52.478 3.524   33.163 1.00 3.65  ? 45   THR B C    1 
ATOM   2726 O O    . THR B 1 45  ? 51.624 4.335   33.534 1.00 4.41  ? 45   THR B O    1 
ATOM   2727 C CB   . THR B 1 45  ? 53.741 4.549   31.248 1.00 4.44  ? 45   THR B CB   1 
ATOM   2728 O OG1  . THR B 1 45  ? 54.076 4.344   29.869 1.00 5.50  ? 45   THR B OG1  1 
ATOM   2729 C CG2  . THR B 1 45  ? 55.000 4.672   32.056 1.00 5.22  ? 45   THR B CG2  1 
ATOM   2730 H H    . THR B 1 45  ? 51.267 4.078   30.649 1.00 4.95  ? 45   THR B H    1 
ATOM   2731 H HA   . THR B 1 45  ? 53.346 2.510   31.573 1.00 4.76  ? 45   THR B HA   1 
ATOM   2732 H HB   . THR B 1 45  ? 53.221 5.399   31.331 1.00 5.33  ? 45   THR B HB   1 
ATOM   2733 H HG1  . THR B 1 45  ? 54.911 4.324   29.784 1.00 8.25  ? 45   THR B HG1  1 
ATOM   2734 H HG21 . THR B 1 45  ? 54.770 4.809   32.999 1.00 7.83  ? 45   THR B HG21 1 
ATOM   2735 H HG22 . THR B 1 45  ? 55.529 3.853   31.964 1.00 7.83  ? 45   THR B HG22 1 
ATOM   2736 H HG23 . THR B 1 45  ? 55.521 5.436   31.733 1.00 7.83  ? 45   THR B HG23 1 
ATOM   2737 N N    . PHE B 1 46  ? 53.207 2.776   34.012 1.00 3.36  ? 46   PHE B N    1 
ATOM   2738 C CA   . PHE B 1 46  ? 53.143 2.969   35.460 1.00 3.39  ? 46   PHE B CA   1 
ATOM   2739 C C    . PHE B 1 46  ? 54.432 3.621   35.955 1.00 3.37  ? 46   PHE B C    1 
ATOM   2740 O O    . PHE B 1 46  ? 55.527 3.327   35.471 1.00 4.11  ? 46   PHE B O    1 
ATOM   2741 C CB   . PHE B 1 46  ? 52.934 1.627   36.193 1.00 3.79  ? 46   PHE B CB   1 
ATOM   2742 C CG   . PHE B 1 46  ? 51.559 1.042   35.959 1.00 4.11  ? 46   PHE B CG   1 
ATOM   2743 C CD1  . PHE B 1 46  ? 50.488 1.474   36.721 1.00 5.14  ? 46   PHE B CD1  1 
ATOM   2744 C CD2  . PHE B 1 46  ? 51.363 0.073   34.973 1.00 4.43  ? 46   PHE B CD2  1 
ATOM   2745 C CE1  . PHE B 1 46  ? 49.192 0.971   36.483 1.00 6.29  ? 46   PHE B CE1  1 
ATOM   2746 C CE2  . PHE B 1 46  ? 50.079 -0.453  34.775 1.00 5.56  ? 46   PHE B CE2  1 
ATOM   2747 C CZ   . PHE B 1 46  ? 49.021 -0.005  35.543 1.00 6.56  ? 46   PHE B CZ   1 
ATOM   2748 H H    . PHE B 1 46  ? 53.737 2.154   33.687 1.00 4.03  ? 46   PHE B H    1 
ATOM   2749 H HA   . PHE B 1 46  ? 52.375 3.574   35.670 1.00 4.07  ? 46   PHE B HA   1 
ATOM   2750 H HB2  . PHE B 1 46  ? 53.617 0.980   35.883 1.00 4.55  ? 46   PHE B HB2  1 
ATOM   2751 H HB3  . PHE B 1 46  ? 53.066 1.765   37.164 1.00 4.55  ? 46   PHE B HB3  1 
ATOM   2752 H HD1  . PHE B 1 46  ? 50.627 2.114   37.409 1.00 6.17  ? 46   PHE B HD1  1 
ATOM   2753 H HD2  . PHE B 1 46  ? 52.092 -0.226  34.442 1.00 5.32  ? 46   PHE B HD2  1 
ATOM   2754 H HE1  . PHE B 1 46  ? 48.448 1.307   36.969 1.00 7.55  ? 46   PHE B HE1  1 
ATOM   2755 H HE2  . PHE B 1 46  ? 49.935 -1.118  34.112 1.00 6.68  ? 46   PHE B HE2  1 
ATOM   2756 H HZ   . PHE B 1 46  ? 48.159 -0.383  35.415 1.00 7.88  ? 46   PHE B HZ   1 
ATOM   2757 N N    . VAL B 1 47  ? 54.269 4.491   36.969 1.00 3.38  ? 47   VAL B N    1 
ATOM   2758 C CA   . VAL B 1 47  ? 55.384 5.229   37.548 1.00 3.14  ? 47   VAL B CA   1 
ATOM   2759 C C    . VAL B 1 47  ? 55.581 4.738   38.993 1.00 3.12  ? 47   VAL B C    1 
ATOM   2760 O O    . VAL B 1 47  ? 54.672 4.807   39.822 1.00 3.55  ? 47   VAL B O    1 
ATOM   2761 C CB   . VAL B 1 47  ? 55.129 6.742   37.510 1.00 3.64  ? 47   VAL B CB   1 
ATOM   2762 C CG1  . VAL B 1 47  ? 56.345 7.465   38.063 1.00 4.15  ? 47   VAL B CG1  1 
ATOM   2763 C CG2  . VAL B 1 47  ? 54.825 7.212   36.099 1.00 4.53  ? 47   VAL B CG2  1 
ATOM   2764 H H    . VAL B 1 47  ? 53.461 4.618   37.294 1.00 4.05  ? 47   VAL B H    1 
ATOM   2765 H HA   . VAL B 1 47  ? 56.211 5.028   37.024 1.00 3.76  ? 47   VAL B HA   1 
ATOM   2766 H HB   . VAL B 1 47  ? 54.342 6.948   38.092 1.00 4.37  ? 47   VAL B HB   1 
ATOM   2767 H HG11 . VAL B 1 47  ? 56.531 7.145   38.970 1.00 6.22  ? 47   VAL B HG11 1 
ATOM   2768 H HG12 . VAL B 1 47  ? 57.119 7.289   37.489 1.00 6.22  ? 47   VAL B HG12 1 
ATOM   2769 H HG13 . VAL B 1 47  ? 56.169 8.429   38.087 1.00 6.22  ? 47   VAL B HG13 1 
ATOM   2770 H HG21 . VAL B 1 47  ? 54.036 6.740   35.761 1.00 6.80  ? 47   VAL B HG21 1 
ATOM   2771 H HG22 . VAL B 1 47  ? 54.651 8.176   36.107 1.00 6.80  ? 47   VAL B HG22 1 
ATOM   2772 H HG23 . VAL B 1 47  ? 55.592 7.023   35.520 1.00 6.80  ? 47   VAL B HG23 1 
ATOM   2773 N N    . HIS B 1 48  ? 56.803 4.285   39.269 1.00 2.99  ? 48   HIS B N    1 
ATOM   2774 C CA   . HIS B 1 48  ? 57.177 3.724   40.574 1.00 3.21  ? 48   HIS B CA   1 
ATOM   2775 C C    . HIS B 1 48  ? 57.940 4.765   41.390 1.00 3.42  ? 48   HIS B C    1 
ATOM   2776 O O    . HIS B 1 48  ? 59.132 4.674   41.664 1.00 4.11  ? 48   HIS B O    1 
ATOM   2777 C CB   . HIS B 1 48  ? 58.013 2.465   40.396 1.00 3.40  ? 48   HIS B CB   1 
ATOM   2778 C CG   . HIS B 1 48  ? 57.308 1.488   39.519 1.00 3.34  ? 48   HIS B CG   1 
ATOM   2779 N ND1  . HIS B 1 48  ? 56.058 0.980   39.816 1.00 3.79  ? 48   HIS B ND1  1 
ATOM   2780 C CD2  . HIS B 1 48  ? 57.632 0.977   38.291 1.00 3.70  ? 48   HIS B CD2  1 
ATOM   2781 C CE1  . HIS B 1 48  ? 55.674 0.182   38.780 1.00 4.49  ? 48   HIS B CE1  1 
ATOM   2782 N NE2  . HIS B 1 48  ? 56.613 0.165   37.842 1.00 4.38  ? 48   HIS B NE2  1 
ATOM   2783 H H    . HIS B 1 48  ? 57.416 4.324   38.639 1.00 3.59  ? 48   HIS B H    1 
ATOM   2784 H HA   . HIS B 1 48  ? 56.341 3.484   41.068 1.00 3.86  ? 48   HIS B HA   1 
ATOM   2785 H HB2  . HIS B 1 48  ? 58.886 2.702   39.993 1.00 4.08  ? 48   HIS B HB2  1 
ATOM   2786 H HB3  . HIS B 1 48  ? 58.184 2.053   41.280 1.00 4.08  ? 48   HIS B HB3  1 
ATOM   2787 H HD1  . HIS B 1 48  ? 55.592 1.143   40.544 1.00 4.55  ? 48   HIS B HD1  1 
ATOM   2788 H HD2  . HIS B 1 48  ? 58.437 1.156   37.819 1.00 4.44  ? 48   HIS B HD2  1 
ATOM   2789 H HE1  . HIS B 1 48  ? 54.853 -0.294  38.736 1.00 5.39  ? 48   HIS B HE1  1 
ATOM   2790 N N    . GLU B 1 49  ? 57.189 5.821   41.729 1.00 3.51  ? 49   GLU B N    1 
ATOM   2791 C CA   . GLU B 1 49  ? 57.714 6.944   42.474 1.00 3.61  ? 49   GLU B CA   1 
ATOM   2792 C C    . GLU B 1 49  ? 56.592 7.445   43.366 1.00 3.57  ? 49   GLU B C    1 
ATOM   2793 O O    . GLU B 1 49  ? 55.422 7.141   43.136 1.00 4.25  ? 49   GLU B O    1 
ATOM   2794 C CB   . GLU B 1 49  ? 58.142 8.112   41.542 1.00 3.76  ? 49   GLU B CB   1 
ATOM   2795 C CG   . GLU B 1 49  ? 59.238 7.703   40.575 1.00 4.43  ? 49   GLU B CG   1 
ATOM   2796 C CD   . GLU B 1 49  ? 60.606 7.459   41.182 1.00 4.47  ? 49   GLU B CD   1 
ATOM   2797 O OE1  . GLU B 1 49  ? 60.831 7.835   42.360 1.00 5.26  ? 49   GLU B OE1  1 
ATOM   2798 O OE2  . GLU B 1 49  ? 61.489 6.948   40.426 1.00 4.91  ? 49   GLU B OE2  1 
ATOM   2799 H H    . GLU B 1 49  ? 56.343 5.832   41.488 1.00 4.21  ? 49   GLU B H    1 
ATOM   2800 H HA   . GLU B 1 49  ? 58.490 6.651   43.033 1.00 4.33  ? 49   GLU B HA   1 
ATOM   2801 H HB2  . GLU B 1 49  ? 57.355 8.423   41.028 1.00 4.51  ? 49   GLU B HB2  1 
ATOM   2802 H HB3  . GLU B 1 49  ? 58.462 8.868   42.095 1.00 4.51  ? 49   GLU B HB3  1 
ATOM   2803 H HG2  . GLU B 1 49  ? 58.952 6.876   40.114 1.00 5.32  ? 49   GLU B HG2  1 
ATOM   2804 H HG3  . GLU B 1 49  ? 59.325 8.410   39.888 1.00 5.32  ? 49   GLU B HG3  1 
ATOM   2805 N N    . SER B 1 50  ? 56.952 8.238   44.375 1.00 3.59  ? 50   SER B N    1 
ATOM   2806 C CA   . SER B 1 50  ? 55.960 8.882   45.190 1.00 3.73  ? 50   SER B CA   1 
ATOM   2807 C C    . SER B 1 50  ? 55.057 9.791   44.344 1.00 3.55  ? 50   SER B C    1 
ATOM   2808 O O    . SER B 1 50  ? 55.520 10.496  43.442 1.00 3.73  ? 50   SER B O    1 
ATOM   2809 C CB   A SER B 1 50  ? 56.699 9.786   46.189 0.63 4.69  ? 50   SER B CB   1 
ATOM   2810 C CB   B SER B 1 50  ? 56.585 9.663   46.328 0.37 4.30  ? 50   SER B CB   1 
ATOM   2811 O OG   A SER B 1 50  ? 55.828 10.587  46.895 0.63 5.44  ? 50   SER B OG   1 
ATOM   2812 O OG   B SER B 1 50  ? 56.999 10.961  45.956 0.37 4.40  ? 50   SER B OG   1 
ATOM   2813 H H    . SER B 1 50  ? 57.806 8.369   44.542 1.00 4.31  ? 50   SER B H    1 
ATOM   2814 H HA   A SER B 1 50  ? 55.413 8.201   45.676 1.00 4.48  ? 50   SER B HA   1 
ATOM   2815 H HB2  A SER B 1 50  ? 57.211 9.223   46.822 0.63 5.63  ? 50   SER B HB2  1 
ATOM   2816 H HB2  B SER B 1 50  ? 55.929 9.734   47.066 0.37 5.16  ? 50   SER B HB2  1 
ATOM   2817 H HB3  A SER B 1 50  ? 57.343 10.356  45.698 0.63 5.63  ? 50   SER B HB3  1 
ATOM   2818 H HB3  B SER B 1 50  ? 57.368 9.162   46.669 0.37 5.16  ? 50   SER B HB3  1 
ATOM   2819 H HG   A SER B 1 50  ? 55.371 11.045  46.358 0.63 8.16  ? 50   SER B HG   1 
ATOM   2820 H HG   B SER B 1 50  ? 56.335 11.401  45.688 0.37 6.59  ? 50   SER B HG   1 
ATOM   2821 N N    . LEU B 1 51  ? 53.810 9.850   44.741 1.00 4.30  ? 51   LEU B N    1 
ATOM   2822 C CA   . LEU B 1 51  ? 52.886 10.809  44.124 1.00 4.71  ? 51   LEU B CA   1 
ATOM   2823 C C    . LEU B 1 51  ? 53.416 12.241  44.265 1.00 3.98  ? 51   LEU B C    1 
ATOM   2824 O O    . LEU B 1 51  ? 53.228 13.056  43.372 1.00 4.47  ? 51   LEU B O    1 
ATOM   2825 C CB   . LEU B 1 51  ? 51.514 10.652  44.769 1.00 6.49  ? 51   LEU B CB   1 
ATOM   2826 C CG   . LEU B 1 51  ? 50.459 11.578  44.239 1.00 7.62  ? 51   LEU B CG   1 
ATOM   2827 C CD1  . LEU B 1 51  ? 50.192 11.387  42.808 1.00 8.37  ? 51   LEU B CD1  1 
ATOM   2828 C CD2  . LEU B 1 51  ? 49.181 11.410  45.053 1.00 11.50 ? 51   LEU B CD2  1 
ATOM   2829 H H    . LEU B 1 51  ? 53.527 9.314   45.379 1.00 5.16  ? 51   LEU B H    1 
ATOM   2830 H HA   . LEU B 1 51  ? 52.806 10.593  43.151 1.00 5.66  ? 51   LEU B HA   1 
ATOM   2831 H HB2  . LEU B 1 51  ? 51.210 9.719   44.639 1.00 7.78  ? 51   LEU B HB2  1 
ATOM   2832 H HB3  . LEU B 1 51  ? 51.605 10.803  45.744 1.00 7.78  ? 51   LEU B HB3  1 
ATOM   2833 H HG   . LEU B 1 51  ? 50.782 12.516  44.367 1.00 9.14  ? 51   LEU B HG   1 
ATOM   2834 H HD11 . LEU B 1 51  ? 51.024 11.495  42.303 1.00 12.55 ? 51   LEU B HD11 1 
ATOM   2835 H HD12 . LEU B 1 51  ? 49.834 10.487  42.660 1.00 12.55 ? 51   LEU B HD12 1 
ATOM   2836 H HD13 . LEU B 1 51  ? 49.538 12.052  42.507 1.00 12.55 ? 51   LEU B HD13 1 
ATOM   2837 H HD21 . LEU B 1 51  ? 49.379 11.548  46.003 1.00 17.24 ? 51   LEU B HD21 1 
ATOM   2838 H HD22 . LEU B 1 51  ? 48.518 12.068  44.758 1.00 17.24 ? 51   LEU B HD22 1 
ATOM   2839 H HD23 . LEU B 1 51  ? 48.826 10.506  44.921 1.00 17.24 ? 51   LEU B HD23 1 
ATOM   2840 N N    . ALA B 1 52  ? 54.036 12.570  45.413 1.00 3.85  ? 52   ALA B N    1 
ATOM   2841 C CA   . ALA B 1 52  ? 54.517 13.931  45.609 1.00 3.66  ? 52   ALA B CA   1 
ATOM   2842 C C    . ALA B 1 52  ? 55.610 14.308  44.596 1.00 3.52  ? 52   ALA B C    1 
ATOM   2843 O O    . ALA B 1 52  ? 55.702 15.442  44.143 1.00 3.82  ? 52   ALA B O    1 
ATOM   2844 C CB   . ALA B 1 52  ? 55.026 14.085  47.030 1.00 4.74  ? 52   ALA B CB   1 
ATOM   2845 H H    . ALA B 1 52  ? 54.150 11.966  46.043 1.00 4.62  ? 52   ALA B H    1 
ATOM   2846 H HA   . ALA B 1 52  ? 53.746 14.556  45.484 1.00 4.39  ? 52   ALA B HA   1 
ATOM   2847 H HB1  . ALA B 1 52  ? 55.800 13.498  47.165 1.00 7.11  ? 52   ALA B HB1  1 
ATOM   2848 H HB2  . ALA B 1 52  ? 54.316 13.840  47.659 1.00 7.11  ? 52   ALA B HB2  1 
ATOM   2849 H HB3  . ALA B 1 52  ? 55.292 15.016  47.182 1.00 7.11  ? 52   ALA B HB3  1 
ATOM   2850 N N    . ASP B 1 53  ? 56.487 13.332  44.267 1.00 3.40  ? 53   ASP B N    1 
ATOM   2851 C CA   . ASP B 1 53  ? 57.503 13.574  43.260 1.00 3.52  ? 53   ASP B CA   1 
ATOM   2852 C C    . ASP B 1 53  ? 56.881 13.745  41.887 1.00 3.67  ? 53   ASP B C    1 
ATOM   2853 O O    . ASP B 1 53  ? 57.323 14.600  41.088 1.00 4.22  ? 53   ASP B O    1 
ATOM   2854 C CB   . ASP B 1 53  ? 58.524 12.431  43.239 1.00 3.79  ? 53   ASP B CB   1 
ATOM   2855 C CG   . ASP B 1 53  ? 59.519 12.457  44.394 1.00 4.33  ? 53   ASP B CG   1 
ATOM   2856 O OD1  . ASP B 1 53  ? 60.100 13.551  44.642 1.00 4.96  ? 53   ASP B OD1  1 
ATOM   2857 O OD2  . ASP B 1 53  ? 59.780 11.403  44.971 1.00 6.87  ? 53   ASP B OD2  1 
ATOM   2858 H H    . ASP B 1 53  ? 56.441 12.549  44.665 1.00 4.08  ? 53   ASP B H    1 
ATOM   2859 H HA   . ASP B 1 53  ? 57.983 14.420  43.494 1.00 4.22  ? 53   ASP B HA   1 
ATOM   2860 H HB2  . ASP B 1 53  ? 58.036 11.570  43.260 1.00 4.55  ? 53   ASP B HB2  1 
ATOM   2861 H HB3  . ASP B 1 53  ? 59.026 12.470  42.386 1.00 4.55  ? 53   ASP B HB3  1 
ATOM   2862 N N    . VAL B 1 54  ? 55.853 12.966  41.568 1.00 3.41  ? 54   VAL B N    1 
ATOM   2863 C CA   . VAL B 1 54  ? 55.224 13.085  40.257 1.00 3.78  ? 54   VAL B CA   1 
ATOM   2864 C C    . VAL B 1 54  ? 54.439 14.403  40.145 1.00 3.58  ? 54   VAL B C    1 
ATOM   2865 O O    . VAL B 1 54  ? 54.485 15.074  39.135 1.00 4.11  ? 54   VAL B O    1 
ATOM   2866 C CB   . VAL B 1 54  ? 54.382 11.840  39.967 1.00 3.89  ? 54   VAL B CB   1 
ATOM   2867 C CG1  . VAL B 1 54  ? 53.630 11.993  38.653 1.00 4.81  ? 54   VAL B CG1  1 
ATOM   2868 C CG2  . VAL B 1 54  ? 55.289 10.612  39.919 1.00 4.25  ? 54   VAL B CG2  1 
ATOM   2869 H H    . VAL B 1 54  ? 55.550 12.378  42.148 1.00 4.09  ? 54   VAL B H    1 
ATOM   2870 H HA   . VAL B 1 54  ? 55.956 13.115  39.577 1.00 4.53  ? 54   VAL B HA   1 
ATOM   2871 H HB   . VAL B 1 54  ? 53.718 11.721  40.706 1.00 4.67  ? 54   VAL B HB   1 
ATOM   2872 H HG11 . VAL B 1 54  ? 53.057 12.787  38.695 1.00 7.22  ? 54   VAL B HG11 1 
ATOM   2873 H HG12 . VAL B 1 54  ? 54.271 12.091  37.919 1.00 7.22  ? 54   VAL B HG12 1 
ATOM   2874 H HG13 . VAL B 1 54  ? 53.077 11.198  38.499 1.00 7.22  ? 54   VAL B HG13 1 
ATOM   2875 H HG21 . VAL B 1 54  ? 55.768 10.526  40.770 1.00 6.38  ? 54   VAL B HG21 1 
ATOM   2876 H HG22 . VAL B 1 54  ? 54.746 9.810   39.767 1.00 6.38  ? 54   VAL B HG22 1 
ATOM   2877 H HG23 . VAL B 1 54  ? 55.936 10.712  39.189 1.00 6.38  ? 54   VAL B HG23 1 
ATOM   2878 N N    . GLN B 1 55  ? 53.737 14.794  41.239 1.00 4.24  ? 55   GLN B N    1 
ATOM   2879 C CA   . GLN B 1 55  ? 53.006 16.046  41.198 1.00 4.42  ? 55   GLN B CA   1 
ATOM   2880 C C    . GLN B 1 55  ? 53.926 17.221  40.902 1.00 4.34  ? 55   GLN B C    1 
ATOM   2881 O O    . GLN B 1 55  ? 53.556 18.158  40.207 1.00 5.00  ? 55   GLN B O    1 
ATOM   2882 C CB   . GLN B 1 55  ? 52.291 16.299  42.532 1.00 4.72  ? 55   GLN B CB   1 
ATOM   2883 C CG   . GLN B 1 55  ? 51.071 15.413  42.728 1.00 5.39  ? 55   GLN B CG   1 
ATOM   2884 C CD   . GLN B 1 55  ? 50.407 15.594  44.069 1.00 6.37  ? 55   GLN B CD   1 
ATOM   2885 O OE1  . GLN B 1 55  ? 51.033 16.104  45.008 1.00 10.59 ? 55   GLN B OE1  1 
ATOM   2886 N NE2  . GLN B 1 55  ? 49.176 15.153  44.163 1.00 7.35  ? 55   GLN B NE2  1 
ATOM   2887 H H    . GLN B 1 55  ? 53.725 14.294  41.963 1.00 5.09  ? 55   GLN B H    1 
ATOM   2888 H HA   . GLN B 1 55  ? 52.318 15.990  40.474 1.00 5.30  ? 55   GLN B HA   1 
ATOM   2889 H HB2  . GLN B 1 55  ? 52.928 16.139  43.273 1.00 5.67  ? 55   GLN B HB2  1 
ATOM   2890 H HB3  . GLN B 1 55  ? 52.011 17.247  42.572 1.00 5.67  ? 55   GLN B HB3  1 
ATOM   2891 H HG2  . GLN B 1 55  ? 50.413 15.612  42.015 1.00 6.46  ? 55   GLN B HG2  1 
ATOM   2892 H HG3  . GLN B 1 55  ? 51.344 14.466  42.630 1.00 6.46  ? 55   GLN B HG3  1 
ATOM   2893 H HE21 . GLN B 1 55  ? 48.781 14.799  43.461 1.00 8.82  ? 55   GLN B HE21 1 
ATOM   2894 H HE22 . GLN B 1 55  ? 48.745 15.210  44.928 1.00 8.82  ? 55   GLN B HE22 1 
ATOM   2895 N N    . ALA B 1 56  ? 55.152 17.195  41.476 1.00 3.79  ? 56   ALA B N    1 
ATOM   2896 C CA   . ALA B 1 56  ? 56.075 18.307  41.274 1.00 3.89  ? 56   ALA B CA   1 
ATOM   2897 C C    . ALA B 1 56  ? 56.531 18.430  39.828 1.00 3.71  ? 56   ALA B C    1 
ATOM   2898 O O    . ALA B 1 56  ? 57.026 19.511  39.439 1.00 3.91  ? 56   ALA B O    1 
ATOM   2899 C CB   . ALA B 1 56  ? 57.285 18.129  42.194 1.00 4.70  ? 56   ALA B CB   1 
ATOM   2900 H H    . ALA B 1 56  ? 55.392 16.508  41.970 1.00 4.55  ? 56   ALA B H    1 
ATOM   2901 H HA   . ALA B 1 56  ? 55.607 19.153  41.529 1.00 4.66  ? 56   ALA B HA   1 
ATOM   2902 H HB1  . ALA B 1 56  ? 56.980 18.046  43.122 1.00 7.05  ? 56   ALA B HB1  1 
ATOM   2903 H HB2  . ALA B 1 56  ? 57.775 17.320  41.937 1.00 7.05  ? 56   ALA B HB2  1 
ATOM   2904 H HB3  . ALA B 1 56  ? 57.874 18.908  42.112 1.00 7.05  ? 56   ALA B HB3  1 
ATOM   2905 N N    . VAL B 1 57  ? 56.402 17.375  39.028 1.00 3.45  ? 57   VAL B N    1 
ATOM   2906 C CA   . VAL B 1 57  ? 56.782 17.499  37.607 1.00 3.36  ? 57   VAL B CA   1 
ATOM   2907 C C    . VAL B 1 57  ? 55.998 18.616  36.938 1.00 3.35  ? 57   VAL B C    1 
ATOM   2908 O O    . VAL B 1 57  ? 56.493 19.243  35.997 1.00 3.74  ? 57   VAL B O    1 
ATOM   2909 C CB   . VAL B 1 57  ? 56.617 16.132  36.896 1.00 3.44  ? 57   VAL B CB   1 
ATOM   2910 C CG1  . VAL B 1 57  ? 56.939 16.260  35.409 1.00 3.97  ? 57   VAL B CG1  1 
ATOM   2911 C CG2  . VAL B 1 57  ? 57.535 15.108  37.566 1.00 3.87  ? 57   VAL B CG2  1 
ATOM   2912 H H    . VAL B 1 57  ? 56.095 16.613  39.342 1.00 4.14  ? 57   VAL B H    1 
ATOM   2913 H HA   . VAL B 1 57  ? 57.750 17.745  37.572 1.00 4.03  ? 57   VAL B HA   1 
ATOM   2914 H HB   . VAL B 1 57  ? 55.670 15.828  36.995 1.00 4.13  ? 57   VAL B HB   1 
ATOM   2915 H HG11 . VAL B 1 57  ? 56.342 16.921  35.001 1.00 5.96  ? 57   VAL B HG11 1 
ATOM   2916 H HG12 . VAL B 1 57  ? 57.869 16.550  35.300 1.00 5.96  ? 57   VAL B HG12 1 
ATOM   2917 H HG13 . VAL B 1 57  ? 56.814 15.392  34.971 1.00 5.96  ? 57   VAL B HG13 1 
ATOM   2918 H HG21 . VAL B 1 57  ? 57.315 15.047  38.519 1.00 5.81  ? 57   VAL B HG21 1 
ATOM   2919 H HG22 . VAL B 1 57  ? 57.411 14.232  37.145 1.00 5.81  ? 57   VAL B HG22 1 
ATOM   2920 H HG23 . VAL B 1 57  ? 58.468 15.390  37.463 1.00 5.81  ? 57   VAL B HG23 1 
ATOM   2921 N N    . CYS B 1 58  ? 54.778 18.913  37.419 1.00 3.65  ? 58   CYS B N    1 
ATOM   2922 C CA   . CYS B 1 58  ? 53.963 19.992  36.862 1.00 3.93  ? 58   CYS B CA   1 
ATOM   2923 C C    . CYS B 1 58  ? 54.581 21.390  36.986 1.00 3.89  ? 58   CYS B C    1 
ATOM   2924 O O    . CYS B 1 58  ? 54.009 22.324  36.438 1.00 4.79  ? 58   CYS B O    1 
ATOM   2925 C CB   . CYS B 1 58  ? 52.599 20.011  37.539 1.00 4.47  ? 58   CYS B CB   1 
ATOM   2926 S SG   . CYS B 1 58  ? 51.603 18.505  37.312 1.00 5.20  ? 58   CYS B SG   1 
ATOM   2927 H H    . CYS B 1 58  ? 54.459 18.442  38.090 1.00 4.38  ? 58   CYS B H    1 
ATOM   2928 H HA   . CYS B 1 58  ? 53.823 19.802  35.890 1.00 4.72  ? 58   CYS B HA   1 
ATOM   2929 H HB2  . CYS B 1 58  ? 52.732 20.157  38.509 1.00 5.36  ? 58   CYS B HB2  1 
ATOM   2930 H HB3  . CYS B 1 58  ? 52.086 20.782  37.189 1.00 5.36  ? 58   CYS B HB3  1 
ATOM   2931 N N    . SER B 1 59  ? 55.699 21.512  37.714 1.00 3.85  ? 59   SER B N    1 
ATOM   2932 C CA   . SER B 1 59  ? 56.437 22.769  37.828 1.00 3.92  ? 59   SER B CA   1 
ATOM   2933 C C    . SER B 1 59  ? 57.826 22.686  37.193 1.00 3.82  ? 59   SER B C    1 
ATOM   2934 O O    . SER B 1 59  ? 58.654 23.569  37.446 1.00 4.75  ? 59   SER B O    1 
ATOM   2935 C CB   A SER B 1 59  ? 56.504 23.327  39.235 0.60 5.19  ? 59   SER B CB   1 
ATOM   2936 C CB   B SER B 1 59  ? 56.636 23.020  39.352 0.40 4.80  ? 59   SER B CB   1 
ATOM   2937 O OG   A SER B 1 59  ? 57.113 22.428  40.084 0.60 8.25  ? 59   SER B OG   1 
ATOM   2938 O OG   B SER B 1 59  ? 55.343 23.262  39.950 0.40 6.17  ? 59   SER B OG   1 
ATOM   2939 H H    . SER B 1 59  ? 56.003 20.805  38.143 1.00 4.62  ? 59   SER B H    1 
ATOM   2940 H HA   A SER B 1 59  ? 55.926 23.439  37.289 1.00 4.71  ? 59   SER B HA   1 
ATOM   2941 H HB2  A SER B 1 59  ? 57.013 24.176  39.231 0.60 6.23  ? 59   SER B HB2  1 
ATOM   2942 H HB2  B SER B 1 59  ? 57.061 22.231  39.773 0.40 5.76  ? 59   SER B HB2  1 
ATOM   2943 H HB3  A SER B 1 59  ? 55.588 23.520  39.559 0.60 6.23  ? 59   SER B HB3  1 
ATOM   2944 H HB3  B SER B 1 59  ? 57.225 23.804  39.492 0.40 5.76  ? 59   SER B HB3  1 
ATOM   2945 H HG   A SER B 1 59  ? 56.696 21.699  40.066 0.60 12.37 ? 59   SER B HG   1 
ATOM   2946 H HG   B SER B 1 59  ? 54.876 22.566  39.898 0.40 9.25  ? 59   SER B HG   1 
ATOM   2947 N N    . GLN B 1 60  ? 58.097 21.656  36.378 1.00 3.87  ? 60   GLN B N    1 
ATOM   2948 C CA   . GLN B 1 60  ? 59.440 21.420  35.859 1.00 3.91  ? 60   GLN B CA   1 
ATOM   2949 C C    . GLN B 1 60  ? 59.523 21.915  34.412 1.00 4.00  ? 60   GLN B C    1 
ATOM   2950 O O    . GLN B 1 60  ? 59.200 23.074  34.173 1.00 5.16  ? 60   GLN B O    1 
ATOM   2951 C CB   . GLN B 1 60  ? 59.895 20.001  36.191 1.00 3.83  ? 60   GLN B CB   1 
ATOM   2952 C CG   . GLN B 1 60  ? 59.941 19.883  37.720 1.00 4.10  ? 60   GLN B CG   1 
ATOM   2953 C CD   . GLN B 1 60  ? 60.365 18.536  38.238 1.00 4.77  ? 60   GLN B CD   1 
ATOM   2954 O OE1  . GLN B 1 60  ? 60.623 17.580  37.544 1.00 4.38  ? 60   GLN B OE1  1 
ATOM   2955 N NE2  . GLN B 1 60  ? 60.307 18.430  39.530 1.00 17.07 ? 60   GLN B NE2  1 
ATOM   2956 H H    . GLN B 1 60  ? 57.448 21.107  36.150 1.00 4.64  ? 60   GLN B H    1 
ATOM   2957 H HA   . GLN B 1 60  ? 60.040 22.024  36.383 1.00 4.70  ? 60   GLN B HA   1 
ATOM   2958 H HB2  . GLN B 1 60  ? 59.260 19.340  35.815 1.00 4.60  ? 60   GLN B HB2  1 
ATOM   2959 H HB3  . GLN B 1 60  ? 60.791 19.830  35.807 1.00 4.60  ? 60   GLN B HB3  1 
ATOM   2960 H HG2  . GLN B 1 60  ? 60.565 20.566  38.070 1.00 4.92  ? 60   GLN B HG2  1 
ATOM   2961 H HG3  . GLN B 1 60  ? 59.041 20.089  38.079 1.00 4.92  ? 60   GLN B HG3  1 
ATOM   2962 H HE21 . GLN B 1 60  ? 60.119 19.135  40.021 1.00 20.49 ? 60   GLN B HE21 1 
ATOM   2963 H HE22 . GLN B 1 60  ? 60.457 17.653  39.915 1.00 20.49 ? 60   GLN B HE22 1 
ATOM   2964 N N    . LYS B 1 61  ? 60.055 21.128  33.469 1.00 4.36  ? 61   LYS B N    1 
ATOM   2965 C CA   . LYS B 1 61  ? 60.330 21.675  32.146 1.00 4.54  ? 61   LYS B CA   1 
ATOM   2966 C C    . LYS B 1 61  ? 59.077 21.670  31.287 1.00 4.61  ? 61   LYS B C    1 
ATOM   2967 O O    . LYS B 1 61  ? 58.522 20.607  30.996 1.00 5.39  ? 61   LYS B O    1 
ATOM   2968 C CB   . LYS B 1 61  ? 61.412 20.856  31.454 1.00 5.36  ? 61   LYS B CB   1 
ATOM   2969 C CG   . LYS B 1 61  ? 61.750 21.361  30.043 1.00 7.24  ? 61   LYS B CG   1 
ATOM   2970 C CD   . LYS B 1 61  ? 62.736 20.545  29.308 1.00 11.64 ? 61   LYS B CD   1 
ATOM   2971 C CE   . LYS B 1 61  ? 62.982 21.054  27.884 1.00 15.91 ? 61   LYS B CE   1 
ATOM   2972 N NZ   . LYS B 1 61  ? 63.822 20.271  26.998 1.00 30.97 ? 61   LYS B NZ   1 
ATOM   2973 H H    . LYS B 1 61  ? 60.238 20.286  33.647 1.00 5.23  ? 61   LYS B H    1 
ATOM   2974 H HA   . LYS B 1 61  ? 60.651 22.617  32.245 1.00 5.44  ? 61   LYS B HA   1 
ATOM   2975 H HB2  . LYS B 1 61  ? 62.233 20.877  32.007 1.00 6.43  ? 61   LYS B HB2  1 
ATOM   2976 H HB3  . LYS B 1 61  ? 61.113 19.914  31.394 1.00 6.43  ? 61   LYS B HB3  1 
ATOM   2977 H HG2  . LYS B 1 61  ? 60.914 21.396  29.513 1.00 8.69  ? 61   LYS B HG2  1 
ATOM   2978 H HG3  . LYS B 1 61  ? 62.097 22.285  30.114 1.00 8.69  ? 61   LYS B HG3  1 
ATOM   2979 H HD2  . LYS B 1 61  ? 63.592 20.549  29.805 1.00 13.96 ? 61   LYS B HD2  1 
ATOM   2980 H HD3  . LYS B 1 61  ? 62.414 19.610  29.266 1.00 13.96 ? 61   LYS B HD3  1 
ATOM   2981 H HE2  . LYS B 1 61  ? 62.100 21.159  27.447 1.00 19.10 ? 61   LYS B HE2  1 
ATOM   2982 H HE3  . LYS B 1 61  ? 63.380 21.958  27.954 1.00 19.10 ? 61   LYS B HE3  1 
ATOM   2983 H HZ1  . LYS B 1 61  ? 64.628 20.126  27.394 1.00 46.45 ? 61   LYS B HZ1  1 
ATOM   2984 H HZ2  . LYS B 1 61  ? 63.420 19.473  26.827 1.00 46.45 ? 61   LYS B HZ2  1 
ATOM   2985 H HZ3  . LYS B 1 61  ? 63.944 20.723  26.218 1.00 46.45 ? 61   LYS B HZ3  1 
ATOM   2986 N N    . ASN B 1 62  ? 58.596 22.835  30.860 1.00 4.49  ? 62   ASN B N    1 
ATOM   2987 C CA   . ASN B 1 62  ? 57.366 22.880  30.071 1.00 4.35  ? 62   ASN B CA   1 
ATOM   2988 C C    . ASN B 1 62  ? 57.659 22.450  28.625 1.00 4.41  ? 62   ASN B C    1 
ATOM   2989 O O    . ASN B 1 62  ? 58.601 22.978  28.026 1.00 5.86  ? 62   ASN B O    1 
ATOM   2990 C CB   . ASN B 1 62  ? 56.812 24.311  30.140 1.00 4.83  ? 62   ASN B CB   1 
ATOM   2991 C CG   . ASN B 1 62  ? 55.440 24.544  29.528 1.00 5.03  ? 62   ASN B CG   1 
ATOM   2992 O OD1  . ASN B 1 62  ? 55.156 25.660  29.079 1.00 5.78  ? 62   ASN B OD1  1 
ATOM   2993 N ND2  . ASN B 1 62  ? 54.575 23.571  29.585 1.00 6.11  ? 62   ASN B ND2  1 
ATOM   2994 H H    . ASN B 1 62  ? 59.020 23.581  31.053 1.00 5.39  ? 62   ASN B H    1 
ATOM   2995 H HA   . ASN B 1 62  ? 56.699 22.251  30.470 1.00 5.21  ? 62   ASN B HA   1 
ATOM   2996 H HB2  . ASN B 1 62  ? 56.773 24.581  31.092 1.00 5.80  ? 62   ASN B HB2  1 
ATOM   2997 H HB3  . ASN B 1 62  ? 57.456 24.913  29.689 1.00 5.80  ? 62   ASN B HB3  1 
ATOM   2998 H HD21 . ASN B 1 62  ? 54.813 22.789  29.911 1.00 7.34  ? 62   ASN B HD21 1 
ATOM   2999 H HD22 . ASN B 1 62  ? 53.753 23.696  29.299 1.00 7.34  ? 62   ASN B HD22 1 
ATOM   3000 N N    . VAL B 1 63  ? 56.865 21.534  28.119 1.00 4.54  ? 63   VAL B N    1 
ATOM   3001 C CA   . VAL B 1 63  ? 57.018 20.988  26.785 1.00 4.97  ? 63   VAL B CA   1 
ATOM   3002 C C    . VAL B 1 63  ? 55.637 20.850  26.145 1.00 5.13  ? 63   VAL B C    1 
ATOM   3003 O O    . VAL B 1 63  ? 54.595 20.837  26.796 1.00 5.58  ? 63   VAL B O    1 
ATOM   3004 C CB   . VAL B 1 63  ? 57.747 19.629  26.803 1.00 5.50  ? 63   VAL B CB   1 
ATOM   3005 C CG1  . VAL B 1 63  ? 59.114 19.739  27.407 1.00 6.69  ? 63   VAL B CG1  1 
ATOM   3006 C CG2  . VAL B 1 63  ? 56.937 18.554  27.522 1.00 6.13  ? 63   VAL B CG2  1 
ATOM   3007 H H    . VAL B 1 63  ? 56.203 21.236  28.617 1.00 5.44  ? 63   VAL B H    1 
ATOM   3008 H HA   . VAL B 1 63  ? 57.557 21.630  26.240 1.00 5.96  ? 63   VAL B HA   1 
ATOM   3009 H HB   . VAL B 1 63  ? 57.860 19.335  25.853 1.00 6.60  ? 63   VAL B HB   1 
ATOM   3010 H HG11 . VAL B 1 63  ? 59.628 20.423  26.929 1.00 10.03 ? 63   VAL B HG11 1 
ATOM   3011 H HG12 . VAL B 1 63  ? 59.034 19.991  28.351 1.00 10.03 ? 63   VAL B HG12 1 
ATOM   3012 H HG13 . VAL B 1 63  ? 59.573 18.876  27.337 1.00 10.03 ? 63   VAL B HG13 1 
ATOM   3013 H HG21 . VAL B 1 63  ? 56.049 18.487  27.114 1.00 9.19  ? 63   VAL B HG21 1 
ATOM   3014 H HG22 . VAL B 1 63  ? 57.398 17.693  27.446 1.00 9.19  ? 63   VAL B HG22 1 
ATOM   3015 H HG23 . VAL B 1 63  ? 56.845 18.793  28.468 1.00 9.19  ? 63   VAL B HG23 1 
ATOM   3016 N N    . ALA B 1 64  ? 55.636 20.733  24.804 1.00 5.79  ? 64   ALA B N    1 
ATOM   3017 C CA   . ALA B 1 64  ? 54.410 20.475  24.092 1.00 6.20  ? 64   ALA B CA   1 
ATOM   3018 C C    . ALA B 1 64  ? 53.909 19.064  24.368 1.00 6.05  ? 64   ALA B C    1 
ATOM   3019 O O    . ALA B 1 64  ? 54.675 18.134  24.405 1.00 7.52  ? 64   ALA B O    1 
ATOM   3020 C CB   . ALA B 1 64  ? 54.673 20.644  22.578 1.00 8.76  ? 64   ALA B CB   1 
ATOM   3021 H H    . ALA B 1 64  ? 56.390 20.813  24.358 1.00 6.95  ? 64   ALA B H    1 
ATOM   3022 H HA   . ALA B 1 64  ? 53.716 21.134  24.381 1.00 7.44  ? 64   ALA B HA   1 
ATOM   3023 H HB1  . ALA B 1 64  ? 55.336 19.984  22.286 1.00 13.14 ? 64   ALA B HB1  1 
ATOM   3024 H HB2  . ALA B 1 64  ? 53.838 20.509  22.084 1.00 13.14 ? 64   ALA B HB2  1 
ATOM   3025 H HB3  . ALA B 1 64  ? 55.013 21.547  22.404 1.00 13.14 ? 64   ALA B HB3  1 
ATOM   3026 N N    . CYS B 1 65  ? 52.574 18.941  24.495 1.00 6.25  ? 65   CYS B N    1 
ATOM   3027 C CA   . CYS B 1 65  ? 51.941 17.659  24.649 1.00 6.12  ? 65   CYS B CA   1 
ATOM   3028 C C    . CYS B 1 65  ? 51.849 16.915  23.291 1.00 7.17  ? 65   CYS B C    1 
ATOM   3029 O O    . CYS B 1 65  ? 51.512 17.522  22.274 1.00 10.54 ? 65   CYS B O    1 
ATOM   3030 C CB   . CYS B 1 65  ? 50.542 17.832  25.191 1.00 7.36  ? 65   CYS B CB   1 
ATOM   3031 S SG   . CYS B 1 65  ? 50.417 18.638  26.791 1.00 7.99  ? 65   CYS B SG   1 
ATOM   3032 H H    . CYS B 1 65  ? 52.074 19.666  24.483 1.00 7.50  ? 65   CYS B H    1 
ATOM   3033 H HA   . CYS B 1 65  ? 52.474 17.106  25.289 1.00 7.34  ? 65   CYS B HA   1 
ATOM   3034 H HB2  . CYS B 1 65  ? 50.017 18.357  24.536 1.00 8.83  ? 65   CYS B HB2  1 
ATOM   3035 H HB3  . CYS B 1 65  ? 50.122 16.938  25.260 1.00 8.83  ? 65   CYS B HB3  1 
ATOM   3036 N N    . LYS B 1 66  ? 51.984 15.609  23.339 1.00 6.66  ? 66   LYS B N    1 
ATOM   3037 C CA   . LYS B 1 66  ? 51.657 14.789  22.204 1.00 6.57  ? 66   LYS B CA   1 
ATOM   3038 C C    . LYS B 1 66  ? 50.205 14.396  22.095 1.00 7.01  ? 66   LYS B C    1 
ATOM   3039 O O    . LYS B 1 66  ? 49.662 14.257  20.989 1.00 8.06  ? 66   LYS B O    1 
ATOM   3040 C CB   . LYS B 1 66  ? 52.467 13.511  22.272 1.00 8.16  ? 66   LYS B CB   1 
ATOM   3041 C CG   A LYS B 1 66  ? 54.029 13.615  22.249 0.58 12.01 ? 66   LYS B CG   1 
ATOM   3042 C CG   B LYS B 1 66  ? 53.939 13.892  22.012 0.41 8.06  ? 66   LYS B CG   1 
ATOM   3043 C CD   A LYS B 1 66  ? 54.418 14.364  20.998 0.58 16.94 ? 66   LYS B CD   1 
ATOM   3044 C CD   B LYS B 1 66  ? 54.891 12.861  22.509 0.41 12.14 ? 66   LYS B CD   1 
ATOM   3045 C CE   A LYS B 1 66  ? 55.868 14.358  20.598 0.58 22.06 ? 66   LYS B CE   1 
ATOM   3046 C CE   B LYS B 1 66  ? 56.354 13.203  22.226 0.41 18.12 ? 66   LYS B CE   1 
ATOM   3047 N NZ   A LYS B 1 66  ? 56.084 15.167  19.279 0.58 21.48 ? 66   LYS B NZ   1 
ATOM   3048 N NZ   B LYS B 1 66  ? 57.139 11.923  22.263 0.41 31.60 ? 66   LYS B NZ   1 
ATOM   3049 H H    . LYS B 1 66  ? 52.279 15.230  24.077 1.00 7.99  ? 66   LYS B H    1 
ATOM   3050 H HA   . LYS B 1 66  ? 51.914 15.283  21.373 1.00 7.88  ? 66   LYS B HA   1 
ATOM   3051 H HB2  A LYS B 1 66  ? 52.209 13.035  23.101 1.00 9.80  ? 66   LYS B HB2  1 
ATOM   3052 H HB3  A LYS B 1 66  ? 52.192 12.940  21.511 1.00 9.80  ? 66   LYS B HB3  1 
ATOM   3053 H HG2  A LYS B 1 66  ? 54.351 14.098  23.051 0.58 14.41 ? 66   LYS B HG2  1 
ATOM   3054 H HG2  B LYS B 1 66  ? 54.075 14.015  21.039 0.41 9.68  ? 66   LYS B HG2  1 
ATOM   3055 H HG3  A LYS B 1 66  ? 54.432 12.711  22.245 0.58 14.41 ? 66   LYS B HG3  1 
ATOM   3056 H HG3  B LYS B 1 66  ? 54.134 14.754  22.458 0.41 9.68  ? 66   LYS B HG3  1 
ATOM   3057 H HD2  A LYS B 1 66  ? 53.894 13.991  20.245 0.58 20.33 ? 66   LYS B HD2  1 
ATOM   3058 H HD2  B LYS B 1 66  ? 54.769 12.756  23.486 0.41 14.57 ? 66   LYS B HD2  1 
ATOM   3059 H HD3  A LYS B 1 66  ? 54.138 15.307  21.110 0.58 20.33 ? 66   LYS B HD3  1 
ATOM   3060 H HD3  B LYS B 1 66  ? 54.676 11.993  22.083 0.41 14.57 ? 66   LYS B HD3  1 
ATOM   3061 H HE2  A LYS B 1 66  ? 56.412 14.757  21.322 0.58 26.47 ? 66   LYS B HE2  1 
ATOM   3062 H HE2  B LYS B 1 66  ? 56.439 13.629  21.337 0.41 21.74 ? 66   LYS B HE2  1 
ATOM   3063 H HE3  A LYS B 1 66  ? 56.170 13.425  20.465 0.58 26.47 ? 66   LYS B HE3  1 
ATOM   3064 H HE3  B LYS B 1 66  ? 56.695 13.833  22.909 0.41 21.74 ? 66   LYS B HE3  1 
ATOM   3065 H HZ1  A LYS B 1 66  ? 55.557 14.823  18.622 0.58 32.21 ? 66   LYS B HZ1  1 
ATOM   3066 H HZ1  B LYS B 1 66  ? 56.726 11.299  21.746 0.41 47.40 ? 66   LYS B HZ1  1 
ATOM   3067 H HZ2  A LYS B 1 66  ? 55.865 16.039  19.418 0.58 32.21 ? 66   LYS B HZ2  1 
ATOM   3068 H HZ2  B LYS B 1 66  ? 57.978 12.073  21.945 0.41 47.40 ? 66   LYS B HZ2  1 
ATOM   3069 H HZ3  A LYS B 1 66  ? 56.957 15.111  19.028 0.58 32.21 ? 66   LYS B HZ3  1 
ATOM   3070 H HZ3  B LYS B 1 66  ? 57.188 11.623  23.121 0.41 47.40 ? 66   LYS B HZ3  1 
HETATM 3071 N N    . IAS B 1 67  ? 49.498 14.248  23.259 1.00 6.97  ? 67   IAS B N    1 
HETATM 3072 C CA   . IAS B 1 67  ? 48.105 13.864  23.263 1.00 7.14  ? 67   IAS B CA   1 
HETATM 3073 C C    . IAS B 1 67  ? 47.850 12.569  22.473 1.00 6.46  ? 67   IAS B C    1 
HETATM 3074 O O    . IAS B 1 67  ? 46.794 12.412  21.851 1.00 8.92  ? 67   IAS B O    1 
HETATM 3075 C CB   . IAS B 1 67  ? 47.150 14.974  22.822 1.00 9.48  ? 67   IAS B CB   1 
HETATM 3076 C CG   . IAS B 1 67  ? 47.091 16.074  23.866 1.00 12.56 ? 67   IAS B CG   1 
HETATM 3077 O OD1  . IAS B 1 67  ? 46.958 15.838  25.075 1.00 21.86 ? 67   IAS B OD1  1 
HETATM 3078 H H    . IAS B 1 67  ? 49.904 14.390  24.026 1.00 8.37  ? 67   IAS B H    1 
HETATM 3079 H HA   . IAS B 1 67  ? 47.875 13.660  24.215 1.00 8.56  ? 67   IAS B HA   1 
HETATM 3080 H HB2  . IAS B 1 67  ? 47.458 15.353  21.960 1.00 11.37 ? 67   IAS B HB2  1 
HETATM 3081 H HB3  . IAS B 1 67  ? 46.245 14.598  22.686 1.00 11.37 ? 67   IAS B HB3  1 
ATOM   3082 N N    . GLY B 1 68  ? 47.059 17.361  23.374 1.00 12.26 ? 68   GLY B N    1 
ATOM   3083 C CA   . GLY B 1 68  ? 46.932 18.461  24.298 1.00 11.65 ? 68   GLY B CA   1 
ATOM   3084 C C    . GLY B 1 68  ? 47.504 19.698  23.644 1.00 11.83 ? 68   GLY B C    1 
ATOM   3085 O O    . GLY B 1 68  ? 47.739 19.756  22.355 1.00 14.35 ? 68   GLY B O    1 
ATOM   3086 H H    . GLY B 1 68  ? 47.115 17.510  22.509 1.00 14.71 ? 68   GLY B H    1 
ATOM   3087 H HA2  . GLY B 1 68  ? 45.979 18.606  24.524 1.00 13.98 ? 68   GLY B HA2  1 
ATOM   3088 H HA3  . GLY B 1 68  ? 47.424 18.261  25.134 1.00 13.98 ? 68   GLY B HA3  1 
ATOM   3089 N N    . GLN B 1 69  ? 47.670 20.699  24.487 1.00 10.28 ? 69   GLN B N    1 
ATOM   3090 C CA   . GLN B 1 69  ? 48.248 21.980  24.117 1.00 9.27  ? 69   GLN B CA   1 
ATOM   3091 C C    . GLN B 1 69  ? 49.727 21.960  24.543 1.00 8.13  ? 69   GLN B C    1 
ATOM   3092 O O    . GLN B 1 69  ? 50.518 21.058  24.131 1.00 8.84  ? 69   GLN B O    1 
ATOM   3093 C CB   . GLN B 1 69  ? 47.390 23.098  24.706 1.00 11.87 ? 69   GLN B CB   1 
ATOM   3094 C CG   . GLN B 1 69  ? 45.906 23.051  24.286 1.00 16.76 ? 69   GLN B CG   1 
ATOM   3095 C CD   . GLN B 1 69  ? 45.091 22.045  25.102 1.00 12.85 ? 69   GLN B CD   1 
ATOM   3096 O OE1  . GLN B 1 69  ? 45.278 21.845  26.338 1.00 20.82 ? 69   GLN B OE1  1 
ATOM   3097 N NE2  . GLN B 1 69  ? 44.191 21.463  24.320 1.00 18.77 ? 69   GLN B NE2  1 
ATOM   3098 H H    . GLN B 1 69  ? 47.416 20.585  25.322 1.00 12.33 ? 69   GLN B H    1 
ATOM   3099 H HA   . GLN B 1 69  ? 48.214 22.057  23.121 1.00 11.12 ? 69   GLN B HA   1 
ATOM   3100 H HB2  . GLN B 1 69  ? 47.441 23.050  25.694 1.00 14.25 ? 69   GLN B HB2  1 
ATOM   3101 H HB3  . GLN B 1 69  ? 47.770 23.969  24.429 1.00 14.25 ? 69   GLN B HB3  1 
ATOM   3102 H HG2  . GLN B 1 69  ? 45.511 23.952  24.396 1.00 20.11 ? 69   GLN B HG2  1 
ATOM   3103 H HG3  . GLN B 1 69  ? 45.850 22.810  23.327 1.00 20.11 ? 69   GLN B HG3  1 
ATOM   3104 H HE21 . GLN B 1 69  ? 44.145 21.677  23.468 1.00 22.53 ? 69   GLN B HE21 1 
ATOM   3105 H HE22 . GLN B 1 69  ? 43.640 20.864  24.654 1.00 22.53 ? 69   GLN B HE22 1 
ATOM   3106 N N    . THR B 1 70  ? 50.105 22.890  25.381 1.00 7.02  ? 70   THR B N    1 
ATOM   3107 C CA   . THR B 1 70  ? 51.414 22.932  25.964 1.00 7.16  ? 70   THR B CA   1 
ATOM   3108 C C    . THR B 1 70  ? 51.387 22.917  27.459 1.00 6.24  ? 70   THR B C    1 
ATOM   3109 O O    . THR B 1 70  ? 52.314 23.341  28.109 1.00 9.11  ? 70   THR B O    1 
ATOM   3110 C CB   . THR B 1 70  ? 52.219 24.174  25.472 1.00 7.19  ? 70   THR B CB   1 
ATOM   3111 O OG1  . THR B 1 70  ? 51.530 25.371  25.846 1.00 7.66  ? 70   THR B OG1  1 
ATOM   3112 C CG2  . THR B 1 70  ? 52.350 24.131  23.948 1.00 10.09 ? 70   THR B CG2  1 
ATOM   3113 H H    . THR B 1 70  ? 49.529 23.519  25.598 1.00 8.42  ? 70   THR B H    1 
ATOM   3114 H HA   . THR B 1 70  ? 51.906 22.115  25.662 1.00 8.59  ? 70   THR B HA   1 
ATOM   3115 H HB   . THR B 1 70  ? 53.129 24.169  25.886 1.00 8.63  ? 70   THR B HB   1 
ATOM   3116 H HG1  . THR B 1 70  ? 51.374 25.831  25.161 1.00 11.49 ? 70   THR B HG1  1 
ATOM   3117 H HG21 . THR B 1 70  ? 51.457 24.121  23.544 1.00 15.14 ? 70   THR B HG21 1 
ATOM   3118 H HG22 . THR B 1 70  ? 52.840 24.921  23.639 1.00 15.14 ? 70   THR B HG22 1 
ATOM   3119 H HG23 . THR B 1 70  ? 52.836 23.322  23.685 1.00 15.14 ? 70   THR B HG23 1 
ATOM   3120 N N    . ASN B 1 71  ? 50.362 22.301  28.047 1.00 6.69  ? 71   ASN B N    1 
ATOM   3121 C CA   . ASN B 1 71  ? 50.297 22.078  29.464 1.00 6.62  ? 71   ASN B CA   1 
ATOM   3122 C C    . ASN B 1 71  ? 50.937 20.717  29.878 1.00 5.69  ? 71   ASN B C    1 
ATOM   3123 O O    . ASN B 1 71  ? 50.452 20.054  30.777 1.00 6.25  ? 71   ASN B O    1 
ATOM   3124 C CB   . ASN B 1 71  ? 48.883 22.163  29.992 1.00 9.42  ? 71   ASN B CB   1 
ATOM   3125 C CG   . ASN B 1 71  ? 48.043 21.106  29.316 1.00 12.23 ? 71   ASN B CG   1 
ATOM   3126 O OD1  . ASN B 1 71  ? 48.053 20.920  28.044 1.00 14.09 ? 71   ASN B OD1  1 
ATOM   3127 N ND2  . ASN B 1 71  ? 47.237 20.404  30.153 1.00 18.49 ? 71   ASN B ND2  1 
ATOM   3128 H H    . ASN B 1 71  ? 49.696 22.018  27.545 1.00 8.03  ? 71   ASN B H    1 
ATOM   3129 H HA   . ASN B 1 71  ? 50.825 22.803  29.905 1.00 7.95  ? 71   ASN B HA   1 
ATOM   3130 H HB2  . ASN B 1 71  ? 48.880 22.020  30.972 1.00 11.31 ? 71   ASN B HB2  1 
ATOM   3131 H HB3  . ASN B 1 71  ? 48.508 23.061  29.808 1.00 11.31 ? 71   ASN B HB3  1 
ATOM   3132 H HD21 . ASN B 1 71  ? 47.258 20.559  31.019 1.00 22.19 ? 71   ASN B HD21 1 
ATOM   3133 H HD22 . ASN B 1 71  ? 46.693 19.792  29.829 1.00 22.19 ? 71   ASN B HD22 1 
ATOM   3134 N N    . CYS B 1 72  ? 52.049 20.374  29.238 1.00 5.39  ? 72   CYS B N    1 
ATOM   3135 C CA   . CYS B 1 72  ? 52.839 19.215  29.584 1.00 4.78  ? 72   CYS B CA   1 
ATOM   3136 C C    . CYS B 1 72  ? 54.186 19.629  30.162 1.00 4.20  ? 72   CYS B C    1 
ATOM   3137 O O    . CYS B 1 72  ? 54.714 20.704  29.863 1.00 4.37  ? 72   CYS B O    1 
ATOM   3138 C CB   . CYS B 1 72  ? 53.023 18.277  28.384 1.00 5.17  ? 72   CYS B CB   1 
ATOM   3139 S SG   . CYS B 1 72  ? 51.498 17.349  28.013 1.00 6.78  ? 72   CYS B SG   1 
ATOM   3140 H H    . CYS B 1 72  ? 52.319 20.879  28.570 1.00 6.46  ? 72   CYS B H    1 
ATOM   3141 H HA   . CYS B 1 72  ? 52.346 18.710  30.293 1.00 5.73  ? 72   CYS B HA   1 
ATOM   3142 H HB2  . CYS B 1 72  ? 53.283 18.809  27.591 1.00 6.20  ? 72   CYS B HB2  1 
ATOM   3143 H HB3  . CYS B 1 72  ? 53.755 17.639  28.577 1.00 6.20  ? 72   CYS B HB3  1 
ATOM   3144 N N    . TYR B 1 73  ? 54.728 18.735  30.970 1.00 3.88  ? 73   TYR B N    1 
ATOM   3145 C CA   . TYR B 1 73  ? 55.951 19.045  31.712 1.00 3.88  ? 73   TYR B CA   1 
ATOM   3146 C C    . TYR B 1 73  ? 56.783 17.755  31.807 1.00 3.89  ? 73   TYR B C    1 
ATOM   3147 O O    . TYR B 1 73  ? 56.254 16.676  32.096 1.00 4.10  ? 73   TYR B O    1 
ATOM   3148 C CB   . TYR B 1 73  ? 55.626 19.550  33.130 1.00 4.63  ? 73   TYR B CB   1 
ATOM   3149 C CG   . TYR B 1 73  ? 54.765 20.783  33.110 1.00 4.49  ? 73   TYR B CG   1 
ATOM   3150 C CD1  . TYR B 1 73  ? 53.364 20.648  33.021 1.00 4.60  ? 73   TYR B CD1  1 
ATOM   3151 C CD2  . TYR B 1 73  ? 55.295 22.059  33.146 1.00 4.57  ? 73   TYR B CD2  1 
ATOM   3152 C CE1  . TYR B 1 73  ? 52.550 21.780  32.941 1.00 4.77  ? 73   TYR B CE1  1 
ATOM   3153 C CE2  . TYR B 1 73  ? 54.487 23.202  33.081 1.00 4.85  ? 73   TYR B CE2  1 
ATOM   3154 C CZ   . TYR B 1 73  ? 53.118 23.052  32.961 1.00 4.71  ? 73   TYR B CZ   1 
ATOM   3155 O OH   . TYR B 1 73  ? 52.334 24.180  32.900 1.00 5.37  ? 73   TYR B OH   1 
ATOM   3156 H H    . TYR B 1 73  ? 54.351 17.945  31.062 1.00 4.66  ? 73   TYR B H    1 
ATOM   3157 H HA   . TYR B 1 73  ? 56.472 19.743  31.220 1.00 4.66  ? 73   TYR B HA   1 
ATOM   3158 H HB2  . TYR B 1 73  ? 55.158 18.835  33.630 1.00 5.55  ? 73   TYR B HB2  1 
ATOM   3159 H HB3  . TYR B 1 73  ? 56.471 19.751  33.605 1.00 5.55  ? 73   TYR B HB3  1 
ATOM   3160 H HD1  . TYR B 1 73  ? 52.971 19.782  33.015 1.00 5.53  ? 73   TYR B HD1  1 
ATOM   3161 H HD2  . TYR B 1 73  ? 56.237 22.165  33.216 1.00 5.49  ? 73   TYR B HD2  1 
ATOM   3162 H HE1  . TYR B 1 73  ? 51.607 21.683  32.873 1.00 5.72  ? 73   TYR B HE1  1 
ATOM   3163 H HE2  . TYR B 1 73  ? 54.874 24.068  33.120 1.00 5.82  ? 73   TYR B HE2  1 
ATOM   3164 H HH   . TYR B 1 73  ? 51.527 23.958  32.825 1.00 8.06  ? 73   TYR B HH   1 
ATOM   3165 N N    . GLN B 1 74  ? 58.076 17.947  31.593 1.00 4.28  ? 74   GLN B N    1 
ATOM   3166 C CA   . GLN B 1 74  ? 59.073 16.888  31.634 1.00 4.01  ? 74   GLN B CA   1 
ATOM   3167 C C    . GLN B 1 74  ? 59.838 16.945  32.953 1.00 4.00  ? 74   GLN B C    1 
ATOM   3168 O O    . GLN B 1 74  ? 60.282 18.001  33.390 1.00 4.90  ? 74   GLN B O    1 
ATOM   3169 C CB   . GLN B 1 74  ? 60.033 17.062  30.455 1.00 4.76  ? 74   GLN B CB   1 
ATOM   3170 C CG   . GLN B 1 74  ? 61.091 15.982  30.362 1.00 5.67  ? 74   GLN B CG   1 
ATOM   3171 C CD   . GLN B 1 74  ? 61.967 16.232  29.127 1.00 9.52  ? 74   GLN B CD   1 
ATOM   3172 O OE1  . GLN B 1 74  ? 61.399 16.398  28.019 1.00 12.67 ? 74   GLN B OE1  1 
ATOM   3173 N NE2  . GLN B 1 74  ? 63.211 16.148  29.237 1.00 14.08 ? 74   GLN B NE2  1 
ATOM   3174 H H    . GLN B 1 74  ? 58.349 18.764  31.414 1.00 5.14  ? 74   GLN B H    1 
ATOM   3175 H HA   . GLN B 1 74  ? 58.615 16.002  31.558 1.00 4.82  ? 74   GLN B HA   1 
ATOM   3176 H HB2  . GLN B 1 74  ? 59.509 17.067  29.615 1.00 5.71  ? 74   GLN B HB2  1 
ATOM   3177 H HB3  . GLN B 1 74  ? 60.481 17.941  30.535 1.00 5.71  ? 74   GLN B HB3  1 
ATOM   3178 H HG2  . GLN B 1 74  ? 61.651 15.991  31.178 1.00 6.80  ? 74   GLN B HG2  1 
ATOM   3179 H HG3  . GLN B 1 74  ? 60.659 15.094  30.293 1.00 6.80  ? 74   GLN B HG3  1 
ATOM   3180 H HE21 . GLN B 1 74  ? 63.576 16.031  30.029 1.00 16.90 ? 74   GLN B HE21 1 
ATOM   3181 H HE22 . GLN B 1 74  ? 63.720 16.205  28.522 1.00 16.90 ? 74   GLN B HE22 1 
ATOM   3182 N N    . SER B 1 75  ? 59.997 15.764  33.555 1.00 3.86  ? 75   SER B N    1 
ATOM   3183 C CA   . SER B 1 75  ? 60.659 15.686  34.851 1.00 3.57  ? 75   SER B CA   1 
ATOM   3184 C C    . SER B 1 75  ? 62.149 15.991  34.723 1.00 3.99  ? 75   SER B C    1 
ATOM   3185 O O    . SER B 1 75  ? 62.837 15.510  33.824 1.00 5.56  ? 75   SER B O    1 
ATOM   3186 C CB   . SER B 1 75  ? 60.433 14.311  35.482 1.00 3.70  ? 75   SER B CB   1 
ATOM   3187 O OG   . SER B 1 75  ? 61.025 13.240  34.756 1.00 4.05  ? 75   SER B OG   1 
ATOM   3188 H H    . SER B 1 75  ? 59.701 15.031  33.168 1.00 4.64  ? 75   SER B H    1 
ATOM   3189 H HA   . SER B 1 75  ? 60.251 16.374  35.451 1.00 4.29  ? 75   SER B HA   1 
ATOM   3190 H HB2  . SER B 1 75  ? 60.804 14.316  36.400 1.00 4.45  ? 75   SER B HB2  1 
ATOM   3191 H HB3  . SER B 1 75  ? 59.459 14.148  35.552 1.00 4.45  ? 75   SER B HB3  1 
ATOM   3192 H HG   . SER B 1 75  ? 61.855 13.360  34.707 1.00 6.07  ? 75   SER B HG   1 
ATOM   3193 N N    . TYR B 1 76  ? 62.657 16.731  35.718 1.00 3.98  ? 76   TYR B N    1 
ATOM   3194 C CA   . TYR B 1 76  ? 64.083 16.951  35.823 1.00 4.73  ? 76   TYR B CA   1 
ATOM   3195 C C    . TYR B 1 76  ? 64.797 15.635  36.194 1.00 4.88  ? 76   TYR B C    1 
ATOM   3196 O O    . TYR B 1 76  ? 65.899 15.333  35.720 1.00 6.80  ? 76   TYR B O    1 
ATOM   3197 C CB   . TYR B 1 76  ? 64.402 17.982  36.908 1.00 6.15  ? 76   TYR B CB   1 
ATOM   3198 C CG   . TYR B 1 76  ? 63.890 19.389  36.592 1.00 5.84  ? 76   TYR B CG   1 
ATOM   3199 C CD1  . TYR B 1 76  ? 63.814 19.881  35.311 1.00 7.35  ? 76   TYR B CD1  1 
ATOM   3200 C CD2  . TYR B 1 76  ? 63.557 20.231  37.633 1.00 7.54  ? 76   TYR B CD2  1 
ATOM   3201 C CE1  . TYR B 1 76  ? 63.357 21.198  35.071 1.00 9.00  ? 76   TYR B CE1  1 
ATOM   3202 C CE2  . TYR B 1 76  ? 63.145 21.532  37.384 1.00 8.82  ? 76   TYR B CE2  1 
ATOM   3203 C CZ   . TYR B 1 76  ? 63.057 22.005  36.077 1.00 8.81  ? 76   TYR B CZ   1 
ATOM   3204 O OH   . TYR B 1 76  ? 62.650 23.278  35.885 1.00 11.56 ? 76   TYR B OH   1 
ATOM   3205 H H    . TYR B 1 76  ? 62.117 17.087  36.314 1.00 4.77  ? 76   TYR B H    1 
ATOM   3206 H HA   . TYR B 1 76  ? 64.431 17.279  34.945 1.00 5.67  ? 76   TYR B HA   1 
ATOM   3207 H HB2  . TYR B 1 76  ? 64.002 17.681  37.762 1.00 7.38  ? 76   TYR B HB2  1 
ATOM   3208 H HB3  . TYR B 1 76  ? 65.383 18.021  37.033 1.00 7.38  ? 76   TYR B HB3  1 
ATOM   3209 H HD1  . TYR B 1 76  ? 64.070 19.331  34.580 1.00 8.82  ? 76   TYR B HD1  1 
ATOM   3210 H HD2  . TYR B 1 76  ? 63.611 19.917  38.528 1.00 9.04  ? 76   TYR B HD2  1 
ATOM   3211 H HE1  . TYR B 1 76  ? 63.265 21.507  34.177 1.00 10.79 ? 76   TYR B HE1  1 
ATOM   3212 H HE2  . TYR B 1 76  ? 62.921 22.104  38.109 1.00 10.58 ? 76   TYR B HE2  1 
ATOM   3213 H HH   . TYR B 1 76  ? 62.513 23.643  36.629 1.00 17.34 ? 76   TYR B HH   1 
ATOM   3214 N N    . SER B 1 77  ? 64.184 14.859  37.072 1.00 4.39  ? 77   SER B N    1 
ATOM   3215 C CA   . SER B 1 77  ? 64.782 13.604  37.533 1.00 4.32  ? 77   SER B CA   1 
ATOM   3216 C C    . SER B 1 77  ? 64.409 12.466  36.584 1.00 3.79  ? 77   SER B C    1 
ATOM   3217 O O    . SER B 1 77  ? 63.410 12.475  35.884 1.00 5.82  ? 77   SER B O    1 
ATOM   3218 C CB   A SER B 1 77  ? 64.328 13.301  38.939 0.71 5.76  ? 77   SER B CB   1 
ATOM   3219 C CB   B SER B 1 77  ? 64.168 13.225  38.912 0.29 4.33  ? 77   SER B CB   1 
ATOM   3220 O OG   A SER B 1 77  ? 64.794 14.218  39.898 0.71 12.56 ? 77   SER B OG   1 
ATOM   3221 O OG   B SER B 1 77  ? 62.771 12.896  38.780 0.29 4.84  ? 77   SER B OG   1 
ATOM   3222 H H    . SER B 1 77  ? 63.398 15.102  37.385 1.00 5.27  ? 77   SER B H    1 
ATOM   3223 H HA   A SER B 1 77  ? 65.777 13.706  37.534 1.00 5.19  ? 77   SER B HA   1 
ATOM   3224 H HB2  A SER B 1 77  ? 63.338 13.295  38.960 0.71 6.91  ? 77   SER B HB2  1 
ATOM   3225 H HB2  B SER B 1 77  ? 64.656 12.450  39.289 0.29 5.19  ? 77   SER B HB2  1 
ATOM   3226 H HB3  A SER B 1 77  ? 64.639 12.395  39.187 0.71 6.91  ? 77   SER B HB3  1 
ATOM   3227 H HB3  B SER B 1 77  ? 64.270 13.985  39.538 0.29 5.19  ? 77   SER B HB3  1 
ATOM   3228 H HG   A SER B 1 77  ? 64.535 14.991  39.696 0.71 18.84 ? 77   SER B HG   1 
ATOM   3229 H HG   B SER B 1 77  ? 62.357 13.553  38.460 0.29 7.26  ? 77   SER B HG   1 
ATOM   3230 N N    . THR B 1 78  ? 65.251 11.423  36.656 1.00 3.77  ? 78   THR B N    1 
ATOM   3231 C CA   . THR B 1 78  ? 64.931 10.145  36.040 1.00 3.81  ? 78   THR B CA   1 
ATOM   3232 C C    . THR B 1 78  ? 64.089 9.330   37.050 1.00 3.76  ? 78   THR B C    1 
ATOM   3233 O O    . THR B 1 78  ? 64.364 9.360   38.247 1.00 6.17  ? 78   THR B O    1 
ATOM   3234 C CB   . THR B 1 78  ? 66.254 9.420   35.702 1.00 4.54  ? 78   THR B CB   1 
ATOM   3235 O OG1  . THR B 1 78  ? 66.991 10.212  34.783 1.00 5.18  ? 78   THR B OG1  1 
ATOM   3236 C CG2  . THR B 1 78  ? 65.995 8.089   35.041 1.00 6.06  ? 78   THR B CG2  1 
ATOM   3237 H H    . THR B 1 78  ? 66.014 11.515  37.086 1.00 4.53  ? 78   THR B H    1 
ATOM   3238 H HA   . THR B 1 78  ? 64.404 10.295  35.204 1.00 4.57  ? 78   THR B HA   1 
ATOM   3239 H HB   . THR B 1 78  ? 66.788 9.285   36.537 1.00 5.45  ? 78   THR B HB   1 
ATOM   3240 H HG1  . THR B 1 78  ? 67.159 10.959  35.129 1.00 7.77  ? 78   THR B HG1  1 
ATOM   3241 H HG21 . THR B 1 78  ? 65.470 7.521   35.644 1.00 9.09  ? 78   THR B HG21 1 
ATOM   3242 H HG22 . THR B 1 78  ? 65.497 8.229   34.209 1.00 9.09  ? 78   THR B HG22 1 
ATOM   3243 H HG23 . THR B 1 78  ? 66.849 7.651   34.841 1.00 9.09  ? 78   THR B HG23 1 
ATOM   3244 N N    . MET B 1 79  ? 63.065 8.676   36.542 1.00 3.54  ? 79   MET B N    1 
ATOM   3245 C CA   . MET B 1 79  ? 62.114 7.935   37.363 1.00 3.54  ? 79   MET B CA   1 
ATOM   3246 C C    . MET B 1 79  ? 62.051 6.488   36.926 1.00 3.51  ? 79   MET B C    1 
ATOM   3247 O O    . MET B 1 79  ? 62.226 6.149   35.752 1.00 4.06  ? 79   MET B O    1 
ATOM   3248 C CB   A MET B 1 79  ? 60.751 8.613   37.316 0.86 3.73  ? 79   MET B CB   1 
ATOM   3249 C CB   B MET B 1 79  ? 60.721 8.502   36.951 0.14 3.69  ? 79   MET B CB   1 
ATOM   3250 C CG   A MET B 1 79  ? 60.818 9.970   38.000 0.86 4.06  ? 79   MET B CG   1 
ATOM   3251 C CG   B MET B 1 79  ? 60.259 9.937   37.110 0.14 4.23  ? 79   MET B CG   1 
ATOM   3252 S SD   A MET B 1 79  ? 59.156 10.701  38.074 0.86 4.36  ? 79   MET B SD   1 
ATOM   3253 S SD   B MET B 1 79  ? 60.741 10.547  38.756 0.14 4.82  ? 79   MET B SD   1 
ATOM   3254 C CE   A MET B 1 79  ? 59.530 12.154  39.046 0.86 6.10  ? 79   MET B CE   1 
ATOM   3255 C CE   B MET B 1 79  ? 59.819 12.104  38.598 0.14 5.99  ? 79   MET B CE   1 
ATOM   3256 H H    . MET B 1 79  ? 62.950 8.687   35.670 1.00 4.24  ? 79   MET B H    1 
ATOM   3257 H HA   A MET B 1 79  ? 62.439 7.958   38.309 1.00 4.25  ? 79   MET B HA   1 
ATOM   3258 H HB2  A MET B 1 79  ? 60.470 8.729   36.374 0.86 4.48  ? 79   MET B HB2  1 
ATOM   3259 H HB2  B MET B 1 79  ? 60.618 8.291   35.989 0.14 4.42  ? 79   MET B HB2  1 
ATOM   3260 H HB3  A MET B 1 79  ? 60.080 8.044   37.770 0.86 4.48  ? 79   MET B HB3  1 
ATOM   3261 H HB3  B MET B 1 79  ? 60.053 7.949   37.427 0.14 4.42  ? 79   MET B HB3  1 
ATOM   3262 H HG2  A MET B 1 79  ? 61.178 9.865   38.916 0.86 4.87  ? 79   MET B HG2  1 
ATOM   3263 H HG2  B MET B 1 79  ? 60.671 10.502  36.410 0.14 5.07  ? 79   MET B HG2  1 
ATOM   3264 H HG3  A MET B 1 79  ? 61.424 10.569  37.496 0.86 4.87  ? 79   MET B HG3  1 
ATOM   3265 H HG3  B MET B 1 79  ? 59.275 9.986   37.009 0.14 5.07  ? 79   MET B HG3  1 
ATOM   3266 H HE1  A MET B 1 79  ? 59.895 11.881  39.914 0.86 9.15  ? 79   MET B HE1  1 
ATOM   3267 H HE1  B MET B 1 79  ? 58.875 11.908  38.422 0.14 8.99  ? 79   MET B HE1  1 
ATOM   3268 H HE2  A MET B 1 79  ? 60.190 12.703  38.573 0.86 9.15  ? 79   MET B HE2  1 
ATOM   3269 H HE2  B MET B 1 79  ? 59.897 12.615  39.431 0.14 8.99  ? 79   MET B HE2  1 
ATOM   3270 H HE3  A MET B 1 79  ? 58.712 12.674  39.185 0.86 9.15  ? 79   MET B HE3  1 
ATOM   3271 H HE3  B MET B 1 79  ? 60.189 12.628  37.857 0.14 8.99  ? 79   MET B HE3  1 
ATOM   3272 N N    . SER B 1 80  ? 61.753 5.626   37.904 1.00 3.46  ? 80   SER B N    1 
ATOM   3273 C CA   . SER B 1 80  ? 61.485 4.231   37.625 1.00 3.27  ? 80   SER B CA   1 
ATOM   3274 C C    . SER B 1 80  ? 60.070 4.093   37.062 1.00 3.27  ? 80   SER B C    1 
ATOM   3275 O O    . SER B 1 80  ? 59.108 4.522   37.712 1.00 3.75  ? 80   SER B O    1 
ATOM   3276 C CB   . SER B 1 80  ? 61.612 3.454   38.942 1.00 3.66  ? 80   SER B CB   1 
ATOM   3277 O OG   . SER B 1 80  ? 61.267 2.110   38.684 1.00 4.00  ? 80   SER B OG   1 
ATOM   3278 H H    . SER B 1 80  ? 61.719 5.913   38.735 1.00 4.15  ? 80   SER B H    1 
ATOM   3279 H HA   . SER B 1 80  ? 62.148 3.885   36.962 1.00 3.93  ? 80   SER B HA   1 
ATOM   3280 H HB2  . SER B 1 80  ? 62.541 3.508   39.281 1.00 4.39  ? 80   SER B HB2  1 
ATOM   3281 H HB3  . SER B 1 80  ? 61.006 3.837   39.624 1.00 4.39  ? 80   SER B HB3  1 
ATOM   3282 H HG   . SER B 1 80  ? 61.332 1.663   39.392 1.00 6.00  ? 80   SER B HG   1 
ATOM   3283 N N    . ILE B 1 81  ? 59.979 3.508   35.866 1.00 3.31  ? 81   ILE B N    1 
ATOM   3284 C CA   . ILE B 1 81  ? 58.697 3.333   35.193 1.00 3.30  ? 81   ILE B CA   1 
ATOM   3285 C C    . ILE B 1 81  ? 58.620 1.916   34.633 1.00 3.43  ? 81   ILE B C    1 
ATOM   3286 O O    . ILE B 1 81  ? 59.619 1.234   34.447 1.00 3.98  ? 81   ILE B O    1 
ATOM   3287 C CB   . ILE B 1 81  ? 58.481 4.378   34.071 1.00 4.09  ? 81   ILE B CB   1 
ATOM   3288 C CG1  . ILE B 1 81  ? 59.438 4.188   32.899 1.00 5.23  ? 81   ILE B CG1  1 
ATOM   3289 C CG2  . ILE B 1 81  ? 58.563 5.789   34.635 1.00 5.07  ? 81   ILE B CG2  1 
ATOM   3290 C CD1  . ILE B 1 81  ? 59.109 5.021   31.679 1.00 7.91  ? 81   ILE B CD1  1 
ATOM   3291 H H    . ILE B 1 81  ? 60.712 3.220   35.473 1.00 3.97  ? 81   ILE B H    1 
ATOM   3292 H HA   . ILE B 1 81  ? 57.969 3.444   35.870 1.00 3.96  ? 81   ILE B HA   1 
ATOM   3293 H HB   . ILE B 1 81  ? 57.552 4.251   33.721 1.00 4.91  ? 81   ILE B HB   1 
ATOM   3294 H HG12 . ILE B 1 81  ? 60.354 4.413   33.198 1.00 6.28  ? 81   ILE B HG12 1 
ATOM   3295 H HG13 . ILE B 1 81  ? 59.434 3.232   32.639 1.00 6.28  ? 81   ILE B HG13 1 
ATOM   3296 H HG21 . ILE B 1 81  ? 57.943 5.876   35.389 1.00 7.60  ? 81   ILE B HG21 1 
ATOM   3297 H HG22 . ILE B 1 81  ? 59.477 5.965   34.941 1.00 7.60  ? 81   ILE B HG22 1 
ATOM   3298 H HG23 . ILE B 1 81  ? 58.322 6.434   33.938 1.00 7.60  ? 81   ILE B HG23 1 
ATOM   3299 H HD11 . ILE B 1 81  ? 58.209 4.797   31.364 1.00 11.86 ? 81   ILE B HD11 1 
ATOM   3300 H HD12 . ILE B 1 81  ? 59.146 5.972   31.914 1.00 11.86 ? 81   ILE B HD12 1 
ATOM   3301 H HD13 . ILE B 1 81  ? 59.760 4.834   30.971 1.00 11.86 ? 81   ILE B HD13 1 
ATOM   3302 N N    . THR B 1 82  ? 57.375 1.515   34.352 1.00 3.47  ? 82   THR B N    1 
ATOM   3303 C CA   . THR B 1 82  ? 57.094 0.274   33.656 1.00 3.69  ? 82   THR B CA   1 
ATOM   3304 C C    . THR B 1 82  ? 56.267 0.605   32.422 1.00 3.70  ? 82   THR B C    1 
ATOM   3305 O O    . THR B 1 82  ? 55.211 1.235   32.507 1.00 4.14  ? 82   THR B O    1 
ATOM   3306 C CB   . THR B 1 82  ? 56.334 -0.723  34.538 1.00 3.75  ? 82   THR B CB   1 
ATOM   3307 O OG1  . THR B 1 82  ? 57.206 -1.101  35.595 1.00 3.92  ? 82   THR B OG1  1 
ATOM   3308 C CG2  . THR B 1 82  ? 55.960 -1.965  33.751 1.00 4.50  ? 82   THR B CG2  1 
ATOM   3309 H H    . THR B 1 82  ? 56.701 2.024   34.599 1.00 4.16  ? 82   THR B H    1 
ATOM   3310 H HA   . THR B 1 82  ? 57.958 -0.140  33.367 1.00 4.43  ? 82   THR B HA   1 
ATOM   3311 H HB   . THR B 1 82  ? 55.512 -0.293  34.910 1.00 4.50  ? 82   THR B HB   1 
ATOM   3312 H HG1  . THR B 1 82  ? 57.424 -0.419  36.035 1.00 5.88  ? 82   THR B HG1  1 
ATOM   3313 H HG21 . THR B 1 82  ? 56.774 -2.393  33.410 1.00 6.75  ? 82   THR B HG21 1 
ATOM   3314 H HG22 . THR B 1 82  ? 55.482 -2.590  34.334 1.00 6.75  ? 82   THR B HG22 1 
ATOM   3315 H HG23 . THR B 1 82  ? 55.384 -1.714  32.999 1.00 6.75  ? 82   THR B HG23 1 
ATOM   3316 N N    . ASP B 1 83  ? 56.761 0.118   31.273 1.00 3.96  ? 83   ASP B N    1 
ATOM   3317 C CA   . ASP B 1 83  ? 55.991 0.173   30.033 1.00 4.43  ? 83   ASP B CA   1 
ATOM   3318 C C    . ASP B 1 83  ? 55.162 -1.118  29.949 1.00 4.44  ? 83   ASP B C    1 
ATOM   3319 O O    . ASP B 1 83  ? 55.705 -2.223  30.076 1.00 5.31  ? 83   ASP B O    1 
ATOM   3320 C CB   . ASP B 1 83  ? 56.995 0.190   28.850 1.00 6.13  ? 83   ASP B CB   1 
ATOM   3321 C CG   . ASP B 1 83  ? 56.313 0.300   27.514 1.00 6.65  ? 83   ASP B CG   1 
ATOM   3322 O OD1  . ASP B 1 83  ? 55.867 1.443   27.174 1.00 8.33  ? 83   ASP B OD1  1 
ATOM   3323 O OD2  . ASP B 1 83  ? 56.174 -0.689  26.796 1.00 9.33  ? 83   ASP B OD2  1 
ATOM   3324 H H    . ASP B 1 83  ? 57.564 -0.241  31.266 1.00 4.75  ? 83   ASP B H    1 
ATOM   3325 H HA   . ASP B 1 83  ? 55.400 0.980   30.013 1.00 5.31  ? 83   ASP B HA   1 
ATOM   3326 H HB2  . ASP B 1 83  ? 57.613 0.955   28.961 1.00 7.35  ? 83   ASP B HB2  1 
ATOM   3327 H HB3  . ASP B 1 83  ? 57.533 -0.640  28.871 1.00 7.35  ? 83   ASP B HB3  1 
ATOM   3328 N N    . CYS B 1 84  ? 53.849 -0.938  29.733 1.00 4.51  ? 84   CYS B N    1 
ATOM   3329 C CA   . CYS B 1 84  ? 52.952 -2.060  29.514 1.00 4.65  ? 84   CYS B CA   1 
ATOM   3330 C C    . CYS B 1 84  ? 52.385 -1.897  28.101 1.00 5.19  ? 84   CYS B C    1 
ATOM   3331 O O    . CYS B 1 84  ? 51.763 -0.894  27.783 1.00 6.68  ? 84   CYS B O    1 
ATOM   3332 C CB   . CYS B 1 84  ? 51.759 -2.057  30.467 1.00 4.96  ? 84   CYS B CB   1 
ATOM   3333 S SG   . CYS B 1 84  ? 52.219 -2.265  32.214 1.00 4.72  ? 84   CYS B SG   1 
ATOM   3334 H H    . CYS B 1 84  ? 53.524 -0.121  29.723 1.00 5.42  ? 84   CYS B H    1 
ATOM   3335 H HA   . CYS B 1 84  ? 53.453 -2.923  29.589 1.00 5.58  ? 84   CYS B HA   1 
ATOM   3336 H HB2  . CYS B 1 84  ? 51.270 -1.203  30.364 1.00 5.95  ? 84   CYS B HB2  1 
ATOM   3337 H HB3  . CYS B 1 84  ? 51.143 -2.789  30.209 1.00 5.95  ? 84   CYS B HB3  1 
ATOM   3338 N N    . ARG B 1 85  ? 52.639 -2.887  27.241 1.00 5.34  ? 85   ARG B N    1 
ATOM   3339 C CA   . ARG B 1 85  ? 52.259 -2.758  25.838 1.00 5.94  ? 85   ARG B CA   1 
ATOM   3340 C C    . ARG B 1 85  ? 51.698 -4.092  25.376 1.00 5.53  ? 85   ARG B C    1 
ATOM   3341 O O    . ARG B 1 85  ? 52.305 -5.153  25.589 1.00 6.13  ? 85   ARG B O    1 
ATOM   3342 C CB   A ARG B 1 85  ? 53.552 -2.386  25.125 0.70 8.50  ? 85   ARG B CB   1 
ATOM   3343 C CB   B ARG B 1 85  ? 53.119 -2.083  24.819 0.30 8.93  ? 85   ARG B CB   1 
ATOM   3344 C CG   A ARG B 1 85  ? 53.396 -1.920  23.701 0.70 9.14  ? 85   ARG B CG   1 
ATOM   3345 C CG   B ARG B 1 85  ? 54.339 -3.016  24.682 0.30 9.31  ? 85   ARG B CG   1 
ATOM   3346 C CD   A ARG B 1 85  ? 54.721 -1.326  23.253 0.70 9.15  ? 85   ARG B CD   1 
ATOM   3347 C CD   B ARG B 1 85  ? 55.372 -2.393  23.745 0.30 10.69 ? 85   ARG B CD   1 
ATOM   3348 N NE   A ARG B 1 85  ? 55.067 -0.135  24.023 0.70 7.79  ? 85   ARG B NE   1 
ATOM   3349 N NE   B ARG B 1 85  ? 55.869 -1.102  24.292 0.30 10.35 ? 85   ARG B NE   1 
ATOM   3350 C CZ   A ARG B 1 85  ? 54.786 1.128   23.686 0.70 7.46  ? 85   ARG B CZ   1 
ATOM   3351 C CZ   B ARG B 1 85  ? 55.693 0.080   23.691 0.30 13.52 ? 85   ARG B CZ   1 
ATOM   3352 N NH1  A ARG B 1 85  ? 54.232 1.438   22.539 0.70 7.82  ? 85   ARG B NH1  1 
ATOM   3353 N NH1  B ARG B 1 85  ? 54.987 0.250   22.571 0.30 17.51 ? 85   ARG B NH1  1 
ATOM   3354 N NH2  A ARG B 1 85  ? 55.146 2.101   24.547 0.70 7.82  ? 85   ARG B NH2  1 
ATOM   3355 N NH2  B ARG B 1 85  ? 56.241 1.137   24.302 0.30 16.70 ? 85   ARG B NH2  1 
ATOM   3356 H H    . ARG B 1 85  ? 53.037 -3.620  27.522 1.00 6.41  ? 85   ARG B H    1 
ATOM   3357 H HA   A ARG B 1 85  ? 51.578 -2.035  25.725 1.00 7.12  ? 85   ARG B HA   1 
ATOM   3358 H HB2  A ARG B 1 85  ? 53.999 -1.669  25.641 0.70 10.20 ? 85   ARG B HB2  1 
ATOM   3359 H HB2  B ARG B 1 85  ? 52.641 -1.995  23.956 0.30 10.72 ? 85   ARG B HB2  1 
ATOM   3360 H HB3  A ARG B 1 85  ? 54.150 -3.175  25.132 0.70 10.20 ? 85   ARG B HB3  1 
ATOM   3361 H HB3  B ARG B 1 85  ? 53.393 -1.184  25.128 0.30 10.72 ? 85   ARG B HB3  1 
ATOM   3362 H HG2  A ARG B 1 85  ? 53.150 -2.682  23.118 0.70 10.97 ? 85   ARG B HG2  1 
ATOM   3363 H HG2  B ARG B 1 85  ? 54.746 -3.165  25.572 0.30 11.17 ? 85   ARG B HG2  1 
ATOM   3364 H HG3  A ARG B 1 85  ? 52.680 -1.238  23.642 0.70 10.97 ? 85   ARG B HG3  1 
ATOM   3365 H HG3  B ARG B 1 85  ? 54.050 -3.892  24.323 0.30 11.17 ? 85   ARG B HG3  1 
ATOM   3366 H HD2  A ARG B 1 85  ? 55.436 -2.003  23.360 0.70 10.98 ? 85   ARG B HD2  1 
ATOM   3367 H HD2  B ARG B 1 85  ? 56.131 -3.017  23.629 0.30 12.83 ? 85   ARG B HD2  1 
ATOM   3368 H HD3  A ARG B 1 85  ? 54.666 -1.089  22.293 0.70 10.98 ? 85   ARG B HD3  1 
ATOM   3369 H HD3  B ARG B 1 85  ? 54.962 -2.240  22.857 0.30 12.83 ? 85   ARG B HD3  1 
ATOM   3370 H HE   A ARG B 1 85  ? 55.500 -0.260  24.779 0.70 9.35  ? 85   ARG B HE   1 
ATOM   3371 H HE   B ARG B 1 85  ? 56.304 -1.117  25.057 0.30 12.42 ? 85   ARG B HE   1 
ATOM   3372 H HH11 A ARG B 1 85  ? 54.032 0.805   21.961 0.70 9.38  ? 85   ARG B HH11 1 
ATOM   3373 H HH11 B ARG B 1 85  ? 54.604 -0.442  22.184 0.30 21.01 ? 85   ARG B HH11 1 
ATOM   3374 H HH12 A ARG B 1 85  ? 54.060 2.279   22.347 0.70 9.38  ? 85   ARG B HH12 1 
ATOM   3375 H HH12 B ARG B 1 85  ? 54.905 1.052   22.220 0.30 21.01 ? 85   ARG B HH12 1 
ATOM   3376 H HH21 A ARG B 1 85  ? 55.519 1.892   25.317 0.70 9.38  ? 85   ARG B HH21 1 
ATOM   3377 H HH21 B ARG B 1 85  ? 56.707 1.026   25.041 0.30 20.04 ? 85   ARG B HH21 1 
ATOM   3378 H HH22 A ARG B 1 85  ? 55.009 2.945   24.340 0.70 9.38  ? 85   ARG B HH22 1 
ATOM   3379 H HH22 B ARG B 1 85  ? 56.137 1.943   23.965 0.30 20.04 ? 85   ARG B HH22 1 
ATOM   3380 N N    . GLU B 1 86  ? 50.558 -4.040  24.716 1.00 5.33  ? 86   GLU B N    1 
ATOM   3381 C CA   . GLU B 1 86  ? 49.904 -5.262  24.256 1.00 5.66  ? 86   GLU B CA   1 
ATOM   3382 C C    . GLU B 1 86  ? 50.846 -6.060  23.332 1.00 6.29  ? 86   GLU B C    1 
ATOM   3383 O O    . GLU B 1 86  ? 51.593 -5.501  22.521 1.00 7.78  ? 86   GLU B O    1 
ATOM   3384 C CB   A GLU B 1 86  ? 48.635 -4.971  23.470 0.66 6.93  ? 86   GLU B CB   1 
ATOM   3385 C CB   B GLU B 1 86  ? 48.604 -4.841  23.553 0.34 9.13  ? 86   GLU B CB   1 
ATOM   3386 C CG   A GLU B 1 86  ? 48.829 -4.101  22.251 0.66 6.12  ? 86   GLU B CG   1 
ATOM   3387 C CG   B GLU B 1 86  ? 47.439 -5.757  23.625 0.34 12.66 ? 86   GLU B CG   1 
ATOM   3388 C CD   A GLU B 1 86  ? 47.591 -3.819  21.396 0.66 6.57  ? 86   GLU B CD   1 
ATOM   3389 C CD   B GLU B 1 86  ? 46.069 -5.348  23.256 0.34 10.91 ? 86   GLU B CD   1 
ATOM   3390 O OE1  A GLU B 1 86  ? 46.520 -4.267  21.761 0.66 12.88 ? 86   GLU B OE1  1 
ATOM   3391 O OE1  B GLU B 1 86  ? 45.806 -4.188  22.979 0.34 16.77 ? 86   GLU B OE1  1 
ATOM   3392 O OE2  A GLU B 1 86  ? 47.729 -3.116  20.372 0.66 7.60  ? 86   GLU B OE2  1 
ATOM   3393 O OE2  B GLU B 1 86  ? 45.173 -6.229  23.267 0.34 9.08  ? 86   GLU B OE2  1 
ATOM   3394 H H    . GLU B 1 86  ? 50.187 -3.260  24.550 1.00 6.39  ? 86   GLU B H    1 
ATOM   3395 H HA   A GLU B 1 86  ? 49.673 -5.825  25.050 1.00 6.80  ? 86   GLU B HA   1 
ATOM   3396 H HB2  A GLU B 1 86  ? 48.238 -5.832  23.183 0.66 8.31  ? 86   GLU B HB2  1 
ATOM   3397 H HB2  B GLU B 1 86  ? 48.325 -3.969  23.929 0.34 10.96 ? 86   GLU B HB2  1 
ATOM   3398 H HB3  A GLU B 1 86  ? 47.986 -4.529  24.073 0.66 8.31  ? 86   GLU B HB3  1 
ATOM   3399 H HB3  B GLU B 1 86  ? 48.812 -4.692  22.596 0.34 10.96 ? 86   GLU B HB3  1 
ATOM   3400 H HG2  A GLU B 1 86  ? 49.200 -3.233  22.549 0.66 7.35  ? 86   GLU B HG2  1 
ATOM   3401 H HG2  B GLU B 1 86  ? 47.661 -6.541  23.062 0.34 15.19 ? 86   GLU B HG2  1 
ATOM   3402 H HG3  A GLU B 1 86  ? 49.510 -4.529  21.674 0.66 7.35  ? 86   GLU B HG3  1 
ATOM   3403 H HG3  B GLU B 1 86  ? 47.394 -6.084  24.558 0.34 15.19 ? 86   GLU B HG3  1 
ATOM   3404 N N    . THR B 1 87  ? 50.754 -7.351  23.469 1.00 6.25  ? 87   THR B N    1 
ATOM   3405 C CA   . THR B 1 87  ? 51.438 -8.238  22.560 1.00 6.52  ? 87   THR B CA   1 
ATOM   3406 C C    . THR B 1 87  ? 50.559 -8.536  21.351 1.00 6.64  ? 87   THR B C    1 
ATOM   3407 O O    . THR B 1 87  ? 49.359 -8.284  21.339 1.00 7.75  ? 87   THR B O    1 
ATOM   3408 C CB   . THR B 1 87  ? 51.884 -9.540  23.276 1.00 6.48  ? 87   THR B CB   1 
ATOM   3409 O OG1  . THR B 1 87  ? 50.694 -10.141 23.754 1.00 7.69  ? 87   THR B OG1  1 
ATOM   3410 C CG2  . THR B 1 87  ? 52.829 -9.217  24.414 1.00 8.24  ? 87   THR B CG2  1 
ATOM   3411 H H    . THR B 1 87  ? 50.269 -7.685  24.123 1.00 7.50  ? 87   THR B H    1 
ATOM   3412 H HA   . THR B 1 87  ? 52.260 -7.770  22.234 1.00 7.83  ? 87   THR B HA   1 
ATOM   3413 H HB   . THR B 1 87  ? 52.334 -10.149 22.623 1.00 7.78  ? 87   THR B HB   1 
ATOM   3414 H HG1  . THR B 1 87  ? 50.192 -10.322 23.106 1.00 11.53 ? 87   THR B HG1  1 
ATOM   3415 H HG21 . THR B 1 87  ? 53.615 -8.749  24.063 1.00 12.36 ? 87   THR B HG21 1 
ATOM   3416 H HG22 . THR B 1 87  ? 52.372 -8.644  25.065 1.00 12.36 ? 87   THR B HG22 1 
ATOM   3417 H HG23 . THR B 1 87  ? 53.111 -10.048 24.851 1.00 12.36 ? 87   THR B HG23 1 
ATOM   3418 N N    . GLY B 1 88  ? 51.143 -9.123  20.315 1.00 8.26  ? 88   GLY B N    1 
ATOM   3419 C CA   . GLY B 1 88  ? 50.397 -9.336  19.082 1.00 8.96  ? 88   GLY B CA   1 
ATOM   3420 C C    . GLY B 1 88  ? 49.203 -10.262 19.245 1.00 8.93  ? 88   GLY B C    1 
ATOM   3421 O O    . GLY B 1 88  ? 48.189 -10.185 18.524 1.00 13.22 ? 88   GLY B O    1 
ATOM   3422 H H    . GLY B 1 88  ? 51.982 -9.383  20.372 1.00 9.91  ? 88   GLY B H    1 
ATOM   3423 H HA2  . GLY B 1 88  ? 50.078 -8.461  18.746 1.00 10.75 ? 88   GLY B HA2  1 
ATOM   3424 H HA3  . GLY B 1 88  ? 51.006 -9.716  18.400 1.00 10.75 ? 88   GLY B HA3  1 
ATOM   3425 N N    . SER B 1 89  ? 49.309 -11.195 20.178 1.00 8.28  ? 89   SER B N    1 
ATOM   3426 C CA   . SER B 1 89  ? 48.250 -12.161 20.377 1.00 9.25  ? 89   SER B CA   1 
ATOM   3427 C C    . SER B 1 89  ? 47.185 -11.671 21.412 1.00 9.43  ? 89   SER B C    1 
ATOM   3428 O O    . SER B 1 89  ? 46.174 -12.314 21.567 1.00 12.76 ? 89   SER B O    1 
ATOM   3429 C CB   . SER B 1 89  ? 48.830 -13.517 20.812 1.00 10.65 ? 89   SER B CB   1 
ATOM   3430 O OG   . SER B 1 89  ? 49.547 -13.423 21.986 1.00 10.79 ? 89   SER B OG   1 
ATOM   3431 H H    . SER B 1 89  ? 50.029 -11.227 20.682 1.00 9.94  ? 89   SER B H    1 
ATOM   3432 H HA   . SER B 1 89  ? 47.787 -12.292 19.500 1.00 11.10 ? 89   SER B HA   1 
ATOM   3433 H HB2  . SER B 1 89  ? 48.090 -14.163 20.934 1.00 12.78 ? 89   SER B HB2  1 
ATOM   3434 H HB3  . SER B 1 89  ? 49.420 -13.862 20.097 1.00 12.78 ? 89   SER B HB3  1 
ATOM   3435 H HG   . SER B 1 89  ? 49.850 -14.179 22.191 1.00 16.18 ? 89   SER B HG   1 
ATOM   3436 N N    . SER B 1 90  ? 47.408 -10.548 22.011 1.00 8.23  ? 90   SER B N    1 
ATOM   3437 C CA   . SER B 1 90  ? 46.452 -10.019 22.927 1.00 8.47  ? 90   SER B CA   1 
ATOM   3438 C C    . SER B 1 90  ? 45.120 -9.765  22.208 1.00 8.82  ? 90   SER B C    1 
ATOM   3439 O O    . SER B 1 90  ? 45.081 -9.174  21.145 1.00 10.80 ? 90   SER B O    1 
ATOM   3440 C CB   . SER B 1 90  ? 46.962 -8.724  23.485 1.00 7.87  ? 90   SER B CB   1 
ATOM   3441 O OG   . SER B 1 90  ? 46.074 -8.172  24.463 1.00 8.32  ? 90   SER B OG   1 
ATOM   3442 N N    . LYS B 1 91  ? 44.017 -10.129 22.828 1.00 8.58  ? 91   LYS B N    1 
ATOM   3443 C CA   . LYS B 1 91  ? 42.704 -9.900  22.231 1.00 9.28  ? 91   LYS B CA   1 
ATOM   3444 C C    . LYS B 1 91  ? 41.623 -9.970  23.318 1.00 8.41  ? 91   LYS B C    1 
ATOM   3445 O O    . LYS B 1 91  ? 41.547 -10.998 24.067 1.00 10.20 ? 91   LYS B O    1 
ATOM   3446 C CB   . LYS B 1 91  ? 42.299 -10.877 21.161 1.00 12.28 ? 91   LYS B CB   1 
ATOM   3447 C CG   A LYS B 1 91  ? 41.032 -10.475 20.423 0.81 13.11 ? 91   LYS B CG   1 
ATOM   3448 C CG   B LYS B 1 91  ? 40.962 -10.555 20.521 0.19 13.36 ? 91   LYS B CG   1 
ATOM   3449 C CD   A LYS B 1 91  ? 41.198 -9.292  19.513 0.81 16.44 ? 91   LYS B CD   1 
ATOM   3450 C CD   B LYS B 1 91  ? 40.736 -11.305 19.226 0.19 9.10  ? 91   LYS B CD   1 
ATOM   3451 C CE   A LYS B 1 91  ? 40.017 -8.481  18.940 0.81 15.06 ? 91   LYS B CE   1 
ATOM   3452 C CE   B LYS B 1 91  ? 39.460 -10.767 18.580 0.19 9.11  ? 91   LYS B CE   1 
ATOM   3453 N NZ   A LYS B 1 91  ? 39.191 -7.615  19.829 0.81 10.12 ? 91   LYS B NZ   1 
ATOM   3454 N NZ   B LYS B 1 91  ? 39.584 -9.382  18.029 0.19 8.10  ? 91   LYS B NZ   1 
ATOM   3455 H H    . LYS B 1 91  ? 44.072 -10.517 23.616 1.00 10.30 ? 91   LYS B H    1 
ATOM   3456 H HA   . LYS B 1 91  ? 42.694 -8.981  21.837 1.00 11.13 ? 91   LYS B HA   1 
ATOM   3457 H HB2  A LYS B 1 91  ? 43.038 -10.961 20.507 1.00 14.74 ? 91   LYS B HB2  1 
ATOM   3458 H HB3  A LYS B 1 91  ? 42.161 -11.766 21.574 1.00 14.74 ? 91   LYS B HB3  1 
ATOM   3459 H HG2  A LYS B 1 91  ? 40.718 -11.246 19.888 0.81 15.74 ? 91   LYS B HG2  1 
ATOM   3460 H HG2  B LYS B 1 91  ? 40.238 -10.782 21.157 0.19 16.03 ? 91   LYS B HG2  1 
ATOM   3461 H HG3  A LYS B 1 91  ? 40.330 -10.266 21.089 0.81 15.74 ? 91   LYS B HG3  1 
ATOM   3462 H HG3  B LYS B 1 91  ? 40.915 -9.582  20.344 0.19 16.03 ? 91   LYS B HG3  1 
ATOM   3463 H HD2  A LYS B 1 91  ? 41.773 -8.646  19.995 0.81 19.73 ? 91   LYS B HD2  1 
ATOM   3464 H HD2  B LYS B 1 91  ? 41.506 -11.173 18.618 0.19 10.93 ? 91   LYS B HD2  1 
ATOM   3465 H HD3  A LYS B 1 91  ? 41.723 -9.609  18.735 0.81 19.73 ? 91   LYS B HD3  1 
ATOM   3466 H HD3  B LYS B 1 91  ? 40.642 -12.274 19.406 0.19 10.93 ? 91   LYS B HD3  1 
ATOM   3467 H HE2  A LYS B 1 91  ? 40.380 -7.903  18.223 0.81 18.07 ? 91   LYS B HE2  1 
ATOM   3468 H HE2  B LYS B 1 91  ? 39.195 -11.377 17.847 0.19 10.93 ? 91   LYS B HE2  1 
ATOM   3469 H HE3  A LYS B 1 91  ? 39.403 -9.125  18.506 0.81 18.07 ? 91   LYS B HE3  1 
ATOM   3470 H HE3  B LYS B 1 91  ? 38.735 -10.776 19.254 0.19 10.93 ? 91   LYS B HE3  1 
ATOM   3471 H HZ1  A LYS B 1 91  ? 39.725 -7.002  20.237 0.81 15.17 ? 91   LYS B HZ1  1 
ATOM   3472 H HZ1  B LYS B 1 91  ? 40.298 -9.342  17.467 0.19 12.14 ? 91   LYS B HZ1  1 
ATOM   3473 H HZ2  A LYS B 1 91  ? 38.560 -7.186  19.333 0.81 15.17 ? 91   LYS B HZ2  1 
ATOM   3474 H HZ2  B LYS B 1 91  ? 38.826 -9.168  17.573 0.19 12.14 ? 91   LYS B HZ2  1 
ATOM   3475 H HZ3  A LYS B 1 91  ? 38.783 -8.130  20.459 0.81 15.17 ? 91   LYS B HZ3  1 
ATOM   3476 H HZ3  B LYS B 1 91  ? 39.703 -8.793  18.713 0.19 12.14 ? 91   LYS B HZ3  1 
ATOM   3477 N N    . TYR B 1 92  ? 40.840 -8.952  23.483 1.00 9.10  ? 92   TYR B N    1 
ATOM   3478 C CA   . TYR B 1 92  ? 39.834 -8.862  24.529 1.00 8.75  ? 92   TYR B CA   1 
ATOM   3479 C C    . TYR B 1 92  ? 38.956 -10.129 24.502 1.00 9.98  ? 92   TYR B C    1 
ATOM   3480 O O    . TYR B 1 92  ? 38.504 -10.496 23.426 1.00 12.22 ? 92   TYR B O    1 
ATOM   3481 C CB   . TYR B 1 92  ? 38.984 -7.623  24.277 1.00 10.04 ? 92   TYR B CB   1 
ATOM   3482 C CG   . TYR B 1 92  ? 37.961 -7.407  25.339 1.00 10.54 ? 92   TYR B CG   1 
ATOM   3483 C CD1  . TYR B 1 92  ? 38.298 -6.805  26.539 1.00 10.96 ? 92   TYR B CD1  1 
ATOM   3484 C CD2  . TYR B 1 92  ? 36.658 -7.857  25.142 1.00 13.88 ? 92   TYR B CD2  1 
ATOM   3485 C CE1  . TYR B 1 92  ? 37.365 -6.610  27.481 1.00 11.44 ? 92   TYR B CE1  1 
ATOM   3486 C CE2  . TYR B 1 92  ? 35.700 -7.664  26.074 1.00 13.94 ? 92   TYR B CE2  1 
ATOM   3487 C CZ   . TYR B 1 92  ? 36.038 -7.052  27.264 1.00 14.06 ? 92   TYR B CZ   1 
ATOM   3488 O OH   . TYR B 1 92  ? 35.027 -6.826  28.193 1.00 18.80 ? 92   TYR B OH   1 
ATOM   3489 H H    . TYR B 1 92  ? 40.922 -8.274  22.929 1.00 10.92 ? 92   TYR B H    1 
ATOM   3490 H HA   . TYR B 1 92  ? 40.283 -8.785  25.419 1.00 10.50 ? 92   TYR B HA   1 
ATOM   3491 H HB2  . TYR B 1 92  ? 39.574 -6.829  24.229 1.00 12.05 ? 92   TYR B HB2  1 
ATOM   3492 H HB3  . TYR B 1 92  ? 38.529 -7.714  23.402 1.00 12.05 ? 92   TYR B HB3  1 
ATOM   3493 H HD1  . TYR B 1 92  ? 39.193 -6.528  26.694 1.00 13.15 ? 92   TYR B HD1  1 
ATOM   3494 H HD2  . TYR B 1 92  ? 36.439 -8.309  24.335 1.00 16.66 ? 92   TYR B HD2  1 
ATOM   3495 H HE1  . TYR B 1 92  ? 37.594 -6.176  28.295 1.00 13.72 ? 92   TYR B HE1  1 
ATOM   3496 H HE2  . TYR B 1 92  ? 34.807 -7.945  25.914 1.00 16.73 ? 92   TYR B HE2  1 
ATOM   3497 H HH   . TYR B 1 92  ? 35.350 -6.454  28.873 1.00 28.20 ? 92   TYR B HH   1 
ATOM   3498 N N    . PRO B 1 93  ? 38.630 -10.717 25.643 1.00 11.14 ? 93   PRO B N    1 
ATOM   3499 C CA   . PRO B 1 93  ? 38.940 -10.305 27.043 1.00 10.65 ? 93   PRO B CA   1 
ATOM   3500 C C    . PRO B 1 93  ? 40.301 -10.839 27.559 1.00 9.71  ? 93   PRO B C    1 
ATOM   3501 O O    . PRO B 1 93  ? 40.542 -10.432 28.796 1.00 13.41 ? 93   PRO B O    1 
ATOM   3502 C CB   . PRO B 1 93  ? 37.752 -10.871 27.790 1.00 14.43 ? 93   PRO B CB   1 
ATOM   3503 C CG   . PRO B 1 93  ? 37.545 -12.225 27.164 1.00 15.96 ? 93   PRO B CG   1 
ATOM   3504 C CD   . PRO B 1 93  ? 37.695 -11.890 25.693 1.00 13.38 ? 93   PRO B CD   1 
ATOM   3505 H HA   . PRO B 1 93  ? 38.928 -9.307  27.107 1.00 12.77 ? 93   PRO B HA   1 
ATOM   3506 H HB2  . PRO B 1 93  ? 37.948 -10.954 28.757 1.00 17.32 ? 93   PRO B HB2  1 
ATOM   3507 H HB3  . PRO B 1 93  ? 36.953 -10.299 27.671 1.00 17.32 ? 93   PRO B HB3  1 
ATOM   3508 H HG2  . PRO B 1 93  ? 38.232 -12.873 27.461 1.00 19.16 ? 93   PRO B HG2  1 
ATOM   3509 H HG3  . PRO B 1 93  ? 36.645 -12.586 27.365 1.00 19.16 ? 93   PRO B HG3  1 
ATOM   3510 H HD2  . PRO B 1 93  ? 38.074 -12.659 25.197 1.00 16.06 ? 93   PRO B HD2  1 
ATOM   3511 H HD3  . PRO B 1 93  ? 36.819 -11.656 25.297 1.00 16.06 ? 93   PRO B HD3  1 
ATOM   3512 N N    . ASN B 1 94  ? 41.064 -11.491 26.726 1.00 9.61  ? 94   ASN B N    1 
ATOM   3513 C CA   . ASN B 1 94  ? 42.326 -12.044 27.111 1.00 10.27 ? 94   ASN B CA   1 
ATOM   3514 C C    . ASN B 1 94  ? 43.463 -11.046 26.728 1.00 8.58  ? 94   ASN B C    1 
ATOM   3515 O O    . ASN B 1 94  ? 44.224 -11.265 25.838 1.00 10.88 ? 94   ASN B O    1 
ATOM   3516 C CB   . ASN B 1 94  ? 42.483 -13.391 26.447 1.00 12.89 ? 94   ASN B CB   1 
ATOM   3517 C CG   . ASN B 1 94  ? 41.321 -14.324 26.842 1.00 17.94 ? 94   ASN B CG   1 
ATOM   3518 O OD1  . ASN B 1 94  ? 41.183 -14.604 28.011 1.00 30.43 ? 94   ASN B OD1  1 
ATOM   3519 N ND2  . ASN B 1 94  ? 40.516 -14.689 25.925 1.00 22.46 ? 94   ASN B ND2  1 
ATOM   3520 H H    . ASN B 1 94  ? 40.792 -11.595 25.896 1.00 11.53 ? 94   ASN B H    1 
ATOM   3521 H HA   . ASN B 1 94  ? 42.332 -12.171 28.103 1.00 12.32 ? 94   ASN B HA   1 
ATOM   3522 H HB2  . ASN B 1 94  ? 42.498 -13.277 25.464 1.00 15.47 ? 94   ASN B HB2  1 
ATOM   3523 H HB3  . ASN B 1 94  ? 43.343 -13.798 26.722 1.00 15.47 ? 94   ASN B HB3  1 
ATOM   3524 H HD21 . ASN B 1 94  ? 40.665 -14.457 25.090 1.00 26.95 ? 94   ASN B HD21 1 
ATOM   3525 H HD22 . ASN B 1 94  ? 39.809 -15.174 26.127 1.00 26.95 ? 94   ASN B HD22 1 
ATOM   3526 N N    . CYS B 1 95  ? 43.491 -9.951  27.530 1.00 9.28  ? 95   CYS B N    1 
ATOM   3527 C CA   . CYS B 1 95  ? 44.451 -8.898  27.306 1.00 8.04  ? 95   CYS B CA   1 
ATOM   3528 C C    . CYS B 1 95  ? 45.856 -9.339  27.821 1.00 7.88  ? 95   CYS B C    1 
ATOM   3529 O O    . CYS B 1 95  ? 45.951 -9.879  28.904 1.00 13.96 ? 95   CYS B O    1 
ATOM   3530 C CB   . CYS B 1 95  ? 44.062 -7.604  28.073 1.00 7.71  ? 95   CYS B CB   1 
ATOM   3531 S SG   . CYS B 1 95  ? 42.348 -7.060  27.721 1.00 8.00  ? 95   CYS B SG   1 
ATOM   3532 H H    . CYS B 1 95  ? 42.918 -9.882  28.194 1.00 11.14 ? 95   CYS B H    1 
ATOM   3533 H HA   . CYS B 1 95  ? 44.504 -8.700  26.327 1.00 9.65  ? 95   CYS B HA   1 
ATOM   3534 H HB2  . CYS B 1 95  ? 44.156 -7.765  29.046 1.00 9.25  ? 95   CYS B HB2  1 
ATOM   3535 H HB3  . CYS B 1 95  ? 44.688 -6.879  27.824 1.00 9.25  ? 95   CYS B HB3  1 
ATOM   3536 N N    . ALA B 1 96  ? 46.836 -9.161  27.029 1.00 5.91  ? 96   ALA B N    1 
ATOM   3537 C CA   . ALA B 1 96  ? 48.156 -9.659  27.292 1.00 6.15  ? 96   ALA B CA   1 
ATOM   3538 C C    . ALA B 1 96  ? 49.186 -8.590  26.958 1.00 5.38  ? 96   ALA B C    1 
ATOM   3539 O O    . ALA B 1 96  ? 49.097 -7.960  25.908 1.00 5.84  ? 96   ALA B O    1 
ATOM   3540 C CB   . ALA B 1 96  ? 48.469 -10.940 26.482 1.00 8.06  ? 96   ALA B CB   1 
ATOM   3541 H H    . ALA B 1 96  ? 46.699 -8.710  26.286 1.00 7.10  ? 96   ALA B H    1 
ATOM   3542 H HA   . ALA B 1 96  ? 48.226 -9.874  28.266 1.00 7.38  ? 96   ALA B HA   1 
ATOM   3543 H HB1  . ALA B 1 96  ? 47.814 -11.635 26.704 1.00 12.09 ? 96   ALA B HB1  1 
ATOM   3544 H HB2  . ALA B 1 96  ? 49.369 -11.256 26.705 1.00 12.09 ? 96   ALA B HB2  1 
ATOM   3545 H HB3  . ALA B 1 96  ? 48.421 -10.740 25.524 1.00 12.09 ? 96   ALA B HB3  1 
ATOM   3546 N N    . TYR B 1 97  ? 50.122 -8.433  27.873 1.00 5.19  ? 97   TYR B N    1 
ATOM   3547 C CA   . TYR B 1 97  ? 51.054 -7.304  27.832 1.00 5.15  ? 97   TYR B CA   1 
ATOM   3548 C C    . TYR B 1 97  ? 52.511 -7.727  28.035 1.00 5.00  ? 97   TYR B C    1 
ATOM   3549 O O    . TYR B 1 97  ? 52.778 -8.583  28.908 1.00 5.79  ? 97   TYR B O    1 
ATOM   3550 C CB   . TYR B 1 97  ? 50.709 -6.325  28.998 1.00 5.15  ? 97   TYR B CB   1 
ATOM   3551 C CG   . TYR B 1 97  ? 49.354 -5.690  28.830 1.00 5.16  ? 97   TYR B CG   1 
ATOM   3552 C CD1  . TYR B 1 97  ? 49.225 -4.559  28.013 1.00 5.45  ? 97   TYR B CD1  1 
ATOM   3553 C CD2  . TYR B 1 97  ? 48.232 -6.237  29.376 1.00 5.36  ? 97   TYR B CD2  1 
ATOM   3554 C CE1  . TYR B 1 97  ? 47.986 -4.006  27.786 1.00 5.66  ? 97   TYR B CE1  1 
ATOM   3555 C CE2  . TYR B 1 97  ? 46.964 -5.687  29.160 1.00 5.36  ? 97   TYR B CE2  1 
ATOM   3556 C CZ   . TYR B 1 97  ? 46.841 -4.560  28.354 1.00 5.60  ? 97   TYR B CZ   1 
ATOM   3557 O OH   . TYR B 1 97  ? 45.588 -4.035  28.132 1.00 6.75  ? 97   TYR B OH   1 
ATOM   3558 H H    . TYR B 1 97  ? 50.188 -9.020  28.524 1.00 6.23  ? 97   TYR B H    1 
ATOM   3559 H HA   . TYR B 1 97  ? 50.963 -6.828  26.957 1.00 6.17  ? 97   TYR B HA   1 
ATOM   3560 H HB2  . TYR B 1 97  ? 50.732 -6.821  29.854 1.00 6.18  ? 97   TYR B HB2  1 
ATOM   3561 H HB3  . TYR B 1 97  ? 51.398 -5.615  29.039 1.00 6.18  ? 97   TYR B HB3  1 
ATOM   3562 H HD1  . TYR B 1 97  ? 49.996 -4.173  27.614 1.00 6.54  ? 97   TYR B HD1  1 
ATOM   3563 H HD2  . TYR B 1 97  ? 48.313 -7.013  29.919 1.00 6.44  ? 97   TYR B HD2  1 
ATOM   3564 H HE1  . TYR B 1 97  ? 47.910 -3.236  27.235 1.00 6.79  ? 97   TYR B HE1  1 
ATOM   3565 H HE2  . TYR B 1 97  ? 46.195 -6.079  29.559 1.00 6.43  ? 97   TYR B HE2  1 
ATOM   3566 H HH   . TYR B 1 97  ? 45.650 -3.367  27.626 1.00 10.13 ? 97   TYR B HH   1 
ATOM   3567 N N    . LYS B 1 98  ? 53.388 -7.101  27.313 1.00 5.20  ? 98   LYS B N    1 
ATOM   3568 C CA   . LYS B 1 98  ? 54.812 -7.159  27.607 1.00 5.38  ? 98   LYS B CA   1 
ATOM   3569 C C    . LYS B 1 98  ? 55.105 -6.111  28.702 1.00 4.71  ? 98   LYS B C    1 
ATOM   3570 O O    . LYS B 1 98  ? 54.771 -4.937  28.514 1.00 5.50  ? 98   LYS B O    1 
ATOM   3571 C CB   . LYS B 1 98  ? 55.584 -6.837  26.363 1.00 6.64  ? 98   LYS B CB   1 
ATOM   3572 C CG   . LYS B 1 98  ? 57.101 -6.716  26.556 1.00 9.76  ? 98   LYS B CG   1 
ATOM   3573 C CD   . LYS B 1 98  ? 57.804 -8.004  26.896 1.00 14.62 ? 98   LYS B CD   1 
ATOM   3574 C CE   . LYS B 1 98  ? 59.227 -7.662  27.150 1.00 19.25 ? 98   LYS B CE   1 
ATOM   3575 N NZ   . LYS B 1 98  ? 60.255 -8.225  28.018 1.00 30.00 ? 98   LYS B NZ   1 
ATOM   3576 H H    . LYS B 1 98  ? 53.113 -6.628  26.623 1.00 6.25  ? 98   LYS B H    1 
ATOM   3577 H HA   . LYS B 1 98  ? 55.057 -8.072  27.934 1.00 6.46  ? 98   LYS B HA   1 
ATOM   3578 H HB2  . LYS B 1 98  ? 55.407 -7.543  25.692 1.00 7.97  ? 98   LYS B HB2  1 
ATOM   3579 H HB3  . LYS B 1 98  ? 55.244 -5.984  25.994 1.00 7.97  ? 98   LYS B HB3  1 
ATOM   3580 H HG2  . LYS B 1 98  ? 57.495 -6.352  25.724 1.00 11.71 ? 98   LYS B HG2  1 
ATOM   3581 H HG3  . LYS B 1 98  ? 57.274 -6.062  27.279 1.00 11.71 ? 98   LYS B HG3  1 
ATOM   3582 H HD2  . LYS B 1 98  ? 57.399 -8.415  27.701 1.00 17.54 ? 98   LYS B HD2  1 
ATOM   3583 H HD3  . LYS B 1 98  ? 57.732 -8.644  26.145 1.00 17.54 ? 98   LYS B HD3  1 
ATOM   3584 H HE2  . LYS B 1 98  ? 59.640 -7.681  26.250 1.00 23.10 ? 98   LYS B HE2  1 
ATOM   3585 H HE3  . LYS B 1 98  ? 59.199 -6.705  27.406 1.00 23.10 ? 98   LYS B HE3  1 
ATOM   3586 H HZ1  . LYS B 1 98  ? 60.392 -9.098  27.800 1.00 45.00 ? 98   LYS B HZ1  1 
ATOM   3587 H HZ2  . LYS B 1 98  ? 61.031 -7.761  27.911 1.00 45.00 ? 98   LYS B HZ2  1 
ATOM   3588 H HZ3  . LYS B 1 98  ? 59.985 -8.168  28.885 1.00 45.00 ? 98   LYS B HZ3  1 
ATOM   3589 N N    . THR B 1 99  ? 55.755 -6.566  29.762 1.00 4.34  ? 99   THR B N    1 
ATOM   3590 C CA   . THR B 1 99  ? 56.242 -5.697  30.840 1.00 3.99  ? 99   THR B CA   1 
ATOM   3591 C C    . THR B 1 99  ? 57.710 -5.353  30.577 1.00 4.41  ? 99   THR B C    1 
ATOM   3592 O O    . THR B 1 99  ? 58.518 -6.279  30.471 1.00 5.66  ? 99   THR B O    1 
ATOM   3593 C CB   . THR B 1 99  ? 56.131 -6.434  32.171 1.00 4.11  ? 99   THR B CB   1 
ATOM   3594 O OG1  . THR B 1 99  ? 54.765 -6.660  32.498 1.00 4.50  ? 99   THR B OG1  1 
ATOM   3595 C CG2  . THR B 1 99  ? 56.742 -5.654  33.319 1.00 4.41  ? 99   THR B CG2  1 
ATOM   3596 H H    . THR B 1 99  ? 55.903 -7.432  29.824 1.00 5.20  ? 99   THR B H    1 
ATOM   3597 H HA   . THR B 1 99  ? 55.698 -4.858  30.871 1.00 4.79  ? 99   THR B HA   1 
ATOM   3598 H HB   . THR B 1 99  ? 56.596 -7.316  32.094 1.00 4.94  ? 99   THR B HB   1 
ATOM   3599 H HG1  . THR B 1 99  ? 54.716 -7.065  33.232 1.00 6.75  ? 99   THR B HG1  1 
ATOM   3600 H HG21 . THR B 1 99  ? 56.282 -4.794  33.411 1.00 6.62  ? 99   THR B HG21 1 
ATOM   3601 H HG22 . THR B 1 99  ? 56.646 -6.166  34.149 1.00 6.62  ? 99   THR B HG22 1 
ATOM   3602 H HG23 . THR B 1 99  ? 57.693 -5.499  33.139 1.00 6.62  ? 99   THR B HG23 1 
ATOM   3603 N N    . THR B 1 100 ? 58.032 -4.045  30.512 1.00 4.50  ? 100  THR B N    1 
ATOM   3604 C CA   . THR B 1 100 ? 59.420 -3.634  30.373 1.00 5.49  ? 100  THR B CA   1 
ATOM   3605 C C    . THR B 1 100 ? 59.729 -2.630  31.503 1.00 4.73  ? 100  THR B C    1 
ATOM   3606 O O    . THR B 1 100 ? 59.042 -1.619  31.627 1.00 5.41  ? 100  THR B O    1 
ATOM   3607 C CB   . THR B 1 100 ? 59.709 -2.996  29.038 1.00 7.04  ? 100  THR B CB   1 
ATOM   3608 O OG1  . THR B 1 100 ? 59.292 -3.892  27.988 1.00 7.63  ? 100  THR B OG1  1 
ATOM   3609 C CG2  . THR B 1 100 ? 61.188 -2.712  28.876 1.00 9.50  ? 100  THR B CG2  1 
ATOM   3610 H H    . THR B 1 100 ? 57.398 -3.436  30.555 1.00 5.40  ? 100  THR B H    1 
ATOM   3611 H HA   . THR B 1 100 ? 60.007 -4.436  30.482 1.00 6.59  ? 100  THR B HA   1 
ATOM   3612 H HB   . THR B 1 100 ? 59.198 -2.139  28.964 1.00 8.45  ? 100  THR B HB   1 
ATOM   3613 H HG1  . THR B 1 100 ? 58.991 -4.600  28.327 1.00 11.45 ? 100  THR B HG1  1 
ATOM   3614 H HG21 . THR B 1 100 ? 61.485 -2.111  29.591 1.00 14.24 ? 100  THR B HG21 1 
ATOM   3615 H HG22 . THR B 1 100 ? 61.689 -3.552  28.926 1.00 14.24 ? 100  THR B HG22 1 
ATOM   3616 H HG23 . THR B 1 100 ? 61.346 -2.289  28.006 1.00 14.24 ? 100  THR B HG23 1 
ATOM   3617 N N    . GLN B 1 101 ? 60.763 -2.915  32.267 1.00 4.31  ? 101  GLN B N    1 
ATOM   3618 C CA   . GLN B 1 101 ? 61.260 -1.974  33.275 1.00 3.97  ? 101  GLN B CA   1 
ATOM   3619 C C    . GLN B 1 101 ? 62.148 -0.923  32.595 1.00 4.22  ? 101  GLN B C    1 
ATOM   3620 O O    . GLN B 1 101 ? 62.983 -1.286  31.769 1.00 5.50  ? 101  GLN B O    1 
ATOM   3621 C CB   . GLN B 1 101 ? 62.126 -2.683  34.303 1.00 4.77  ? 101  GLN B CB   1 
ATOM   3622 C CG   . GLN B 1 101 ? 61.471 -3.812  35.086 1.00 5.57  ? 101  GLN B CG   1 
ATOM   3623 C CD   . GLN B 1 101 ? 62.399 -4.480  36.014 1.00 6.60  ? 101  GLN B CD   1 
ATOM   3624 O OE1  . GLN B 1 101 ? 63.625 -4.503  35.783 1.00 12.53 ? 101  GLN B OE1  1 
ATOM   3625 N NE2  . GLN B 1 101 ? 61.918 -5.002  37.117 1.00 6.86  ? 101  GLN B NE2  1 
ATOM   3626 H H    . GLN B 1 101 ? 61.166 -3.691  32.171 1.00 5.17  ? 101  GLN B H    1 
ATOM   3627 H HA   . GLN B 1 101 ? 60.491 -1.526  33.730 1.00 4.76  ? 101  GLN B HA   1 
ATOM   3628 H HB2  . GLN B 1 101 ? 62.918 -3.051  33.837 1.00 5.73  ? 101  GLN B HB2  1 
ATOM   3629 H HB3  . GLN B 1 101 ? 62.451 -2.008  34.949 1.00 5.73  ? 101  GLN B HB3  1 
ATOM   3630 H HG2  . GLN B 1 101 ? 60.708 -3.447  35.601 1.00 6.69  ? 101  GLN B HG2  1 
ATOM   3631 H HG3  . GLN B 1 101 ? 61.114 -4.481  34.450 1.00 6.69  ? 101  GLN B HG3  1 
ATOM   3632 H HE21 . GLN B 1 101 ? 61.052 -4.981  37.272 1.00 8.23  ? 101  GLN B HE21 1 
ATOM   3633 H HE22 . GLN B 1 101 ? 62.461 -5.373  37.701 1.00 8.23  ? 101  GLN B HE22 1 
ATOM   3634 N N    . ALA B 1 102 ? 62.051 0.332   33.050 1.00 4.20  ? 102  ALA B N    1 
ATOM   3635 C CA   . ALA B 1 102 ? 62.883 1.371   32.491 1.00 4.77  ? 102  ALA B CA   1 
ATOM   3636 C C    . ALA B 1 102 ? 63.116 2.461   33.534 1.00 4.48  ? 102  ALA B C    1 
ATOM   3637 O O    . ALA B 1 102 ? 62.460 2.529   34.579 1.00 4.24  ? 102  ALA B O    1 
ATOM   3638 C CB   . ALA B 1 102 ? 62.278 1.928   31.212 1.00 6.33  ? 102  ALA B CB   1 
ATOM   3639 H H    . ALA B 1 102 ? 61.479 0.524   33.690 1.00 5.04  ? 102  ALA B H    1 
ATOM   3640 H HA   . ALA B 1 102 ? 63.769 0.968   32.263 1.00 5.72  ? 102  ALA B HA   1 
ATOM   3641 H HB1  . ALA B 1 102 ? 61.418 2.352   31.415 1.00 9.49  ? 102  ALA B HB1  1 
ATOM   3642 H HB2  . ALA B 1 102 ? 62.886 2.592   30.825 1.00 9.49  ? 102  ALA B HB2  1 
ATOM   3643 H HB3  . ALA B 1 102 ? 62.140 1.199   30.572 1.00 9.49  ? 102  ALA B HB3  1 
ATOM   3644 N N    . ASN B 1 103 ? 64.061 3.355   33.200 1.00 5.17  ? 103  ASN B N    1 
ATOM   3645 C CA   . ASN B 1 103 ? 64.347 4.522   34.017 1.00 5.07  ? 103  ASN B CA   1 
ATOM   3646 C C    . ASN B 1 103 ? 64.438 5.705   33.041 1.00 5.12  ? 103  ASN B C    1 
ATOM   3647 O O    . ASN B 1 103 ? 65.365 5.758   32.238 1.00 6.75  ? 103  ASN B O    1 
ATOM   3648 C CB   . ASN B 1 103 ? 65.628 4.366   34.814 1.00 5.90  ? 103  ASN B CB   1 
ATOM   3649 C CG   . ASN B 1 103 ? 65.478 3.262   35.868 1.00 6.25  ? 103  ASN B CG   1 
ATOM   3650 O OD1  . ASN B 1 103 ? 65.739 2.115   35.539 1.00 8.34  ? 103  ASN B OD1  1 
ATOM   3651 N ND2  . ASN B 1 103 ? 65.045 3.618   37.058 1.00 6.53  ? 103  ASN B ND2  1 
ATOM   3652 H H    . ASN B 1 103 ? 64.523 3.230   32.462 1.00 6.20  ? 103  ASN B H    1 
ATOM   3653 H HA   . ASN B 1 103 ? 63.586 4.675   34.647 1.00 6.09  ? 103  ASN B HA   1 
ATOM   3654 H HB2  . ASN B 1 103 ? 66.373 4.140   34.203 1.00 7.08  ? 103  ASN B HB2  1 
ATOM   3655 H HB3  . ASN B 1 103 ? 65.846 5.222   35.261 1.00 7.08  ? 103  ASN B HB3  1 
ATOM   3656 H HD21 . ASN B 1 103 ? 64.875 4.464   37.229 1.00 7.84  ? 103  ASN B HD21 1 
ATOM   3657 H HD22 . ASN B 1 103 ? 64.926 3.010   37.683 1.00 7.84  ? 103  ASN B HD22 1 
ATOM   3658 N N    . LYS B 1 104 ? 63.447 6.579   33.087 1.00 4.59  ? 104  LYS B N    1 
ATOM   3659 C CA   . LYS B 1 104 ? 63.291 7.622   32.069 1.00 4.86  ? 104  LYS B CA   1 
ATOM   3660 C C    . LYS B 1 104 ? 62.806 8.905   32.730 1.00 4.30  ? 104  LYS B C    1 
ATOM   3661 O O    . LYS B 1 104 ? 62.263 8.879   33.846 1.00 4.88  ? 104  LYS B O    1 
ATOM   3662 C CB   . LYS B 1 104 ? 62.287 7.228   30.987 1.00 7.03  ? 104  LYS B CB   1 
ATOM   3663 C CG   . LYS B 1 104 ? 62.701 5.994   30.186 1.00 9.45  ? 104  LYS B CG   1 
ATOM   3664 C CD   . LYS B 1 104 ? 63.794 6.181   29.285 1.00 11.11 ? 104  LYS B CD   1 
ATOM   3665 C CE   A LYS B 1 104 ? 64.111 4.864   28.579 0.65 15.05 ? 104  LYS B CE   1 
ATOM   3666 C CE   B LYS B 1 104 ? 64.131 5.048   28.340 0.34 13.68 ? 104  LYS B CE   1 
ATOM   3667 N NZ   A LYS B 1 104 ? 65.444 5.013   27.851 0.65 26.98 ? 104  LYS B NZ   1 
ATOM   3668 N NZ   B LYS B 1 104 ? 63.249 4.965   27.145 0.34 20.50 ? 104  LYS B NZ   1 
ATOM   3669 H H    . LYS B 1 104 ? 62.866 6.533   33.746 1.00 5.51  ? 104  LYS B H    1 
ATOM   3670 H HA   . LYS B 1 104 ? 64.179 7.793   31.642 1.00 5.83  ? 104  LYS B HA   1 
ATOM   3671 H HB2  . LYS B 1 104 ? 61.411 7.054   31.413 1.00 8.43  ? 104  LYS B HB2  1 
ATOM   3672 H HB3  . LYS B 1 104 ? 62.173 7.990   30.365 1.00 8.43  ? 104  LYS B HB3  1 
ATOM   3673 H HG2  . LYS B 1 104 ? 62.940 5.275   30.822 1.00 11.34 ? 104  LYS B HG2  1 
ATOM   3674 H HG3  . LYS B 1 104 ? 61.918 5.683   29.666 1.00 11.34 ? 104  LYS B HG3  1 
ATOM   3675 H HD2  A LYS B 1 104 ? 63.560 6.871   28.615 1.00 13.33 ? 104  LYS B HD2  1 
ATOM   3676 H HD3  A LYS B 1 104 ? 64.589 6.492   29.785 1.00 13.33 ? 104  LYS B HD3  1 
ATOM   3677 H HE2  A LYS B 1 104 ? 64.167 4.130   29.241 0.65 18.06 ? 104  LYS B HE2  1 
ATOM   3678 H HE2  B LYS B 1 104 ? 65.067 5.156   28.036 0.34 16.42 ? 104  LYS B HE2  1 
ATOM   3679 H HE3  A LYS B 1 104 ? 63.394 4.646   27.931 0.65 18.06 ? 104  LYS B HE3  1 
ATOM   3680 H HE3  B LYS B 1 104 ? 64.074 4.193   28.836 0.34 16.42 ? 104  LYS B HE3  1 
ATOM   3681 H HZ1  A LYS B 1 104 ? 65.394 5.709   27.267 0.65 40.47 ? 104  LYS B HZ1  1 
ATOM   3682 H HZ1  B LYS B 1 104 ? 62.380 4.921   27.411 0.34 30.74 ? 104  LYS B HZ1  1 
ATOM   3683 H HZ2  A LYS B 1 104 ? 66.104 5.173   28.457 0.65 40.47 ? 104  LYS B HZ2  1 
ATOM   3684 H HZ2  B LYS B 1 104 ? 63.370 5.703   26.626 0.34 30.74 ? 104  LYS B HZ2  1 
ATOM   3685 H HZ3  A LYS B 1 104 ? 65.628 4.248   27.396 0.65 40.47 ? 104  LYS B HZ3  1 
ATOM   3686 H HZ3  B LYS B 1 104 ? 63.457 4.220   26.666 0.34 30.74 ? 104  LYS B HZ3  1 
ATOM   3687 N N    . HIS B 1 105 ? 62.953 10.024  32.017 1.00 4.62  ? 105  HIS B N    1 
ATOM   3688 C CA   . HIS B 1 105 ? 62.232 11.233  32.397 1.00 4.28  ? 105  HIS B CA   1 
ATOM   3689 C C    . HIS B 1 105 ? 60.796 11.064  31.940 1.00 4.68  ? 105  HIS B C    1 
ATOM   3690 O O    . HIS B 1 105 ? 60.560 10.559  30.819 1.00 9.05  ? 105  HIS B O    1 
ATOM   3691 C CB   . HIS B 1 105 ? 62.871 12.471  31.723 1.00 5.08  ? 105  HIS B CB   1 
ATOM   3692 C CG   . HIS B 1 105 ? 64.291 12.620  32.069 1.00 5.41  ? 105  HIS B CG   1 
ATOM   3693 N ND1  . HIS B 1 105 ? 64.792 13.287  33.117 1.00 7.66  ? 105  HIS B ND1  1 
ATOM   3694 C CD2  . HIS B 1 105 ? 65.370 12.057  31.468 1.00 10.08 ? 105  HIS B CD2  1 
ATOM   3695 C CE1  . HIS B 1 105 ? 66.111 13.289  33.200 1.00 8.54  ? 105  HIS B CE1  1 
ATOM   3696 N NE2  . HIS B 1 105 ? 66.488 12.557  32.254 1.00 10.98 ? 105  HIS B NE2  1 
ATOM   3697 H H    . HIS B 1 105 ? 63.487 10.032  31.318 1.00 5.54  ? 105  HIS B H    1 
ATOM   3698 H HA   . HIS B 1 105 ? 62.258 11.341  33.391 1.00 5.14  ? 105  HIS B HA   1 
ATOM   3699 H HB2  . HIS B 1 105 ? 62.783 12.388  30.740 1.00 6.10  ? 105  HIS B HB2  1 
ATOM   3700 H HB3  . HIS B 1 105 ? 62.381 13.284  32.004 1.00 6.10  ? 105  HIS B HB3  1 
ATOM   3701 H HD1  . HIS B 1 105 ? 64.281 13.694  33.707 1.00 9.19  ? 105  HIS B HD1  1 
ATOM   3702 H HD2  . HIS B 1 105 ? 65.391 11.477  30.716 1.00 12.09 ? 105  HIS B HD2  1 
ATOM   3703 H HE1  . HIS B 1 105 ? 66.652 13.745  33.834 1.00 10.24 ? 105  HIS B HE1  1 
ATOM   3704 N N    . ILE B 1 106 ? 59.836 11.458  32.745 1.00 4.07  ? 106  ILE B N    1 
ATOM   3705 C CA   . ILE B 1 106 ? 58.434 11.367  32.385 1.00 3.96  ? 106  ILE B CA   1 
ATOM   3706 C C    . ILE B 1 106 ? 57.915 12.718  31.937 1.00 3.67  ? 106  ILE B C    1 
ATOM   3707 O O    . ILE B 1 106 ? 58.413 13.768  32.364 1.00 4.21  ? 106  ILE B O    1 
ATOM   3708 C CB   . ILE B 1 106 ? 57.555 10.791  33.529 1.00 4.20  ? 106  ILE B CB   1 
ATOM   3709 C CG1  . ILE B 1 106 ? 57.454 11.719  34.733 1.00 4.61  ? 106  ILE B CG1  1 
ATOM   3710 C CG2  . ILE B 1 106 ? 58.082 9.394   33.914 1.00 5.33  ? 106  ILE B CG2  1 
ATOM   3711 C CD1  . ILE B 1 106 ? 56.428 11.279  35.754 1.00 5.57  ? 106  ILE B CD1  1 
ATOM   3712 H H    . ILE B 1 106 ? 60.052 11.789  33.531 1.00 4.88  ? 106  ILE B H    1 
ATOM   3713 H HA   . ILE B 1 106 ? 58.363 10.744  31.607 1.00 4.75  ? 106  ILE B HA   1 
ATOM   3714 H HB   . ILE B 1 106 ? 56.631 10.672  33.165 1.00 5.04  ? 106  ILE B HB   1 
ATOM   3715 H HG12 . ILE B 1 106 ? 58.340 11.772  35.171 1.00 5.53  ? 106  ILE B HG12 1 
ATOM   3716 H HG13 . ILE B 1 106 ? 57.221 12.628  34.417 1.00 5.53  ? 106  ILE B HG13 1 
ATOM   3717 H HG21 . ILE B 1 106 ? 58.127 8.829   33.114 1.00 7.99  ? 106  ILE B HG21 1 
ATOM   3718 H HG22 . ILE B 1 106 ? 58.977 9.479   34.304 1.00 7.99  ? 106  ILE B HG22 1 
ATOM   3719 H HG23 . ILE B 1 106 ? 57.478 8.985   34.568 1.00 7.99  ? 106  ILE B HG23 1 
ATOM   3720 H HD11 . ILE B 1 106 ? 56.660 10.386  36.086 1.00 8.36  ? 106  ILE B HD11 1 
ATOM   3721 H HD12 . ILE B 1 106 ? 56.418 11.913  36.502 1.00 8.36  ? 106  ILE B HD12 1 
ATOM   3722 H HD13 . ILE B 1 106 ? 55.542 11.252  35.337 1.00 8.36  ? 106  ILE B HD13 1 
ATOM   3723 N N    . ILE B 1 107 ? 56.881 12.667  31.108 1.00 3.85  ? 107  ILE B N    1 
ATOM   3724 C CA   . ILE B 1 107 ? 56.189 13.869  30.643 1.00 3.78  ? 107  ILE B CA   1 
ATOM   3725 C C    . ILE B 1 107 ? 54.714 13.672  30.964 1.00 3.95  ? 107  ILE B C    1 
ATOM   3726 O O    . ILE B 1 107 ? 54.106 12.702  30.499 1.00 4.33  ? 107  ILE B O    1 
ATOM   3727 C CB   . ILE B 1 107 ? 56.411 14.146  29.145 1.00 4.31  ? 107  ILE B CB   1 
ATOM   3728 C CG1  A ILE B 1 107 ? 57.904 14.220  28.842 0.69 5.04  ? 107  ILE B CG1  1 
ATOM   3729 C CG1  B ILE B 1 107 ? 57.816 14.566  28.756 0.31 4.76  ? 107  ILE B CG1  1 
ATOM   3730 C CG2  . ILE B 1 107 ? 55.571 15.380  28.743 1.00 5.25  ? 107  ILE B CG2  1 
ATOM   3731 C CD1  A ILE B 1 107 ? 58.285 14.268  27.389 0.69 7.12  ? 107  ILE B CD1  1 
ATOM   3732 C CD1  B ILE B 1 107 ? 58.670 13.356  28.480 0.31 6.67  ? 107  ILE B CD1  1 
ATOM   3733 H H    . ILE B 1 107 ? 56.601 11.882  30.827 1.00 4.62  ? 107  ILE B H    1 
ATOM   3734 H HA   . ILE B 1 107 ? 56.526 14.652  31.165 1.00 4.53  ? 107  ILE B HA   1 
ATOM   3735 H HB   A ILE B 1 107 ? 56.046 13.363  28.642 1.00 5.17  ? 107  ILE B HB   1 
ATOM   3736 H HG12 A ILE B 1 107 ? 58.271 15.026  29.285 0.69 6.05  ? 107  ILE B HG12 1 
ATOM   3737 H HG12 B ILE B 1 107 ? 57.780 15.136  27.948 0.31 5.71  ? 107  ILE B HG12 1 
ATOM   3738 H HG13 A ILE B 1 107 ? 58.343 13.433  29.252 0.69 6.05  ? 107  ILE B HG13 1 
ATOM   3739 H HG13 B ILE B 1 107 ? 58.219 15.096  29.489 0.31 5.71  ? 107  ILE B HG13 1 
ATOM   3740 H HG21 . ILE B 1 107 ? 54.623 15.201  28.918 1.00 7.87  ? 107  ILE B HG21 1 
ATOM   3741 H HG22 . ILE B 1 107 ? 55.859 16.157  29.268 1.00 7.87  ? 107  ILE B HG22 1 
ATOM   3742 H HG23 . ILE B 1 107 ? 55.698 15.565  27.789 1.00 7.87  ? 107  ILE B HG23 1 
ATOM   3743 H HD11 A ILE B 1 107 ? 57.812 15.006  26.952 0.69 10.69 ? 107  ILE B HD11 1 
ATOM   3744 H HD11 B ILE B 1 107 ? 58.649 12.758  29.257 0.31 10.00 ? 107  ILE B HD11 1 
ATOM   3745 H HD12 A ILE B 1 107 ? 59.252 14.407  27.310 0.69 10.69 ? 107  ILE B HD12 1 
ATOM   3746 H HD12 B ILE B 1 107 ? 58.323 12.884  27.695 0.31 10.00 ? 107  ILE B HD12 1 
ATOM   3747 H HD13 A ILE B 1 107 ? 58.040 13.422  26.959 0.69 10.69 ? 107  ILE B HD13 1 
ATOM   3748 H HD13 B ILE B 1 107 ? 59.593 13.639  28.311 0.31 10.00 ? 107  ILE B HD13 1 
ATOM   3749 N N    . VAL B 1 108 ? 54.164 14.589  31.762 1.00 4.18  ? 108  VAL B N    1 
ATOM   3750 C CA   . VAL B 1 108 ? 52.770 14.529  32.176 1.00 4.31  ? 108  VAL B CA   1 
ATOM   3751 C C    . VAL B 1 108 ? 52.082 15.815  31.720 1.00 4.26  ? 108  VAL B C    1 
ATOM   3752 O O    . VAL B 1 108 ? 52.663 16.888  31.701 1.00 5.14  ? 108  VAL B O    1 
ATOM   3753 C CB   . VAL B 1 108 ? 52.619 14.320  33.697 1.00 4.96  ? 108  VAL B CB   1 
ATOM   3754 C CG1  . VAL B 1 108 ? 53.147 12.924  34.067 1.00 6.36  ? 108  VAL B CG1  1 
ATOM   3755 C CG2  . VAL B 1 108 ? 53.315 15.370  34.517 1.00 5.70  ? 108  VAL B CG2  1 
ATOM   3756 H H    . VAL B 1 108 ? 54.662 15.255  32.049 1.00 5.01  ? 108  VAL B H    1 
ATOM   3757 H HA   . VAL B 1 108 ? 52.337 13.758  31.708 1.00 5.17  ? 108  VAL B HA   1 
ATOM   3758 H HB   . VAL B 1 108 ? 51.644 14.350  33.918 1.00 5.95  ? 108  VAL B HB   1 
ATOM   3759 H HG11 . VAL B 1 108 ? 52.688 12.247  33.527 1.00 9.54  ? 108  VAL B HG11 1 
ATOM   3760 H HG12 . VAL B 1 108 ? 54.111 12.883  33.892 1.00 9.54  ? 108  VAL B HG12 1 
ATOM   3761 H HG13 . VAL B 1 108 ? 52.980 12.753  35.017 1.00 9.54  ? 108  VAL B HG13 1 
ATOM   3762 H HG21 . VAL B 1 108 ? 52.961 16.254  34.285 1.00 8.55  ? 108  VAL B HG21 1 
ATOM   3763 H HG22 . VAL B 1 108 ? 53.161 15.196  35.469 1.00 8.55  ? 108  VAL B HG22 1 
ATOM   3764 H HG23 . VAL B 1 108 ? 54.277 15.345  34.332 1.00 8.55  ? 108  VAL B HG23 1 
ATOM   3765 N N    . ALA B 1 109 ? 50.778 15.684  31.442 1.00 4.55  ? 109  ALA B N    1 
ATOM   3766 C CA   . ALA B 1 109 ? 49.910 16.830  31.271 1.00 4.83  ? 109  ALA B CA   1 
ATOM   3767 C C    . ALA B 1 109 ? 49.338 17.188  32.627 1.00 4.65  ? 109  ALA B C    1 
ATOM   3768 O O    . ALA B 1 109 ? 48.929 16.273  33.359 1.00 5.39  ? 109  ALA B O    1 
ATOM   3769 C CB   . ALA B 1 109 ? 48.755 16.505  30.300 1.00 6.66  ? 109  ALA B CB   1 
ATOM   3770 H H    . ALA B 1 109 ? 50.439 14.876  31.360 1.00 5.46  ? 109  ALA B H    1 
ATOM   3771 H HA   . ALA B 1 109 ? 50.439 17.601  30.916 1.00 5.80  ? 109  ALA B HA   1 
ATOM   3772 H HB1  . ALA B 1 109 ? 48.237 15.750  30.649 1.00 9.99  ? 109  ALA B HB1  1 
ATOM   3773 H HB2  . ALA B 1 109 ? 49.122 16.271  29.422 1.00 9.99  ? 109  ALA B HB2  1 
ATOM   3774 H HB3  . ALA B 1 109 ? 48.172 17.288  30.211 1.00 9.99  ? 109  ALA B HB3  1 
ATOM   3775 N N    . CYS B 1 110 ? 49.302 18.482  32.958 1.00 5.13  ? 110  CYS B N    1 
ATOM   3776 C CA   . CYS B 1 110 ? 48.770 18.936  34.220 1.00 5.08  ? 110  CYS B CA   1 
ATOM   3777 C C    . CYS B 1 110 ? 47.635 19.937  34.008 1.00 5.84  ? 110  CYS B C    1 
ATOM   3778 O O    . CYS B 1 110 ? 47.633 20.674  33.009 1.00 8.50  ? 110  CYS B O    1 
ATOM   3779 C CB   . CYS B 1 110 ? 49.870 19.617  35.042 1.00 5.45  ? 110  CYS B CB   1 
ATOM   3780 S SG   . CYS B 1 110 ? 51.256 18.460  35.299 1.00 5.14  ? 110  CYS B SG   1 
ATOM   3781 H H    . CYS B 1 110 ? 49.612 19.076  32.388 1.00 6.16  ? 110  CYS B H    1 
ATOM   3782 H HA   . CYS B 1 110 ? 48.421 18.149  34.730 1.00 6.10  ? 110  CYS B HA   1 
ATOM   3783 H HB2  . CYS B 1 110 ? 50.192 20.423  34.565 1.00 6.54  ? 110  CYS B HB2  1 
ATOM   3784 H HB3  . CYS B 1 110 ? 49.505 19.901  35.917 1.00 6.54  ? 110  CYS B HB3  1 
ATOM   3785 N N    . GLU B 1 111 ? 46.710 19.946  34.933 1.00 6.26  ? 111  GLU B N    1 
ATOM   3786 C CA   . GLU B 1 111 ? 45.538 20.822  34.837 1.00 7.98  ? 111  GLU B CA   1 
ATOM   3787 C C    . GLU B 1 111 ? 44.974 20.957  36.241 1.00 7.71  ? 111  GLU B C    1 
ATOM   3788 O O    . GLU B 1 111 ? 45.123 20.096  37.090 1.00 8.06  ? 111  GLU B O    1 
ATOM   3789 C CB   . GLU B 1 111 ? 44.477 20.232  33.913 1.00 12.63 ? 111  GLU B CB   1 
ATOM   3790 C CG   . GLU B 1 111 ? 43.450 21.108  33.358 1.00 24.00 ? 111  GLU B CG   1 
ATOM   3791 C CD   . GLU B 1 111 ? 42.479 20.231  32.545 1.00 33.40 ? 111  GLU B CD   1 
ATOM   3792 O OE1  . GLU B 1 111 ? 42.585 18.965  32.701 1.00 41.38 ? 111  GLU B OE1  1 
ATOM   3793 O OE2  . GLU B 1 111 ? 41.730 21.049  31.937 1.00 64.56 ? 111  GLU B OE2  1 
ATOM   3794 H H    . GLU B 1 111 ? 46.792 19.414  35.629 1.00 7.51  ? 111  GLU B H    1 
ATOM   3795 H HA   . GLU B 1 111 ? 45.816 21.721  34.499 1.00 9.57  ? 111  GLU B HA   1 
ATOM   3796 H HB2  . GLU B 1 111 ? 44.948 19.806  33.153 1.00 15.16 ? 111  GLU B HB2  1 
ATOM   3797 H HB3  . GLU B 1 111 ? 44.017 19.510  34.410 1.00 15.16 ? 111  GLU B HB3  1 
ATOM   3798 H HG2  . GLU B 1 111 ? 42.965 21.569  34.087 1.00 28.80 ? 111  GLU B HG2  1 
ATOM   3799 H HG3  . GLU B 1 111 ? 43.864 21.792  32.774 1.00 28.80 ? 111  GLU B HG3  1 
ATOM   3800 N N    . GLY B 1 112 ? 44.204 22.065  36.403 1.00 8.86  ? 112  GLY B N    1 
ATOM   3801 C CA   . GLY B 1 112 ? 43.367 22.222  37.546 1.00 8.89  ? 112  GLY B CA   1 
ATOM   3802 C C    . GLY B 1 112 ? 43.902 23.128  38.607 1.00 8.70  ? 112  GLY B C    1 
ATOM   3803 O O    . GLY B 1 112 ? 44.981 23.728  38.506 1.00 9.98  ? 112  GLY B O    1 
ATOM   3804 H H    . GLY B 1 112 ? 44.222 22.697  35.791 1.00 10.63 ? 112  GLY B H    1 
ATOM   3805 H HA2  . GLY B 1 112 ? 42.490 22.572  37.247 1.00 10.67 ? 112  GLY B HA2  1 
ATOM   3806 H HA3  . GLY B 1 112 ? 43.210 21.330  37.945 1.00 10.67 ? 112  GLY B HA3  1 
ATOM   3807 N N    . ASN B 1 113 ? 43.088 23.252  39.629 1.00 11.87 ? 113  ASN B N    1 
ATOM   3808 C CA   . ASN B 1 113 ? 43.450 23.977  40.849 1.00 12.48 ? 113  ASN B CA   1 
ATOM   3809 C C    . ASN B 1 113 ? 43.036 23.008  41.942 1.00 13.33 ? 113  ASN B C    1 
ATOM   3810 O O    . ASN B 1 113 ? 41.798 22.911  42.293 1.00 16.65 ? 113  ASN B O    1 
ATOM   3811 C CB   . ASN B 1 113 ? 42.729 25.304  40.878 1.00 16.26 ? 113  ASN B CB   1 
ATOM   3812 C CG   A ASN B 1 113 ? 42.799 25.747  42.344 0.55 19.77 ? 113  ASN B CG   1 
ATOM   3813 C CG   B ASN B 1 113 ? 42.982 26.094  42.081 0.45 12.99 ? 113  ASN B CG   1 
ATOM   3814 O OD1  A ASN B 1 113 ? 44.006 25.903  42.716 0.55 18.56 ? 113  ASN B OD1  1 
ATOM   3815 O OD1  B ASN B 1 113 ? 43.633 25.508  43.004 0.45 18.72 ? 113  ASN B OD1  1 
ATOM   3816 N ND2  A ASN B 1 113 ? 41.623 25.924  43.008 0.55 26.54 ? 113  ASN B ND2  1 
ATOM   3817 N ND2  B ASN B 1 113 ? 42.400 27.296  42.212 0.45 14.17 ? 113  ASN B ND2  1 
ATOM   3818 H H    . ASN B 1 113 ? 42.290 22.883  39.579 1.00 14.25 ? 113  ASN B H    1 
ATOM   3819 H HA   . ASN B 1 113 ? 44.439 24.124  40.879 1.00 14.97 ? 113  ASN B HA   1 
ATOM   3820 H HB2  A ASN B 1 113 ? 43.177 25.961  40.289 1.00 19.52 ? 113  ASN B HB2  1 
ATOM   3821 H HB3  A ASN B 1 113 ? 41.789 25.200  40.586 1.00 19.52 ? 113  ASN B HB3  1 
ATOM   3822 H HD21 A ASN B 1 113 ? 40.859 25.769  42.600 0.55 31.84 ? 113  ASN B HD21 1 
ATOM   3823 H HD21 B ASN B 1 113 ? 41.962 27.650  41.536 0.45 17.00 ? 113  ASN B HD21 1 
ATOM   3824 H HD22 A ASN B 1 113 ? 41.627 26.192  43.847 0.55 31.84 ? 113  ASN B HD22 1 
ATOM   3825 H HD22 B ASN B 1 113 ? 42.456 27.731  42.975 0.45 17.00 ? 113  ASN B HD22 1 
ATOM   3826 N N    . PRO B 1 114 ? 43.957 22.283  42.572 1.00 12.40 ? 114  PRO B N    1 
ATOM   3827 C CA   . PRO B 1 114 ? 45.392 22.399  42.404 1.00 12.12 ? 114  PRO B CA   1 
ATOM   3828 C C    . PRO B 1 114 ? 45.836 21.832  41.068 1.00 8.70  ? 114  PRO B C    1 
ATOM   3829 O O    . PRO B 1 114 ? 45.178 20.999  40.444 1.00 9.24  ? 114  PRO B O    1 
ATOM   3830 C CB   . PRO B 1 114 ? 45.948 21.494  43.574 1.00 12.00 ? 114  PRO B CB   1 
ATOM   3831 C CG   . PRO B 1 114 ? 44.931 20.435  43.756 1.00 16.18 ? 114  PRO B CG   1 
ATOM   3832 C CD   . PRO B 1 114 ? 43.675 21.254  43.582 1.00 15.00 ? 114  PRO B CD   1 
ATOM   3833 H HA   . PRO B 1 114 ? 45.691 23.347  42.509 1.00 14.54 ? 114  PRO B HA   1 
ATOM   3834 H HB2  . PRO B 1 114 ? 46.823 21.102  43.328 1.00 14.40 ? 114  PRO B HB2  1 
ATOM   3835 H HB3  . PRO B 1 114 ? 46.056 22.023  44.404 1.00 14.40 ? 114  PRO B HB3  1 
ATOM   3836 H HG2  . PRO B 1 114 ? 45.008 19.728  43.067 1.00 19.42 ? 114  PRO B HG2  1 
ATOM   3837 H HG3  . PRO B 1 114 ? 44.982 20.027  44.657 1.00 19.42 ? 114  PRO B HG3  1 
ATOM   3838 H HD2  . PRO B 1 114 ? 42.929 20.677  43.283 1.00 17.99 ? 114  PRO B HD2  1 
ATOM   3839 H HD3  . PRO B 1 114 ? 43.421 21.677  44.440 1.00 17.99 ? 114  PRO B HD3  1 
ATOM   3840 N N    . TYR B 1 115 ? 47.007 22.297  40.648 1.00 7.97  ? 115  TYR B N    1 
ATOM   3841 C CA   . TYR B 1 115 ? 47.527 22.000  39.304 1.00 6.94  ? 115  TYR B CA   1 
ATOM   3842 C C    . TYR B 1 115 ? 48.346 20.682  39.392 1.00 6.73  ? 115  TYR B C    1 
ATOM   3843 O O    . TYR B 1 115 ? 49.429 20.664  39.947 1.00 7.79  ? 115  TYR B O    1 
ATOM   3844 C CB   . TYR B 1 115 ? 48.399 23.167  38.904 1.00 7.87  ? 115  TYR B CB   1 
ATOM   3845 C CG   . TYR B 1 115 ? 48.769 23.196  37.449 1.00 6.91  ? 115  TYR B CG   1 
ATOM   3846 C CD1  . TYR B 1 115 ? 47.802 23.508  36.461 1.00 8.48  ? 115  TYR B CD1  1 
ATOM   3847 C CD2  . TYR B 1 115 ? 50.065 23.008  37.005 1.00 6.17  ? 115  TYR B CD2  1 
ATOM   3848 C CE1  . TYR B 1 115 ? 48.107 23.556  35.126 1.00 8.62  ? 115  TYR B CE1  1 
ATOM   3849 C CE2  . TYR B 1 115 ? 50.403 23.131  35.674 1.00 6.03  ? 115  TYR B CE2  1 
ATOM   3850 C CZ   . TYR B 1 115 ? 49.424 23.435  34.716 1.00 6.56  ? 115  TYR B CZ   1 
ATOM   3851 O OH   . TYR B 1 115 ? 49.777 23.577  33.418 1.00 7.08  ? 115  TYR B OH   1 
ATOM   3852 H H    . TYR B 1 115 ? 47.487 22.797  41.190 1.00 9.57  ? 115  TYR B H    1 
ATOM   3853 H HA   . TYR B 1 115 ? 46.772 21.896  38.657 1.00 8.32  ? 115  TYR B HA   1 
ATOM   3854 H HB2  . TYR B 1 115 ? 47.924 24.007  39.127 1.00 9.44  ? 115  TYR B HB2  1 
ATOM   3855 H HB3  . TYR B 1 115 ? 49.229 23.141  39.442 1.00 9.44  ? 115  TYR B HB3  1 
ATOM   3856 H HD1  . TYR B 1 115 ? 46.911 23.691  36.734 1.00 10.17 ? 115  TYR B HD1  1 
ATOM   3857 H HD2  . TYR B 1 115 ? 50.742 22.787  37.634 1.00 7.41  ? 115  TYR B HD2  1 
ATOM   3858 H HE1  . TYR B 1 115 ? 47.417 23.672  34.483 1.00 10.35 ? 115  TYR B HE1  1 
ATOM   3859 H HE2  . TYR B 1 115 ? 51.306 23.009  35.404 1.00 7.24  ? 115  TYR B HE2  1 
ATOM   3860 H HH   . TYR B 1 115 ? 49.097 23.763  32.962 1.00 10.63 ? 115  TYR B HH   1 
ATOM   3861 N N    . VAL B 1 116 ? 47.745 19.598  38.915 1.00 5.88  ? 116  VAL B N    1 
ATOM   3862 C CA   . VAL B 1 116 ? 48.259 18.248  39.154 1.00 5.89  ? 116  VAL B CA   1 
ATOM   3863 C C    . VAL B 1 116 ? 48.208 17.444  37.875 1.00 4.59  ? 116  VAL B C    1 
ATOM   3864 O O    . VAL B 1 116 ? 47.558 17.814  36.894 1.00 5.00  ? 116  VAL B O    1 
ATOM   3865 C CB   . VAL B 1 116 ? 47.474 17.531  40.271 1.00 7.16  ? 116  VAL B CB   1 
ATOM   3866 C CG1  . VAL B 1 116 ? 47.650 18.207  41.625 1.00 10.17 ? 116  VAL B CG1  1 
ATOM   3867 C CG2  . VAL B 1 116 ? 45.993 17.410  39.921 1.00 9.99  ? 116  VAL B CG2  1 
ATOM   3868 H H    . VAL B 1 116 ? 47.011 19.695  38.438 1.00 7.06  ? 116  VAL B H    1 
ATOM   3869 H HA   . VAL B 1 116 ? 49.214 18.322  39.440 1.00 7.07  ? 116  VAL B HA   1 
ATOM   3870 H HB   . VAL B 1 116 ? 47.841 16.604  40.349 1.00 8.59  ? 116  VAL B HB   1 
ATOM   3871 H HG11 . VAL B 1 116 ? 48.603 18.247  41.849 1.00 15.25 ? 116  VAL B HG11 1 
ATOM   3872 H HG12 . VAL B 1 116 ? 47.285 19.116  41.585 1.00 15.25 ? 116  VAL B HG12 1 
ATOM   3873 H HG13 . VAL B 1 116 ? 47.174 17.694  42.311 1.00 15.25 ? 116  VAL B HG13 1 
ATOM   3874 H HG21 . VAL B 1 116 ? 45.898 16.969  39.052 1.00 14.98 ? 116  VAL B HG21 1 
ATOM   3875 H HG22 . VAL B 1 116 ? 45.537 16.881  40.608 1.00 14.98 ? 116  VAL B HG22 1 
ATOM   3876 H HG23 . VAL B 1 116 ? 45.594 18.304  39.879 1.00 14.98 ? 116  VAL B HG23 1 
ATOM   3877 N N    . PRO B 1 117 ? 48.887 16.278  37.857 1.00 4.77  ? 117  PRO B N    1 
ATOM   3878 C CA   . PRO B 1 117 ? 48.881 15.472  36.627 1.00 4.64  ? 117  PRO B CA   1 
ATOM   3879 C C    . PRO B 1 117 ? 47.494 14.893  36.323 1.00 4.86  ? 117  PRO B C    1 
ATOM   3880 O O    . PRO B 1 117 ? 46.819 14.368  37.196 1.00 5.50  ? 117  PRO B O    1 
ATOM   3881 C CB   . PRO B 1 117 ? 49.900 14.349  36.908 1.00 5.74  ? 117  PRO B CB   1 
ATOM   3882 C CG   . PRO B 1 117 ? 50.788 14.916  37.966 1.00 6.49  ? 117  PRO B CG   1 
ATOM   3883 C CD   . PRO B 1 117 ? 49.855 15.748  38.829 1.00 6.20  ? 117  PRO B CD   1 
ATOM   3884 H HA   . PRO B 1 117 ? 49.192 16.028  35.856 1.00 5.57  ? 117  PRO B HA   1 
ATOM   3885 H HB2  . PRO B 1 117 ? 49.445 13.531  37.229 1.00 6.89  ? 117  PRO B HB2  1 
ATOM   3886 H HB3  . PRO B 1 117 ? 50.418 14.130  36.093 1.00 6.89  ? 117  PRO B HB3  1 
ATOM   3887 H HG2  . PRO B 1 117 ? 51.210 14.194  38.497 1.00 7.78  ? 117  PRO B HG2  1 
ATOM   3888 H HG3  . PRO B 1 117 ? 51.498 15.479  37.568 1.00 7.78  ? 117  PRO B HG3  1 
ATOM   3889 H HD2  . PRO B 1 117 ? 49.405 15.189  39.511 1.00 7.44  ? 117  PRO B HD2  1 
ATOM   3890 H HD3  . PRO B 1 117 ? 50.344 16.480  39.281 1.00 7.44  ? 117  PRO B HD3  1 
ATOM   3891 N N    . VAL B 1 118 ? 47.144 14.979  35.028 1.00 4.79  ? 118  VAL B N    1 
ATOM   3892 C CA   . VAL B 1 118 ? 45.916 14.407  34.526 1.00 5.51  ? 118  VAL B CA   1 
ATOM   3893 C C    . VAL B 1 118 ? 46.135 13.456  33.358 1.00 6.04  ? 118  VAL B C    1 
ATOM   3894 O O    . VAL B 1 118 ? 45.201 12.702  33.039 1.00 9.57  ? 118  VAL B O    1 
ATOM   3895 C CB   . VAL B 1 118 ? 44.877 15.482  34.167 1.00 6.69  ? 118  VAL B CB   1 
ATOM   3896 C CG1  . VAL B 1 118 ? 44.420 16.236  35.424 1.00 7.44  ? 118  VAL B CG1  1 
ATOM   3897 C CG2  . VAL B 1 118 ? 45.369 16.420  33.054 1.00 7.77  ? 118  VAL B CG2  1 
ATOM   3898 H H    . VAL B 1 118 ? 47.679 15.396  34.468 1.00 5.75  ? 118  VAL B H    1 
ATOM   3899 H HA   . VAL B 1 118 ? 45.525 13.865  35.270 1.00 6.62  ? 118  VAL B HA   1 
ATOM   3900 H HB   . VAL B 1 118 ? 44.075 15.002  33.809 1.00 8.02  ? 118  VAL B HB   1 
ATOM   3901 H HG11 . VAL B 1 118 ? 44.024 15.603  36.059 1.00 11.16 ? 118  VAL B HG11 1 
ATOM   3902 H HG12 . VAL B 1 118 ? 45.192 16.675  35.840 1.00 11.16 ? 118  VAL B HG12 1 
ATOM   3903 H HG13 . VAL B 1 118 ? 43.754 16.911  35.177 1.00 11.16 ? 118  VAL B HG13 1 
ATOM   3904 H HG21 . VAL B 1 118 ? 45.656 15.888  32.282 1.00 11.66 ? 118  VAL B HG21 1 
ATOM   3905 H HG22 . VAL B 1 118 ? 44.641 17.019  32.785 1.00 11.66 ? 118  VAL B HG22 1 
ATOM   3906 H HG23 . VAL B 1 118 ? 46.124 16.950  33.384 1.00 11.66 ? 118  VAL B HG23 1 
ATOM   3907 N N    . HIS B 1 119 ? 47.294 13.430  32.724 1.00 5.13  ? 119  HIS B N    1 
ATOM   3908 C CA   . HIS B 1 119 ? 47.569 12.445  31.684 1.00 5.44  ? 119  HIS B CA   1 
ATOM   3909 C C    . HIS B 1 119 ? 49.035 12.116  31.730 1.00 4.97  ? 119  HIS B C    1 
ATOM   3910 O O    . HIS B 1 119 ? 49.888 12.939  32.039 1.00 5.64  ? 119  HIS B O    1 
ATOM   3911 C CB   . HIS B 1 119 ? 47.281 12.900  30.253 1.00 7.20  ? 119  HIS B CB   1 
ATOM   3912 C CG   . HIS B 1 119 ? 45.919 13.338  30.015 1.00 8.97  ? 119  HIS B CG   1 
ATOM   3913 N ND1  . HIS B 1 119 ? 44.774 12.554  30.120 1.00 12.57 ? 119  HIS B ND1  1 
ATOM   3914 C CD2  . HIS B 1 119 ? 45.495 14.540  29.633 1.00 13.46 ? 119  HIS B CD2  1 
ATOM   3915 C CE1  . HIS B 1 119 ? 43.779 13.342  29.860 1.00 15.12 ? 119  HIS B CE1  1 
ATOM   3916 N NE2  . HIS B 1 119 ? 44.129 14.541  29.551 1.00 16.39 ? 119  HIS B NE2  1 
ATOM   3917 H H    . HIS B 1 119 ? 47.913 14.019  32.934 1.00 6.15  ? 119  HIS B H    1 
ATOM   3918 H HA   . HIS B 1 119 ? 47.043 11.616  31.874 1.00 6.53  ? 119  HIS B HA   1 
ATOM   3919 H HB2  . HIS B 1 119 ? 47.895 13.644  30.029 1.00 8.64  ? 119  HIS B HB2  1 
ATOM   3920 H HB3  . HIS B 1 119 ? 47.483 12.151  29.637 1.00 8.64  ? 119  HIS B HB3  1 
ATOM   3921 H HD1  . HIS B 1 119 ? 44.734 11.698  30.322 1.00 15.08 ? 119  HIS B HD1  1 
ATOM   3922 H HD2  . HIS B 1 119 ? 46.055 15.284  29.446 1.00 16.15 ? 119  HIS B HD2  1 
ATOM   3923 H HE1  . HIS B 1 119 ? 42.872 13.060  29.895 1.00 18.15 ? 119  HIS B HE1  1 
ATOM   3924 N N    . PHE B 1 120 ? 49.352 10.839  31.374 1.00 5.02  ? 120  PHE B N    1 
ATOM   3925 C CA   . PHE B 1 120 ? 50.729 10.438  31.139 1.00 4.57  ? 120  PHE B CA   1 
ATOM   3926 C C    . PHE B 1 120 ? 50.982 10.621  29.638 1.00 4.84  ? 120  PHE B C    1 
ATOM   3927 O O    . PHE B 1 120 ? 50.384 9.933   28.830 1.00 6.01  ? 120  PHE B O    1 
ATOM   3928 C CB   . PHE B 1 120 ? 50.975 8.991   31.566 1.00 5.14  ? 120  PHE B CB   1 
ATOM   3929 C CG   . PHE B 1 120 ? 52.445 8.656   31.530 1.00 4.72  ? 120  PHE B CG   1 
ATOM   3930 C CD1  . PHE B 1 120 ? 53.068 8.290   30.324 1.00 5.43  ? 120  PHE B CD1  1 
ATOM   3931 C CD2  . PHE B 1 120 ? 53.242 8.782   32.662 1.00 5.47  ? 120  PHE B CD2  1 
ATOM   3932 C CE1  . PHE B 1 120 ? 54.430 8.063   30.270 1.00 5.95  ? 120  PHE B CE1  1 
ATOM   3933 C CE2  . PHE B 1 120 ? 54.593 8.568   32.620 1.00 6.37  ? 120  PHE B CE2  1 
ATOM   3934 C CZ   . PHE B 1 120 ? 55.226 8.212   31.439 1.00 6.21  ? 120  PHE B CZ   1 
ATOM   3935 H H    . PHE B 1 120 ? 48.709 10.244  31.285 1.00 6.02  ? 120  PHE B H    1 
ATOM   3936 H HA   . PHE B 1 120 ? 51.340 11.042  31.653 1.00 5.49  ? 120  PHE B HA   1 
ATOM   3937 H HB2  . PHE B 1 120 ? 50.629 8.855   32.484 1.00 6.17  ? 120  PHE B HB2  1 
ATOM   3938 H HB3  . PHE B 1 120 ? 50.484 8.381   30.960 1.00 6.17  ? 120  PHE B HB3  1 
ATOM   3939 H HD1  . PHE B 1 120 ? 52.546 8.197   29.536 1.00 6.51  ? 120  PHE B HD1  1 
ATOM   3940 H HD2  . PHE B 1 120 ? 52.837 9.023   33.487 1.00 6.56  ? 120  PHE B HD2  1 
ATOM   3941 H HE1  . PHE B 1 120 ? 54.836 7.807   29.450 1.00 7.14  ? 120  PHE B HE1  1 
ATOM   3942 H HE2  . PHE B 1 120 ? 55.106 8.665   33.414 1.00 7.65  ? 120  PHE B HE2  1 
ATOM   3943 H HZ   . PHE B 1 120 ? 56.165 8.071   31.412 1.00 7.45  ? 120  PHE B HZ   1 
ATOM   3944 N N    . ASP B 1 121 ? 51.843 11.574  29.281 1.00 4.46  ? 121  ASP B N    1 
ATOM   3945 C CA   . ASP B 1 121 ? 52.014 11.913  27.896 1.00 4.73  ? 121  ASP B CA   1 
ATOM   3946 C C    . ASP B 1 121 ? 53.102 11.151  27.193 1.00 5.42  ? 121  ASP B C    1 
ATOM   3947 O O    . ASP B 1 121 ? 52.884 10.743  26.030 1.00 6.89  ? 121  ASP B O    1 
ATOM   3948 C CB   . ASP B 1 121 ? 52.229 13.425  27.731 1.00 5.19  ? 121  ASP B CB   1 
ATOM   3949 C CG   . ASP B 1 121 ? 52.008 13.868  26.265 1.00 5.22  ? 121  ASP B CG   1 
ATOM   3950 O OD1  . ASP B 1 121 ? 50.880 13.612  25.763 1.00 6.10  ? 121  ASP B OD1  1 
ATOM   3951 O OD2  . ASP B 1 121 ? 52.934 14.436  25.676 1.00 6.16  ? 121  ASP B OD2  1 
ATOM   3952 H H    . ASP B 1 121 ? 52.308 11.997  29.897 1.00 5.35  ? 121  ASP B H    1 
ATOM   3953 H HA   . ASP B 1 121 ? 51.156 11.689  27.433 1.00 5.67  ? 121  ASP B HA   1 
ATOM   3954 H HB2  . ASP B 1 121 ? 51.599 13.912  28.319 1.00 6.22  ? 121  ASP B HB2  1 
ATOM   3955 H HB3  . ASP B 1 121 ? 53.150 13.658  28.009 1.00 6.22  ? 121  ASP B HB3  1 
ATOM   3956 N N    . ALA B 1 122 ? 54.269 10.970  27.798 1.00 4.87  ? 122  ALA B N    1 
ATOM   3957 C CA   . ALA B 1 122 ? 55.416 10.454  27.110 1.00 6.06  ? 122  ALA B CA   1 
ATOM   3958 C C    . ALA B 1 122 ? 56.522 10.189  28.108 1.00 5.11  ? 122  ALA B C    1 
ATOM   3959 O O    . ALA B 1 122 ? 56.479 10.588  29.254 1.00 4.73  ? 122  ALA B O    1 
ATOM   3960 C CB   . ALA B 1 122 ? 55.893 11.448  26.015 1.00 8.02  ? 122  ALA B CB   1 
ATOM   3961 H H    . ALA B 1 122 ? 54.341 11.173  28.651 1.00 5.84  ? 122  ALA B H    1 
ATOM   3962 H HA   . ALA B 1 122 ? 55.166 9.591   26.672 1.00 7.27  ? 122  ALA B HA   1 
ATOM   3963 H HB1  . ALA B 1 122 ? 56.155 12.294  26.434 1.00 12.04 ? 122  ALA B HB1  1 
ATOM   3964 H HB2  . ALA B 1 122 ? 56.661 11.067  25.540 1.00 12.04 ? 122  ALA B HB2  1 
ATOM   3965 H HB3  . ALA B 1 122 ? 55.164 11.609  25.381 1.00 12.04 ? 122  ALA B HB3  1 
ATOM   3966 N N    . SER B 1 123 ? 57.606 9.569   27.620 1.00 8.02  ? 123  SER B N    1 
ATOM   3967 C CA   . SER B 1 123 ? 58.833 9.471   28.390 1.00 6.93  ? 123  SER B CA   1 
ATOM   3968 C C    . SER B 1 123 ? 60.006 9.755   27.433 1.00 7.07  ? 123  SER B C    1 
ATOM   3969 O O    . SER B 1 123 ? 59.869 9.564   26.214 1.00 10.78 ? 123  SER B O    1 
ATOM   3970 C CB   . SER B 1 123 ? 58.982 8.148   29.048 1.00 9.04  ? 123  SER B CB   1 
ATOM   3971 O OG   . SER B 1 123 ? 59.163 7.120   28.156 1.00 11.74 ? 123  SER B OG   1 
ATOM   3972 H H    . SER B 1 123 ? 57.573 9.215   26.816 1.00 9.63  ? 123  SER B H    1 
ATOM   3973 H HA   . SER B 1 123 ? 58.822 10.177  29.097 1.00 8.32  ? 123  SER B HA   1 
ATOM   3974 H HB2  . SER B 1 123 ? 59.757 8.181   29.663 1.00 10.84 ? 123  SER B HB2  1 
ATOM   3975 H HB3  . SER B 1 123 ? 58.174 7.966   29.590 1.00 10.84 ? 123  SER B HB3  1 
ATOM   3976 H HG   . SER B 1 123 ? 58.505 7.082   27.635 1.00 17.60 ? 123  SER B HG   1 
ATOM   3977 N N    . VAL B 1 124 ? 61.116 10.145  27.961 1.00 6.87  ? 124  VAL B N    1 
ATOM   3978 C CA   . VAL B 1 124 ? 62.334 10.436  27.217 1.00 6.88  ? 124  VAL B CA   1 
ATOM   3979 C C    . VAL B 1 124 ? 63.548 10.099  27.975 1.00 6.91  ? 124  VAL B C    1 
ATOM   3980 O O    . VAL B 1 124 ? 64.630 9.952   27.338 1.00 8.82  ? 124  VAL B O    1 
ATOM   3981 C CB   . VAL B 1 124 ? 62.359 11.852  26.649 1.00 10.15 ? 124  VAL B CB   1 
ATOM   3982 C CG1  . VAL B 1 124 ? 61.163 12.059  25.760 1.00 24.81 ? 124  VAL B CG1  1 
ATOM   3983 C CG2  . VAL B 1 124 ? 62.378 12.859  27.743 1.00 11.39 ? 124  VAL B CG2  1 
ATOM   3984 O OXT  . VAL B 1 124 ? 63.517 10.073  29.229 1.00 8.47  ? 124  VAL B OXT  1 
ATOM   3985 H H    . VAL B 1 124 ? 61.139 10.243  28.835 1.00 8.24  ? 124  VAL B H    1 
ATOM   3986 H HA   . VAL B 1 124 ? 62.325 9.824   26.426 1.00 8.26  ? 124  VAL B HA   1 
ATOM   3987 H HB   . VAL B 1 124 ? 63.188 11.961  26.100 1.00 12.18 ? 124  VAL B HB   1 
ATOM   3988 H HG11 . VAL B 1 124 ? 61.141 11.359  25.074 1.00 37.21 ? 124  VAL B HG11 1 
ATOM   3989 H HG12 . VAL B 1 124 ? 60.345 12.014  26.298 1.00 37.21 ? 124  VAL B HG12 1 
ATOM   3990 H HG13 . VAL B 1 124 ? 61.224 12.937  25.330 1.00 37.21 ? 124  VAL B HG13 1 
ATOM   3991 H HG21 . VAL B 1 124 ? 63.148 12.693  28.326 1.00 17.08 ? 124  VAL B HG21 1 
ATOM   3992 H HG22 . VAL B 1 124 ? 62.447 13.758  27.358 1.00 17.08 ? 124  VAL B HG22 1 
ATOM   3993 H HG23 . VAL B 1 124 ? 61.552 12.789  28.265 1.00 17.08 ? 124  VAL B HG23 1 
HETATM 3994 S S    . SO4 C 2 .   ? 14.409 9.457   30.684 0.35 8.96  ? 125  SO4 A S    1 
HETATM 3995 O O1   . SO4 C 2 .   ? 13.828 9.675   29.363 0.35 19.80 ? 125  SO4 A O1   1 
HETATM 3996 O O2   . SO4 C 2 .   ? 15.744 9.928   30.720 0.35 13.65 ? 125  SO4 A O2   1 
HETATM 3997 O O3   . SO4 C 2 .   ? 13.564 10.265  31.638 0.35 11.97 ? 125  SO4 A O3   1 
HETATM 3998 O O4   . SO4 C 2 .   ? 14.320 8.071   31.053 0.35 11.99 ? 125  SO4 A O4   1 
HETATM 3999 C C    . ACT D 3 .   ? 19.505 6.093   28.643 0.65 11.27 ? 600  ACT A C    1 
HETATM 4000 O O    . ACT D 3 .   ? 18.842 5.756   29.723 0.65 6.19  ? 600  ACT A O    1 
HETATM 4001 O OXT  . ACT D 3 .   ? 20.683 5.712   28.331 0.65 13.80 ? 600  ACT A OXT  1 
HETATM 4002 C CH3  . ACT D 3 .   ? 18.892 6.971   27.602 0.65 15.96 ? 600  ACT A CH3  1 
HETATM 4003 C C1   . IPA E 4 .   ? 24.350 24.619  25.742 1.00 21.94 ? 800  IPA A C1   1 
HETATM 4004 C C2   . IPA E 4 .   ? 24.083 26.029  25.303 1.00 26.54 ? 800  IPA A C2   1 
HETATM 4005 C C3   . IPA E 4 .   ? 24.920 26.178  24.051 1.00 25.83 ? 800  IPA A C3   1 
HETATM 4006 O O2   . IPA E 4 .   ? 24.646 27.017  26.234 1.00 38.06 ? 800  IPA A O2   1 
HETATM 4007 C C1   . IPA F 4 .   ? 21.495 22.287  44.257 0.55 27.43 ? 801  IPA A C1   1 
HETATM 4008 C C2   . IPA F 4 .   ? 20.486 21.702  43.282 0.55 16.11 ? 801  IPA A C2   1 
HETATM 4009 C C3   . IPA F 4 .   ? 20.631 20.167  43.377 0.55 29.35 ? 801  IPA A C3   1 
HETATM 4010 O O2   . IPA F 4 .   ? 20.668 22.232  41.950 0.55 12.10 ? 801  IPA A O2   1 
HETATM 4011 C C1   . IPA G 4 .   ? 13.641 26.440  36.533 1.00 21.57 ? 802  IPA A C1   1 
HETATM 4012 C C2   . IPA G 4 .   ? 13.585 25.848  35.203 1.00 15.94 ? 802  IPA A C2   1 
HETATM 4013 C C3   . IPA G 4 .   ? 13.171 26.682  34.143 1.00 17.84 ? 802  IPA A C3   1 
HETATM 4014 O O2   . IPA G 4 .   ? 13.157 24.497  35.303 1.00 20.12 ? 802  IPA A O2   1 
HETATM 4015 C C1   . IPA H 4 .   ? 28.385 2.937   45.851 1.00 13.13 ? 803  IPA A C1   1 
HETATM 4016 C C2   . IPA H 4 .   ? 27.949 4.195   45.175 1.00 13.27 ? 803  IPA A C2   1 
HETATM 4017 C C3   . IPA H 4 .   ? 29.047 5.193   45.264 1.00 14.51 ? 803  IPA A C3   1 
HETATM 4018 O O2   . IPA H 4 .   ? 26.809 4.752   45.638 1.00 15.40 ? 803  IPA A O2   1 
HETATM 4019 S S    . SO4 I 2 .   ? 45.868 9.003   29.781 0.42 5.65  ? 125  SO4 B S    1 
HETATM 4020 O O1   . SO4 I 2 .   ? 45.849 9.606   28.454 0.42 8.78  ? 125  SO4 B O1   1 
HETATM 4021 O O2   . SO4 I 2 .   ? 47.216 9.009   30.281 0.42 8.19  ? 125  SO4 B O2   1 
HETATM 4022 O O3   . SO4 I 2 .   ? 45.065 9.879   30.708 0.42 7.88  ? 125  SO4 B O3   1 
HETATM 4023 O O4   . SO4 I 2 .   ? 45.272 7.702   29.739 0.42 10.96 ? 125  SO4 B O4   1 
HETATM 4024 S S    . SO4 J 2 .   ? 52.705 -12.991 20.067 0.34 7.12  ? 126  SO4 B S    1 
HETATM 4025 O O1   . SO4 J 2 .   ? 51.901 -13.464 18.936 0.34 8.52  ? 126  SO4 B O1   1 
HETATM 4026 O O2   . SO4 J 2 .   ? 53.848 -12.246 19.569 0.34 11.85 ? 126  SO4 B O2   1 
HETATM 4027 O O3   . SO4 J 2 .   ? 51.893 -12.205 20.955 0.34 5.80  ? 126  SO4 B O3   1 
HETATM 4028 O O4   . SO4 J 2 .   ? 53.225 -14.200 20.766 0.34 7.41  ? 126  SO4 B O4   1 
HETATM 4029 C C    . ACT K 3 .   ? 51.340 5.849   28.203 0.58 5.39  ? 600  ACT B C    1 
HETATM 4030 O O    . ACT K 3 .   ? 50.581 5.521   29.155 0.58 6.48  ? 600  ACT B O    1 
HETATM 4031 O OXT  . ACT K 3 .   ? 52.574 5.612   28.129 0.58 5.90  ? 600  ACT B OXT  1 
HETATM 4032 C CH3  . ACT K 3 .   ? 50.763 6.625   27.037 0.58 8.21  ? 600  ACT B CH3  1 
HETATM 4033 C C    . ACT L 3 .   ? 52.224 4.691   21.789 1.00 12.20 ? 601  ACT B C    1 
HETATM 4034 O O    . ACT L 3 .   ? 53.422 4.204   21.907 1.00 12.73 ? 601  ACT B O    1 
HETATM 4035 O OXT  . ACT L 3 .   ? 51.448 4.221   20.865 1.00 16.38 ? 601  ACT B OXT  1 
HETATM 4036 C CH3  . ACT L 3 .   ? 51.662 5.688   22.754 1.00 12.80 ? 601  ACT B CH3  1 
HETATM 4037 C C    . ACT M 3 .   ? 50.597 -7.080  41.583 1.00 25.37 ? 602  ACT B C    1 
HETATM 4038 O O    . ACT M 3 .   ? 50.991 -7.218  42.861 1.00 20.47 ? 602  ACT B O    1 
HETATM 4039 O OXT  . ACT M 3 .   ? 51.393 -7.334  40.483 1.00 31.42 ? 602  ACT B OXT  1 
HETATM 4040 C CH3  . ACT M 3 .   ? 49.215 -6.884  41.136 1.00 38.02 ? 602  ACT B CH3  1 
HETATM 4041 C C1   . IPA N 4 .   ? 55.780 26.701  26.124 1.00 27.21 ? 800  IPA B C1   1 
HETATM 4042 C C2   . IPA N 4 .   ? 55.654 25.698  25.074 1.00 22.42 ? 800  IPA B C2   1 
HETATM 4043 C C3   . IPA N 4 .   ? 56.078 24.366  25.648 1.00 23.41 ? 800  IPA B C3   1 
HETATM 4044 O O2   . IPA N 4 .   ? 56.445 25.921  23.896 1.00 32.85 ? 800  IPA B O2   1 
HETATM 4045 C C1   . IPA O 4 .   ? 56.287 21.416  43.688 1.00 10.00 ? 801  IPA B C1   1 
HETATM 4046 C C2   . IPA O 4 .   ? 56.613 22.739  44.335 1.00 11.78 ? 801  IPA B C2   1 
HETATM 4047 C C3   . IPA O 4 .   ? 55.507 23.726  44.226 1.00 11.14 ? 801  IPA B C3   1 
HETATM 4048 O O2   . IPA O 4 .   ? 57.787 23.306  43.921 1.00 12.96 ? 801  IPA B O2   1 
HETATM 4049 C C1   . IPA P 4 .   ? 44.533 13.263  25.863 0.54 19.77 ? 804  IPA B C1   1 
HETATM 4050 C C2   . IPA P 4 .   ? 44.581 12.362  24.629 0.54 15.26 ? 804  IPA B C2   1 
HETATM 4051 C C3   . IPA P 4 .   ? 43.221 11.657  24.385 0.54 16.02 ? 804  IPA B C3   1 
HETATM 4052 O O2   . IPA P 4 .   ? 45.550 11.294  24.839 0.54 16.63 ? 804  IPA B O2   1 
HETATM 4053 C C1   . IPA Q 4 .   ? 62.175 -8.494  35.096 1.00 29.87 ? 805  IPA B C1   1 
HETATM 4054 C C2   . IPA Q 4 .   ? 61.426 -7.737  33.937 1.00 32.44 ? 805  IPA B C2   1 
HETATM 4055 C C3   . IPA Q 4 .   ? 60.030 -7.315  34.415 1.00 23.70 ? 805  IPA B C3   1 
HETATM 4056 O O2   . IPA Q 4 .   ? 61.552 -8.822  33.066 1.00 30.60 ? 805  IPA B O2   1 
HETATM 4057 O O    . HOH R 5 .   ? 3.659  6.129   43.377 1.00 26.47 ? 2001 HOH A O    1 
HETATM 4058 O O    . HOH R 5 .   ? 7.411  8.760   43.829 1.00 47.68 ? 2002 HOH A O    1 
HETATM 4059 O O    . HOH R 5 .   ? 7.831  18.127  43.956 0.50 18.64 ? 2003 HOH A O    1 
HETATM 4060 O O    . HOH R 5 .   ? 2.766  3.862   41.932 1.00 32.74 ? 2004 HOH A O    1 
HETATM 4061 O O    . HOH R 5 .   ? 6.176  5.842   44.105 1.00 29.76 ? 2005 HOH A O    1 
HETATM 4062 O O    . HOH R 5 .   ? 9.932  3.796   42.653 0.50 16.49 ? 2006 HOH A O    1 
HETATM 4063 O O    . HOH R 5 .   ? 10.583 18.669  34.763 1.00 34.71 ? 2007 HOH A O    1 
HETATM 4064 O O    . HOH R 5 .   ? 4.018  6.297   38.040 1.00 8.31  ? 2008 HOH A O    1 
HETATM 4065 O O    . HOH R 5 .   ? 9.434  6.450   41.956 1.00 31.13 ? 2009 HOH A O    1 
HETATM 4066 O O    . HOH R 5 .   ? 9.861  19.285  37.660 1.00 29.72 ? 2010 HOH A O    1 
HETATM 4067 O O    . HOH R 5 .   ? 6.913  11.512  43.571 1.00 11.49 ? 2011 HOH A O    1 
HETATM 4068 O O    . HOH R 5 .   ? 10.039 16.973  42.680 1.00 18.57 ? 2012 HOH A O    1 
HETATM 4069 O O    . HOH R 5 .   ? 10.229 14.493  44.185 1.00 19.01 ? 2013 HOH A O    1 
HETATM 4070 O O    . HOH R 5 .   ? 18.151 9.366   48.761 1.00 27.01 ? 2014 HOH A O    1 
HETATM 4071 O O    . HOH R 5 .   ? 7.533  16.752  37.942 1.00 21.29 ? 2015 HOH A O    1 
HETATM 4072 O O    . HOH R 5 .   ? 10.451 16.831  39.826 1.00 12.72 ? 2016 HOH A O    1 
HETATM 4073 O O    . HOH R 5 .   ? 11.714 7.341   43.118 1.00 39.01 ? 2017 HOH A O    1 
HETATM 4074 O O    . HOH R 5 .   ? 20.277 5.470   49.807 1.00 20.50 ? 2018 HOH A O    1 
HETATM 4075 O O    . HOH R 5 .   ? 8.788  7.149   31.643 1.00 25.52 ? 2019 HOH A O    1 
HETATM 4076 O O    . HOH R 5 .   ? 17.576 7.606   44.023 0.66 13.64 ? 2020 HOH A O    1 
HETATM 4077 O O    . HOH R 5 .   ? 14.883 12.102  46.622 1.00 18.66 ? 2021 HOH A O    1 
HETATM 4078 O O    . HOH R 5 .   ? 15.796 9.830   47.590 1.00 23.79 ? 2022 HOH A O    1 
HETATM 4079 O O    . HOH R 5 .   ? 12.930 13.649  44.392 1.00 34.19 ? 2023 HOH A O    1 
HETATM 4080 O O    . HOH R 5 .   ? 12.169 9.749   44.673 0.26 27.05 ? 2024 HOH A O    1 
HETATM 4081 O O    . HOH R 5 .   ? 15.406 8.049   45.482 0.23 21.46 ? 2025 HOH A O    1 
HETATM 4082 O O    . HOH R 5 .   ? 30.154 -11.395 33.216 1.00 15.00 ? 2026 HOH A O    1 
HETATM 4083 O O    . HOH R 5 .   ? 30.339 -10.764 37.803 1.00 26.72 ? 2027 HOH A O    1 
HETATM 4084 O O    . HOH R 5 .   ? 11.258 -7.628  40.281 1.00 16.15 ? 2028 HOH A O    1 
HETATM 4085 O O    . HOH R 5 .   ? 25.005 -10.742 42.331 1.00 16.67 ? 2029 HOH A O    1 
HETATM 4086 O O    . HOH R 5 .   ? 7.936  3.295   33.601 1.00 13.03 ? 2030 HOH A O    1 
HETATM 4087 O O    . HOH R 5 .   ? 8.642  -2.267  43.702 1.00 25.20 ? 2031 HOH A O    1 
HETATM 4088 O O    . HOH R 5 .   ? 11.342 1.192   42.512 1.00 55.02 ? 2032 HOH A O    1 
HETATM 4089 O O    . HOH R 5 .   ? 7.652  2.742   42.011 1.00 45.71 ? 2033 HOH A O    1 
HETATM 4090 O O    . HOH R 5 .   ? 12.467 -0.447  44.773 1.00 25.97 ? 2034 HOH A O    1 
HETATM 4091 O O    . HOH R 5 .   ? 11.375 5.112   30.492 0.65 14.64 ? 2035 HOH A O    1 
HETATM 4092 O O    . HOH R 5 .   ? 9.324  3.526   30.978 1.00 36.55 ? 2036 HOH A O    1 
HETATM 4093 O O    . HOH R 5 .   ? 16.852 4.940   43.168 1.00 12.93 ? 2037 HOH A O    1 
HETATM 4094 O O    . HOH R 5 .   ? 21.417 -3.255  43.272 1.00 14.64 ? 2038 HOH A O    1 
HETATM 4095 O O    . HOH R 5 .   ? 18.912 1.429   44.904 1.00 25.90 ? 2039 HOH A O    1 
HETATM 4096 O O    . HOH R 5 .   ? 25.444 2.275   48.797 1.00 10.96 ? 2040 HOH A O    1 
HETATM 4097 O O    . HOH R 5 .   ? 19.527 4.486   44.219 1.00 11.32 ? 2041 HOH A O    1 
HETATM 4098 O O    . HOH R 5 .   ? 19.710 7.122   45.135 1.00 25.29 ? 2042 HOH A O    1 
HETATM 4099 O O    . HOH R 5 .   ? 21.098 3.639   48.220 0.50 23.17 ? 2043 HOH A O    1 
HETATM 4100 O O    . HOH R 5 .   ? 19.953 7.563   48.075 1.00 19.83 ? 2044 HOH A O    1 
HETATM 4101 O O    . HOH R 5 .   ? 25.026 -3.062  48.800 1.00 6.47  ? 2045 HOH A O    1 
HETATM 4102 O O    . HOH R 5 .   ? 19.125 -2.383  46.640 1.00 27.97 ? 2046 HOH A O    1 
HETATM 4103 O O    . HOH R 5 .   ? 14.431 16.057  44.067 1.00 14.95 ? 2047 HOH A O    1 
HETATM 4104 O O    . HOH R 5 .   ? 15.128 16.477  46.624 1.00 30.68 ? 2048 HOH A O    1 
HETATM 4105 O O    . HOH R 5 .   ? 32.839 18.068  39.780 0.50 15.74 ? 2049 HOH A O    1 
HETATM 4106 O O    . HOH R 5 .   ? 30.620 -6.561  39.021 1.00 24.90 ? 2050 HOH A O    1 
HETATM 4107 O O    . HOH R 5 .   ? 23.241 -5.125  42.632 0.71 9.82  ? 2051 HOH A O    1 
HETATM 4108 O O    . HOH R 5 .   ? 29.500 -11.117 40.634 1.00 19.27 ? 2052 HOH A O    1 
HETATM 4109 O O    . HOH R 5 .   ? 8.855  19.764  24.347 1.00 19.68 ? 2053 HOH A O    1 
HETATM 4110 O O    . HOH R 5 .   ? 23.942 -9.486  40.000 1.00 12.20 ? 2054 HOH A O    1 
HETATM 4111 O O    . HOH R 5 .   ? 28.759 -7.013  34.718 1.00 28.23 ? 2055 HOH A O    1 
HETATM 4112 O O    . HOH R 5 .   ? 33.845 20.296  31.218 1.00 30.27 ? 2056 HOH A O    1 
HETATM 4113 O O    . HOH R 5 .   ? 28.842 -11.720 35.600 1.00 6.64  ? 2057 HOH A O    1 
HETATM 4114 O O    . HOH R 5 .   ? 29.357 -8.797  33.162 1.00 38.46 ? 2058 HOH A O    1 
HETATM 4115 O O    . HOH R 5 .   ? 33.483 23.304  31.264 1.00 29.19 ? 2059 HOH A O    1 
HETATM 4116 O O    . HOH R 5 .   ? 14.236 -7.814  32.104 1.00 8.10  ? 2060 HOH A O    1 
HETATM 4117 O O    . HOH R 5 .   ? 11.023 -12.334 18.504 1.00 24.02 ? 2061 HOH A O    1 
HETATM 4118 O O    . HOH R 5 .   ? 14.961 -10.605 39.857 1.00 11.52 ? 2062 HOH A O    1 
HETATM 4119 O O    . HOH R 5 .   ? 20.477 -12.188 42.193 1.00 26.86 ? 2063 HOH A O    1 
HETATM 4120 O O    . HOH R 5 .   ? 13.548 -8.450  39.003 1.00 10.22 ? 2064 HOH A O    1 
HETATM 4121 O O    . HOH R 5 .   ? 6.744  -5.927  35.323 1.00 22.33 ? 2065 HOH A O    1 
HETATM 4122 O O    . HOH R 5 .   ? 15.329 -2.440  41.888 1.00 12.77 ? 2066 HOH A O    1 
HETATM 4123 O O    . HOH R 5 .   ? 10.965 -6.300  42.714 1.00 14.26 ? 2067 HOH A O    1 
HETATM 4124 O O    . HOH R 5 .   ? 10.953 -3.509  42.494 1.00 16.41 ? 2068 HOH A O    1 
HETATM 4125 O O    . HOH R 5 .   ? 13.286 -2.538  43.646 1.00 17.43 ? 2069 HOH A O    1 
HETATM 4126 O O    . HOH R 5 .   ? 17.574 -1.585  43.184 1.00 23.25 ? 2070 HOH A O    1 
HETATM 4127 O O    . HOH R 5 .   ? 7.369  -0.310  31.938 1.00 17.44 ? 2071 HOH A O    1 
HETATM 4128 O O    . HOH R 5 .   ? 10.064 0.246   40.561 1.00 30.64 ? 2072 HOH A O    1 
HETATM 4129 O O    . HOH R 5 .   ? 6.760  -0.319  42.576 0.50 27.91 ? 2073 HOH A O    1 
HETATM 4130 O O    . HOH R 5 .   ? 12.427 17.848  43.497 1.00 16.61 ? 2074 HOH A O    1 
HETATM 4131 O O    . HOH R 5 .   ? 9.435  1.199   29.691 0.50 19.09 ? 2075 HOH A O    1 
HETATM 4132 O O    . HOH R 5 .   ? 9.517  13.046  33.598 1.00 25.46 ? 2076 HOH A O    1 
HETATM 4133 O O    . HOH R 5 .   ? 11.464 -7.908  32.286 1.00 11.47 ? 2077 HOH A O    1 
HETATM 4134 O O    . HOH R 5 .   ? 8.911  -4.279  34.740 1.00 7.00  ? 2078 HOH A O    1 
HETATM 4135 O O    . HOH R 5 .   ? 7.937  -7.960  31.448 1.00 24.30 ? 2079 HOH A O    1 
HETATM 4136 O O    . HOH R 5 .   ? 0.790  0.587   36.539 1.00 5.20  ? 2080 HOH A O    1 
HETATM 4137 O O    . HOH R 5 .   ? 3.808  -1.559  39.105 1.00 24.11 ? 2081 HOH A O    1 
HETATM 4138 O O    . HOH R 5 .   ? 1.198  -5.143  31.749 1.00 9.61  ? 2082 HOH A O    1 
HETATM 4139 O O    . HOH R 5 .   ? 3.743  -0.896  24.333 1.00 27.82 ? 2083 HOH A O    1 
HETATM 4140 O O    . HOH R 5 .   ? 6.968  1.759   28.678 1.00 15.80 ? 2084 HOH A O    1 
HETATM 4141 O O    . HOH R 5 .   ? 4.472  2.630   31.034 1.00 14.87 ? 2085 HOH A O    1 
HETATM 4142 O O    . HOH R 5 .   ? 10.849 5.855   27.779 1.00 47.78 ? 2086 HOH A O    1 
HETATM 4143 O O    . HOH R 5 .   ? 6.737  1.371   23.133 0.66 15.44 ? 2087 HOH A O    1 
HETATM 4144 O O    . HOH R 5 .   ? 14.937 3.383   25.246 1.00 33.23 ? 2088 HOH A O    1 
HETATM 4145 O O    . HOH R 5 .   ? 30.322 3.578   42.277 1.00 8.69  ? 2089 HOH A O    1 
HETATM 4146 O O    . HOH R 5 .   ? 32.942 6.345   40.091 0.50 17.50 ? 2090 HOH A O    1 
HETATM 4147 O O    . HOH R 5 .   ? 32.019 5.502   41.297 0.50 12.01 ? 2091 HOH A O    1 
HETATM 4148 O O    . HOH R 5 .   ? 22.476 11.398  48.269 1.00 18.16 ? 2092 HOH A O    1 
HETATM 4149 O O    . HOH R 5 .   ? 22.491 8.773   47.634 1.00 9.88  ? 2093 HOH A O    1 
HETATM 4150 O O    . HOH R 5 .   ? 31.575 10.876  45.830 1.00 36.67 ? 2094 HOH A O    1 
HETATM 4151 O O    . HOH R 5 .   ? 28.865 8.981   44.500 1.00 6.13  ? 2095 HOH A O    1 
HETATM 4152 O O    . HOH R 5 .   ? 16.687 14.994  42.847 1.00 15.13 ? 2096 HOH A O    1 
HETATM 4153 O O    . HOH R 5 .   ? 16.735 14.548  47.070 1.00 34.11 ? 2097 HOH A O    1 
HETATM 4154 O O    . HOH R 5 .   ? 23.220 21.425  40.965 1.00 13.69 ? 2098 HOH A O    1 
HETATM 4155 O O    . HOH R 5 .   ? 29.835 24.005  39.190 1.00 22.28 ? 2099 HOH A O    1 
HETATM 4156 O O    . HOH R 5 .   ? 22.599 25.205  41.246 1.00 24.02 ? 2100 HOH A O    1 
HETATM 4157 O O    . HOH R 5 .   ? 30.853 15.553  38.432 1.00 7.54  ? 2101 HOH A O    1 
HETATM 4158 O O    . HOH R 5 .   ? 31.539 20.552  40.182 1.00 21.31 ? 2102 HOH A O    1 
HETATM 4159 O O    . HOH R 5 .   ? 34.499 19.852  28.634 0.50 28.08 ? 2103 HOH A O    1 
HETATM 4160 O O    . HOH R 5 .   ? 28.824 25.440  30.794 1.00 9.50  ? 2104 HOH A O    1 
HETATM 4161 O O    . HOH R 5 .   ? 24.736 28.211  30.210 1.00 6.26  ? 2105 HOH A O    1 
HETATM 4162 O O    . HOH R 5 .   ? 28.052 23.167  25.284 1.00 29.38 ? 2106 HOH A O    1 
HETATM 4163 O O    . HOH R 5 .   ? 29.124 25.022  28.123 1.00 31.04 ? 2107 HOH A O    1 
HETATM 4164 O O    . HOH R 5 .   ? 26.239 21.384  23.424 1.00 22.76 ? 2108 HOH A O    1 
HETATM 4165 O O    . HOH R 5 .   ? 25.587 18.190  23.450 1.00 34.77 ? 2109 HOH A O    1 
HETATM 4166 O O    . HOH R 5 .   ? 25.381 14.557  23.889 1.00 28.74 ? 2110 HOH A O    1 
HETATM 4167 O O    . HOH R 5 .   ? 15.564 16.457  27.756 1.00 26.57 ? 2111 HOH A O    1 
HETATM 4168 O O    . HOH R 5 .   ? 13.922 23.938  29.126 1.00 20.77 ? 2112 HOH A O    1 
HETATM 4169 O O    . HOH R 5 .   ? 10.693 19.343  26.220 1.00 22.77 ? 2113 HOH A O    1 
HETATM 4170 O O    . HOH R 5 .   ? 18.948 20.608  21.991 1.00 12.92 ? 2114 HOH A O    1 
HETATM 4171 O O    . HOH R 5 .   ? 10.407 21.703  22.988 1.00 19.54 ? 2115 HOH A O    1 
HETATM 4172 O O    . HOH R 5 .   ? 14.837 19.558  27.738 1.00 20.86 ? 2116 HOH A O    1 
HETATM 4173 O O    . HOH R 5 .   ? 13.884 18.111  29.774 0.50 29.09 ? 2117 HOH A O    1 
HETATM 4174 O O    . HOH R 5 .   ? 31.888 18.764  31.795 0.50 18.67 ? 2118 HOH A O    1 
HETATM 4175 O O    . HOH R 5 .   ? 32.962 16.619  31.164 1.00 21.17 ? 2119 HOH A O    1 
HETATM 4176 O O    . HOH R 5 .   ? 32.461 25.158  37.402 1.00 34.47 ? 2120 HOH A O    1 
HETATM 4177 O O    . HOH R 5 .   ? 31.713 24.300  32.819 0.50 19.96 ? 2121 HOH A O    1 
HETATM 4178 O O    . HOH R 5 .   ? 32.706 15.920  40.657 0.50 11.12 ? 2122 HOH A O    1 
HETATM 4179 O O    . HOH R 5 .   ? 36.044 16.381  38.067 1.00 24.48 ? 2123 HOH A O    1 
HETATM 4180 O O    . HOH R 5 .   ? 37.569 8.661   34.711 1.00 12.57 ? 2124 HOH A O    1 
HETATM 4181 O O    . HOH R 5 .   ? 30.705 0.894   36.220 1.00 6.93  ? 2125 HOH A O    1 
HETATM 4182 O O    . HOH R 5 .   ? 28.556 -0.870  35.989 1.00 6.07  ? 2126 HOH A O    1 
HETATM 4183 O O    . HOH R 5 .   ? 24.831 -3.019  27.147 1.00 8.21  ? 2127 HOH A O    1 
HETATM 4184 O O    . HOH R 5 .   ? 21.085 3.689   21.136 1.00 27.26 ? 2128 HOH A O    1 
HETATM 4185 O O    . HOH R 5 .   ? 19.143 -6.001  19.894 0.50 20.68 ? 2129 HOH A O    1 
HETATM 4186 O O    . HOH R 5 .   ? 15.516 -3.257  20.950 1.00 25.95 ? 2130 HOH A O    1 
HETATM 4187 O O    . HOH R 5 .   ? 21.684 -9.042  20.334 1.00 31.85 ? 2131 HOH A O    1 
HETATM 4188 O O    . HOH R 5 .   ? 13.738 -15.089 20.214 1.00 13.00 ? 2132 HOH A O    1 
HETATM 4189 O O    . HOH R 5 .   ? 20.022 -12.544 21.133 1.00 18.93 ? 2133 HOH A O    1 
HETATM 4190 O O    . HOH R 5 .   ? 13.048 -10.715 18.848 1.00 28.50 ? 2134 HOH A O    1 
HETATM 4191 O O    . HOH R 5 .   ? 5.505  -9.060  22.105 1.00 10.59 ? 2135 HOH A O    1 
HETATM 4192 O O    . HOH R 5 .   ? 10.952 -10.227 31.077 1.00 15.31 ? 2136 HOH A O    1 
HETATM 4193 O O    . HOH R 5 .   ? 6.784  -16.990 27.767 1.00 46.64 ? 2137 HOH A O    1 
HETATM 4194 O O    . HOH R 5 .   ? 15.575 -11.921 30.345 1.00 12.62 ? 2138 HOH A O    1 
HETATM 4195 O O    . HOH R 5 .   ? 20.969 -11.005 28.584 1.00 6.51  ? 2139 HOH A O    1 
HETATM 4196 O O    . HOH R 5 .   ? 27.480 -9.707  29.643 1.00 15.55 ? 2140 HOH A O    1 
HETATM 4197 O O    . HOH R 5 .   ? 21.616 -8.473  31.959 1.00 5.36  ? 2141 HOH A O    1 
HETATM 4198 O O    . HOH R 5 .   ? 28.989 -4.147  25.569 1.00 42.57 ? 2142 HOH A O    1 
HETATM 4199 O O    . HOH R 5 .   ? 30.574 -4.962  31.348 1.00 15.55 ? 2143 HOH A O    1 
HETATM 4200 O O    . HOH R 5 .   ? 32.502 -3.507  30.724 1.00 35.49 ? 2144 HOH A O    1 
HETATM 4201 O O    . HOH R 5 .   ? 32.608 -5.046  32.399 1.00 32.24 ? 2145 HOH A O    1 
HETATM 4202 O O    . HOH R 5 .   ? 35.575 7.681   30.462 1.00 20.67 ? 2146 HOH A O    1 
HETATM 4203 O O    . HOH R 5 .   ? 33.883 3.097   30.362 1.00 17.96 ? 2147 HOH A O    1 
HETATM 4204 O O    . HOH R 5 .   ? 35.149 1.195   32.786 1.00 26.52 ? 2148 HOH A O    1 
HETATM 4205 O O    . HOH R 5 .   ? 33.341 -0.391  36.290 0.50 24.67 ? 2149 HOH A O    1 
HETATM 4206 O O    . HOH R 5 .   ? 33.773 6.813   37.393 0.67 11.32 ? 2150 HOH A O    1 
HETATM 4207 O O    . HOH R 5 .   ? 34.092 3.797   25.154 1.00 52.88 ? 2151 HOH A O    1 
HETATM 4208 O O    . HOH R 5 .   ? 35.620 5.012   29.060 1.00 39.62 ? 2152 HOH A O    1 
HETATM 4209 O O    . HOH R 5 .   ? 12.064 19.002  39.214 1.00 11.94 ? 2153 HOH A O    1 
HETATM 4210 O O    . HOH R 5 .   ? 12.014 30.149  45.049 1.00 21.09 ? 2154 HOH A O    1 
HETATM 4211 O O    . HOH R 5 .   ? 16.249 29.749  43.704 1.00 37.22 ? 2155 HOH A O    1 
HETATM 4212 O O    . HOH R 5 .   ? 15.759 26.675  46.701 1.00 19.69 ? 2156 HOH A O    1 
HETATM 4213 O O    . HOH R 5 .   ? 12.209 20.196  41.769 1.00 15.30 ? 2157 HOH A O    1 
HETATM 4214 O O    . HOH R 5 .   ? 17.657 24.992  42.734 1.00 28.85 ? 2158 HOH A O    1 
HETATM 4215 O O    . HOH R 5 .   ? 16.162 24.686  32.829 1.00 9.48  ? 2159 HOH A O    1 
HETATM 4216 O O    . HOH R 5 .   ? 20.242 19.323  41.578 0.45 25.28 ? 2160 HOH A O    1 
HETATM 4217 O O    . HOH R 5 .   ? 16.144 13.352  40.451 1.00 8.93  ? 2161 HOH A O    1 
HETATM 4218 O O    . HOH R 5 .   ? 11.723 11.843  34.866 1.00 10.53 ? 2162 HOH A O    1 
HETATM 4219 O O    . HOH R 5 .   ? 12.632 13.424  27.740 1.00 35.85 ? 2163 HOH A O    1 
HETATM 4220 O O    . HOH R 5 .   ? 23.553 15.809  25.323 1.00 7.99  ? 2164 HOH A O    1 
HETATM 4221 O O    . HOH R 5 .   ? 22.011 8.593   24.931 1.00 21.69 ? 2165 HOH A O    1 
HETATM 4222 O O    . HOH R 5 .   ? 16.921 13.898  27.933 1.00 15.75 ? 2166 HOH A O    1 
HETATM 4223 O O    . HOH R 5 .   ? 24.792 8.423   25.134 1.00 23.67 ? 2167 HOH A O    1 
HETATM 4224 O O    . HOH R 5 .   ? 24.951 6.071   28.272 1.00 29.63 ? 2168 HOH A O    1 
HETATM 4225 O O    . HOH R 5 .   ? 34.644 9.725   29.107 0.50 28.14 ? 2169 HOH A O    1 
HETATM 4226 O O    . HOH R 5 .   ? 15.160 9.901   31.833 0.65 10.92 ? 2170 HOH A O    1 
HETATM 4227 O O    . HOH R 5 .   ? 13.786 7.387   31.375 0.65 19.31 ? 2171 HOH A O    1 
HETATM 4228 O O    . HOH R 5 .   ? 13.503 9.502   34.206 1.00 11.89 ? 2172 HOH A O    1 
HETATM 4229 O O    . HOH R 5 .   ? 15.797 9.180   29.315 0.65 19.67 ? 2173 HOH A O    1 
HETATM 4230 O O    . HOH R 5 .   ? 16.156 6.417   29.265 0.65 18.86 ? 2174 HOH A O    1 
HETATM 4231 O O    . HOH R 5 .   ? 17.203 7.827   29.135 0.35 9.52  ? 2175 HOH A O    1 
HETATM 4232 O O    . HOH R 5 .   ? 22.437 6.701   26.621 0.50 28.81 ? 2176 HOH A O    1 
HETATM 4233 O O    . HOH R 5 .   ? 26.840 6.599   47.638 1.00 18.89 ? 2177 HOH A O    1 
HETATM 4234 O O    . HOH S 5 .   ? 36.217 6.265   43.422 0.50 20.35 ? 2001 HOH B O    1 
HETATM 4235 O O    . HOH S 5 .   ? 33.756 6.605   43.040 0.50 21.82 ? 2002 HOH B O    1 
HETATM 4236 O O    . HOH S 5 .   ? 35.808 11.491  43.835 1.00 34.72 ? 2003 HOH B O    1 
HETATM 4237 O O    . HOH S 5 .   ? 33.210 9.023   44.728 1.00 28.31 ? 2004 HOH B O    1 
HETATM 4238 O O    . HOH S 5 .   ? 37.843 13.445  33.543 1.00 41.09 ? 2005 HOH B O    1 
HETATM 4239 O O    . HOH S 5 .   ? 39.476 12.023  44.113 0.50 13.92 ? 2006 HOH B O    1 
HETATM 4240 O O    . HOH S 5 .   ? 39.096 3.469   41.405 1.00 25.26 ? 2007 HOH B O    1 
HETATM 4241 O O    . HOH S 5 .   ? 39.429 14.979  43.961 0.50 13.14 ? 2008 HOH B O    1 
HETATM 4242 O O    . HOH S 5 .   ? 45.314 1.181   44.477 0.50 26.27 ? 2009 HOH B O    1 
HETATM 4243 O O    . HOH S 5 .   ? 39.938 6.265   41.270 1.00 16.46 ? 2010 HOH B O    1 
HETATM 4244 O O    . HOH S 5 .   ? 37.955 11.305  35.192 1.00 15.21 ? 2011 HOH B O    1 
HETATM 4245 O O    . HOH S 5 .   ? 39.579 17.601  40.127 1.00 27.44 ? 2012 HOH B O    1 
HETATM 4246 O O    . HOH S 5 .   ? 43.376 3.617   41.907 1.00 41.00 ? 2013 HOH B O    1 
HETATM 4247 O O    . HOH S 5 .   ? 49.229 3.748   49.775 0.50 25.72 ? 2014 HOH B O    1 
HETATM 4248 O O    . HOH S 5 .   ? 37.902 10.760  42.220 1.00 15.77 ? 2015 HOH B O    1 
HETATM 4249 O O    . HOH S 5 .   ? 40.714 15.700  41.935 1.00 28.52 ? 2016 HOH B O    1 
HETATM 4250 O O    . HOH S 5 .   ? 45.800 3.842   43.817 1.00 33.04 ? 2017 HOH B O    1 
HETATM 4251 O O    . HOH S 5 .   ? 45.149 15.611  43.297 1.00 12.20 ? 2018 HOH B O    1 
HETATM 4252 O O    . HOH S 5 .   ? 48.814 9.237   48.386 1.00 28.98 ? 2019 HOH B O    1 
HETATM 4253 O O    . HOH S 5 .   ? 44.787 9.263   48.860 1.00 26.48 ? 2020 HOH B O    1 
HETATM 4254 O O    . HOH S 5 .   ? 38.079 15.924  36.275 1.00 28.64 ? 2021 HOH B O    1 
HETATM 4255 O O    . HOH S 5 .   ? 41.039 16.501  38.292 1.00 21.82 ? 2022 HOH B O    1 
HETATM 4256 O O    . HOH S 5 .   ? 49.579 -3.662  43.950 1.00 20.84 ? 2023 HOH B O    1 
HETATM 4257 O O    . HOH S 5 .   ? 42.564 6.630   41.986 1.00 20.80 ? 2024 HOH B O    1 
HETATM 4258 O O    . HOH S 5 .   ? 50.983 1.981   48.444 0.50 19.29 ? 2025 HOH B O    1 
HETATM 4259 O O    . HOH S 5 .   ? 51.023 5.411   49.367 1.00 15.65 ? 2026 HOH B O    1 
HETATM 4260 O O    . HOH S 5 .   ? 50.205 -0.770  48.538 1.00 15.42 ? 2027 HOH B O    1 
HETATM 4261 O O    . HOH S 5 .   ? 37.673 8.202   32.048 1.00 31.02 ? 2028 HOH B O    1 
HETATM 4262 O O    . HOH S 5 .   ? 40.549 6.590   28.934 1.00 43.22 ? 2029 HOH B O    1 
HETATM 4263 O O    . HOH S 5 .   ? 55.665 -10.933 42.134 1.00 12.88 ? 2030 HOH B O    1 
HETATM 4264 O O    . HOH S 5 .   ? 46.389 8.163   45.068 0.34 23.08 ? 2031 HOH B O    1 
HETATM 4265 O O    . HOH S 5 .   ? 43.718 12.883  42.791 1.00 23.70 ? 2032 HOH B O    1 
HETATM 4266 O O    . HOH S 5 .   ? 48.522 7.391   43.526 0.79 12.02 ? 2033 HOH B O    1 
HETATM 4267 O O    . HOH S 5 .   ? 47.230 14.061  42.243 1.00 12.44 ? 2034 HOH B O    1 
HETATM 4268 O O    . HOH S 5 .   ? 47.902 4.869   42.625 1.00 12.46 ? 2035 HOH B O    1 
HETATM 4269 O O    . HOH S 5 .   ? 46.744 9.991   47.241 1.00 25.86 ? 2036 HOH B O    1 
HETATM 4270 O O    . HOH S 5 .   ? 45.880 12.149  45.964 1.00 12.11 ? 2037 HOH B O    1 
HETATM 4271 O O    . HOH S 5 .   ? 61.366 -10.823 38.072 1.00 22.22 ? 2038 HOH B O    1 
HETATM 4272 O O    . HOH S 5 .   ? 39.650 3.555   32.792 1.00 41.88 ? 2039 HOH B O    1 
HETATM 4273 O O    . HOH S 5 .   ? 41.524 1.808   41.534 1.00 34.44 ? 2040 HOH B O    1 
HETATM 4274 O O    . HOH S 5 .   ? 42.742 0.260   43.493 1.00 63.36 ? 2041 HOH B O    1 
HETATM 4275 O O    . HOH S 5 .   ? 41.255 4.290   30.567 1.00 22.74 ? 2042 HOH B O    1 
HETATM 4276 O O    . HOH S 5 .   ? 52.177 -3.330  43.082 1.00 7.85  ? 2043 HOH B O    1 
HETATM 4277 O O    . HOH S 5 .   ? 49.828 1.296   44.454 1.00 23.47 ? 2044 HOH B O    1 
HETATM 4278 O O    . HOH S 5 .   ? 50.725 6.966   44.732 1.00 19.45 ? 2045 HOH B O    1 
HETATM 4279 O O    . HOH S 5 .   ? 54.052 3.619   48.637 0.50 19.14 ? 2046 HOH B O    1 
HETATM 4280 O O    . HOH S 5 .   ? 50.554 4.318   43.856 1.00 11.50 ? 2047 HOH B O    1 
HETATM 4281 O O    . HOH S 5 .   ? 56.156 2.129   48.685 1.00 9.93  ? 2048 HOH B O    1 
HETATM 4282 O O    . HOH S 5 .   ? 50.673 7.494   47.538 1.00 12.65 ? 2049 HOH B O    1 
HETATM 4283 O O    . HOH S 5 .   ? 55.527 -3.354  48.610 1.00 5.50  ? 2050 HOH B O    1 
HETATM 4284 O O    . HOH S 5 .   ? 49.452 -1.549  45.875 1.00 28.57 ? 2051 HOH B O    1 
HETATM 4285 O O    . HOH S 5 .   ? 49.525 13.824  48.739 1.00 28.20 ? 2052 HOH B O    1 
HETATM 4286 O O    . HOH S 5 .   ? 63.960 1.125   41.438 1.00 30.40 ? 2053 HOH B O    1 
HETATM 4287 O O    . HOH S 5 .   ? 62.548 25.087  29.372 1.00 19.93 ? 2054 HOH B O    1 
HETATM 4288 O O    . HOH S 5 .   ? 57.652 22.321  21.093 1.00 21.00 ? 2055 HOH B O    1 
HETATM 4289 O O    . HOH S 5 .   ? 61.502 -7.396  38.939 0.50 17.94 ? 2056 HOH B O    1 
HETATM 4290 O O    . HOH S 5 .   ? 53.930 -5.372  42.513 0.85 8.77  ? 2057 HOH B O    1 
HETATM 4291 O O    . HOH S 5 .   ? 60.264 -11.480 40.871 1.00 14.13 ? 2058 HOH B O    1 
HETATM 4292 O O    . HOH S 5 .   ? 54.794 -9.668  39.844 1.00 7.88  ? 2059 HOH B O    1 
HETATM 4293 O O    . HOH S 5 .   ? 59.991 -11.958 35.826 1.00 5.66  ? 2060 HOH B O    1 
HETATM 4294 O O    . HOH S 5 .   ? 64.332 23.438  31.282 0.50 31.01 ? 2061 HOH B O    1 
HETATM 4295 O O    . HOH S 5 .   ? 65.937 26.348  35.107 0.50 27.33 ? 2062 HOH B O    1 
HETATM 4296 O O    . HOH S 5 .   ? 69.892 15.213  33.115 0.50 27.58 ? 2063 HOH B O    1 
HETATM 4297 O O    . HOH S 5 .   ? 54.530 -3.547  20.239 1.00 29.34 ? 2064 HOH B O    1 
HETATM 4298 O O    . HOH S 5 .   ? 45.678 -10.976 35.265 0.50 16.13 ? 2065 HOH B O    1 
HETATM 4299 O O    . HOH S 5 .   ? 45.635 -8.316  31.552 1.00 12.55 ? 2066 HOH B O    1 
HETATM 4300 O O    . HOH S 5 .   ? 45.860 -11.083 38.919 1.00 19.89 ? 2067 HOH B O    1 
HETATM 4301 O O    . HOH S 5 .   ? 44.822 -8.645  38.740 1.00 14.04 ? 2068 HOH B O    1 
HETATM 4302 O O    . HOH S 5 .   ? 50.919 -12.851 41.839 1.00 31.44 ? 2069 HOH B O    1 
HETATM 4303 O O    . HOH S 5 .   ? 48.182 -12.874 42.014 1.00 17.49 ? 2070 HOH B O    1 
HETATM 4304 O O    . HOH S 5 .   ? 65.234 -8.010  37.450 0.50 27.32 ? 2071 HOH B O    1 
HETATM 4305 O O    . HOH S 5 .   ? 45.542 -5.869  43.986 1.00 26.48 ? 2072 HOH B O    1 
HETATM 4306 O O    . HOH S 5 .   ? 47.091 -4.199  42.486 0.50 16.83 ? 2073 HOH B O    1 
HETATM 4307 O O    . HOH S 5 .   ? 41.598 -3.524  41.952 1.00 21.99 ? 2074 HOH B O    1 
HETATM 4308 O O    . HOH S 5 .   ? 40.836 -0.147  39.640 1.00 24.88 ? 2075 HOH B O    1 
HETATM 4309 O O    . HOH S 5 .   ? 43.552 -2.465  43.248 1.00 32.79 ? 2076 HOH B O    1 
HETATM 4310 O O    . HOH S 5 .   ? 45.891 -2.407  41.716 0.50 13.26 ? 2077 HOH B O    1 
HETATM 4311 O O    . HOH S 5 .   ? 41.710 -6.466  41.820 1.00 18.30 ? 2078 HOH B O    1 
HETATM 4312 O O    . HOH S 5 .   ? 59.778 5.950   23.396 1.00 33.72 ? 2079 HOH B O    1 
HETATM 4313 O O    . HOH S 5 .   ? 47.736 -1.344  43.333 1.00 25.72 ? 2080 HOH B O    1 
HETATM 4314 O O    . HOH S 5 .   ? 38.465 -1.029  31.090 1.00 45.11 ? 2081 HOH B O    1 
HETATM 4315 O O    . HOH S 5 .   ? 43.012 17.242  42.518 1.00 12.35 ? 2082 HOH B O    1 
HETATM 4316 O O    . HOH S 5 .   ? 39.660 19.911  43.931 1.00 33.06 ? 2083 HOH B O    1 
HETATM 4317 O O    . HOH S 5 .   ? 38.479 24.003  40.009 0.50 20.11 ? 2084 HOH B O    1 
HETATM 4318 O O    . HOH S 5 .   ? 41.103 12.043  32.156 1.00 21.23 ? 2085 HOH B O    1 
HETATM 4319 O O    . HOH S 5 .   ? 40.251 -4.608  34.283 1.00 12.05 ? 2086 HOH B O    1 
HETATM 4320 O O    . HOH S 5 .   ? 40.742 -8.737  32.344 1.00 33.44 ? 2087 HOH B O    1 
HETATM 4321 O O    . HOH S 5 .   ? 57.313 5.983   24.515 1.00 19.19 ? 2088 HOH B O    1 
HETATM 4322 O O    . HOH S 5 .   ? 32.120 0.318   28.689 1.00 23.17 ? 2089 HOH B O    1 
HETATM 4323 O O    . HOH S 5 .   ? 35.408 -0.658  24.028 0.50 30.48 ? 2090 HOH B O    1 
HETATM 4324 O O    . HOH S 5 .   ? 40.915 -0.832  23.347 1.00 9.15  ? 2091 HOH B O    1 
HETATM 4325 O O    . HOH S 5 .   ? 46.742 3.148   24.658 1.00 19.16 ? 2092 HOH B O    1 
HETATM 4326 O O    . HOH S 5 .   ? 53.359 1.788   28.676 1.00 9.46  ? 2093 HOH B O    1 
HETATM 4327 O O    . HOH S 5 .   ? 56.469 3.726   28.673 1.00 9.39  ? 2094 HOH B O    1 
HETATM 4328 O O    . HOH S 5 .   ? 61.372 3.237   42.508 1.00 6.72  ? 2095 HOH B O    1 
HETATM 4329 O O    . HOH S 5 .   ? 64.117 6.100   40.534 1.00 10.94 ? 2096 HOH B O    1 
HETATM 4330 O O    . HOH S 5 .   ? 53.538 11.090  48.108 1.00 17.57 ? 2097 HOH B O    1 
HETATM 4331 O O    . HOH S 5 .   ? 53.219 8.425   47.252 1.00 9.66  ? 2098 HOH B O    1 
HETATM 4332 O O    . HOH S 5 .   ? 59.754 8.742   44.673 1.00 5.31  ? 2099 HOH B O    1 
HETATM 4333 O O    . HOH S 5 .   ? 47.489 14.382  46.440 1.00 18.15 ? 2100 HOH B O    1 
HETATM 4334 O O    . HOH S 5 .   ? 53.975 21.193  40.648 1.00 15.52 ? 2101 HOH B O    1 
HETATM 4335 O O    . HOH S 5 .   ? 60.713 23.959  39.282 0.50 19.38 ? 2102 HOH B O    1 
HETATM 4336 O O    . HOH S 5 .   ? 53.473 24.868  40.985 1.00 23.71 ? 2103 HOH B O    1 
HETATM 4337 O O    . HOH S 5 .   ? 62.010 21.035  40.764 0.50 16.28 ? 2104 HOH B O    1 
HETATM 4338 O O    . HOH S 5 .   ? 62.526 18.154  26.205 0.50 22.41 ? 2105 HOH B O    1 
HETATM 4339 O O    . HOH S 5 .   ? 60.273 25.212  30.988 1.00 7.45  ? 2106 HOH B O    1 
HETATM 4340 O O    . HOH S 5 .   ? 56.232 27.958  30.203 1.00 5.35  ? 2107 HOH B O    1 
HETATM 4341 O O    . HOH S 5 .   ? 57.297 18.082  23.116 1.00 32.76 ? 2108 HOH B O    1 
HETATM 4342 O O    . HOH S 5 .   ? 58.092 20.768  23.291 1.00 16.76 ? 2109 HOH B O    1 
HETATM 4343 O O    . HOH S 5 .   ? 58.818 10.750  24.020 1.00 26.24 ? 2110 HOH B O    1 
HETATM 4344 O O    . HOH S 5 .   ? 59.698 13.782  20.977 1.00 29.33 ? 2111 HOH B O    1 
HETATM 4345 O O    . HOH S 5 .   ? 59.825 10.964  21.450 0.50 21.88 ? 2112 HOH B O    1 
HETATM 4346 O O    . HOH S 5 .   ? 58.038 13.633  18.435 1.00 36.93 ? 2113 HOH B O    1 
HETATM 4347 O O    . HOH S 5 .   ? 43.592 16.875  25.537 1.00 37.02 ? 2114 HOH B O    1 
HETATM 4348 O O    . HOH S 5 .   ? 47.469 16.316  27.260 1.00 35.95 ? 2115 HOH B O    1 
HETATM 4349 O O    . HOH S 5 .   ? 42.428 19.420  25.501 0.50 22.41 ? 2116 HOH B O    1 
HETATM 4350 O O    . HOH S 5 .   ? 45.720 23.402  28.343 1.00 24.44 ? 2117 HOH B O    1 
HETATM 4351 O O    . HOH S 5 .   ? 46.421 19.536  26.777 0.50 22.43 ? 2118 HOH B O    1 
HETATM 4352 O O    . HOH S 5 .   ? 64.630 16.217  31.836 1.00 22.76 ? 2119 HOH B O    1 
HETATM 4353 O O    . HOH S 5 .   ? 63.763 24.557  33.723 1.00 31.30 ? 2120 HOH B O    1 
HETATM 4354 O O    . HOH S 5 .   ? 68.098 16.812  35.382 1.00 21.72 ? 2121 HOH B O    1 
HETATM 4355 O O    . HOH S 5 .   ? 63.361 25.105  37.629 1.00 26.35 ? 2122 HOH B O    1 
HETATM 4356 O O    . HOH S 5 .   ? 68.518 14.077  34.574 1.00 19.73 ? 2123 HOH B O    1 
HETATM 4357 O O    . HOH S 5 .   ? 63.145 16.135  40.904 1.00 11.51 ? 2124 HOH B O    1 
HETATM 4358 O O    . HOH S 5 .   ? 61.565 15.324  38.719 1.00 5.97  ? 2125 HOH B O    1 
HETATM 4359 O O    . HOH S 5 .   ? 66.430 16.225  39.361 1.00 20.83 ? 2126 HOH B O    1 
HETATM 4360 O O    . HOH S 5 .   ? 68.521 11.917  36.156 1.00 8.78  ? 2127 HOH B O    1 
HETATM 4361 O O    . HOH S 5 .   ? 59.896 -1.133  36.230 1.00 4.87  ? 2128 HOH B O    1 
HETATM 4362 O O    . HOH S 5 .   ? 56.739 -3.277  27.244 1.00 7.85  ? 2129 HOH B O    1 
HETATM 4363 O O    . HOH S 5 .   ? 53.438 0.224   20.291 1.00 32.34 ? 2130 HOH B O    1 
HETATM 4364 O O    . HOH S 5 .   ? 56.823 -4.015  24.417 0.70 26.39 ? 2131 HOH B O    1 
HETATM 4365 O O    . HOH S 5 .   ? 54.678 -5.361  22.935 0.50 15.14 ? 2132 HOH B O    1 
HETATM 4366 O O    . HOH S 5 .   ? 44.988 -5.936  20.127 0.50 20.04 ? 2133 HOH B O    1 
HETATM 4367 O O    . HOH S 5 .   ? 45.208 -5.740  23.658 0.66 11.17 ? 2134 HOH B O    1 
HETATM 4368 O O    . HOH S 5 .   ? 52.149 -2.932  21.460 1.00 18.53 ? 2135 HOH B O    1 
HETATM 4369 O O    . HOH S 5 .   ? 50.002 -1.593  20.097 1.00 23.29 ? 2136 HOH B O    1 
HETATM 4370 O O    . HOH S 5 .   ? 45.929 -1.829  18.980 1.00 15.92 ? 2137 HOH B O    1 
HETATM 4371 O O    . HOH S 5 .   ? 47.233 -7.333  19.761 1.00 18.03 ? 2138 HOH B O    1 
HETATM 4372 O O    . HOH S 5 .   ? 45.162 -14.545 20.129 1.00 27.89 ? 2139 HOH B O    1 
HETATM 4373 O O    . HOH S 5 .   ? 44.074 -7.212  19.083 0.50 30.76 ? 2140 HOH B O    1 
HETATM 4374 O O    . HOH S 5 .   ? 40.739 -13.607 23.238 1.00 27.74 ? 2141 HOH B O    1 
HETATM 4375 O O    . HOH S 5 .   ? 38.595 -13.204 22.108 1.00 37.78 ? 2142 HOH B O    1 
HETATM 4376 O O    . HOH S 5 .   ? 37.310 -9.043  21.508 1.00 16.57 ? 2143 HOH B O    1 
HETATM 4377 O O    . HOH S 5 .   ? 42.764 -9.514  30.860 1.00 35.76 ? 2144 HOH B O    1 
HETATM 4378 O O    . HOH S 5 .   ? 39.263 -8.631  30.252 1.00 20.54 ? 2145 HOH B O    1 
HETATM 4379 O O    . HOH S 5 .   ? 44.061 -11.656 30.181 1.00 32.58 ? 2146 HOH B O    1 
HETATM 4380 O O    . HOH S 5 .   ? 47.354 -12.262 29.449 1.00 15.83 ? 2147 HOH B O    1 
HETATM 4381 O O    . HOH S 5 .   ? 52.527 -11.196 28.237 1.00 7.58  ? 2148 HOH B O    1 
HETATM 4382 O O    . HOH S 5 .   ? 62.364 -7.564  28.751 1.00 40.24 ? 2149 HOH B O    1 
HETATM 4383 O O    . HOH S 5 .   ? 58.986 -10.009 29.812 1.00 11.37 ? 2150 HOH B O    1 
HETATM 4384 O O    . HOH S 5 .   ? 53.009 -8.660  31.752 1.00 5.16  ? 2151 HOH B O    1 
HETATM 4385 O O    . HOH S 5 .   ? 65.890 -5.580  36.705 1.00 34.13 ? 2152 HOH B O    1 
HETATM 4386 O O    . HOH S 5 .   ? 67.714 2.689   38.931 0.50 26.65 ? 2153 HOH B O    1 
HETATM 4387 O O    . HOH S 5 .   ? 66.772 8.307   31.369 0.50 25.54 ? 2154 HOH B O    1 
HETATM 4388 O O    . HOH S 5 .   ? 68.093 5.619   32.956 1.00 26.78 ? 2155 HOH B O    1 
HETATM 4389 O O    . HOH S 5 .   ? 65.313 1.945   39.301 1.00 14.11 ? 2156 HOH B O    1 
HETATM 4390 O O    . HOH S 5 .   ? 67.030 1.546   33.064 1.00 14.38 ? 2157 HOH B O    1 
HETATM 4391 O O    . HOH S 5 .   ? 63.773 3.036   25.379 1.00 33.47 ? 2158 HOH B O    1 
HETATM 4392 O O    . HOH S 5 .   ? 61.352 6.465   26.647 1.00 33.06 ? 2159 HOH B O    1 
HETATM 4393 O O    . HOH S 5 .   ? 67.669 4.258   29.845 1.00 18.66 ? 2160 HOH B O    1 
HETATM 4394 O O    . HOH S 5 .   ? 69.237 11.798  31.376 0.52 22.51 ? 2161 HOH B O    1 
HETATM 4395 O O    . HOH S 5 .   ? 41.035 18.931  35.915 0.50 22.60 ? 2162 HOH B O    1 
HETATM 4396 O O    . HOH S 5 .   ? 43.046 18.367  38.135 1.00 13.37 ? 2163 HOH B O    1 
HETATM 4397 O O    . HOH S 5 .   ? 44.397 24.258  34.480 1.00 20.71 ? 2164 HOH B O    1 
HETATM 4398 O O    . HOH S 5 .   ? 39.782 22.346  45.127 0.50 24.42 ? 2165 HOH B O    1 
HETATM 4399 O O    . HOH S 5 .   ? 40.237 27.950  39.917 1.00 31.33 ? 2166 HOH B O    1 
HETATM 4400 O O    . HOH S 5 .   ? 43.133 29.661  43.804 0.74 27.90 ? 2167 HOH B O    1 
HETATM 4401 O O    . HOH S 5 .   ? 40.380 21.981  39.368 1.00 19.34 ? 2168 HOH B O    1 
HETATM 4402 O O    . HOH S 5 .   ? 40.480 20.010  41.171 1.00 18.43 ? 2169 HOH B O    1 
HETATM 4403 O O    . HOH S 5 .   ? 42.254 29.778  39.672 1.00 17.22 ? 2170 HOH B O    1 
HETATM 4404 O O    . HOH S 5 .   ? 43.036 19.331  40.710 1.00 11.02 ? 2171 HOH B O    1 
HETATM 4405 O O    . HOH S 5 .   ? 51.110 21.931  41.802 1.00 33.78 ? 2172 HOH B O    1 
HETATM 4406 O O    . HOH S 5 .   ? 51.020 18.914  41.037 1.00 29.88 ? 2173 HOH B O    1 
HETATM 4407 O O    . HOH S 5 .   ? 47.676 24.574  32.102 1.00 12.24 ? 2174 HOH B O    1 
HETATM 4408 O O    . HOH S 5 .   ? 46.967 13.180  39.690 1.00 5.99  ? 2175 HOH B O    1 
HETATM 4409 O O    . HOH S 5 .   ? 43.144 11.419  33.916 1.00 12.29 ? 2176 HOH B O    1 
HETATM 4410 O O    . HOH S 5 .   ? 55.409 15.482  25.215 1.00 7.56  ? 2177 HOH B O    1 
HETATM 4411 O O    . HOH S 5 .   ? 48.628 13.574  27.306 1.00 14.12 ? 2178 HOH B O    1 
HETATM 4412 O O    . HOH S 5 .   ? 53.972 8.663   24.589 1.00 9.25  ? 2179 HOH B O    1 
HETATM 4413 O O    . HOH S 5 .   ? 61.128 7.998   24.423 1.00 33.65 ? 2180 HOH B O    1 
HETATM 4414 O O    . HOH S 5 .   ? 56.827 8.650   24.718 1.00 14.19 ? 2181 HOH B O    1 
HETATM 4415 O O    . HOH S 5 .   ? 56.848 6.014   27.316 1.00 12.88 ? 2182 HOH B O    1 
HETATM 4416 O O    . HOH S 5 .   ? 65.079 9.314   24.735 1.00 14.36 ? 2183 HOH B O    1 
HETATM 4417 O O    . HOH S 5 .   ? 47.754 9.070   28.493 0.58 15.74 ? 2184 HOH B O    1 
HETATM 4418 O O    . HOH S 5 .   ? 46.835 9.440   30.881 0.58 7.95  ? 2185 HOH B O    1 
HETATM 4419 O O    . HOH S 5 .   ? 43.077 6.340   28.107 1.00 33.34 ? 2186 HOH B O    1 
HETATM 4420 O O    . HOH S 5 .   ? 45.257 9.396   33.343 1.00 11.78 ? 2187 HOH B O    1 
HETATM 4421 O O    . HOH S 5 .   ? 52.891 -11.214 17.553 0.50 32.92 ? 2188 HOH B O    1 
HETATM 4422 O O    . HOH S 5 .   ? 55.589 -13.539 21.766 1.00 65.06 ? 2189 HOH B O    1 
HETATM 4423 O O    . HOH S 5 .   ? 50.712 5.611   29.401 0.42 7.39  ? 2190 HOH B O    1 
HETATM 4424 O O    . HOH S 5 .   ? 49.003 7.549   28.376 0.42 13.30 ? 2191 HOH B O    1 
HETATM 4425 O O    . HOH S 5 .   ? 47.965 6.396   28.818 0.58 7.85  ? 2192 HOH B O    1 
HETATM 4426 O O    . HOH S 5 .   ? 54.237 6.505   26.244 1.00 12.90 ? 2193 HOH B O    1 
HETATM 4427 O O    . HOH S 5 .   ? 54.370 4.112   19.198 1.00 40.06 ? 2194 HOH B O    1 
HETATM 4428 O O    . HOH S 5 .   ? 51.797 1.677   19.732 1.00 25.90 ? 2195 HOH B O    1 
HETATM 4429 O O    . HOH S 5 .   ? 54.984 4.905   24.047 1.00 13.08 ? 2196 HOH B O    1 
HETATM 4430 O O    . HOH S 5 .   ? 48.870 4.900   20.599 1.00 11.90 ? 2197 HOH B O    1 
HETATM 4431 O O    . HOH S 5 .   ? 52.995 -8.306  44.093 1.00 19.26 ? 2198 HOH B O    1 
HETATM 4432 O O    . HOH S 5 .   ? 49.537 -6.269  44.892 1.00 19.51 ? 2199 HOH B O    1 
HETATM 4433 O O    . HOH S 5 .   ? 55.740 28.042  21.822 1.00 33.91 ? 2200 HOH B O    1 
HETATM 4434 O O    . HOH S 5 .   ? 57.980 25.235  41.920 1.00 13.90 ? 2201 HOH B O    1 
HETATM 4435 O O    . HOH S 5 .   ? 47.472 11.467  26.963 1.00 33.29 ? 2202 HOH B O    1 
HETATM 4436 O O    . HOH S 5 .   ? 60.914 -7.579  30.987 1.00 35.33 ? 2203 HOH B O    1 
HETATM 4437 O O    . HOH S 5 .   ? 61.449 -11.605 33.450 1.00 10.61 ? 2204 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N    . LYS A 1   ? 0.0753 0.1485 0.1042 -0.0356 -0.0264 0.0515  1    LYS A N    
2    C CA   . LYS A 1   ? 0.0543 0.0781 0.0805 -0.0113 -0.0149 0.0013  1    LYS A CA   
3    C C    . LYS A 1   ? 0.0554 0.0678 0.0835 -0.0027 -0.0230 -0.0052 1    LYS A C    
4    O O    . LYS A 1   ? 0.0723 0.1548 0.0898 -0.0259 -0.0281 0.0056  1    LYS A O    
5    C CB   . LYS A 1   ? 0.0528 0.0793 0.0687 -0.0156 -0.0047 -0.0221 1    LYS A CB   
6    C CG   . LYS A 1   ? 0.0658 0.1193 0.0970 -0.0195 -0.0059 -0.0538 1    LYS A CG   
7    C CD   . LYS A 1   ? 0.0644 0.0909 0.1183 -0.0139 0.0133  -0.0486 1    LYS A CD   
8    C CE   . LYS A 1   ? 0.0864 0.0891 0.1031 0.0055  -0.0131 -0.0276 1    LYS A CE   
9    N NZ   . LYS A 1   ? 0.0749 0.0811 0.1132 -0.0109 0.0066  -0.0371 1    LYS A NZ   
10   H H1   . LYS A 1   ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  1    LYS A H1   
11   H H2   . LYS A 1   ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  1    LYS A H2   
12   H H3   . LYS A 1   ? 0.1640 0.1640 0.1640 0.0000  0.0000  0.0000  1    LYS A H3   
13   H HA   . LYS A 1   ? 0.0852 0.0852 0.0852 0.0000  0.0000  0.0000  1    LYS A HA   
14   H HB2  . LYS A 1   ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  1    LYS A HB2  
15   H HB3  . LYS A 1   ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  1    LYS A HB3  
16   H HG2  . LYS A 1   ? 0.1128 0.1128 0.1128 0.0000  0.0000  0.0000  1    LYS A HG2  
17   H HG3  . LYS A 1   ? 0.1128 0.1128 0.1128 0.0000  0.0000  0.0000  1    LYS A HG3  
18   H HD2  . LYS A 1   ? 0.1094 0.1094 0.1094 0.0000  0.0000  0.0000  1    LYS A HD2  
19   H HD3  . LYS A 1   ? 0.1094 0.1094 0.1094 0.0000  0.0000  0.0000  1    LYS A HD3  
20   H HE2  . LYS A 1   ? 0.1115 0.1115 0.1115 0.0000  0.0000  0.0000  1    LYS A HE2  
21   H HE3  . LYS A 1   ? 0.1115 0.1115 0.1115 0.0000  0.0000  0.0000  1    LYS A HE3  
22   H HZ1  . LYS A 1   ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  1    LYS A HZ1  
23   H HZ2  . LYS A 1   ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  1    LYS A HZ2  
24   H HZ3  . LYS A 1   ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  1    LYS A HZ3  
25   N N    . GLU A 2   ? 0.0466 0.0574 0.0794 -0.0033 -0.0149 -0.0082 2    GLU A N    
26   C CA   . GLU A 2   ? 0.0409 0.0623 0.0935 0.0008  -0.0239 -0.0023 2    GLU A CA   
27   C C    . GLU A 2   ? 0.0432 0.0583 0.1108 0.0080  -0.0183 -0.0119 2    GLU A C    
28   O O    . GLU A 2   ? 0.0558 0.0602 0.1079 -0.0038 -0.0291 0.0076  2    GLU A O    
29   C CB   . GLU A 2   ? 0.0677 0.0647 0.0835 0.0047  -0.0074 -0.0031 2    GLU A CB   
30   C CG   . GLU A 2   ? 0.1011 0.0661 0.1309 0.0104  0.0032  -0.0168 2    GLU A CG   
31   C CD   . GLU A 2   ? 0.0809 0.0737 0.1265 0.0158  0.0017  -0.0150 2    GLU A CD   
32   O OE1  . GLU A 2   ? 0.0772 0.1241 0.1562 0.0313  -0.0196 -0.0454 2    GLU A OE1  
33   O OE2  . GLU A 2   ? 0.0689 0.1311 0.1423 0.0222  -0.0156 -0.0517 2    GLU A OE2  
34   H H    . GLU A 2   ? 0.0733 0.0733 0.0733 0.0000  0.0000  0.0000  2    GLU A H    
35   H HA   . GLU A 2   ? 0.0787 0.0787 0.0787 0.0000  0.0000  0.0000  2    GLU A HA   
36   H HB2  . GLU A 2   ? 0.0864 0.0864 0.0864 0.0000  0.0000  0.0000  2    GLU A HB2  
37   H HB3  . GLU A 2   ? 0.0864 0.0864 0.0864 0.0000  0.0000  0.0000  2    GLU A HB3  
38   H HG2  . GLU A 2   ? 0.1193 0.1193 0.1193 0.0000  0.0000  0.0000  2    GLU A HG2  
39   H HG3  . GLU A 2   ? 0.1193 0.1193 0.1193 0.0000  0.0000  0.0000  2    GLU A HG3  
40   N N    . THR A 3   ? 0.0515 0.0573 0.1081 0.0027  -0.0066 -0.0157 3    THR A N    
41   C CA   . THR A 3   ? 0.0515 0.0483 0.1266 0.0067  -0.0025 -0.0151 3    THR A CA   
42   C C    . THR A 3   ? 0.0513 0.0517 0.1116 -0.0039 -0.0129 -0.0136 3    THR A C    
43   O O    . THR A 3   ? 0.0522 0.0502 0.1030 0.0032  -0.0071 -0.0139 3    THR A O    
44   C CB   . THR A 3   ? 0.0683 0.0700 0.1687 -0.0029 -0.0005 -0.0441 3    THR A CB   
45   O OG1  . THR A 3   ? 0.0688 0.0902 0.1393 -0.0050 -0.0055 -0.0521 3    THR A OG1  
46   C CG2  . THR A 3   ? 0.0983 0.0870 0.1717 -0.0046 0.0226  -0.0557 3    THR A CG2  
47   H H    . THR A 3   ? 0.0868 0.0868 0.0868 0.0000  0.0000  0.0000  3    THR A H    
48   H HA   . THR A 3   ? 0.0906 0.0906 0.0906 0.0000  0.0000  0.0000  3    THR A HA   
49   H HB   . THR A 3   ? 0.1229 0.1229 0.1229 0.0000  0.0000  0.0000  3    THR A HB   
50   H HG1  . THR A 3   ? 0.1492 0.1492 0.1492 0.0000  0.0000  0.0000  3    THR A HG1  
51   H HG21 . THR A 3   ? 0.1786 0.1786 0.1786 0.0000  0.0000  0.0000  3    THR A HG21 
52   H HG22 . THR A 3   ? 0.1786 0.1786 0.1786 0.0000  0.0000  0.0000  3    THR A HG22 
53   H HG23 . THR A 3   ? 0.1786 0.1786 0.1786 0.0000  0.0000  0.0000  3    THR A HG23 
54   N N    . ALA A 4   ? 0.0592 0.0517 0.1360 -0.0023 -0.0058 0.0048  4    ALA A N    
55   C CA   . ALA A 4   ? 0.0593 0.0694 0.1203 -0.0063 -0.0100 0.0183  4    ALA A CA   
56   C C    . ALA A 4   ? 0.0522 0.0615 0.1215 -0.0113 -0.0072 -0.0005 4    ALA A C    
57   O O    . ALA A 4   ? 0.0650 0.0650 0.1031 -0.0003 -0.0049 -0.0028 4    ALA A O    
58   C CB   . ALA A 4   ? 0.0770 0.1062 0.1674 -0.0165 -0.0068 0.0504  4    ALA A CB   
59   H H    . ALA A 4   ? 0.0988 0.0988 0.0988 0.0000  0.0000  0.0000  4    ALA A H    
60   H HA   . ALA A 4   ? 0.0995 0.0995 0.0995 0.0000  0.0000  0.0000  4    ALA A HA   
61   H HB1  . ALA A 4   ? 0.1753 0.1753 0.1753 0.0000  0.0000  0.0000  4    ALA A HB1  
62   H HB2  . ALA A 4   ? 0.1753 0.1753 0.1753 0.0000  0.0000  0.0000  4    ALA A HB2  
63   H HB3  . ALA A 4   ? 0.1753 0.1753 0.1753 0.0000  0.0000  0.0000  4    ALA A HB3  
64   N N    . ALA A 5   ? 0.0640 0.0686 0.1104 -0.0080 -0.0044 -0.0103 5    ALA A N    
65   C CA   . ALA A 5   ? 0.0564 0.0947 0.1114 -0.0094 -0.0052 -0.0168 5    ALA A CA   
66   C C    . ALA A 5   ? 0.0584 0.0946 0.0948 0.0087  -0.0089 -0.0125 5    ALA A C    
67   O O    . ALA A 5   ? 0.0567 0.1144 0.1037 0.0159  0.0002  -0.0096 5    ALA A O    
68   C CB   . ALA A 5   ? 0.1042 0.1111 0.1514 -0.0247 -0.0100 -0.0357 5    ALA A CB   
69   H H    . ALA A 5   ? 0.0971 0.0971 0.0971 0.0000  0.0000  0.0000  5    ALA A H    
70   H HA   . ALA A 5   ? 0.1050 0.1050 0.1050 0.0000  0.0000  0.0000  5    ALA A HA   
71   H HB1  . ALA A 5   ? 0.1834 0.1834 0.1834 0.0000  0.0000  0.0000  5    ALA A HB1  
72   H HB2  . ALA A 5   ? 0.1834 0.1834 0.1834 0.0000  0.0000  0.0000  5    ALA A HB2  
73   H HB3  . ALA A 5   ? 0.1834 0.1834 0.1834 0.0000  0.0000  0.0000  5    ALA A HB3  
74   N N    . ALA A 6   ? 0.0545 0.0853 0.0931 0.0064  0.0022  -0.0111 6    ALA A N    
75   C CA   . ALA A 6   ? 0.0598 0.0939 0.0892 0.0136  0.0031  -0.0081 6    ALA A CA   
76   C C    . ALA A 6   ? 0.0593 0.0805 0.0972 0.0147  0.0054  0.0012  6    ALA A C    
77   O O    . ALA A 6   ? 0.0777 0.0938 0.0980 0.0281  0.0015  0.0086  6    ALA A O    
78   C CB   . ALA A 6   ? 0.0793 0.1013 0.1056 0.0136  0.0206  -0.0032 6    ALA A CB   
79   H H    . ALA A 6   ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  6    ALA A H    
80   H HA   . ALA A 6   ? 0.0971 0.0971 0.0971 0.0000  0.0000  0.0000  6    ALA A HA   
81   H HB1  . ALA A 6   ? 0.1431 0.1431 0.1431 0.0000  0.0000  0.0000  6    ALA A HB1  
82   H HB2  . ALA A 6   ? 0.1431 0.1431 0.1431 0.0000  0.0000  0.0000  6    ALA A HB2  
83   H HB3  . ALA A 6   ? 0.1431 0.1431 0.1431 0.0000  0.0000  0.0000  6    ALA A HB3  
84   N N    . LYS A 7   ? 0.0540 0.0668 0.0907 0.0113  0.0002  -0.0044 7    LYS A N    
85   C CA   . LYS A 7   ? 0.0563 0.0532 0.0952 0.0053  0.0006  -0.0044 7    LYS A CA   
86   C C    . LYS A 7   ? 0.0524 0.0511 0.0815 0.0110  -0.0081 -0.0015 7    LYS A C    
87   O O    . LYS A 7   ? 0.0514 0.0573 0.0887 0.0090  -0.0100 -0.0009 7    LYS A O    
88   C CB   . LYS A 7   ? 0.0453 0.0732 0.1044 0.0063  -0.0121 -0.0116 7    LYS A CB   
89   C CG   . LYS A 7   ? 0.0687 0.1094 0.1452 0.0156  -0.0137 -0.0450 7    LYS A CG   
90   C CD   . LYS A 7   ? 0.1115 0.1683 0.1191 0.0418  -0.0315 -0.0431 7    LYS A CD   
91   C CE   . LYS A 7   ? 0.0944 0.1727 0.1473 0.0291  0.0056  -0.0265 7    LYS A CE   
92   N NZ   . LYS A 7   ? 0.1388 0.2775 0.1290 0.0976  0.0035  0.0015  7    LYS A NZ   
93   H H    . LYS A 7   ? 0.0846 0.0846 0.0846 0.0000  0.0000  0.0000  7    LYS A H    
94   H HA   . LYS A 7   ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  7    LYS A HA   
95   H HB2  . LYS A 7   ? 0.0892 0.0892 0.0892 0.0000  0.0000  0.0000  7    LYS A HB2  
96   H HB3  . LYS A 7   ? 0.0892 0.0892 0.0892 0.0000  0.0000  0.0000  7    LYS A HB3  
97   H HG2  . LYS A 7   ? 0.1293 0.1293 0.1293 0.0000  0.0000  0.0000  7    LYS A HG2  
98   H HG3  . LYS A 7   ? 0.1293 0.1293 0.1293 0.0000  0.0000  0.0000  7    LYS A HG3  
99   H HD2  . LYS A 7   ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  7    LYS A HD2  
100  H HD3  . LYS A 7   ? 0.1596 0.1596 0.1596 0.0000  0.0000  0.0000  7    LYS A HD3  
101  H HE2  . LYS A 7   ? 0.1658 0.1658 0.1658 0.0000  0.0000  0.0000  7    LYS A HE2  
102  H HE3  . LYS A 7   ? 0.1658 0.1658 0.1658 0.0000  0.0000  0.0000  7    LYS A HE3  
103  H HZ1  . LYS A 7   ? 0.2727 0.2727 0.2727 0.0000  0.0000  0.0000  7    LYS A HZ1  
104  H HZ2  . LYS A 7   ? 0.2727 0.2727 0.2727 0.0000  0.0000  0.0000  7    LYS A HZ2  
105  H HZ3  . LYS A 7   ? 0.2727 0.2727 0.2727 0.0000  0.0000  0.0000  7    LYS A HZ3  
106  N N    . PHE A 8   ? 0.0487 0.0566 0.0837 0.0066  0.0000  -0.0050 8    PHE A N    
107  C CA   . PHE A 8   ? 0.0470 0.0553 0.0796 0.0088  -0.0067 -0.0066 8    PHE A CA   
108  C C    . PHE A 8   ? 0.0465 0.0485 0.0780 0.0023  -0.0090 -0.0074 8    PHE A C    
109  O O    . PHE A 8   ? 0.0525 0.0430 0.0858 0.0052  -0.0053 -0.0044 8    PHE A O    
110  C CB   . PHE A 8   ? 0.0541 0.0553 0.0882 0.0024  -0.0041 0.0023  8    PHE A CB   
111  C CG   . PHE A 8   ? 0.0525 0.0442 0.0805 0.0064  -0.0116 0.0029  8    PHE A CG   
112  C CD1  . PHE A 8   ? 0.0592 0.0728 0.0873 0.0017  -0.0069 0.0194  8    PHE A CD1  
113  C CD2  . PHE A 8   ? 0.0559 0.0693 0.0832 -0.0017 -0.0081 0.0109  8    PHE A CD2  
114  C CE1  . PHE A 8   ? 0.0580 0.0640 0.0926 -0.0023 -0.0140 0.0246  8    PHE A CE1  
115  C CE2  . PHE A 8   ? 0.0638 0.0776 0.0834 -0.0062 0.0006  0.0034  8    PHE A CE2  
116  C CZ   . PHE A 8   ? 0.0575 0.0591 0.0992 0.0014  -0.0041 0.0053  8    PHE A CZ   
117  H H    . PHE A 8   ? 0.0756 0.0756 0.0756 0.0000  0.0000  0.0000  8    PHE A H    
118  H HA   . PHE A 8   ? 0.0727 0.0727 0.0727 0.0000  0.0000  0.0000  8    PHE A HA   
119  H HB2  . PHE A 8   ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  8    PHE A HB2  
120  H HB3  . PHE A 8   ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  8    PHE A HB3  
121  H HD1  . PHE A 8   ? 0.0878 0.0878 0.0878 0.0000  0.0000  0.0000  8    PHE A HD1  
122  H HD2  . PHE A 8   ? 0.0833 0.0833 0.0833 0.0000  0.0000  0.0000  8    PHE A HD2  
123  H HE1  . PHE A 8   ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  8    PHE A HE1  
124  H HE2  . PHE A 8   ? 0.0899 0.0899 0.0899 0.0000  0.0000  0.0000  8    PHE A HE2  
125  H HZ   . PHE A 8   ? 0.0864 0.0864 0.0864 0.0000  0.0000  0.0000  8    PHE A HZ   
126  N N    . GLU A 9   ? 0.0574 0.0582 0.0772 0.0113  -0.0083 -0.0064 9    GLU A N    
127  C CA   . GLU A 9   ? 0.0636 0.0721 0.0662 0.0063  -0.0148 -0.0109 9    GLU A CA   
128  C C    . GLU A 9   ? 0.0583 0.0680 0.0595 -0.0010 -0.0099 -0.0007 9    GLU A C    
129  O O    . GLU A 9   ? 0.0551 0.0572 0.0850 0.0031  -0.0174 0.0030  9    GLU A O    
130  C CB   . GLU A 9   ? 0.1106 0.0821 0.0654 0.0120  -0.0156 -0.0127 9    GLU A CB   
131  C CG   A GLU A 9   ? 0.0985 0.0976 0.0855 0.0212  -0.0552 -0.0267 9    GLU A CG   
132  C CG   B GLU A 9   ? 0.0998 0.0556 0.0620 0.0064  -0.0306 0.0089  9    GLU A CG   
133  C CG   C GLU A 9   ? 0.1149 0.1607 0.0723 0.0403  -0.0349 -0.0139 9    GLU A CG   
134  C CD   A GLU A 9   ? 0.1690 0.1418 0.1221 -0.0156 -0.0162 -0.0588 9    GLU A CD   
135  C CD   B GLU A 9   ? 0.0928 0.0460 0.1139 0.0146  -0.0353 -0.0209 9    GLU A CD   
136  C CD   C GLU A 9   ? 0.1741 0.2254 0.0655 0.0915  0.0155  -0.0062 9    GLU A CD   
137  O OE1  A GLU A 9   ? 0.2581 0.3350 0.0607 -0.0063 -0.0044 0.0098  9    GLU A OE1  
138  O OE1  B GLU A 9   ? 0.2251 0.0711 0.0731 -0.0102 0.0395  -0.0001 9    GLU A OE1  
139  O OE1  C GLU A 9   ? 0.1362 0.3059 0.2402 -0.0368 0.0716  -0.1719 9    GLU A OE1  
140  O OE2  A GLU A 9   ? 0.2904 0.2882 0.2825 0.0903  0.0470  -0.1431 9    GLU A OE2  
141  O OE2  B GLU A 9   ? 0.2552 0.0516 0.0614 -0.0161 0.0003  0.0090  9    GLU A OE2  
142  O OE2  C GLU A 9   ? 0.2764 0.2998 0.0709 0.1511  -0.0275 -0.0163 9    GLU A OE2  
143  H H    . GLU A 9   ? 0.0771 0.0771 0.0771 0.0000  0.0000  0.0000  9    GLU A H    
144  H HA   . GLU A 9   ? 0.0808 0.0808 0.0808 0.0000  0.0000  0.0000  9    GLU A HA   
145  H HB2  A GLU A 9   ? 0.1032 0.1032 0.1032 0.0000  0.0000  0.0000  9    GLU A HB2  
146  H HB3  A GLU A 9   ? 0.1032 0.1032 0.1032 0.0000  0.0000  0.0000  9    GLU A HB3  
147  H HG2  A GLU A 9   ? 0.1126 0.1126 0.1126 0.0000  0.0000  0.0000  9    GLU A HG2  
148  H HG2  B GLU A 9   ? 0.0870 0.0870 0.0870 0.0000  0.0000  0.0000  9    GLU A HG2  
149  H HG2  C GLU A 9   ? 0.1392 0.1392 0.1392 0.0000  0.0000  0.0000  9    GLU A HG2  
150  H HG3  A GLU A 9   ? 0.1126 0.1126 0.1126 0.0000  0.0000  0.0000  9    GLU A HG3  
151  H HG3  B GLU A 9   ? 0.0870 0.0870 0.0870 0.0000  0.0000  0.0000  9    GLU A HG3  
152  H HG3  C GLU A 9   ? 0.1392 0.1392 0.1392 0.0000  0.0000  0.0000  9    GLU A HG3  
153  N N    . ARG A 10  ? 0.0523 0.0711 0.0663 0.0061  -0.0091 0.0008  10   ARG A N    
154  C CA   . ARG A 10  ? 0.0545 0.0690 0.0762 -0.0042 -0.0171 0.0132  10   ARG A CA   
155  C C    . ARG A 10  ? 0.0545 0.0548 0.0800 -0.0077 -0.0263 0.0111  10   ARG A C    
156  O O    . ARG A 10  ? 0.0875 0.0493 0.0866 -0.0039 -0.0351 0.0032  10   ARG A O    
157  C CB   . ARG A 10  ? 0.0531 0.0935 0.1058 -0.0178 -0.0159 0.0348  10   ARG A CB   
158  C CG   . ARG A 10  ? 0.1042 0.0729 0.1109 0.0022  0.0096  -0.0083 10   ARG A CG   
159  C CD   . ARG A 10  ? 0.0946 0.0870 0.1003 -0.0068 -0.0224 -0.0155 10   ARG A CD   
160  N NE   . ARG A 10  ? 0.0900 0.0708 0.1162 0.0129  -0.0404 -0.0249 10   ARG A NE   
161  C CZ   . ARG A 10  ? 0.0681 0.0965 0.0930 0.0164  -0.0285 -0.0181 10   ARG A CZ   
162  N NH1  . ARG A 10  ? 0.0916 0.1171 0.1236 0.0417  -0.0376 -0.0428 10   ARG A NH1  
163  N NH2  . ARG A 10  ? 0.0838 0.1166 0.0990 0.0320  -0.0148 -0.0183 10   ARG A NH2  
164  H H    . ARG A 10  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  10   ARG A H    
165  H HA   . ARG A 10  ? 0.0799 0.0799 0.0799 0.0000  0.0000  0.0000  10   ARG A HA   
166  H HB2  . ARG A 10  ? 0.1009 0.1009 0.1009 0.0000  0.0000  0.0000  10   ARG A HB2  
167  H HB3  . ARG A 10  ? 0.1009 0.1009 0.1009 0.0000  0.0000  0.0000  10   ARG A HB3  
168  H HG2  . ARG A 10  ? 0.1153 0.1153 0.1153 0.0000  0.0000  0.0000  10   ARG A HG2  
169  H HG3  . ARG A 10  ? 0.1153 0.1153 0.1153 0.0000  0.0000  0.0000  10   ARG A HG3  
170  H HD2  . ARG A 10  ? 0.1127 0.1127 0.1127 0.0000  0.0000  0.0000  10   ARG A HD2  
171  H HD3  . ARG A 10  ? 0.1127 0.1127 0.1127 0.0000  0.0000  0.0000  10   ARG A HD3  
172  H HE   . ARG A 10  ? 0.1108 0.1108 0.1108 0.0000  0.0000  0.0000  10   ARG A HE   
173  H HH11 . ARG A 10  ? 0.1330 0.1330 0.1330 0.0000  0.0000  0.0000  10   ARG A HH11 
174  H HH12 . ARG A 10  ? 0.1330 0.1330 0.1330 0.0000  0.0000  0.0000  10   ARG A HH12 
175  H HH21 . ARG A 10  ? 0.1197 0.1197 0.1197 0.0000  0.0000  0.0000  10   ARG A HH21 
176  H HH22 . ARG A 10  ? 0.1197 0.1197 0.1197 0.0000  0.0000  0.0000  10   ARG A HH22 
177  N N    . GLN A 11  ? 0.0515 0.0530 0.0723 -0.0008 -0.0169 0.0047  11   GLN A N    
178  C CA   . GLN A 11  ? 0.0618 0.0467 0.0714 -0.0036 -0.0236 -0.0032 11   GLN A CA   
179  C C    . GLN A 11  ? 0.0615 0.0532 0.0701 -0.0005 -0.0219 -0.0036 11   GLN A C    
180  O O    . GLN A 11  ? 0.0781 0.0707 0.0939 -0.0050 -0.0069 -0.0402 11   GLN A O    
181  C CB   A GLN A 11  ? 0.0752 0.0543 0.0815 -0.0033 -0.0299 -0.0106 11   GLN A CB   
182  C CB   B GLN A 11  ? 0.0827 0.0988 0.0730 -0.0130 -0.0382 0.0219  11   GLN A CB   
183  C CG   A GLN A 11  ? 0.0589 0.0665 0.0641 0.0077  -0.0220 -0.0126 11   GLN A CG   
184  C CG   B GLN A 11  ? 0.0706 0.0790 0.0514 0.0178  -0.0014 0.0024  11   GLN A CG   
185  C CD   A GLN A 11  ? 0.0684 0.0859 0.0848 0.0129  -0.0237 -0.0160 11   GLN A CD   
186  C CD   B GLN A 11  ? 0.1034 0.1291 0.0844 -0.0067 -0.0590 0.0058  11   GLN A CD   
187  O OE1  A GLN A 11  ? 0.1004 0.1405 0.1563 0.0222  -0.0742 -0.0343 11   GLN A OE1  
188  O OE1  B GLN A 11  ? 0.1746 0.1597 0.0913 0.0269  -0.0609 -0.0077 11   GLN A OE1  
189  N NE2  A GLN A 11  ? 0.0795 0.1288 0.0809 0.0186  -0.0260 0.0050  11   GLN A NE2  
190  N NE2  B GLN A 11  ? 0.2788 0.1172 0.0730 0.0990  -0.0551 0.0136  11   GLN A NE2  
191  H H    . GLN A 11  ? 0.0708 0.0708 0.0708 0.0000  0.0000  0.0000  11   GLN A H    
192  H HA   A GLN A 11  ? 0.0719 0.0719 0.0719 0.0000  0.0000  0.0000  11   GLN A HA   
193  H HB2  A GLN A 11  ? 0.0845 0.0845 0.0845 0.0000  0.0000  0.0000  11   GLN A HB2  
194  H HB2  B GLN A 11  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  11   GLN A HB2  
195  H HB3  A GLN A 11  ? 0.0845 0.0845 0.0845 0.0000  0.0000  0.0000  11   GLN A HB3  
196  H HB3  B GLN A 11  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  11   GLN A HB3  
197  H HG2  A GLN A 11  ? 0.0757 0.0757 0.0757 0.0000  0.0000  0.0000  11   GLN A HG2  
198  H HG2  B GLN A 11  ? 0.0804 0.0804 0.0804 0.0000  0.0000  0.0000  11   GLN A HG2  
199  H HG3  A GLN A 11  ? 0.0757 0.0757 0.0757 0.0000  0.0000  0.0000  11   GLN A HG3  
200  H HG3  B GLN A 11  ? 0.0804 0.0804 0.0804 0.0000  0.0000  0.0000  11   GLN A HG3  
201  H HE21 A GLN A 11  ? 0.1156 0.1156 0.1156 0.0000  0.0000  0.0000  11   GLN A HE21 
202  H HE21 B GLN A 11  ? 0.1876 0.1876 0.1876 0.0000  0.0000  0.0000  11   GLN A HE21 
203  H HE22 A GLN A 11  ? 0.1156 0.1156 0.1156 0.0000  0.0000  0.0000  11   GLN A HE22 
204  H HE22 B GLN A 11  ? 0.1876 0.1876 0.1876 0.0000  0.0000  0.0000  11   GLN A HE22 
205  N N    . HIS A 12  ? 0.0534 0.0467 0.0592 0.0049  -0.0160 -0.0068 12   HIS A N    
206  C CA   . HIS A 12  ? 0.0533 0.0558 0.0661 0.0043  -0.0115 -0.0106 12   HIS A CA   
207  C C    . HIS A 12  ? 0.0563 0.0559 0.0655 0.0086  -0.0151 -0.0145 12   HIS A C    
208  O O    . HIS A 12  ? 0.0523 0.1502 0.0794 0.0203  -0.0127 -0.0279 12   HIS A O    
209  C CB   . HIS A 12  ? 0.0677 0.0489 0.0805 -0.0021 -0.0030 -0.0100 12   HIS A CB   
210  C CG   . HIS A 12  ? 0.0707 0.0519 0.0778 -0.0030 -0.0041 0.0096  12   HIS A CG   
211  N ND1  . HIS A 12  ? 0.0778 0.0467 0.0701 0.0101  -0.0158 0.0027  12   HIS A ND1  
212  C CD2  . HIS A 12  ? 0.0839 0.0637 0.1042 0.0184  0.0031  0.0222  12   HIS A CD2  
213  C CE1  . HIS A 12  ? 0.0822 0.0684 0.0788 0.0081  -0.0183 0.0176  12   HIS A CE1  
214  N NE2  . HIS A 12  ? 0.0840 0.1021 0.0776 0.0201  -0.0120 0.0262  12   HIS A NE2  
215  H H    . HIS A 12  ? 0.0637 0.0637 0.0637 0.0000  0.0000  0.0000  12   HIS A H    
216  H HA   . HIS A 12  ? 0.0700 0.0700 0.0700 0.0000  0.0000  0.0000  12   HIS A HA   
217  H HB2  . HIS A 12  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  12   HIS A HB2  
218  H HB3  . HIS A 12  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  12   HIS A HB3  
219  H HD1  . HIS A 12  ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  12   HIS A HD1  
220  H HD2  . HIS A 12  ? 0.1007 0.1007 0.1007 0.0000  0.0000  0.0000  12   HIS A HD2  
221  H HE1  . HIS A 12  ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  12   HIS A HE1  
222  N N    . MET A 13  ? 0.0482 0.0463 0.0670 0.0005  -0.0202 -0.0019 13   MET A N    
223  C CA   . MET A 13  ? 0.0531 0.0426 0.0663 0.0061  -0.0216 -0.0044 13   MET A CA   
224  C C    . MET A 13  ? 0.0508 0.0429 0.0668 0.0037  -0.0188 -0.0025 13   MET A C    
225  O O    . MET A 13  ? 0.0540 0.0528 0.0951 -0.0027 -0.0222 0.0106  13   MET A O    
226  C CB   . MET A 13  ? 0.0587 0.0479 0.0647 0.0025  -0.0225 -0.0032 13   MET A CB   
227  C CG   . MET A 13  ? 0.0568 0.0434 0.0856 0.0044  -0.0248 -0.0081 13   MET A CG   
228  S SD   . MET A 13  ? 0.0615 0.0449 0.0997 -0.0019 -0.0290 0.0007  13   MET A SD   
229  C CE   . MET A 13  ? 0.0824 0.0873 0.1172 -0.0143 -0.0546 0.0149  13   MET A CE   
230  H H    . MET A 13  ? 0.0646 0.0646 0.0646 0.0000  0.0000  0.0000  13   MET A H    
231  H HA   . MET A 13  ? 0.0648 0.0648 0.0648 0.0000  0.0000  0.0000  13   MET A HA   
232  H HB2  . MET A 13  ? 0.0685 0.0685 0.0685 0.0000  0.0000  0.0000  13   MET A HB2  
233  H HB3  . MET A 13  ? 0.0685 0.0685 0.0685 0.0000  0.0000  0.0000  13   MET A HB3  
234  H HG2  . MET A 13  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  13   MET A HG2  
235  H HG3  . MET A 13  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  13   MET A HG3  
236  H HE1  . MET A 13  ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  13   MET A HE1  
237  H HE2  . MET A 13  ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  13   MET A HE2  
238  H HE3  . MET A 13  ? 0.1435 0.1435 0.1435 0.0000  0.0000  0.0000  13   MET A HE3  
239  N N    . ASP A 14  ? 0.0532 0.0407 0.0652 0.0043  -0.0158 -0.0017 14   ASP A N    
240  C CA   . ASP A 14  ? 0.0560 0.0372 0.0622 0.0048  -0.0132 -0.0007 14   ASP A CA   
241  C C    . ASP A 14  ? 0.0618 0.0381 0.0514 0.0016  -0.0166 0.0021  14   ASP A C    
242  O O    . ASP A 14  ? 0.0559 0.0482 0.0677 0.0006  -0.0196 0.0039  14   ASP A O    
243  C CB   . ASP A 14  ? 0.0675 0.0470 0.0714 0.0057  -0.0311 -0.0032 14   ASP A CB   
244  C CG   . ASP A 14  ? 0.0692 0.0351 0.0973 0.0010  -0.0377 -0.0018 14   ASP A CG   
245  O OD1  . ASP A 14  ? 0.0853 0.0497 0.0878 -0.0049 -0.0204 0.0078  14   ASP A OD1  
246  O OD2  . ASP A 14  ? 0.0974 0.0441 0.1180 0.0195  -0.0451 -0.0131 14   ASP A OD2  
247  H H    . ASP A 14  ? 0.0636 0.0636 0.0636 0.0000  0.0000  0.0000  14   ASP A H    
248  H HA   . ASP A 14  ? 0.0622 0.0622 0.0622 0.0000  0.0000  0.0000  14   ASP A HA   
249  H HB2  . ASP A 14  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  14   ASP A HB2  
250  H HB3  . ASP A 14  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  14   ASP A HB3  
251  N N    . SER A 15  ? 0.0788 0.0523 0.0586 -0.0051 -0.0147 -0.0043 15   SER A N    
252  C CA   . SER A 15  ? 0.0895 0.0619 0.0557 -0.0210 -0.0241 -0.0006 15   SER A CA   
253  C C    . SER A 15  ? 0.0830 0.0666 0.0560 -0.0112 -0.0158 -0.0036 15   SER A C    
254  O O    . SER A 15  ? 0.0953 0.0925 0.0720 -0.0231 -0.0407 0.0014  15   SER A O    
255  C CB   A SER A 15  ? 0.1042 0.0623 0.0765 -0.0352 -0.0324 -0.0060 15   SER A CB   
256  C CB   B SER A 15  ? 0.1069 0.0589 0.1216 -0.0509 -0.0320 -0.0047 15   SER A CB   
257  O OG   A SER A 15  ? 0.1148 0.0634 0.1007 -0.0153 -0.0067 -0.0089 15   SER A OG   
258  O OG   B SER A 15  ? 0.1398 0.1355 0.1207 -0.0056 0.0089  -0.0846 15   SER A OG   
259  H H    . SER A 15  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  15   SER A H    
260  H HA   A SER A 15  ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  15   SER A HA   
261  H HB2  A SER A 15  ? 0.0971 0.0971 0.0971 0.0000  0.0000  0.0000  15   SER A HB2  
262  H HB2  B SER A 15  ? 0.1150 0.1150 0.1150 0.0000  0.0000  0.0000  15   SER A HB2  
263  H HB3  A SER A 15  ? 0.0971 0.0971 0.0971 0.0000  0.0000  0.0000  15   SER A HB3  
264  H HB3  B SER A 15  ? 0.1150 0.1150 0.1150 0.0000  0.0000  0.0000  15   SER A HB3  
265  H HG   A SER A 15  ? 0.1394 0.1394 0.1394 0.0000  0.0000  0.0000  15   SER A HG   
266  H HG   B SER A 15  ? 0.1980 0.1980 0.1980 0.0000  0.0000  0.0000  15   SER A HG   
267  N N    . SER A 16  ? 0.0775 0.0696 0.0580 -0.0112 -0.0186 0.0052  16   SER A N    
268  C CA   . SER A 16  ? 0.0812 0.0773 0.0602 -0.0073 -0.0150 0.0132  16   SER A CA   
269  C C    . SER A 16  ? 0.0673 0.0731 0.0622 -0.0096 -0.0234 0.0112  16   SER A C    
270  O O    . SER A 16  ? 0.0746 0.0913 0.0897 -0.0039 -0.0217 0.0303  16   SER A O    
271  C CB   . SER A 16  ? 0.0766 0.1052 0.0969 -0.0059 -0.0110 0.0450  16   SER A CB   
272  O OG   . SER A 16  ? 0.0837 0.0856 0.1337 -0.0230 -0.0372 0.0477  16   SER A OG   
273  H H    . SER A 16  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  16   SER A H    
274  H HA   . SER A 16  ? 0.0875 0.0875 0.0875 0.0000  0.0000  0.0000  16   SER A HA   
275  H HB2  . SER A 16  ? 0.1115 0.1115 0.1115 0.0000  0.0000  0.0000  16   SER A HB2  
276  H HB3  . SER A 16  ? 0.1115 0.1115 0.1115 0.0000  0.0000  0.0000  16   SER A HB3  
277  H HG   . SER A 16  ? 0.1515 0.1515 0.1515 0.0000  0.0000  0.0000  16   SER A HG   
278  N N    . THR A 17  ? 0.0720 0.0624 0.0632 -0.0050 -0.0212 0.0061  17   THR A N    
279  C CA   . THR A 17  ? 0.0675 0.0661 0.0717 -0.0106 -0.0198 0.0079  17   THR A CA   
280  C C    . THR A 17  ? 0.0761 0.0570 0.0670 -0.0076 -0.0243 0.0113  17   THR A C    
281  O O    . THR A 17  ? 0.0753 0.0712 0.0927 -0.0106 -0.0235 0.0173  17   THR A O    
282  C CB   . THR A 17  ? 0.0752 0.0528 0.0840 -0.0008 -0.0211 0.0062  17   THR A CB   
283  O OG1  . THR A 17  ? 0.0873 0.0720 0.0959 0.0123  -0.0085 0.0191  17   THR A OG1  
284  C CG2  . THR A 17  ? 0.0836 0.0765 0.0817 0.0013  -0.0230 -0.0098 17   THR A CG2  
285  H H    . THR A 17  ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  17   THR A H    
286  H HA   . THR A 17  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  17   THR A HA   
287  H HB   . THR A 17  ? 0.0847 0.0847 0.0847 0.0000  0.0000  0.0000  17   THR A HB   
288  H HG1  . THR A 17  ? 0.1275 0.1275 0.1275 0.0000  0.0000  0.0000  17   THR A HG1  
289  H HG21 . THR A 17  ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  17   THR A HG21 
290  H HG22 . THR A 17  ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  17   THR A HG22 
291  H HG23 . THR A 17  ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  17   THR A HG23 
292  N N    . SER A 18  ? 0.0713 0.0550 0.0646 -0.0148 -0.0122 0.0007  18   SER A N    
293  C CA   . SER A 18  ? 0.0784 0.0427 0.0642 -0.0134 -0.0132 -0.0009 18   SER A CA   
294  C C    . SER A 18  ? 0.0601 0.0408 0.0652 -0.0026 -0.0181 0.0007  18   SER A C    
295  O O    . SER A 18  ? 0.0663 0.0441 0.0654 -0.0075 -0.0194 0.0098  18   SER A O    
296  C CB   . SER A 18  ? 0.0760 0.0591 0.0726 -0.0178 -0.0279 0.0027  18   SER A CB   
297  O OG   . SER A 18  ? 0.0816 0.0615 0.1004 -0.0059 -0.0349 0.0190  18   SER A OG   
298  H H    . SER A 18  ? 0.0764 0.0764 0.0764 0.0000  0.0000  0.0000  18   SER A H    
299  H HA   . SER A 18  ? 0.0741 0.0741 0.0741 0.0000  0.0000  0.0000  18   SER A HA   
300  H HB2  . SER A 18  ? 0.0831 0.0831 0.0831 0.0000  0.0000  0.0000  18   SER A HB2  
301  H HB3  . SER A 18  ? 0.0831 0.0831 0.0831 0.0000  0.0000  0.0000  18   SER A HB3  
302  H HG   . SER A 18  ? 0.1217 0.1217 0.1217 0.0000  0.0000  0.0000  18   SER A HG   
303  N N    . ALA A 19  ? 0.0723 0.0479 0.0575 -0.0092 -0.0176 0.0048  19   ALA A N    
304  C CA   . ALA A 19  ? 0.0712 0.0426 0.0588 -0.0021 -0.0213 0.0008  19   ALA A CA   
305  C C    . ALA A 19  ? 0.0718 0.0391 0.0625 -0.0002 -0.0170 0.0060  19   ALA A C    
306  O O    . ALA A 19  ? 0.0801 0.0491 0.0631 -0.0061 -0.0198 -0.0031 19   ALA A O    
307  C CB   . ALA A 19  ? 0.0697 0.0636 0.0862 0.0016  -0.0216 -0.0074 19   ALA A CB   
308  H H    . ALA A 19  ? 0.0711 0.0711 0.0711 0.0000  0.0000  0.0000  19   ALA A H    
309  H HA   . ALA A 19  ? 0.0690 0.0690 0.0690 0.0000  0.0000  0.0000  19   ALA A HA   
310  H HB1  . ALA A 19  ? 0.1097 0.1097 0.1097 0.0000  0.0000  0.0000  19   ALA A HB1  
311  H HB2  . ALA A 19  ? 0.1097 0.1097 0.1097 0.0000  0.0000  0.0000  19   ALA A HB2  
312  H HB3  . ALA A 19  ? 0.1097 0.1097 0.1097 0.0000  0.0000  0.0000  19   ALA A HB3  
313  N N    . ALA A 20  ? 0.0788 0.0427 0.0576 -0.0045 -0.0242 0.0042  20   ALA A N    
314  C CA   . ALA A 20  ? 0.0840 0.0380 0.0637 -0.0044 -0.0289 -0.0002 20   ALA A CA   
315  C C    . ALA A 20  ? 0.0755 0.0379 0.0661 0.0005  -0.0216 -0.0013 20   ALA A C    
316  O O    . ALA A 20  ? 0.0792 0.0520 0.0846 0.0080  -0.0170 0.0052  20   ALA A O    
317  C CB   . ALA A 20  ? 0.1114 0.0489 0.0703 -0.0060 -0.0326 0.0013  20   ALA A CB   
318  H H    . ALA A 20  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  20   ALA A H    
319  H HA   . ALA A 20  ? 0.0742 0.0742 0.0742 0.0000  0.0000  0.0000  20   ALA A HA   
320  H HB1  . ALA A 20  ? 0.1153 0.1153 0.1153 0.0000  0.0000  0.0000  20   ALA A HB1  
321  H HB2  . ALA A 20  ? 0.1153 0.1153 0.1153 0.0000  0.0000  0.0000  20   ALA A HB2  
322  H HB3  . ALA A 20  ? 0.1153 0.1153 0.1153 0.0000  0.0000  0.0000  20   ALA A HB3  
323  N N    . SER A 21  ? 0.0793 0.0378 0.0653 -0.0007 -0.0321 0.0066  21   SER A N    
324  C CA   . SER A 21  ? 0.0939 0.0385 0.0635 -0.0030 -0.0322 0.0024  21   SER A CA   
325  C C    . SER A 21  ? 0.0740 0.0442 0.0595 0.0002  -0.0245 0.0081  21   SER A C    
326  O O    . SER A 21  ? 0.0922 0.0617 0.0708 0.0163  -0.0329 -0.0001 21   SER A O    
327  C CB   A SER A 21  ? 0.0958 0.0831 0.0662 0.0068  -0.0244 0.0192  21   SER A CB   
328  C CB   B SER A 21  ? 0.1294 0.0612 0.0330 0.0412  -0.0204 0.0153  21   SER A CB   
329  O OG   A SER A 21  ? 0.0846 0.0702 0.0866 0.0183  -0.0215 0.0176  21   SER A OG   
330  O OG   B SER A 21  ? 0.1204 0.0679 0.0821 0.0030  -0.0259 -0.0012 21   SER A OG   
331  H H    . SER A 21  ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  21   SER A H    
332  H HA   A SER A 21  ? 0.0784 0.0784 0.0784 0.0000  0.0000  0.0000  21   SER A HA   
333  H HB2  A SER A 21  ? 0.0980 0.0980 0.0980 0.0000  0.0000  0.0000  21   SER A HB2  
334  H HB2  B SER A 21  ? 0.0894 0.0894 0.0894 0.0000  0.0000  0.0000  21   SER A HB2  
335  H HB3  A SER A 21  ? 0.0980 0.0980 0.0980 0.0000  0.0000  0.0000  21   SER A HB3  
336  H HB3  B SER A 21  ? 0.0894 0.0894 0.0894 0.0000  0.0000  0.0000  21   SER A HB3  
337  H HG   A SER A 21  ? 0.1207 0.1207 0.1207 0.0000  0.0000  0.0000  21   SER A HG   
338  H HG   B SER A 21  ? 0.1353 0.1353 0.1353 0.0000  0.0000  0.0000  21   SER A HG   
339  N N    . SER A 22  ? 0.0776 0.0392 0.0636 0.0047  -0.0308 -0.0026 22   SER A N    
340  C CA   . SER A 22  ? 0.0790 0.0366 0.0658 0.0068  -0.0275 -0.0042 22   SER A CA   
341  C C    . SER A 22  ? 0.0715 0.0342 0.0684 0.0009  -0.0260 -0.0007 22   SER A C    
342  O O    . SER A 22  ? 0.0743 0.0373 0.0672 0.0061  -0.0268 -0.0006 22   SER A O    
343  C CB   . SER A 22  ? 0.0970 0.0362 0.0719 0.0085  -0.0309 0.0040  22   SER A CB   
344  O OG   . SER A 22  ? 0.0917 0.0527 0.0799 -0.0086 -0.0248 0.0038  22   SER A OG   
345  H H    . SER A 22  ? 0.0722 0.0722 0.0722 0.0000  0.0000  0.0000  22   SER A H    
346  H HA   . SER A 22  ? 0.0726 0.0726 0.0726 0.0000  0.0000  0.0000  22   SER A HA   
347  H HB2  . SER A 22  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  22   SER A HB2  
348  H HB3  . SER A 22  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  22   SER A HB3  
349  H HG   . SER A 22  ? 0.1121 0.1121 0.1121 0.0000  0.0000  0.0000  22   SER A HG   
350  N N    . SER A 23  ? 0.0656 0.0372 0.0657 0.0045  -0.0231 -0.0009 23   SER A N    
351  C CA   . SER A 23  ? 0.0740 0.0422 0.0647 0.0015  -0.0200 -0.0012 23   SER A CA   
352  C C    . SER A 23  ? 0.0703 0.0332 0.0568 0.0061  -0.0183 -0.0013 23   SER A C    
353  O O    . SER A 23  ? 0.0724 0.0494 0.0643 0.0035  -0.0215 0.0000  23   SER A O    
354  C CB   . SER A 23  ? 0.0779 0.0494 0.0700 0.0002  -0.0185 -0.0111 23   SER A CB   
355  O OG   . SER A 23  ? 0.0822 0.0415 0.0940 0.0094  -0.0255 -0.0106 23   SER A OG   
356  H H    . SER A 23  ? 0.0674 0.0674 0.0674 0.0000  0.0000  0.0000  23   SER A H    
357  H HA   . SER A 23  ? 0.0723 0.0723 0.0723 0.0000  0.0000  0.0000  23   SER A HA   
358  H HB2  . SER A 23  ? 0.0789 0.0789 0.0789 0.0000  0.0000  0.0000  23   SER A HB2  
359  H HB3  . SER A 23  ? 0.0789 0.0789 0.0789 0.0000  0.0000  0.0000  23   SER A HB3  
360  H HG   . SER A 23  ? 0.1088 0.1088 0.1088 0.0000  0.0000  0.0000  23   SER A HG   
361  N N    . ASN A 24  ? 0.0701 0.0362 0.0633 0.0029  -0.0211 -0.0046 24   ASN A N    
362  C CA   . ASN A 24  ? 0.0643 0.0346 0.0761 0.0033  -0.0132 0.0034  24   ASN A CA   
363  C C    . ASN A 24  ? 0.0698 0.0383 0.0626 0.0029  -0.0224 -0.0006 24   ASN A C    
364  O O    . ASN A 24  ? 0.0675 0.0395 0.0806 0.0032  -0.0155 0.0003  24   ASN A O    
365  C CB   . ASN A 24  ? 0.0715 0.0418 0.0756 0.0006  -0.0162 0.0042  24   ASN A CB   
366  C CG   . ASN A 24  ? 0.0726 0.0503 0.0793 0.0080  -0.0079 0.0129  24   ASN A CG   
367  O OD1  . ASN A 24  ? 0.1090 0.0484 0.0742 0.0144  -0.0025 0.0040  24   ASN A OD1  
368  N ND2  . ASN A 24  ? 0.0836 0.0548 0.0845 0.0124  -0.0106 0.0215  24   ASN A ND2  
369  H H    . ASN A 24  ? 0.0679 0.0679 0.0679 0.0000  0.0000  0.0000  24   ASN A H    
370  H HA   . ASN A 24  ? 0.0699 0.0699 0.0699 0.0000  0.0000  0.0000  24   ASN A HA   
371  H HB2  . ASN A 24  ? 0.0756 0.0756 0.0756 0.0000  0.0000  0.0000  24   ASN A HB2  
372  H HB3  . ASN A 24  ? 0.0756 0.0756 0.0756 0.0000  0.0000  0.0000  24   ASN A HB3  
373  H HD21 . ASN A 24  ? 0.0892 0.0892 0.0892 0.0000  0.0000  0.0000  24   ASN A HD21 
374  H HD22 . ASN A 24  ? 0.0892 0.0892 0.0892 0.0000  0.0000  0.0000  24   ASN A HD22 
375  N N    . TYR A 25  ? 0.0665 0.0390 0.0647 0.0074  -0.0215 -0.0054 25   TYR A N    
376  C CA   . TYR A 25  ? 0.0736 0.0387 0.0579 0.0061  -0.0210 -0.0005 25   TYR A CA   
377  C C    . TYR A 25  ? 0.0628 0.0277 0.0668 0.0021  -0.0158 -0.0003 25   TYR A C    
378  O O    . TYR A 25  ? 0.0706 0.0434 0.0616 0.0063  -0.0152 -0.0007 25   TYR A O    
379  C CB   . TYR A 25  ? 0.0691 0.0415 0.0731 0.0079  -0.0236 -0.0106 25   TYR A CB   
380  C CG   . TYR A 25  ? 0.0664 0.0398 0.0748 0.0030  -0.0267 -0.0109 25   TYR A CG   
381  C CD1  . TYR A 25  ? 0.0818 0.0453 0.0738 0.0110  -0.0378 -0.0101 25   TYR A CD1  
382  C CD2  . TYR A 25  ? 0.0864 0.0402 0.0815 0.0005  -0.0198 -0.0026 25   TYR A CD2  
383  C CE1  . TYR A 25  ? 0.0862 0.0430 0.0862 0.0137  -0.0375 -0.0216 25   TYR A CE1  
384  C CE2  . TYR A 25  ? 0.0977 0.0393 0.0958 0.0013  -0.0177 0.0049  25   TYR A CE2  
385  C CZ   . TYR A 25  ? 0.0853 0.0374 0.1047 0.0019  -0.0294 -0.0134 25   TYR A CZ   
386  O OH   . TYR A 25  ? 0.1055 0.0408 0.1187 0.0121  -0.0306 -0.0239 25   TYR A OH   
387  H H    . TYR A 25  ? 0.0681 0.0681 0.0681 0.0000  0.0000  0.0000  25   TYR A H    
388  H HA   . TYR A 25  ? 0.0681 0.0681 0.0681 0.0000  0.0000  0.0000  25   TYR A HA   
389  H HB2  . TYR A 25  ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  25   TYR A HB2  
390  H HB3  . TYR A 25  ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  25   TYR A HB3  
391  H HD1  . TYR A 25  ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  25   TYR A HD1  
392  H HD2  . TYR A 25  ? 0.0832 0.0832 0.0832 0.0000  0.0000  0.0000  25   TYR A HD2  
393  H HE1  . TYR A 25  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  25   TYR A HE1  
394  H HE2  . TYR A 25  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  25   TYR A HE2  
395  H HH   . TYR A 25  ? 0.1325 0.1325 0.1325 0.0000  0.0000  0.0000  25   TYR A HH   
396  N N    . CYS A 26  ? 0.0653 0.0370 0.0576 0.0011  -0.0191 -0.0014 26   CYS A N    
397  C CA   . CYS A 26  ? 0.0613 0.0348 0.0625 0.0034  -0.0213 -0.0028 26   CYS A CA   
398  C C    . CYS A 26  ? 0.0640 0.0431 0.0633 0.0025  -0.0142 0.0040  26   CYS A C    
399  O O    . CYS A 26  ? 0.0724 0.0465 0.0675 0.0013  -0.0187 0.0036  26   CYS A O    
400  C CB   . CYS A 26  ? 0.0694 0.0347 0.0620 -0.0008 -0.0196 0.0045  26   CYS A CB   
401  S SG   . CYS A 26  ? 0.0659 0.0403 0.0741 -0.0024 -0.0185 0.0014  26   CYS A SG   
402  H H    . CYS A 26  ? 0.0640 0.0640 0.0640 0.0000  0.0000  0.0000  26   CYS A H    
403  H HA   . CYS A 26  ? 0.0635 0.0635 0.0635 0.0000  0.0000  0.0000  26   CYS A HA   
404  H HB2  . CYS A 26  ? 0.0664 0.0664 0.0664 0.0000  0.0000  0.0000  26   CYS A HB2  
405  H HB3  . CYS A 26  ? 0.0664 0.0664 0.0664 0.0000  0.0000  0.0000  26   CYS A HB3  
406  N N    . ASN A 27  ? 0.0711 0.0321 0.0620 -0.0009 -0.0183 -0.0012 27   ASN A N    
407  C CA   . ASN A 27  ? 0.0738 0.0490 0.0553 -0.0109 -0.0142 -0.0024 27   ASN A CA   
408  C C    . ASN A 27  ? 0.0697 0.0553 0.0675 -0.0145 -0.0195 0.0050  27   ASN A C    
409  O O    . ASN A 27  ? 0.0792 0.0869 0.0737 -0.0133 -0.0164 0.0057  27   ASN A O    
410  C CB   . ASN A 27  ? 0.0947 0.0485 0.0585 -0.0132 -0.0203 0.0050  27   ASN A CB   
411  C CG   . ASN A 27  ? 0.0856 0.0407 0.0609 -0.0060 -0.0235 0.0007  27   ASN A CG   
412  O OD1  . ASN A 27  ? 0.1110 0.0589 0.0595 0.0118  -0.0229 0.0024  27   ASN A OD1  
413  N ND2  . ASN A 27  ? 0.0921 0.0455 0.0717 0.0024  -0.0182 0.0026  27   ASN A ND2  
414  H H    . ASN A 27  ? 0.0661 0.0661 0.0661 0.0000  0.0000  0.0000  27   ASN A H    
415  H HA   . ASN A 27  ? 0.0712 0.0712 0.0712 0.0000  0.0000  0.0000  27   ASN A HA   
416  H HB2  . ASN A 27  ? 0.0807 0.0807 0.0807 0.0000  0.0000  0.0000  27   ASN A HB2  
417  H HB3  . ASN A 27  ? 0.0807 0.0807 0.0807 0.0000  0.0000  0.0000  27   ASN A HB3  
418  H HD21 . ASN A 27  ? 0.0837 0.0837 0.0837 0.0000  0.0000  0.0000  27   ASN A HD21 
419  H HD22 . ASN A 27  ? 0.0837 0.0837 0.0837 0.0000  0.0000  0.0000  27   ASN A HD22 
420  N N    . GLN A 28  ? 0.0759 0.0422 0.0565 -0.0019 -0.0168 0.0050  28   GLN A N    
421  C CA   . GLN A 28  ? 0.0707 0.0441 0.0689 -0.0064 -0.0104 0.0040  28   GLN A CA   
422  C C    . GLN A 28  ? 0.0649 0.0534 0.0586 -0.0017 -0.0154 0.0049  28   GLN A C    
423  O O    . GLN A 28  ? 0.0782 0.0539 0.0761 -0.0005 -0.0030 0.0057  28   GLN A O    
424  C CB   . GLN A 28  ? 0.0935 0.0439 0.0644 0.0005  -0.0129 0.0030  28   GLN A CB   
425  C CG   . GLN A 28  ? 0.1094 0.0464 0.0783 0.0090  0.0074  0.0063  28   GLN A CG   
426  C CD   . GLN A 28  ? 0.1088 0.0579 0.0776 0.0262  0.0003  0.0181  28   GLN A CD   
427  O OE1  . GLN A 28  ? 0.1167 0.0809 0.0941 0.0236  0.0155  0.0333  28   GLN A OE1  
428  N NE2  . GLN A 28  ? 0.1139 0.1287 0.0857 0.0367  0.0081  0.0434  28   GLN A NE2  
429  H H    . GLN A 28  ? 0.0699 0.0699 0.0699 0.0000  0.0000  0.0000  28   GLN A H    
430  H HA   . GLN A 28  ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  28   GLN A HA   
431  H HB2  . GLN A 28  ? 0.0807 0.0807 0.0807 0.0000  0.0000  0.0000  28   GLN A HB2  
432  H HB3  . GLN A 28  ? 0.0807 0.0807 0.0807 0.0000  0.0000  0.0000  28   GLN A HB3  
433  H HG2  . GLN A 28  ? 0.0936 0.0936 0.0936 0.0000  0.0000  0.0000  28   GLN A HG2  
434  H HG3  . GLN A 28  ? 0.0936 0.0936 0.0936 0.0000  0.0000  0.0000  28   GLN A HG3  
435  H HE21 . GLN A 28  ? 0.1313 0.1313 0.1313 0.0000  0.0000  0.0000  28   GLN A HE21 
436  H HE22 . GLN A 28  ? 0.1313 0.1313 0.1313 0.0000  0.0000  0.0000  28   GLN A HE22 
437  N N    . MET A 29  ? 0.0655 0.0400 0.0712 -0.0033 -0.0155 -0.0015 29   MET A N    
438  C CA   . MET A 29  ? 0.0653 0.0474 0.0733 0.0023  -0.0179 -0.0014 29   MET A CA   
439  C C    . MET A 29  ? 0.0634 0.0402 0.0863 -0.0036 -0.0120 0.0028  29   MET A C    
440  O O    . MET A 29  ? 0.0600 0.0472 0.0899 0.0047  -0.0147 -0.0020 29   MET A O    
441  C CB   A MET A 29  ? 0.0715 0.0359 0.0985 0.0003  -0.0090 -0.0064 29   MET A CB   
442  C CB   B MET A 29  ? 0.0701 0.0649 0.1258 -0.0138 -0.0360 -0.0261 29   MET A CB   
443  C CG   A MET A 29  ? 0.0651 0.0571 0.1248 0.0049  -0.0366 -0.0140 29   MET A CG   
444  C CG   B MET A 29  ? 0.1754 0.0440 0.1739 -0.0043 -0.1060 -0.0019 29   MET A CG   
445  S SD   A MET A 29  ? 0.1097 0.1312 0.0963 0.0152  -0.0425 -0.0408 29   MET A SD   
446  S SD   B MET A 29  ? 0.1482 0.1172 0.1634 0.0299  -0.0717 -0.0581 29   MET A SD   
447  C CE   A MET A 29  ? 0.0869 0.1124 0.2168 0.0249  -0.0543 -0.0875 29   MET A CE   
448  C CE   B MET A 29  ? 0.2209 0.1068 0.1004 -0.0558 -0.1442 0.0158  29   MET A CE   
449  H H    . MET A 29  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  29   MET A H    
450  H HA   A MET A 29  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  29   MET A HA   
451  H HB2  A MET A 29  ? 0.0823 0.0823 0.0823 0.0000  0.0000  0.0000  29   MET A HB2  
452  H HB2  B MET A 29  ? 0.1044 0.1044 0.1044 0.0000  0.0000  0.0000  29   MET A HB2  
453  H HB3  A MET A 29  ? 0.0823 0.0823 0.0823 0.0000  0.0000  0.0000  29   MET A HB3  
454  H HB3  B MET A 29  ? 0.1044 0.1044 0.1044 0.0000  0.0000  0.0000  29   MET A HB3  
455  H HG2  A MET A 29  ? 0.0988 0.0988 0.0988 0.0000  0.0000  0.0000  29   MET A HG2  
456  H HG2  B MET A 29  ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  29   MET A HG2  
457  H HG3  A MET A 29  ? 0.0988 0.0988 0.0988 0.0000  0.0000  0.0000  29   MET A HG3  
458  H HG3  B MET A 29  ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  29   MET A HG3  
459  H HE1  A MET A 29  ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  29   MET A HE1  
460  H HE1  B MET A 29  ? 0.2140 0.2140 0.2140 0.0000  0.0000  0.0000  29   MET A HE1  
461  H HE2  A MET A 29  ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  29   MET A HE2  
462  H HE2  B MET A 29  ? 0.2140 0.2140 0.2140 0.0000  0.0000  0.0000  29   MET A HE2  
463  H HE3  A MET A 29  ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  29   MET A HE3  
464  H HE3  B MET A 29  ? 0.2140 0.2140 0.2140 0.0000  0.0000  0.0000  29   MET A HE3  
465  N N    . MET A 30  ? 0.0637 0.0500 0.0713 0.0057  -0.0131 -0.0008 30   MET A N    
466  C CA   . MET A 30  ? 0.0658 0.0460 0.0738 0.0047  -0.0139 0.0023  30   MET A CA   
467  C C    . MET A 30  ? 0.0638 0.0648 0.0659 0.0096  -0.0172 0.0003  30   MET A C    
468  O O    . MET A 30  ? 0.0644 0.0710 0.0931 0.0104  -0.0068 0.0097  30   MET A O    
469  C CB   . MET A 30  ? 0.0641 0.0493 0.0729 -0.0002 -0.0155 0.0055  30   MET A CB   
470  C CG   . MET A 30  ? 0.0649 0.0559 0.0689 0.0046  -0.0173 0.0033  30   MET A CG   
471  S SD   . MET A 30  ? 0.0753 0.0484 0.0785 -0.0033 -0.0274 0.0041  30   MET A SD   
472  C CE   . MET A 30  ? 0.0782 0.0578 0.0877 0.0087  -0.0313 0.0095  30   MET A CE   
473  H H    . MET A 30  ? 0.0740 0.0740 0.0740 0.0000  0.0000  0.0000  30   MET A H    
474  H HA   . MET A 30  ? 0.0742 0.0742 0.0742 0.0000  0.0000  0.0000  30   MET A HA   
475  H HB2  . MET A 30  ? 0.0746 0.0746 0.0746 0.0000  0.0000  0.0000  30   MET A HB2  
476  H HB3  . MET A 30  ? 0.0746 0.0746 0.0746 0.0000  0.0000  0.0000  30   MET A HB3  
477  H HG2  . MET A 30  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  30   MET A HG2  
478  H HG3  . MET A 30  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  30   MET A HG3  
479  H HE1  . MET A 30  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  30   MET A HE1  
480  H HE2  . MET A 30  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  30   MET A HE2  
481  H HE3  . MET A 30  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  30   MET A HE3  
482  N N    . LYS A 31  ? 0.0631 0.0563 0.0714 0.0034  -0.0132 -0.0035 31   LYS A N    
483  C CA   . LYS A 31  ? 0.0672 0.0601 0.0748 -0.0129 -0.0157 -0.0095 31   LYS A CA   
484  C C    . LYS A 31  ? 0.0677 0.0616 0.0747 -0.0109 -0.0178 -0.0070 31   LYS A C    
485  O O    . LYS A 31  ? 0.0686 0.0767 0.0745 -0.0112 -0.0114 -0.0044 31   LYS A O    
486  C CB   . LYS A 31  ? 0.1012 0.0573 0.0959 -0.0167 -0.0067 -0.0115 31   LYS A CB   
487  C CG   . LYS A 31  ? 0.1292 0.0821 0.1334 -0.0406 -0.0066 -0.0051 31   LYS A CG   
488  C CD   . LYS A 31  ? 0.1375 0.1111 0.2586 -0.0415 -0.0343 -0.0065 31   LYS A CD   
489  C CE   . LYS A 31  ? 0.1465 0.2520 0.3310 -0.0957 0.0636  -0.0872 31   LYS A CE   
490  N NZ   . LYS A 31  ? 0.2144 0.6169 0.2587 -0.2135 -0.0123 -0.1029 31   LYS A NZ   
491  H H    . LYS A 31  ? 0.0764 0.0764 0.0764 0.0000  0.0000  0.0000  31   LYS A H    
492  H HA   . LYS A 31  ? 0.0808 0.0808 0.0808 0.0000  0.0000  0.0000  31   LYS A HA   
493  H HB2  . LYS A 31  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  31   LYS A HB2  
494  H HB3  . LYS A 31  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  31   LYS A HB3  
495  H HG2  . LYS A 31  ? 0.1379 0.1379 0.1379 0.0000  0.0000  0.0000  31   LYS A HG2  
496  H HG3  . LYS A 31  ? 0.1379 0.1379 0.1379 0.0000  0.0000  0.0000  31   LYS A HG3  
497  H HD2  . LYS A 31  ? 0.2029 0.2029 0.2029 0.0000  0.0000  0.0000  31   LYS A HD2  
498  H HD3  . LYS A 31  ? 0.2029 0.2029 0.2029 0.0000  0.0000  0.0000  31   LYS A HD3  
499  H HE2  . LYS A 31  ? 0.2918 0.2918 0.2918 0.0000  0.0000  0.0000  31   LYS A HE2  
500  H HE3  . LYS A 31  ? 0.2918 0.2918 0.2918 0.0000  0.0000  0.0000  31   LYS A HE3  
501  H HZ1  . LYS A 31  ? 0.5450 0.5450 0.5450 0.0000  0.0000  0.0000  31   LYS A HZ1  
502  H HZ2  . LYS A 31  ? 0.5450 0.5450 0.5450 0.0000  0.0000  0.0000  31   LYS A HZ2  
503  H HZ3  . LYS A 31  ? 0.5450 0.5450 0.5450 0.0000  0.0000  0.0000  31   LYS A HZ3  
504  N N    . SER A 32  ? 0.0704 0.0619 0.0690 -0.0086 -0.0083 -0.0032 32   SER A N    
505  C CA   . SER A 32  ? 0.0895 0.0753 0.0611 -0.0122 -0.0070 -0.0051 32   SER A CA   
506  C C    . SER A 32  ? 0.0896 0.0848 0.0664 -0.0098 -0.0130 -0.0169 32   SER A C    
507  O O    . SER A 32  ? 0.1205 0.0958 0.0874 -0.0023 0.0063  -0.0207 32   SER A O    
508  C CB   A SER A 32  ? 0.1084 0.0932 0.0738 -0.0056 -0.0199 0.0110  32   SER A CB   
509  C CB   B SER A 32  ? 0.1237 0.1144 0.0278 -0.0037 0.0120  0.0115  32   SER A CB   
510  O OG   A SER A 32  ? 0.0732 0.1342 0.0855 -0.0028 -0.0191 -0.0057 32   SER A OG   
511  O OG   B SER A 32  ? 0.1384 0.1592 0.0689 0.0379  -0.0309 -0.0269 32   SER A OG   
512  H H    . SER A 32  ? 0.0806 0.0806 0.0806 0.0000  0.0000  0.0000  32   SER A H    
513  H HA   A SER A 32  ? 0.0904 0.0904 0.0904 0.0000  0.0000  0.0000  32   SER A HA   
514  H HB2  A SER A 32  ? 0.1102 0.1102 0.1102 0.0000  0.0000  0.0000  32   SER A HB2  
515  H HB2  B SER A 32  ? 0.1064 0.1064 0.1064 0.0000  0.0000  0.0000  32   SER A HB2  
516  H HB3  A SER A 32  ? 0.1102 0.1102 0.1102 0.0000  0.0000  0.0000  32   SER A HB3  
517  H HB3  B SER A 32  ? 0.1064 0.1064 0.1064 0.0000  0.0000  0.0000  32   SER A HB3  
518  H HG   A SER A 32  ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  32   SER A HG   
519  H HG   B SER A 32  ? 0.1831 0.1831 0.1831 0.0000  0.0000  0.0000  32   SER A HG   
520  N N    . ARG A 33  ? 0.0698 0.0695 0.0769 -0.0142 -0.0046 -0.0198 33   ARG A N    
521  C CA   . ARG A 33  ? 0.0753 0.0622 0.0925 -0.0103 -0.0149 -0.0231 33   ARG A CA   
522  C C    . ARG A 33  ? 0.0852 0.0737 0.0919 -0.0090 -0.0056 -0.0216 33   ARG A C    
523  O O    . ARG A 33  ? 0.0881 0.0648 0.1312 0.0056  -0.0312 -0.0317 33   ARG A O    
524  C CB   . ARG A 33  ? 0.0750 0.0625 0.0921 -0.0058 -0.0154 -0.0129 33   ARG A CB   
525  C CG   . ARG A 33  ? 0.0753 0.0611 0.1076 -0.0106 -0.0232 -0.0078 33   ARG A CG   
526  C CD   . ARG A 33  ? 0.0766 0.0602 0.0970 -0.0169 -0.0310 0.0032  33   ARG A CD   
527  N NE   . ARG A 33  ? 0.0883 0.0553 0.1095 -0.0146 -0.0396 0.0217  33   ARG A NE   
528  C CZ   . ARG A 33  ? 0.0704 0.0565 0.0860 -0.0071 -0.0278 0.0018  33   ARG A CZ   
529  N NH1  . ARG A 33  ? 0.0655 0.0578 0.0801 -0.0095 -0.0285 0.0020  33   ARG A NH1  
530  N NH2  . ARG A 33  ? 0.0980 0.0667 0.1075 -0.0080 -0.0492 0.0223  33   ARG A NH2  
531  H H    . ARG A 33  ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  33   ARG A H    
532  H HA   . ARG A 33  ? 0.0919 0.0919 0.0919 0.0000  0.0000  0.0000  33   ARG A HA   
533  H HB2  . ARG A 33  ? 0.0918 0.0918 0.0918 0.0000  0.0000  0.0000  33   ARG A HB2  
534  H HB3  . ARG A 33  ? 0.0918 0.0918 0.0918 0.0000  0.0000  0.0000  33   ARG A HB3  
535  H HG2  . ARG A 33  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  33   ARG A HG2  
536  H HG3  . ARG A 33  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  33   ARG A HG3  
537  H HD2  . ARG A 33  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  33   ARG A HD2  
538  H HD3  . ARG A 33  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  33   ARG A HD3  
539  H HE   . ARG A 33  ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  33   ARG A HE   
540  H HH11 . ARG A 33  ? 0.0813 0.0813 0.0813 0.0000  0.0000  0.0000  33   ARG A HH11 
541  H HH12 . ARG A 33  ? 0.0813 0.0813 0.0813 0.0000  0.0000  0.0000  33   ARG A HH12 
542  H HH21 . ARG A 33  ? 0.1089 0.1089 0.1089 0.0000  0.0000  0.0000  33   ARG A HH21 
543  H HH22 . ARG A 33  ? 0.1089 0.1089 0.1089 0.0000  0.0000  0.0000  33   ARG A HH22 
544  N N    . ASN A 34  ? 0.0769 0.0784 0.0819 -0.0100 -0.0089 -0.0223 34   ASN A N    
545  C CA   . ASN A 34  ? 0.0775 0.0839 0.0910 -0.0073 -0.0100 -0.0198 34   ASN A CA   
546  C C    . ASN A 34  ? 0.0680 0.0891 0.1030 0.0093  -0.0144 -0.0065 34   ASN A C    
547  O O    . ASN A 34  ? 0.0979 0.1311 0.1446 0.0534  0.0066  0.0111  34   ASN A O    
548  C CB   . ASN A 34  ? 0.0817 0.1395 0.1223 -0.0080 0.0024  -0.0459 34   ASN A CB   
549  C CG   A ASN A 34  ? 0.0722 0.2418 0.0966 -0.0366 0.0143  -0.0263 34   ASN A CG   
550  C CG   B ASN A 34  ? 0.1073 0.1067 0.1282 -0.0008 0.0083  -0.0022 34   ASN A CG   
551  O OD1  A ASN A 34  ? 0.1595 0.2126 0.1932 -0.0378 0.0500  0.0380  34   ASN A OD1  
552  O OD1  B ASN A 34  ? 0.1327 0.1566 0.2286 -0.0195 0.0640  -0.0475 34   ASN A OD1  
553  N ND2  A ASN A 34  ? 0.2414 0.3561 0.1363 -0.0702 0.0156  -0.0024 34   ASN A ND2  
554  N ND2  B ASN A 34  ? 0.0860 0.1926 0.3004 0.0191  0.0463  0.0343  34   ASN A ND2  
555  H H    . ASN A 34  ? 0.0949 0.0949 0.0949 0.0000  0.0000  0.0000  34   ASN A H    
556  H HA   . ASN A 34  ? 0.1009 0.1009 0.1009 0.0000  0.0000  0.0000  34   ASN A HA   
557  H HB2  A ASN A 34  ? 0.1374 0.1374 0.1374 0.0000  0.0000  0.0000  34   ASN A HB2  
558  H HB3  A ASN A 34  ? 0.1374 0.1374 0.1374 0.0000  0.0000  0.0000  34   ASN A HB3  
559  H HD21 A ASN A 34  ? 0.2935 0.2935 0.2935 0.0000  0.0000  0.0000  34   ASN A HD21 
560  H HD21 B ASN A 34  ? 0.2315 0.2315 0.2315 0.0000  0.0000  0.0000  34   ASN A HD21 
561  H HD22 A ASN A 34  ? 0.2935 0.2935 0.2935 0.0000  0.0000  0.0000  34   ASN A HD22 
562  H HD22 B ASN A 34  ? 0.2315 0.2315 0.2315 0.0000  0.0000  0.0000  34   ASN A HD22 
563  N N    . LEU A 35  ? 0.0636 0.0795 0.0863 0.0145  -0.0162 -0.0192 35   LEU A N    
564  C CA   . LEU A 35  ? 0.0694 0.0827 0.0920 -0.0049 -0.0194 0.0127  35   LEU A CA   
565  C C    . LEU A 35  ? 0.0702 0.1009 0.0792 0.0006  -0.0295 0.0010  35   LEU A C    
566  O O    . LEU A 35  ? 0.1127 0.1375 0.0827 -0.0365 -0.0188 0.0181  35   LEU A O    
567  C CB   . LEU A 35  ? 0.0751 0.0640 0.1004 0.0057  -0.0123 -0.0084 35   LEU A CB   
568  C CG   . LEU A 35  ? 0.0805 0.1053 0.1746 -0.0072 -0.0057 -0.0595 35   LEU A CG   
569  C CD1  . LEU A 35  ? 0.0860 0.1132 0.1899 -0.0106 -0.0073 -0.0644 35   LEU A CD1  
570  C CD2  . LEU A 35  ? 0.1128 0.1518 0.4846 0.0239  -0.0209 -0.1760 35   LEU A CD2  
571  H H    . LEU A 35  ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  35   LEU A H    
572  H HA   . LEU A 35  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  35   LEU A HA   
573  H HB2  . LEU A 35  ? 0.0959 0.0959 0.0959 0.0000  0.0000  0.0000  35   LEU A HB2  
574  H HB3  . LEU A 35  ? 0.0959 0.0959 0.0959 0.0000  0.0000  0.0000  35   LEU A HB3  
575  H HG   . LEU A 35  ? 0.1441 0.1441 0.1441 0.0000  0.0000  0.0000  35   LEU A HG   
576  H HD11 . LEU A 35  ? 0.1945 0.1945 0.1945 0.0000  0.0000  0.0000  35   LEU A HD11 
577  H HD12 . LEU A 35  ? 0.1945 0.1945 0.1945 0.0000  0.0000  0.0000  35   LEU A HD12 
578  H HD13 . LEU A 35  ? 0.1945 0.1945 0.1945 0.0000  0.0000  0.0000  35   LEU A HD13 
579  H HD21 . LEU A 35  ? 0.3746 0.3746 0.3746 0.0000  0.0000  0.0000  35   LEU A HD21 
580  H HD22 . LEU A 35  ? 0.3746 0.3746 0.3746 0.0000  0.0000  0.0000  35   LEU A HD22 
581  H HD23 . LEU A 35  ? 0.3746 0.3746 0.3746 0.0000  0.0000  0.0000  35   LEU A HD23 
582  N N    . THR A 36  ? 0.0603 0.0971 0.0637 -0.0073 -0.0202 0.0042  36   THR A N    
583  C CA   . THR A 36  ? 0.0609 0.1215 0.0649 -0.0182 -0.0225 -0.0041 36   THR A CA   
584  C C    . THR A 36  ? 0.0588 0.1372 0.0705 -0.0159 -0.0124 0.0039  36   THR A C    
585  O O    . THR A 36  ? 0.0774 0.1344 0.1380 -0.0328 -0.0147 -0.0146 36   THR A O    
586  C CB   . THR A 36  ? 0.0689 0.1208 0.0720 -0.0102 -0.0189 -0.0205 36   THR A CB   
587  O OG1  . THR A 36  ? 0.0971 0.1171 0.0755 0.0178  -0.0301 -0.0103 36   THR A OG1  
588  C CG2  . THR A 36  ? 0.0655 0.1468 0.1094 -0.0154 -0.0129 -0.0536 36   THR A CG2  
589  H H    . THR A 36  ? 0.0884 0.0884 0.0884 0.0000  0.0000  0.0000  36   THR A H    
590  H HA   . THR A 36  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  36   THR A HA   
591  H HB   . THR A 36  ? 0.1046 0.1046 0.1046 0.0000  0.0000  0.0000  36   THR A HB   
592  H HG1  . THR A 36  ? 0.1449 0.1449 0.1449 0.0000  0.0000  0.0000  36   THR A HG1  
593  H HG21 . THR A 36  ? 0.1608 0.1608 0.1608 0.0000  0.0000  0.0000  36   THR A HG21 
594  H HG22 . THR A 36  ? 0.1608 0.1608 0.1608 0.0000  0.0000  0.0000  36   THR A HG22 
595  H HG23 . THR A 36  ? 0.1608 0.1608 0.1608 0.0000  0.0000  0.0000  36   THR A HG23 
596  N N    . LYS A 37  ? 0.0683 0.1495 0.0767 -0.0211 -0.0145 -0.0006 37   LYS A N    
597  C CA   . LYS A 37  ? 0.0759 0.1582 0.0922 -0.0153 0.0025  -0.0199 37   LYS A CA   
598  C C    . LYS A 37  ? 0.0532 0.1999 0.1085 -0.0284 -0.0051 -0.0488 37   LYS A C    
599  O O    . LYS A 37  ? 0.0688 0.2093 0.1067 -0.0112 -0.0013 -0.0306 37   LYS A O    
600  C CB   . LYS A 37  ? 0.0957 0.1588 0.1017 -0.0098 -0.0102 -0.0404 37   LYS A CB   
601  C CG   A LYS A 37  ? 0.1099 0.1060 0.0737 -0.0239 -0.0017 -0.0126 37   LYS A CG   
602  C CD   A LYS A 37  ? 0.0902 0.1135 0.1071 -0.0198 -0.0215 0.0063  37   LYS A CD   
603  C CE   A LYS A 37  ? 0.1088 0.0753 0.1098 0.0110  -0.0377 -0.0110 37   LYS A CE   
604  N NZ   A LYS A 37  ? 0.0702 0.0720 0.1797 0.0018  0.0277  0.0054  37   LYS A NZ   
605  H H    . LYS A 37  ? 0.1178 0.1178 0.1178 0.0000  0.0000  0.0000  37   LYS A H    
606  H HA   . LYS A 37  ? 0.1305 0.1305 0.1305 0.0000  0.0000  0.0000  37   LYS A HA   
607  H HB2  A LYS A 37  ? 0.1425 0.1425 0.1425 0.0000  0.0000  0.0000  37   LYS A HB2  
608  H HB3  A LYS A 37  ? 0.1425 0.1425 0.1425 0.0000  0.0000  0.0000  37   LYS A HB3  
609  H HG2  A LYS A 37  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  37   LYS A HG2  
610  H HG3  A LYS A 37  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  37   LYS A HG3  
611  H HD2  A LYS A 37  ? 0.1244 0.1244 0.1244 0.0000  0.0000  0.0000  37   LYS A HD2  
612  H HD3  A LYS A 37  ? 0.1244 0.1244 0.1244 0.0000  0.0000  0.0000  37   LYS A HD3  
613  H HE2  A LYS A 37  ? 0.1175 0.1175 0.1175 0.0000  0.0000  0.0000  37   LYS A HE2  
614  H HE3  A LYS A 37  ? 0.1175 0.1175 0.1175 0.0000  0.0000  0.0000  37   LYS A HE3  
615  H HZ1  A LYS A 37  ? 0.1610 0.1610 0.1610 0.0000  0.0000  0.0000  37   LYS A HZ1  
616  H HZ2  A LYS A 37  ? 0.1610 0.1610 0.1610 0.0000  0.0000  0.0000  37   LYS A HZ2  
617  H HZ3  A LYS A 37  ? 0.1610 0.1610 0.1610 0.0000  0.0000  0.0000  37   LYS A HZ3  
618  N N    . ASP A 38  ? 0.0626 0.2110 0.0876 -0.0321 -0.0139 -0.0298 38   ASP A N    
619  C CA   . ASP A 38  ? 0.0698 0.1733 0.0947 -0.0108 -0.0098 -0.0399 38   ASP A CA   
620  C C    . ASP A 38  ? 0.0640 0.2123 0.0962 0.0090  -0.0200 -0.0688 38   ASP A C    
621  O O    . ASP A 38  ? 0.0846 0.3293 0.1091 0.0427  -0.0472 -0.1150 38   ASP A O    
622  C CB   . ASP A 38  ? 0.0772 0.1973 0.0930 -0.0056 0.0099  -0.0483 38   ASP A CB   
623  C CG   . ASP A 38  ? 0.0996 0.1744 0.1010 0.0257  0.0089  -0.0442 38   ASP A CG   
624  O OD1  . ASP A 38  ? 0.1204 0.1795 0.1348 -0.0440 0.0017  -0.0439 38   ASP A OD1  
625  O OD2  . ASP A 38  ? 0.1596 0.1645 0.3078 0.0212  -0.0668 -0.0747 38   ASP A OD2  
626  H H    . ASP A 38  ? 0.1445 0.1445 0.1445 0.0000  0.0000  0.0000  38   ASP A H    
627  H HA   . ASP A 38  ? 0.1351 0.1351 0.1351 0.0000  0.0000  0.0000  38   ASP A HA   
628  H HB2  . ASP A 38  ? 0.1470 0.1470 0.1470 0.0000  0.0000  0.0000  38   ASP A HB2  
629  H HB3  . ASP A 38  ? 0.1470 0.1470 0.1470 0.0000  0.0000  0.0000  38   ASP A HB3  
630  N N    . ARG A 39  ? 0.0620 0.1396 0.0684 -0.0008 -0.0236 -0.0256 39   ARG A N    
631  C CA   . ARG A 39  ? 0.0713 0.1162 0.0629 -0.0006 -0.0281 -0.0106 39   ARG A CA   
632  C C    . ARG A 39  ? 0.0721 0.1129 0.0615 -0.0097 -0.0318 0.0104  39   ARG A C    
633  O O    . ARG A 39  ? 0.0713 0.2307 0.0531 -0.0024 -0.0206 -0.0245 39   ARG A O    
634  C CB   . ARG A 39  ? 0.1627 0.1099 0.0714 0.0436  -0.0085 -0.0012 39   ARG A CB   
635  C CG   . ARG A 39  ? 0.2202 0.1111 0.0946 0.0144  0.0314  -0.0157 39   ARG A CG   
636  C CD   A ARG A 39  ? 0.2503 0.1854 0.1316 -0.0352 -0.0401 -0.0076 39   ARG A CD   
637  C CD   B ARG A 39  ? 0.0568 0.1022 0.0915 0.0424  -0.0242 -0.0651 39   ARG A CD   
638  N NE   A ARG A 39  ? 0.2358 0.1783 0.1756 0.0273  -0.0409 -0.0823 39   ARG A NE   
639  N NE   B ARG A 39  ? 0.1203 0.0559 0.0698 0.0236  -0.0078 -0.0067 39   ARG A NE   
640  C CZ   A ARG A 39  ? 0.1410 0.1313 0.1998 0.0504  -0.0837 -0.0565 39   ARG A CZ   
641  C CZ   B ARG A 39  ? 0.0717 0.0662 0.0753 -0.0224 0.0000  0.0003  39   ARG A CZ   
642  N NH1  A ARG A 39  ? 0.2700 0.1267 0.1390 0.1352  -0.0664 -0.0433 39   ARG A NH1  
643  N NH1  B ARG A 39  ? 0.1254 0.0585 0.0587 0.0157  -0.0088 -0.0054 39   ARG A NH1  
644  N NH2  A ARG A 39  ? 0.1548 0.1363 0.1264 0.0305  0.0032  -0.0090 39   ARG A NH2  
645  N NH2  B ARG A 39  ? 0.1131 0.0436 0.0715 0.0046  -0.0060 -0.0032 39   ARG A NH2  
646  H H    . ARG A 39  ? 0.1080 0.1080 0.1080 0.0000  0.0000  0.0000  39   ARG A H    
647  H HA   . ARG A 39  ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  39   ARG A HA   
648  H HB2  . ARG A 39  ? 0.1375 0.1375 0.1375 0.0000  0.0000  0.0000  39   ARG A HB2  
649  H HB3  . ARG A 39  ? 0.1375 0.1375 0.1375 0.0000  0.0000  0.0000  39   ARG A HB3  
650  H HG2  A ARG A 39  ? 0.1703 0.1703 0.1703 0.0000  0.0000  0.0000  39   ARG A HG2  
651  H HG3  A ARG A 39  ? 0.1703 0.1703 0.1703 0.0000  0.0000  0.0000  39   ARG A HG3  
652  H HD2  A ARG A 39  ? 0.2268 0.2268 0.2268 0.0000  0.0000  0.0000  39   ARG A HD2  
653  H HD2  B ARG A 39  ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  39   ARG A HD2  
654  H HD3  A ARG A 39  ? 0.2268 0.2268 0.2268 0.0000  0.0000  0.0000  39   ARG A HD3  
655  H HD3  B ARG A 39  ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  39   ARG A HD3  
656  H HE   A ARG A 39  ? 0.2358 0.2358 0.2358 0.0000  0.0000  0.0000  39   ARG A HE   
657  H HE   B ARG A 39  ? 0.0984 0.0984 0.0984 0.0000  0.0000  0.0000  39   ARG A HE   
658  H HH11 A ARG A 39  ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  39   ARG A HH11 
659  H HH11 B ARG A 39  ? 0.0970 0.0970 0.0970 0.0000  0.0000  0.0000  39   ARG A HH11 
660  H HH12 A ARG A 39  ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  39   ARG A HH12 
661  H HH12 B ARG A 39  ? 0.0970 0.0970 0.0970 0.0000  0.0000  0.0000  39   ARG A HH12 
662  H HH21 A ARG A 39  ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  39   ARG A HH21 
663  H HH21 B ARG A 39  ? 0.0913 0.0913 0.0913 0.0000  0.0000  0.0000  39   ARG A HH21 
664  H HH22 A ARG A 39  ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  39   ARG A HH22 
665  H HH22 B ARG A 39  ? 0.0913 0.0913 0.0913 0.0000  0.0000  0.0000  39   ARG A HH22 
666  N N    . CYS A 40  ? 0.0607 0.1044 0.0515 -0.0040 -0.0212 -0.0079 40   CYS A N    
667  C CA   . CYS A 40  ? 0.0588 0.0935 0.0688 -0.0050 -0.0266 0.0079  40   CYS A CA   
668  C C    . CYS A 40  ? 0.0699 0.0789 0.0784 0.0034  -0.0232 0.0045  40   CYS A C    
669  O O    . CYS A 40  ? 0.1183 0.1028 0.0738 -0.0087 -0.0262 0.0186  40   CYS A O    
670  C CB   . CYS A 40  ? 0.0699 0.0825 0.0769 0.0026  -0.0222 0.0007  40   CYS A CB   
671  S SG   . CYS A 40  ? 0.0821 0.0854 0.0765 -0.0030 -0.0305 -0.0071 40   CYS A SG   
672  H H    . CYS A 40  ? 0.0866 0.0866 0.0866 0.0000  0.0000  0.0000  40   CYS A H    
673  H HA   . CYS A 40  ? 0.0884 0.0884 0.0884 0.0000  0.0000  0.0000  40   CYS A HA   
674  H HB2  . CYS A 40  ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  40   CYS A HB2  
675  H HB3  . CYS A 40  ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  40   CYS A HB3  
676  N N    . LYS A 41  ? 0.0790 0.0815 0.0957 0.0007  -0.0309 0.0080  41   LYS A N    
677  C CA   . LYS A 41  ? 0.0785 0.0724 0.0979 0.0012  -0.0377 0.0142  41   LYS A CA   
678  C C    . LYS A 41  ? 0.0786 0.0590 0.0980 -0.0049 -0.0361 0.0166  41   LYS A C    
679  O O    . LYS A 41  ? 0.0801 0.0760 0.1048 0.0100  -0.0364 0.0294  41   LYS A O    
680  C CB   . LYS A 41  ? 0.0849 0.0830 0.1086 0.0043  -0.0298 0.0073  41   LYS A CB   
681  C CG   . LYS A 41  ? 0.1028 0.0776 0.1073 0.0082  -0.0346 0.0085  41   LYS A CG   
682  C CD   . LYS A 41  ? 0.1008 0.0941 0.1514 0.0153  -0.0305 0.0100  41   LYS A CD   
683  C CE   . LYS A 41  ? 0.1481 0.0646 0.1500 0.0204  -0.0579 0.0029  41   LYS A CE   
684  N NZ   . LYS A 41  ? 0.1380 0.1078 0.1681 0.0131  -0.0321 -0.0090 41   LYS A NZ   
685  H H    . LYS A 41  ? 0.1025 0.1025 0.1025 0.0000  0.0000  0.0000  41   LYS A H    
686  H HA   . LYS A 41  ? 0.0994 0.0994 0.0994 0.0000  0.0000  0.0000  41   LYS A HA   
687  H HB2  . LYS A 41  ? 0.1106 0.1106 0.1106 0.0000  0.0000  0.0000  41   LYS A HB2  
688  H HB3  . LYS A 41  ? 0.1106 0.1106 0.1106 0.0000  0.0000  0.0000  41   LYS A HB3  
689  H HG2  . LYS A 41  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  41   LYS A HG2  
690  H HG3  . LYS A 41  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  41   LYS A HG3  
691  H HD2  . LYS A 41  ? 0.1386 0.1386 0.1386 0.0000  0.0000  0.0000  41   LYS A HD2  
692  H HD3  . LYS A 41  ? 0.1386 0.1386 0.1386 0.0000  0.0000  0.0000  41   LYS A HD3  
693  H HE2  . LYS A 41  ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  41   LYS A HE2  
694  H HE3  . LYS A 41  ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  41   LYS A HE3  
695  H HZ1  . LYS A 41  ? 0.2069 0.2069 0.2069 0.0000  0.0000  0.0000  41   LYS A HZ1  
696  H HZ2  . LYS A 41  ? 0.2069 0.2069 0.2069 0.0000  0.0000  0.0000  41   LYS A HZ2  
697  H HZ3  . LYS A 41  ? 0.2069 0.2069 0.2069 0.0000  0.0000  0.0000  41   LYS A HZ3  
698  N N    . PRO A 42  ? 0.0827 0.0663 0.1017 0.0016  -0.0336 0.0244  42   PRO A N    
699  C CA   . PRO A 42  ? 0.0829 0.0740 0.0830 0.0040  -0.0232 0.0004  42   PRO A CA   
700  C C    . PRO A 42  ? 0.0916 0.0634 0.0739 -0.0012 -0.0204 0.0070  42   PRO A C    
701  O O    . PRO A 42  ? 0.0892 0.0686 0.1214 0.0124  -0.0137 -0.0061 42   PRO A O    
702  C CB   A PRO A 42  ? 0.1124 0.1043 0.0834 0.0029  -0.0272 -0.0236 42   PRO A CB   
703  C CB   B PRO A 42  ? 0.1287 0.1229 0.0681 -0.0366 -0.0480 0.0161  42   PRO A CB   
704  C CG   A PRO A 42  ? 0.1002 0.1390 0.0669 0.0037  -0.0295 0.0057  42   PRO A CG   
705  C CG   B PRO A 42  ? 0.1646 0.1150 0.0753 -0.0205 -0.0468 0.0529  42   PRO A CG   
706  C CD   A PRO A 42  ? 0.0800 0.0632 0.0846 0.0052  -0.0351 0.0145  42   PRO A CD   
707  C CD   B PRO A 42  ? 0.1001 0.1184 0.1102 0.0002  -0.0613 0.0318  42   PRO A CD   
708  H HA   A PRO A 42  ? 0.0960 0.0960 0.0960 0.0000  0.0000  0.0000  42   PRO A HA   
709  H HB2  A PRO A 42  ? 0.1201 0.1201 0.1201 0.0000  0.0000  0.0000  42   PRO A HB2  
710  H HB2  B PRO A 42  ? 0.1279 0.1279 0.1279 0.0000  0.0000  0.0000  42   PRO A HB2  
711  H HB3  A PRO A 42  ? 0.1201 0.1201 0.1201 0.0000  0.0000  0.0000  42   PRO A HB3  
712  H HB3  B PRO A 42  ? 0.1279 0.1279 0.1279 0.0000  0.0000  0.0000  42   PRO A HB3  
713  H HG2  A PRO A 42  ? 0.1225 0.1225 0.1225 0.0000  0.0000  0.0000  42   PRO A HG2  
714  H HG2  B PRO A 42  ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  42   PRO A HG2  
715  H HG3  A PRO A 42  ? 0.1225 0.1225 0.1225 0.0000  0.0000  0.0000  42   PRO A HG3  
716  H HG3  B PRO A 42  ? 0.1420 0.1420 0.1420 0.0000  0.0000  0.0000  42   PRO A HG3  
717  H HD2  A PRO A 42  ? 0.0912 0.0912 0.0912 0.0000  0.0000  0.0000  42   PRO A HD2  
718  H HD2  B PRO A 42  ? 0.1315 0.1315 0.1315 0.0000  0.0000  0.0000  42   PRO A HD2  
719  H HD3  A PRO A 42  ? 0.0912 0.0912 0.0912 0.0000  0.0000  0.0000  42   PRO A HD3  
720  H HD3  B PRO A 42  ? 0.1315 0.1315 0.1315 0.0000  0.0000  0.0000  42   PRO A HD3  
721  N N    . VAL A 43  ? 0.0757 0.0669 0.0676 0.0088  -0.0264 0.0075  43   VAL A N    
722  C CA   . VAL A 43  ? 0.0777 0.0812 0.0626 0.0080  -0.0263 0.0011  43   VAL A CA   
723  C C    . VAL A 43  ? 0.0808 0.0714 0.0766 0.0181  -0.0359 0.0006  43   VAL A C    
724  O O    . VAL A 43  ? 0.1169 0.1383 0.0923 0.0560  -0.0533 -0.0288 43   VAL A O    
725  C CB   A VAL A 43  ? 0.1366 0.0961 0.0689 -0.0284 -0.0454 0.0158  43   VAL A CB   
726  C CB   B VAL A 43  ? 0.0843 0.1367 0.1284 -0.0368 0.0177  -0.0236 43   VAL A CB   
727  C CG1  A VAL A 43  ? 0.3339 0.2639 0.1483 -0.1350 0.1015  -0.0811 43   VAL A CG1  
728  C CG1  B VAL A 43  ? 0.1158 0.2664 0.0888 -0.1102 -0.0343 0.0330  43   VAL A CG1  
729  C CG2  A VAL A 43  ? 0.1418 0.1009 0.1848 -0.0274 -0.0346 0.0493  43   VAL A CG2  
730  C CG2  B VAL A 43  ? 0.1207 0.1065 0.0813 -0.0387 -0.0055 0.0029  43   VAL A CG2  
731  H H    . VAL A 43  ? 0.0841 0.0841 0.0841 0.0000  0.0000  0.0000  43   VAL A H    
732  H HA   A VAL A 43  ? 0.0887 0.0887 0.0887 0.0000  0.0000  0.0000  43   VAL A HA   
733  H HB   A VAL A 43  ? 0.1206 0.1206 0.1206 0.0000  0.0000  0.0000  43   VAL A HB   
734  H HB   B VAL A 43  ? 0.1397 0.1397 0.1397 0.0000  0.0000  0.0000  43   VAL A HB   
735  H HG11 A VAL A 43  ? 0.3730 0.3730 0.3730 0.0000  0.0000  0.0000  43   VAL A HG11 
736  H HG11 B VAL A 43  ? 0.2354 0.2354 0.2354 0.0000  0.0000  0.0000  43   VAL A HG11 
737  H HG12 A VAL A 43  ? 0.3730 0.3730 0.3730 0.0000  0.0000  0.0000  43   VAL A HG12 
738  H HG12 B VAL A 43  ? 0.2354 0.2354 0.2354 0.0000  0.0000  0.0000  43   VAL A HG12 
739  H HG13 A VAL A 43  ? 0.3730 0.3730 0.3730 0.0000  0.0000  0.0000  43   VAL A HG13 
740  H HG13 B VAL A 43  ? 0.2354 0.2354 0.2354 0.0000  0.0000  0.0000  43   VAL A HG13 
741  H HG21 A VAL A 43  ? 0.2138 0.2138 0.2138 0.0000  0.0000  0.0000  43   VAL A HG21 
742  H HG21 B VAL A 43  ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  43   VAL A HG21 
743  H HG22 A VAL A 43  ? 0.2138 0.2138 0.2138 0.0000  0.0000  0.0000  43   VAL A HG22 
744  H HG22 B VAL A 43  ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  43   VAL A HG22 
745  H HG23 A VAL A 43  ? 0.2138 0.2138 0.2138 0.0000  0.0000  0.0000  43   VAL A HG23 
746  H HG23 B VAL A 43  ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  43   VAL A HG23 
747  N N    . ASN A 44  ? 0.0752 0.0525 0.0673 0.0005  -0.0273 0.0021  44   ASN A N    
748  C CA   . ASN A 44  ? 0.0837 0.0439 0.0730 0.0021  -0.0324 0.0015  44   ASN A CA   
749  C C    . ASN A 44  ? 0.0827 0.0398 0.0940 0.0053  -0.0440 -0.0038 44   ASN A C    
750  O O    . ASN A 44  ? 0.1477 0.0481 0.2100 0.0201  -0.1122 -0.0284 44   ASN A O    
751  C CB   . ASN A 44  ? 0.1039 0.0484 0.0688 -0.0084 -0.0156 -0.0042 44   ASN A CB   
752  C CG   . ASN A 44  ? 0.1104 0.0537 0.0795 -0.0059 -0.0241 -0.0071 44   ASN A CG   
753  O OD1  . ASN A 44  ? 0.1643 0.0676 0.1185 0.0364  -0.0430 -0.0103 44   ASN A OD1  
754  N ND2  . ASN A 44  ? 0.0979 0.0688 0.0695 0.0076  -0.0152 -0.0160 44   ASN A ND2  
755  H H    . ASN A 44  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  44   ASN A H    
756  H HA   . ASN A 44  ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  44   ASN A HA   
757  H HB2  . ASN A 44  ? 0.0884 0.0884 0.0884 0.0000  0.0000  0.0000  44   ASN A HB2  
758  H HB3  . ASN A 44  ? 0.0884 0.0884 0.0884 0.0000  0.0000  0.0000  44   ASN A HB3  
759  H HD21 . ASN A 44  ? 0.0945 0.0945 0.0945 0.0000  0.0000  0.0000  44   ASN A HD21 
760  H HD22 . ASN A 44  ? 0.0945 0.0945 0.0945 0.0000  0.0000  0.0000  44   ASN A HD22 
761  N N    . THR A 45  ? 0.0698 0.0426 0.0658 0.0063  -0.0203 0.0021  45   THR A N    
762  C CA   . THR A 45  ? 0.0638 0.0405 0.0633 0.0045  -0.0248 -0.0004 45   THR A CA   
763  C C    . THR A 45  ? 0.0600 0.0351 0.0653 -0.0036 -0.0223 -0.0053 45   THR A C    
764  O O    . THR A 45  ? 0.0737 0.0533 0.0746 0.0171  -0.0235 -0.0124 45   THR A O    
765  C CB   . THR A 45  ? 0.0719 0.0514 0.0843 -0.0035 -0.0107 0.0079  45   THR A CB   
766  O OG1  . THR A 45  ? 0.0923 0.0876 0.0782 -0.0072 -0.0018 0.0153  45   THR A OG1  
767  C CG2  . THR A 45  ? 0.0730 0.0545 0.1025 -0.0056 -0.0149 0.0112  45   THR A CG2  
768  H H    . THR A 45  ? 0.0713 0.0713 0.0713 0.0000  0.0000  0.0000  45   THR A H    
769  H HA   . THR A 45  ? 0.0670 0.0670 0.0670 0.0000  0.0000  0.0000  45   THR A HA   
770  H HB   . THR A 45  ? 0.0830 0.0830 0.0830 0.0000  0.0000  0.0000  45   THR A HB   
771  H HG1  . THR A 45  ? 0.1291 0.1291 0.1291 0.0000  0.0000  0.0000  45   THR A HG1  
772  H HG21 . THR A 45  ? 0.1150 0.1150 0.1150 0.0000  0.0000  0.0000  45   THR A HG21 
773  H HG22 . THR A 45  ? 0.1150 0.1150 0.1150 0.0000  0.0000  0.0000  45   THR A HG22 
774  H HG23 . THR A 45  ? 0.1150 0.1150 0.1150 0.0000  0.0000  0.0000  45   THR A HG23 
775  N N    . PHE A 46  ? 0.0555 0.0373 0.0557 -0.0001 -0.0179 -0.0026 46   PHE A N    
776  C CA   . PHE A 46  ? 0.0530 0.0427 0.0638 -0.0051 -0.0231 -0.0065 46   PHE A CA   
777  C C    . PHE A 46  ? 0.0520 0.0366 0.0613 -0.0011 -0.0210 -0.0029 46   PHE A C    
778  O O    . PHE A 46  ? 0.0513 0.0521 0.0807 0.0009  -0.0179 -0.0147 46   PHE A O    
779  C CB   . PHE A 46  ? 0.0540 0.0489 0.0635 -0.0074 -0.0192 -0.0007 46   PHE A CB   
780  C CG   . PHE A 46  ? 0.0629 0.0490 0.0692 -0.0101 -0.0133 0.0025  46   PHE A CG   
781  C CD1  . PHE A 46  ? 0.0713 0.0531 0.1025 -0.0123 0.0005  -0.0017 46   PHE A CD1  
782  C CD2  . PHE A 46  ? 0.0749 0.0479 0.0718 -0.0146 -0.0264 0.0020  46   PHE A CD2  
783  C CE1  . PHE A 46  ? 0.0721 0.0714 0.1362 -0.0122 0.0089  0.0152  46   PHE A CE1  
784  C CE2  . PHE A 46  ? 0.0804 0.0526 0.1007 -0.0200 -0.0372 0.0117  46   PHE A CE2  
785  C CZ   . PHE A 46  ? 0.0691 0.0713 0.1163 -0.0206 -0.0271 0.0190  46   PHE A CZ   
786  H H    . PHE A 46  ? 0.0594 0.0594 0.0594 0.0000  0.0000  0.0000  46   PHE A H    
787  H HA   . PHE A 46  ? 0.0638 0.0638 0.0638 0.0000  0.0000  0.0000  46   PHE A HA   
788  H HB2  . PHE A 46  ? 0.0666 0.0666 0.0666 0.0000  0.0000  0.0000  46   PHE A HB2  
789  H HB3  . PHE A 46  ? 0.0666 0.0666 0.0666 0.0000  0.0000  0.0000  46   PHE A HB3  
790  H HD1  . PHE A 46  ? 0.0907 0.0907 0.0907 0.0000  0.0000  0.0000  46   PHE A HD1  
791  H HD2  . PHE A 46  ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  46   PHE A HD2  
792  H HE1  . PHE A 46  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  46   PHE A HE1  
793  H HE2  . PHE A 46  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  46   PHE A HE2  
794  H HZ   . PHE A 46  ? 0.1027 0.1027 0.1027 0.0000  0.0000  0.0000  46   PHE A HZ   
795  N N    . VAL A 47  ? 0.0492 0.0444 0.0622 -0.0027 -0.0163 -0.0090 47   VAL A N    
796  C CA   . VAL A 47  ? 0.0535 0.0333 0.0572 -0.0001 -0.0224 -0.0028 47   VAL A CA   
797  C C    . VAL A 47  ? 0.0522 0.0287 0.0579 -0.0028 -0.0192 -0.0020 47   VAL A C    
798  O O    . VAL A 47  ? 0.0561 0.0438 0.0618 0.0004  -0.0119 -0.0013 47   VAL A O    
799  C CB   . VAL A 47  ? 0.0596 0.0336 0.0652 0.0043  -0.0193 -0.0014 47   VAL A CB   
800  C CG1  . VAL A 47  ? 0.0837 0.0351 0.0765 -0.0039 -0.0263 -0.0054 47   VAL A CG1  
801  C CG2  . VAL A 47  ? 0.0786 0.0490 0.0739 0.0060  -0.0260 0.0101  47   VAL A CG2  
802  H H    . VAL A 47  ? 0.0623 0.0623 0.0623 0.0000  0.0000  0.0000  47   VAL A H    
803  H HA   . VAL A 47  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  47   VAL A HA   
804  H HB   . VAL A 47  ? 0.0633 0.0633 0.0633 0.0000  0.0000  0.0000  47   VAL A HB   
805  H HG11 . VAL A 47  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  47   VAL A HG11 
806  H HG12 . VAL A 47  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  47   VAL A HG12 
807  H HG13 . VAL A 47  ? 0.0976 0.0976 0.0976 0.0000  0.0000  0.0000  47   VAL A HG13 
808  H HG21 . VAL A 47  ? 0.1008 0.1008 0.1008 0.0000  0.0000  0.0000  47   VAL A HG21 
809  H HG22 . VAL A 47  ? 0.1008 0.1008 0.1008 0.0000  0.0000  0.0000  47   VAL A HG22 
810  H HG23 . VAL A 47  ? 0.1008 0.1008 0.1008 0.0000  0.0000  0.0000  47   VAL A HG23 
811  N N    . HIS A 48  ? 0.0488 0.0367 0.0533 -0.0003 -0.0174 0.0032  48   HIS A N    
812  C CA   . HIS A 48  ? 0.0603 0.0349 0.0562 -0.0045 -0.0259 0.0038  48   HIS A CA   
813  C C    . HIS A 48  ? 0.0592 0.0360 0.0653 -0.0059 -0.0247 0.0020  48   HIS A C    
814  O O    . HIS A 48  ? 0.0630 0.0521 0.0805 -0.0017 -0.0265 -0.0073 48   HIS A O    
815  C CB   . HIS A 48  ? 0.0658 0.0368 0.0652 -0.0018 -0.0260 0.0060  48   HIS A CB   
816  C CG   . HIS A 48  ? 0.0774 0.0304 0.0603 -0.0024 -0.0230 0.0051  48   HIS A CG   
817  N ND1  . HIS A 48  ? 0.0829 0.0462 0.0710 -0.0142 -0.0140 -0.0043 48   HIS A ND1  
818  C CD2  . HIS A 48  ? 0.0785 0.0424 0.0726 0.0070  -0.0151 -0.0024 48   HIS A CD2  
819  C CE1  . HIS A 48  ? 0.0944 0.0547 0.0817 -0.0210 -0.0169 -0.0087 48   HIS A CE1  
820  N NE2  . HIS A 48  ? 0.0961 0.0511 0.0692 -0.0059 -0.0228 -0.0075 48   HIS A NE2  
821  H H    . HIS A 48  ? 0.0555 0.0555 0.0555 0.0000  0.0000  0.0000  48   HIS A H    
822  H HA   . HIS A 48  ? 0.0605 0.0605 0.0605 0.0000  0.0000  0.0000  48   HIS A HA   
823  H HB2  . HIS A 48  ? 0.0671 0.0671 0.0671 0.0000  0.0000  0.0000  48   HIS A HB2  
824  H HB3  . HIS A 48  ? 0.0671 0.0671 0.0671 0.0000  0.0000  0.0000  48   HIS A HB3  
825  H HD1  . HIS A 48  ? 0.0800 0.0800 0.0800 0.0000  0.0000  0.0000  48   HIS A HD1  
826  H HD2  . HIS A 48  ? 0.0774 0.0774 0.0774 0.0000  0.0000  0.0000  48   HIS A HD2  
827  H HE1  . HIS A 48  ? 0.0923 0.0923 0.0923 0.0000  0.0000  0.0000  48   HIS A HE1  
828  N N    . GLU A 49  ? 0.0564 0.0473 0.0665 0.0026  -0.0255 -0.0093 49   GLU A N    
829  C CA   . GLU A 49  ? 0.0690 0.0395 0.0611 0.0043  -0.0220 -0.0028 49   GLU A CA   
830  C C    . GLU A 49  ? 0.0604 0.0377 0.0668 0.0038  -0.0229 -0.0024 49   GLU A C    
831  O O    . GLU A 49  ? 0.0672 0.0580 0.0835 -0.0093 -0.0198 -0.0172 49   GLU A O    
832  C CB   . GLU A 49  ? 0.0719 0.0413 0.0767 0.0015  -0.0157 -0.0009 49   GLU A CB   
833  C CG   . GLU A 49  ? 0.0765 0.0540 0.0679 -0.0012 -0.0103 0.0009  49   GLU A CG   
834  C CD   . GLU A 49  ? 0.0761 0.0596 0.0795 -0.0070 -0.0028 -0.0187 49   GLU A CD   
835  O OE1  . GLU A 49  ? 0.0752 0.1295 0.1034 0.0096  -0.0186 -0.0592 49   GLU A OE1  
836  O OE2  . GLU A 49  ? 0.0775 0.0709 0.0836 -0.0131 0.0009  -0.0156 49   GLU A OE2  
837  H H    . GLU A 49  ? 0.0680 0.0680 0.0680 0.0000  0.0000  0.0000  49   GLU A H    
838  H HA   . GLU A 49  ? 0.0679 0.0679 0.0679 0.0000  0.0000  0.0000  49   GLU A HA   
839  H HB2  . GLU A 49  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  49   GLU A HB2  
840  H HB3  . GLU A 49  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  49   GLU A HB3  
841  H HG2  . GLU A 49  ? 0.0793 0.0793 0.0793 0.0000  0.0000  0.0000  49   GLU A HG2  
842  H HG3  . GLU A 49  ? 0.0793 0.0793 0.0793 0.0000  0.0000  0.0000  49   GLU A HG3  
843  N N    . SER A 50  ? 0.0657 0.0384 0.0605 -0.0024 -0.0190 -0.0049 50   SER A N    
844  C CA   . SER A 50  ? 0.0710 0.0379 0.0697 -0.0055 -0.0067 -0.0035 50   SER A CA   
845  C C    . SER A 50  ? 0.0755 0.0443 0.0555 -0.0113 -0.0157 -0.0085 50   SER A C    
846  O O    . SER A 50  ? 0.0839 0.0443 0.0601 -0.0008 -0.0129 0.0000  50   SER A O    
847  C CB   A SER A 50  ? 0.1091 0.0426 0.0464 0.0110  -0.0282 -0.0068 50   SER A CB   
848  C CB   B SER A 50  ? 0.0756 0.0534 0.0742 -0.0188 -0.0093 0.0046  50   SER A CB   
849  O OG   A SER A 50  ? 0.0925 0.0573 0.0598 0.0179  -0.0217 -0.0113 50   SER A OG   
850  O OG   B SER A 50  ? 0.1054 0.0441 0.0895 -0.0084 -0.0366 -0.0018 50   SER A OG   
851  H H    . SER A 50  ? 0.0659 0.0659 0.0659 0.0000  0.0000  0.0000  50   SER A H    
852  H HA   A SER A 50  ? 0.0714 0.0714 0.0714 0.0000  0.0000  0.0000  50   SER A HA   
853  H HB2  A SER A 50  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  50   SER A HB2  
854  H HB2  B SER A 50  ? 0.0813 0.0813 0.0813 0.0000  0.0000  0.0000  50   SER A HB2  
855  H HB3  A SER A 50  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  50   SER A HB3  
856  H HB3  B SER A 50  ? 0.0813 0.0813 0.0813 0.0000  0.0000  0.0000  50   SER A HB3  
857  H HG   A SER A 50  ? 0.1049 0.1049 0.1049 0.0000  0.0000  0.0000  50   SER A HG   
858  H HG   B SER A 50  ? 0.1196 0.1196 0.1196 0.0000  0.0000  0.0000  50   SER A HG   
859  N N    . LEU A 51  ? 0.0790 0.0548 0.0782 -0.0115 -0.0155 -0.0001 51   LEU A N    
860  C CA   . LEU A 51  ? 0.0702 0.0673 0.1082 -0.0019 -0.0189 -0.0059 51   LEU A CA   
861  C C    . LEU A 51  ? 0.0753 0.0525 0.0758 0.0122  -0.0149 0.0059  51   LEU A C    
862  O O    . LEU A 51  ? 0.0717 0.0744 0.0785 0.0098  -0.0176 0.0111  51   LEU A O    
863  C CB   . LEU A 51  ? 0.0755 0.1017 0.1684 -0.0059 -0.0038 0.0038  51   LEU A CB   
864  C CG   . LEU A 51  ? 0.0983 0.1246 0.2219 0.0275  -0.0190 -0.0535 51   LEU A CG   
865  C CD1  . LEU A 51  ? 0.1401 0.2093 0.2443 0.0807  -0.1159 -0.0819 51   LEU A CD1  
866  C CD2  . LEU A 51  ? 0.1021 0.1823 0.2972 0.0231  0.0113  -0.0788 51   LEU A CD2  
867  H H    . LEU A 51  ? 0.0847 0.0847 0.0847 0.0000  0.0000  0.0000  51   LEU A H    
868  H HA   . LEU A 51  ? 0.0983 0.0983 0.0983 0.0000  0.0000  0.0000  51   LEU A HA   
869  H HB2  . LEU A 51  ? 0.1382 0.1382 0.1382 0.0000  0.0000  0.0000  51   LEU A HB2  
870  H HB3  . LEU A 51  ? 0.1382 0.1382 0.1382 0.0000  0.0000  0.0000  51   LEU A HB3  
871  H HG   . LEU A 51  ? 0.1779 0.1779 0.1779 0.0000  0.0000  0.0000  51   LEU A HG   
872  H HD11 . LEU A 51  ? 0.2969 0.2969 0.2969 0.0000  0.0000  0.0000  51   LEU A HD11 
873  H HD12 . LEU A 51  ? 0.2969 0.2969 0.2969 0.0000  0.0000  0.0000  51   LEU A HD12 
874  H HD13 . LEU A 51  ? 0.2969 0.2969 0.2969 0.0000  0.0000  0.0000  51   LEU A HD13 
875  H HD21 . LEU A 51  ? 0.2908 0.2908 0.2908 0.0000  0.0000  0.0000  51   LEU A HD21 
876  H HD22 . LEU A 51  ? 0.2908 0.2908 0.2908 0.0000  0.0000  0.0000  51   LEU A HD22 
877  H HD23 . LEU A 51  ? 0.2908 0.2908 0.2908 0.0000  0.0000  0.0000  51   LEU A HD23 
878  N N    . ALA A 52  ? 0.1013 0.0441 0.0685 0.0015  -0.0137 0.0010  52   ALA A N    
879  C CA   . ALA A 52  ? 0.0907 0.0427 0.0777 0.0057  -0.0100 -0.0045 52   ALA A CA   
880  C C    . ALA A 52  ? 0.0987 0.0434 0.0619 0.0007  -0.0217 -0.0017 52   ALA A C    
881  O O    . ALA A 52  ? 0.1179 0.0403 0.0628 0.0020  -0.0170 -0.0005 52   ALA A O    
882  C CB   . ALA A 52  ? 0.1170 0.0661 0.0654 -0.0067 -0.0153 0.0000  52   ALA A CB   
883  H H    . ALA A 52  ? 0.0856 0.0856 0.0856 0.0000  0.0000  0.0000  52   ALA A H    
884  H HA   . ALA A 52  ? 0.0845 0.0845 0.0845 0.0000  0.0000  0.0000  52   ALA A HA   
885  H HB1  . ALA A 52  ? 0.1242 0.1242 0.1242 0.0000  0.0000  0.0000  52   ALA A HB1  
886  H HB2  . ALA A 52  ? 0.1242 0.1242 0.1242 0.0000  0.0000  0.0000  52   ALA A HB2  
887  H HB3  . ALA A 52  ? 0.1242 0.1242 0.1242 0.0000  0.0000  0.0000  52   ALA A HB3  
888  N N    . ASP A 53  ? 0.0994 0.0359 0.0636 -0.0002 -0.0277 -0.0003 53   ASP A N    
889  C CA   . ASP A 53  ? 0.0803 0.0437 0.0638 -0.0057 -0.0246 0.0015  53   ASP A CA   
890  C C    . ASP A 53  ? 0.0668 0.0408 0.0674 0.0017  -0.0258 -0.0056 53   ASP A C    
891  O O    . ASP A 53  ? 0.0827 0.0473 0.0720 -0.0102 -0.0249 0.0081  53   ASP A O    
892  C CB   . ASP A 53  ? 0.0779 0.0480 0.0786 -0.0037 -0.0293 -0.0014 53   ASP A CB   
893  C CG   . ASP A 53  ? 0.0933 0.0547 0.0961 0.0029  -0.0403 -0.0171 53   ASP A CG   
894  O OD1  . ASP A 53  ? 0.0868 0.0662 0.1231 -0.0022 -0.0236 -0.0067 53   ASP A OD1  
895  O OD2  . ASP A 53  ? 0.1216 0.0580 0.1101 0.0055  -0.0595 -0.0056 53   ASP A OD2  
896  H H    . ASP A 53  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  53   ASP A H    
897  H HA   . ASP A 53  ? 0.0751 0.0751 0.0751 0.0000  0.0000  0.0000  53   ASP A HA   
898  H HB2  . ASP A 53  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  53   ASP A HB2  
899  H HB3  . ASP A 53  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  53   ASP A HB3  
900  N N    . VAL A 54  ? 0.0691 0.0385 0.0641 -0.0009 -0.0269 0.0000  54   VAL A N    
901  C CA   . VAL A 54  ? 0.0618 0.0484 0.0574 0.0031  -0.0225 -0.0104 54   VAL A CA   
902  C C    . VAL A 54  ? 0.0722 0.0509 0.0540 0.0058  -0.0204 -0.0025 54   VAL A C    
903  O O    . VAL A 54  ? 0.0703 0.0621 0.0561 0.0051  -0.0183 -0.0013 54   VAL A O    
904  C CB   . VAL A 54  ? 0.0617 0.0496 0.0716 0.0021  -0.0148 -0.0094 54   VAL A CB   
905  C CG1  . VAL A 54  ? 0.0733 0.0799 0.0783 0.0000  -0.0299 -0.0107 54   VAL A CG1  
906  C CG2  . VAL A 54  ? 0.0676 0.0527 0.0828 0.0008  -0.0256 -0.0178 54   VAL A CG2  
907  H H    . VAL A 54  ? 0.0686 0.0686 0.0686 0.0000  0.0000  0.0000  54   VAL A H    
908  H HA   . VAL A 54  ? 0.0670 0.0670 0.0670 0.0000  0.0000  0.0000  54   VAL A HA   
909  H HB   . VAL A 54  ? 0.0732 0.0732 0.0732 0.0000  0.0000  0.0000  54   VAL A HB   
910  H HG11 . VAL A 54  ? 0.1158 0.1158 0.1158 0.0000  0.0000  0.0000  54   VAL A HG11 
911  H HG12 . VAL A 54  ? 0.1158 0.1158 0.1158 0.0000  0.0000  0.0000  54   VAL A HG12 
912  H HG13 . VAL A 54  ? 0.1158 0.1158 0.1158 0.0000  0.0000  0.0000  54   VAL A HG13 
913  H HG21 . VAL A 54  ? 0.1016 0.1016 0.1016 0.0000  0.0000  0.0000  54   VAL A HG21 
914  H HG22 . VAL A 54  ? 0.1016 0.1016 0.1016 0.0000  0.0000  0.0000  54   VAL A HG22 
915  H HG23 . VAL A 54  ? 0.1016 0.1016 0.1016 0.0000  0.0000  0.0000  54   VAL A HG23 
916  N N    . GLN A 55  ? 0.0830 0.0526 0.0597 0.0185  -0.0074 0.0024  55   GLN A N    
917  C CA   . GLN A 55  ? 0.0885 0.0609 0.0686 0.0243  -0.0109 0.0050  55   GLN A CA   
918  C C    . GLN A 55  ? 0.0913 0.0560 0.0640 0.0271  -0.0108 0.0008  55   GLN A C    
919  O O    . GLN A 55  ? 0.0998 0.0616 0.0752 0.0374  -0.0152 0.0139  55   GLN A O    
920  C CB   . GLN A 55  ? 0.0971 0.0680 0.0822 0.0285  0.0070  0.0008  55   GLN A CB   
921  C CG   . GLN A 55  ? 0.0796 0.1080 0.0821 0.0246  -0.0094 0.0188  55   GLN A CG   
922  C CD   . GLN A 55  ? 0.0604 0.1578 0.1534 -0.0102 0.0009  -0.0274 55   GLN A CD   
923  O OE1  . GLN A 55  ? 0.0979 0.3074 0.0944 -0.0550 0.0067  -0.0211 55   GLN A OE1  
924  N NE2  . GLN A 55  ? 0.0795 0.3167 0.1108 -0.0230 -0.0019 0.0206  55   GLN A NE2  
925  H H    . GLN A 55  ? 0.0781 0.0781 0.0781 0.0000  0.0000  0.0000  55   GLN A H    
926  H HA   . GLN A 55  ? 0.0873 0.0873 0.0873 0.0000  0.0000  0.0000  55   GLN A HA   
927  H HB2  . GLN A 55  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  55   GLN A HB2  
928  H HB3  . GLN A 55  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  55   GLN A HB3  
929  H HG2  . GLN A 55  ? 0.1079 0.1079 0.1079 0.0000  0.0000  0.0000  55   GLN A HG2  
930  H HG3  . GLN A 55  ? 0.1079 0.1079 0.1079 0.0000  0.0000  0.0000  55   GLN A HG3  
931  H HE21 . GLN A 55  ? 0.2028 0.2028 0.2028 0.0000  0.0000  0.0000  55   GLN A HE21 
932  H HE22 . GLN A 55  ? 0.2028 0.2028 0.2028 0.0000  0.0000  0.0000  55   GLN A HE22 
933  N N    . ALA A 56  ? 0.0928 0.0454 0.0560 0.0236  -0.0240 0.0014  56   ALA A N    
934  C CA   . ALA A 56  ? 0.0917 0.0402 0.0627 0.0194  -0.0282 -0.0064 56   ALA A CA   
935  C C    . ALA A 56  ? 0.0736 0.0446 0.0636 0.0147  -0.0263 -0.0042 56   ALA A C    
936  O O    . ALA A 56  ? 0.0806 0.0387 0.0741 0.0102  -0.0299 -0.0004 56   ALA A O    
937  C CB   . ALA A 56  ? 0.1021 0.0622 0.0732 0.0145  -0.0372 0.0002  56   ALA A CB   
938  H H    . ALA A 56  ? 0.0776 0.0776 0.0776 0.0000  0.0000  0.0000  56   ALA A H    
939  H HA   . ALA A 56  ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  56   ALA A HA   
940  H HB1  . ALA A 56  ? 0.1187 0.1187 0.1187 0.0000  0.0000  0.0000  56   ALA A HB1  
941  H HB2  . ALA A 56  ? 0.1187 0.1187 0.1187 0.0000  0.0000  0.0000  56   ALA A HB2  
942  H HB3  . ALA A 56  ? 0.1187 0.1187 0.1187 0.0000  0.0000  0.0000  56   ALA A HB3  
943  N N    . VAL A 57  ? 0.0765 0.0415 0.0575 0.0102  -0.0230 -0.0026 57   VAL A N    
944  C CA   . VAL A 57  ? 0.0649 0.0419 0.0554 0.0053  -0.0205 -0.0010 57   VAL A CA   
945  C C    . VAL A 57  ? 0.0676 0.0416 0.0608 0.0057  -0.0241 -0.0045 57   VAL A C    
946  O O    . VAL A 57  ? 0.0724 0.0442 0.0568 0.0048  -0.0164 0.0028  57   VAL A O    
947  C CB   . VAL A 57  ? 0.0704 0.0453 0.0543 0.0027  -0.0164 -0.0033 57   VAL A CB   
948  C CG1  . VAL A 57  ? 0.0681 0.0481 0.0608 0.0032  -0.0146 -0.0019 57   VAL A CG1  
949  C CG2  . VAL A 57  ? 0.0758 0.0423 0.0661 0.0106  -0.0151 -0.0001 57   VAL A CG2  
950  H H    . VAL A 57  ? 0.0702 0.0702 0.0702 0.0000  0.0000  0.0000  57   VAL A H    
951  H HA   . VAL A 57  ? 0.0648 0.0648 0.0648 0.0000  0.0000  0.0000  57   VAL A HA   
952  H HB   . VAL A 57  ? 0.0680 0.0680 0.0680 0.0000  0.0000  0.0000  57   VAL A HB   
953  H HG11 . VAL A 57  ? 0.0885 0.0885 0.0885 0.0000  0.0000  0.0000  57   VAL A HG11 
954  H HG12 . VAL A 57  ? 0.0885 0.0885 0.0885 0.0000  0.0000  0.0000  57   VAL A HG12 
955  H HG13 . VAL A 57  ? 0.0885 0.0885 0.0885 0.0000  0.0000  0.0000  57   VAL A HG13 
956  H HG21 . VAL A 57  ? 0.0921 0.0921 0.0921 0.0000  0.0000  0.0000  57   VAL A HG21 
957  H HG22 . VAL A 57  ? 0.0921 0.0921 0.0921 0.0000  0.0000  0.0000  57   VAL A HG22 
958  H HG23 . VAL A 57  ? 0.0921 0.0921 0.0921 0.0000  0.0000  0.0000  57   VAL A HG23 
959  N N    . CYS A 58  ? 0.0630 0.0464 0.0661 0.0075  -0.0187 0.0094  58   CYS A N    
960  C CA   . CYS A 58  ? 0.0664 0.0490 0.0733 0.0143  -0.0206 0.0079  58   CYS A CA   
961  C C    . CYS A 58  ? 0.0733 0.0450 0.0735 0.0097  -0.0198 0.0034  58   CYS A C    
962  O O    . CYS A 58  ? 0.0814 0.0483 0.0894 0.0143  -0.0324 0.0083  58   CYS A O    
963  C CB   . CYS A 58  ? 0.0685 0.0680 0.0785 0.0183  -0.0119 0.0109  58   CYS A CB   
964  S SG   . CYS A 58  ? 0.0680 0.0753 0.0970 0.0018  -0.0055 0.0224  58   CYS A SG   
965  H H    . CYS A 58  ? 0.0702 0.0702 0.0702 0.0000  0.0000  0.0000  58   CYS A H    
966  H HA   . CYS A 58  ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  58   CYS A HA   
967  H HB2  . CYS A 58  ? 0.0860 0.0860 0.0860 0.0000  0.0000  0.0000  58   CYS A HB2  
968  H HB3  . CYS A 58  ? 0.0860 0.0860 0.0860 0.0000  0.0000  0.0000  58   CYS A HB3  
969  N N    . SER A 59  ? 0.0625 0.0427 0.0755 0.0096  -0.0209 0.0084  59   SER A N    
970  C CA   . SER A 59  ? 0.0673 0.0403 0.0747 0.0115  -0.0210 0.0000  59   SER A CA   
971  C C    . SER A 59  ? 0.0691 0.0345 0.0753 0.0065  -0.0155 -0.0010 59   SER A C    
972  O O    . SER A 59  ? 0.0835 0.0430 0.0924 0.0008  -0.0083 -0.0077 59   SER A O    
973  C CB   A SER A 59  ? 0.0732 0.0599 0.0728 0.0066  -0.0053 0.0024  59   SER A CB   
974  C CB   B SER A 59  ? 0.0903 0.0388 0.0717 -0.0023 -0.0262 -0.0098 59   SER A CB   
975  O OG   A SER A 59  ? 0.1554 0.0926 0.0818 -0.0440 -0.0645 0.0279  59   SER A OG   
976  O OG   B SER A 59  ? 0.1091 0.0768 0.0831 0.0014  0.0019  -0.0136 59   SER A OG   
977  H H    . SER A 59  ? 0.0722 0.0722 0.0722 0.0000  0.0000  0.0000  59   SER A H    
978  H HA   A SER A 59  ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  59   SER A HA   
979  H HB2  A SER A 59  ? 0.0823 0.0823 0.0823 0.0000  0.0000  0.0000  59   SER A HB2  
980  H HB2  B SER A 59  ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  59   SER A HB2  
981  H HB3  A SER A 59  ? 0.0823 0.0823 0.0823 0.0000  0.0000  0.0000  59   SER A HB3  
982  H HB3  B SER A 59  ? 0.0803 0.0803 0.0803 0.0000  0.0000  0.0000  59   SER A HB3  
983  H HG   A SER A 59  ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  59   SER A HG   
984  H HG   B SER A 59  ? 0.1345 0.1345 0.1345 0.0000  0.0000  0.0000  59   SER A HG   
985  N N    . GLN A 60  ? 0.0673 0.0368 0.0769 0.0066  -0.0191 -0.0023 60   GLN A N    
986  C CA   . GLN A 60  ? 0.0668 0.0400 0.0726 0.0055  -0.0205 0.0034  60   GLN A CA   
987  C C    . GLN A 60  ? 0.0621 0.0513 0.0753 0.0040  -0.0155 0.0043  60   GLN A C    
988  O O    . GLN A 60  ? 0.1108 0.0465 0.0891 0.0164  -0.0162 0.0124  60   GLN A O    
989  C CB   . GLN A 60  ? 0.0711 0.0430 0.0642 0.0090  -0.0187 -0.0032 60   GLN A CB   
990  C CG   . GLN A 60  ? 0.0820 0.0464 0.0694 0.0110  -0.0203 -0.0055 60   GLN A CG   
991  C CD   . GLN A 60  ? 0.0789 0.0501 0.0704 0.0143  -0.0212 -0.0016 60   GLN A CD   
992  O OE1  . GLN A 60  ? 0.0719 0.0435 0.0712 0.0097  -0.0154 -0.0036 60   GLN A OE1  
993  N NE2  . GLN A 60  ? 0.1080 0.0742 0.0798 0.0280  -0.0153 -0.0030 60   GLN A NE2  
994  H H    . GLN A 60  ? 0.0724 0.0724 0.0724 0.0000  0.0000  0.0000  60   GLN A H    
995  H HA   . GLN A 60  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  60   GLN A HA   
996  H HB2  . GLN A 60  ? 0.0713 0.0713 0.0713 0.0000  0.0000  0.0000  60   GLN A HB2  
997  H HB3  . GLN A 60  ? 0.0713 0.0713 0.0713 0.0000  0.0000  0.0000  60   GLN A HB3  
998  H HG2  . GLN A 60  ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  60   GLN A HG2  
999  H HG3  . GLN A 60  ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  60   GLN A HG3  
1000 H HE21 . GLN A 60  ? 0.1049 0.1049 0.1049 0.0000  0.0000  0.0000  60   GLN A HE21 
1001 H HE22 . GLN A 60  ? 0.1049 0.1049 0.1049 0.0000  0.0000  0.0000  60   GLN A HE22 
1002 N N    . LYS A 61  ? 0.0657 0.0531 0.0708 0.0014  -0.0205 -0.0004 61   LYS A N    
1003 C CA   . LYS A 61  ? 0.0711 0.0562 0.0732 -0.0030 -0.0161 0.0085  61   LYS A CA   
1004 C C    . LYS A 61  ? 0.0662 0.0512 0.0716 -0.0065 -0.0133 0.0074  61   LYS A C    
1005 O O    . LYS A 61  ? 0.0702 0.0469 0.1091 -0.0050 -0.0268 0.0134  61   LYS A O    
1006 C CB   . LYS A 61  ? 0.0747 0.0913 0.0885 0.0015  -0.0129 -0.0068 61   LYS A CB   
1007 C CG   . LYS A 61  ? 0.0889 0.1670 0.0967 -0.0101 -0.0048 0.0131  61   LYS A CG   
1008 C CD   . LYS A 61  ? 0.1697 0.2418 0.1220 0.0513  0.0338  -0.0047 61   LYS A CD   
1009 C CE   . LYS A 61  ? 0.2261 0.4330 0.1377 0.0235  0.0787  -0.0018 61   LYS A CE   
1010 N NZ   . LYS A 61  ? 0.3886 0.3840 0.2807 -0.0955 0.1313  -0.1905 61   LYS A NZ   
1011 H H    . LYS A 61  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  61   LYS A H    
1012 H HA   . LYS A 61  ? 0.0802 0.0802 0.0802 0.0000  0.0000  0.0000  61   LYS A HA   
1013 H HB2  . LYS A 61  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  61   LYS A HB2  
1014 H HB3  . LYS A 61  ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  61   LYS A HB3  
1015 H HG2  . LYS A 61  ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  61   LYS A HG2  
1016 H HG3  . LYS A 61  ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  61   LYS A HG3  
1017 H HD2  . LYS A 61  ? 0.2134 0.2134 0.2134 0.0000  0.0000  0.0000  61   LYS A HD2  
1018 H HD3  . LYS A 61  ? 0.2134 0.2134 0.2134 0.0000  0.0000  0.0000  61   LYS A HD3  
1019 H HE2  . LYS A 61  ? 0.3187 0.3187 0.3187 0.0000  0.0000  0.0000  61   LYS A HE2  
1020 H HE3  . LYS A 61  ? 0.3187 0.3187 0.3187 0.0000  0.0000  0.0000  61   LYS A HE3  
1021 H HZ1  . LYS A 61  ? 0.5267 0.5267 0.5267 0.0000  0.0000  0.0000  61   LYS A HZ1  
1022 H HZ2  . LYS A 61  ? 0.5267 0.5267 0.5267 0.0000  0.0000  0.0000  61   LYS A HZ2  
1023 H HZ3  . LYS A 61  ? 0.5267 0.5267 0.5267 0.0000  0.0000  0.0000  61   LYS A HZ3  
1024 N N    . ASN A 62  ? 0.0753 0.0427 0.0790 -0.0042 -0.0222 0.0040  62   ASN A N    
1025 C CA   . ASN A 62  ? 0.0746 0.0446 0.0632 -0.0042 -0.0244 0.0019  62   ASN A CA   
1026 C C    . ASN A 62  ? 0.0787 0.0506 0.0685 -0.0073 -0.0193 -0.0021 62   ASN A C    
1027 O O    . ASN A 62  ? 0.0934 0.0725 0.0766 -0.0266 -0.0103 0.0012  62   ASN A O    
1028 C CB   . ASN A 62  ? 0.0749 0.0446 0.0834 -0.0012 -0.0177 -0.0018 62   ASN A CB   
1029 C CG   . ASN A 62  ? 0.0952 0.0408 0.0653 0.0054  -0.0290 0.0001  62   ASN A CG   
1030 O OD1  . ASN A 62  ? 0.1094 0.0493 0.0891 0.0016  -0.0325 0.0059  62   ASN A OD1  
1031 N ND2  . ASN A 62  ? 0.0867 0.0490 0.1050 -0.0012 -0.0249 0.0084  62   ASN A ND2  
1032 H H    . ASN A 62  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  62   ASN A H    
1033 H HA   . ASN A 62  ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  62   ASN A HA   
1034 H HB2  . ASN A 62  ? 0.0812 0.0812 0.0812 0.0000  0.0000  0.0000  62   ASN A HB2  
1035 H HB3  . ASN A 62  ? 0.0812 0.0812 0.0812 0.0000  0.0000  0.0000  62   ASN A HB3  
1036 H HD21 . ASN A 62  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  62   ASN A HD21 
1037 H HD22 . ASN A 62  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  62   ASN A HD22 
1038 N N    . VAL A 63  ? 0.0817 0.0472 0.0660 -0.0115 -0.0184 0.0042  63   VAL A N    
1039 C CA   . VAL A 63  ? 0.0963 0.0598 0.0626 -0.0161 -0.0127 0.0025  63   VAL A CA   
1040 C C    . VAL A 63  ? 0.0898 0.0594 0.0675 -0.0088 -0.0171 0.0033  63   VAL A C    
1041 O O    . VAL A 63  ? 0.1014 0.0797 0.0713 -0.0194 -0.0288 0.0059  63   VAL A O    
1042 C CB   . VAL A 63  ? 0.0982 0.0598 0.0758 -0.0072 -0.0105 -0.0020 63   VAL A CB   
1043 C CG1  . VAL A 63  ? 0.1050 0.0773 0.1052 0.0034  -0.0153 0.0010  63   VAL A CG1  
1044 C CG2  . VAL A 63  ? 0.1124 0.0560 0.1004 -0.0032 -0.0065 0.0092  63   VAL A CG2  
1045 H H    . VAL A 63  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  63   VAL A H    
1046 H HA   . VAL A 63  ? 0.0875 0.0875 0.0875 0.0000  0.0000  0.0000  63   VAL A HA   
1047 H HB   . VAL A 63  ? 0.0936 0.0936 0.0936 0.0000  0.0000  0.0000  63   VAL A HB   
1048 H HG11 . VAL A 63  ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  63   VAL A HG11 
1049 H HG12 . VAL A 63  ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  63   VAL A HG12 
1050 H HG13 . VAL A 63  ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  63   VAL A HG13 
1051 H HG21 . VAL A 63  ? 0.1344 0.1344 0.1344 0.0000  0.0000  0.0000  63   VAL A HG21 
1052 H HG22 . VAL A 63  ? 0.1344 0.1344 0.1344 0.0000  0.0000  0.0000  63   VAL A HG22 
1053 H HG23 . VAL A 63  ? 0.1344 0.1344 0.1344 0.0000  0.0000  0.0000  63   VAL A HG23 
1054 N N    . ALA A 64  ? 0.1093 0.0777 0.0650 -0.0094 -0.0231 -0.0002 64   ALA A N    
1055 C CA   . ALA A 64  ? 0.1073 0.0746 0.0780 -0.0015 -0.0372 0.0092  64   ALA A CA   
1056 C C    . ALA A 64  ? 0.0999 0.0725 0.0714 0.0042  -0.0307 -0.0031 64   ALA A C    
1057 O O    . ALA A 64  ? 0.1120 0.0874 0.1157 -0.0150 -0.0073 0.0034  64   ALA A O    
1058 C CB   . ALA A 64  ? 0.1598 0.1458 0.0710 -0.0369 -0.0238 0.0083  64   ALA A CB   
1059 H H    . ALA A 64  ? 0.1008 0.1008 0.1008 0.0000  0.0000  0.0000  64   ALA A H    
1060 H HA   . ALA A 64  ? 0.1040 0.1040 0.1040 0.0000  0.0000  0.0000  64   ALA A HA   
1061 H HB1  . ALA A 64  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  64   ALA A HB1  
1062 H HB2  . ALA A 64  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  64   ALA A HB2  
1063 H HB3  . ALA A 64  ? 0.1882 0.1882 0.1882 0.0000  0.0000  0.0000  64   ALA A HB3  
1064 N N    . CYS A 65  ? 0.0931 0.0797 0.0980 -0.0039 -0.0313 -0.0028 65   CYS A N    
1065 C CA   . CYS A 65  ? 0.0908 0.0748 0.0837 -0.0038 -0.0344 0.0028  65   CYS A CA   
1066 C C    . CYS A 65  ? 0.1047 0.0689 0.0815 -0.0138 -0.0374 0.0048  65   CYS A C    
1067 O O    . CYS A 65  ? 0.1614 0.0876 0.0924 0.0004  -0.0626 0.0038  65   CYS A O    
1068 C CB   . CYS A 65  ? 0.0724 0.1082 0.1002 -0.0123 -0.0319 -0.0101 65   CYS A CB   
1069 S SG   . CYS A 65  ? 0.0850 0.1339 0.1091 0.0057  -0.0339 -0.0319 65   CYS A SG   
1070 H H    . CYS A 65  ? 0.1083 0.1083 0.1083 0.0000  0.0000  0.0000  65   CYS A H    
1071 H HA   . CYS A 65  ? 0.0997 0.0997 0.0997 0.0000  0.0000  0.0000  65   CYS A HA   
1072 H HB2  . CYS A 65  ? 0.1123 0.1123 0.1123 0.0000  0.0000  0.0000  65   CYS A HB2  
1073 H HB3  . CYS A 65  ? 0.1123 0.1123 0.1123 0.0000  0.0000  0.0000  65   CYS A HB3  
1074 N N    . LYS A 66  ? 0.0892 0.0831 0.0684 -0.0187 -0.0360 0.0114  66   LYS A N    
1075 C CA   . LYS A 66  ? 0.0897 0.0948 0.0643 -0.0111 -0.0247 -0.0043 66   LYS A CA   
1076 C C    . LYS A 66  ? 0.0900 0.0702 0.0806 -0.0141 -0.0290 0.0027  66   LYS A C    
1077 O O    . LYS A 66  ? 0.1083 0.0903 0.0828 -0.0077 -0.0466 -0.0049 66   LYS A O    
1078 C CB   . LYS A 66  ? 0.1053 0.0939 0.0991 -0.0109 -0.0191 -0.0126 66   LYS A CB   
1079 C CG   A LYS A 66  ? 0.0968 0.1174 0.0897 0.0024  -0.0374 -0.0119 66   LYS A CG   
1080 C CG   B LYS A 66  ? 0.1185 0.2150 0.1002 0.0339  -0.0252 0.0125  66   LYS A CG   
1081 C CD   A LYS A 66  ? 0.1048 0.2923 0.1408 0.0134  0.0289  0.0055  66   LYS A CD   
1082 C CD   B LYS A 66  ? 0.1560 0.2485 0.2458 0.0790  0.0494  0.0352  66   LYS A CD   
1083 C CE   A LYS A 66  ? 0.0874 0.4418 0.2145 -0.0152 0.0321  0.0804  66   LYS A CE   
1084 C CE   B LYS A 66  ? 0.1812 0.2716 0.3684 0.0899  0.0492  0.0841  66   LYS A CE   
1085 N NZ   A LYS A 66  ? 0.1953 0.4856 0.2457 -0.0967 0.0719  0.0918  66   LYS A NZ   
1086 N NZ   B LYS A 66  ? 0.2164 0.2960 0.2834 0.1411  0.0890  0.0861  66   LYS A NZ   
1087 H H    . LYS A 66  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  66   LYS A H    
1088 H HA   . LYS A 66  ? 0.0995 0.0995 0.0995 0.0000  0.0000  0.0000  66   LYS A HA   
1089 H HB2  A LYS A 66  ? 0.1193 0.1193 0.1193 0.0000  0.0000  0.0000  66   LYS A HB2  
1090 H HB3  A LYS A 66  ? 0.1193 0.1193 0.1193 0.0000  0.0000  0.0000  66   LYS A HB3  
1091 H HG2  A LYS A 66  ? 0.1216 0.1216 0.1216 0.0000  0.0000  0.0000  66   LYS A HG2  
1092 H HG2  B LYS A 66  ? 0.1735 0.1735 0.1735 0.0000  0.0000  0.0000  66   LYS A HG2  
1093 H HG3  A LYS A 66  ? 0.1216 0.1216 0.1216 0.0000  0.0000  0.0000  66   LYS A HG3  
1094 H HG3  B LYS A 66  ? 0.1735 0.1735 0.1735 0.0000  0.0000  0.0000  66   LYS A HG3  
1095 H HD2  A LYS A 66  ? 0.2152 0.2152 0.2152 0.0000  0.0000  0.0000  66   LYS A HD2  
1096 H HD2  B LYS A 66  ? 0.2601 0.2601 0.2601 0.0000  0.0000  0.0000  66   LYS A HD2  
1097 H HD3  A LYS A 66  ? 0.2152 0.2152 0.2152 0.0000  0.0000  0.0000  66   LYS A HD3  
1098 H HD3  B LYS A 66  ? 0.2601 0.2601 0.2601 0.0000  0.0000  0.0000  66   LYS A HD3  
1099 H HE2  A LYS A 66  ? 0.2975 0.2975 0.2975 0.0000  0.0000  0.0000  66   LYS A HE2  
1100 H HE2  B LYS A 66  ? 0.3285 0.3285 0.3285 0.0000  0.0000  0.0000  66   LYS A HE2  
1101 H HE3  A LYS A 66  ? 0.2975 0.2975 0.2975 0.0000  0.0000  0.0000  66   LYS A HE3  
1102 H HE3  B LYS A 66  ? 0.3285 0.3285 0.3285 0.0000  0.0000  0.0000  66   LYS A HE3  
1103 H HZ1  A LYS A 66  ? 0.4633 0.4633 0.4633 0.0000  0.0000  0.0000  66   LYS A HZ1  
1104 H HZ1  B LYS A 66  ? 0.3979 0.3979 0.3979 0.0000  0.0000  0.0000  66   LYS A HZ1  
1105 H HZ2  A LYS A 66  ? 0.4633 0.4633 0.4633 0.0000  0.0000  0.0000  66   LYS A HZ2  
1106 H HZ2  B LYS A 66  ? 0.3979 0.3979 0.3979 0.0000  0.0000  0.0000  66   LYS A HZ2  
1107 H HZ3  A LYS A 66  ? 0.4633 0.4633 0.4633 0.0000  0.0000  0.0000  66   LYS A HZ3  
1108 H HZ3  B LYS A 66  ? 0.3979 0.3979 0.3979 0.0000  0.0000  0.0000  66   LYS A HZ3  
1109 N N    . IAS A 67  ? 0.0872 0.0877 0.0848 -0.0127 -0.0379 0.0048  67   IAS A N    
1110 C CA   . IAS A 67  ? 0.0850 0.0724 0.1099 -0.0073 -0.0248 0.0076  67   IAS A CA   
1111 C C    . IAS A 67  ? 0.1028 0.0675 0.1396 0.0022  -0.0505 -0.0008 67   IAS A C    
1112 O O    . IAS A 67  ? 0.0930 0.0821 0.2695 0.0023  -0.0761 -0.0255 67   IAS A O    
1113 C CB   . IAS A 67  ? 0.0988 0.0709 0.1193 0.0002  -0.0340 -0.0157 67   IAS A CB   
1114 C CG   . IAS A 67  ? 0.1208 0.0701 0.1174 0.0005  -0.0384 0.0012  67   IAS A CG   
1115 O OD1  . IAS A 67  ? 0.1464 0.0937 0.1303 -0.0188 -0.0153 0.0063  67   IAS A OD1  
1116 H H    . IAS A 67  ? 0.1039 0.1039 0.1039 0.0000  0.0000  0.0000  67   IAS A H    
1117 H HA   . IAS A 67  ? 0.1069 0.1069 0.1069 0.0000  0.0000  0.0000  67   IAS A HA   
1118 H HB2  . IAS A 67  ? 0.1155 0.1155 0.1155 0.0000  0.0000  0.0000  67   IAS A HB2  
1119 H HB3  . IAS A 67  ? 0.1155 0.1155 0.1155 0.0000  0.0000  0.0000  67   IAS A HB3  
1120 N N    . GLY A 68  ? 0.1054 0.0603 0.1491 -0.0045 -0.0267 -0.0111 68   GLY A N    
1121 C CA   . GLY A 68  ? 0.1128 0.0750 0.1374 -0.0093 -0.0190 -0.0254 68   GLY A CA   
1122 C C    . GLY A 68  ? 0.1242 0.0627 0.1189 -0.0025 -0.0459 0.0009  68   GLY A C    
1123 O O    . GLY A 68  ? 0.2103 0.0744 0.1118 -0.0016 -0.0395 -0.0145 68   GLY A O    
1124 H H    . GLY A 68  ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  68   GLY A H    
1125 H HA2  . GLY A 68  ? 0.1301 0.1301 0.1301 0.0000  0.0000  0.0000  68   GLY A HA2  
1126 H HA3  . GLY A 68  ? 0.1301 0.1301 0.1301 0.0000  0.0000  0.0000  68   GLY A HA3  
1127 N N    . GLN A 69  ? 0.1188 0.0650 0.1039 0.0039  -0.0354 0.0028  69   GLN A N    
1128 C CA   . GLN A 69  ? 0.1151 0.0548 0.1120 0.0116  -0.0441 -0.0068 69   GLN A CA   
1129 C C    . GLN A 69  ? 0.1132 0.0577 0.1218 0.0175  -0.0452 -0.0117 69   GLN A C    
1130 O O    . GLN A 69  ? 0.1320 0.0930 0.1518 0.0087  -0.0529 -0.0282 69   GLN A O    
1131 C CB   . GLN A 69  ? 0.1060 0.0680 0.1799 0.0057  -0.0419 -0.0188 69   GLN A CB   
1132 C CG   . GLN A 69  ? 0.1143 0.0865 0.1500 0.0140  -0.0319 0.0143  69   GLN A CG   
1133 C CD   . GLN A 69  ? 0.1337 0.0907 0.1491 0.0096  -0.0328 -0.0074 69   GLN A CD   
1134 O OE1  . GLN A 69  ? 0.1482 0.1250 0.1424 -0.0023 -0.0297 0.0049  69   GLN A OE1  
1135 N NE2  . GLN A 69  ? 0.1089 0.1217 0.1888 -0.0188 -0.0223 0.0120  69   GLN A NE2  
1136 H H    . GLN A 69  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  69   GLN A H    
1137 H HA   . GLN A 69  ? 0.1127 0.1127 0.1127 0.0000  0.0000  0.0000  69   GLN A HA   
1138 H HB2  . GLN A 69  ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  69   GLN A HB2  
1139 H HB3  . GLN A 69  ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  69   GLN A HB3  
1140 H HG2  . GLN A 69  ? 0.1403 0.1403 0.1403 0.0000  0.0000  0.0000  69   GLN A HG2  
1141 H HG3  . GLN A 69  ? 0.1403 0.1403 0.1403 0.0000  0.0000  0.0000  69   GLN A HG3  
1142 H HE21 . GLN A 69  ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  69   GLN A HE21 
1143 H HE22 . GLN A 69  ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  69   GLN A HE22 
1144 N N    . THR A 70  ? 0.0969 0.0607 0.0868 0.0084  -0.0301 0.0070  70   THR A N    
1145 C CA   . THR A 70  ? 0.0946 0.0545 0.0860 0.0105  -0.0269 0.0133  70   THR A CA   
1146 C C    . THR A 70  ? 0.0891 0.0435 0.1007 0.0001  -0.0411 0.0190  70   THR A C    
1147 O O    . THR A 70  ? 0.1143 0.0935 0.1159 -0.0341 -0.0565 0.0343  70   THR A O    
1148 C CB   . THR A 70  ? 0.0980 0.0582 0.0892 0.0089  -0.0120 0.0070  70   THR A CB   
1149 O OG1  . THR A 70  ? 0.1053 0.0580 0.0869 0.0070  -0.0233 0.0076  70   THR A OG1  
1150 C CG2  . THR A 70  ? 0.1340 0.0685 0.0931 0.0137  0.0050  0.0067  70   THR A CG2  
1151 H H    . THR A 70  ? 0.0978 0.0978 0.0978 0.0000  0.0000  0.0000  70   THR A H    
1152 H HA   . THR A 70  ? 0.0941 0.0941 0.0941 0.0000  0.0000  0.0000  70   THR A HA   
1153 H HB   . THR A 70  ? 0.0982 0.0982 0.0982 0.0000  0.0000  0.0000  70   THR A HB   
1154 H HG1  . THR A 70  ? 0.1251 0.1251 0.1251 0.0000  0.0000  0.0000  70   THR A HG1  
1155 H HG21 . THR A 70  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  70   THR A HG21 
1156 H HG22 . THR A 70  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  70   THR A HG22 
1157 H HG23 . THR A 70  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  70   THR A HG23 
1158 N N    . ASN A 71  ? 0.0867 0.0716 0.0746 0.0042  -0.0300 0.0138  71   ASN A N    
1159 C CA   . ASN A 71  ? 0.0974 0.0804 0.0833 0.0161  -0.0253 0.0118  71   ASN A CA   
1160 C C    . ASN A 71  ? 0.0707 0.0696 0.0672 -0.0022 -0.0228 0.0119  71   ASN A C    
1161 O O    . ASN A 71  ? 0.0835 0.0649 0.0885 -0.0033 -0.0116 0.0095  71   ASN A O    
1162 C CB   . ASN A 71  ? 0.0926 0.1333 0.1106 0.0439  -0.0214 0.0137  71   ASN A CB   
1163 C CG   . ASN A 71  ? 0.0847 0.2093 0.1171 0.0351  -0.0192 0.0425  71   ASN A CG   
1164 O OD1  . ASN A 71  ? 0.0892 0.1769 0.1902 -0.0086 -0.0256 0.0183  71   ASN A OD1  
1165 N ND2  . ASN A 71  ? 0.1017 0.2785 0.1845 -0.0199 -0.0451 0.1167  71   ASN A ND2  
1166 H H    . ASN A 71  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  71   ASN A H    
1167 H HA   . ASN A 71  ? 0.1045 0.1045 0.1045 0.0000  0.0000  0.0000  71   ASN A HA   
1168 H HB2  . ASN A 71  ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  71   ASN A HB2  
1169 H HB3  . ASN A 71  ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  71   ASN A HB3  
1170 H HD21 . ASN A 71  ? 0.2258 0.2258 0.2258 0.0000  0.0000  0.0000  71   ASN A HD21 
1171 H HD22 . ASN A 71  ? 0.2258 0.2258 0.2258 0.0000  0.0000  0.0000  71   ASN A HD22 
1172 N N    . CYS A 72  ? 0.0767 0.0684 0.0721 -0.0008 -0.0253 0.0242  72   CYS A N    
1173 C CA   . CYS A 72  ? 0.0713 0.0530 0.0672 -0.0050 -0.0191 0.0142  72   CYS A CA   
1174 C C    . CYS A 72  ? 0.0720 0.0411 0.0610 -0.0040 -0.0175 0.0048  72   CYS A C    
1175 O O    . CYS A 72  ? 0.0704 0.0481 0.0661 -0.0048 -0.0176 0.0124  72   CYS A O    
1176 C CB   . CYS A 72  ? 0.0711 0.0721 0.0701 -0.0107 -0.0283 0.0134  72   CYS A CB   
1177 S SG   . CYS A 72  ? 0.0950 0.1103 0.0763 -0.0405 -0.0214 -0.0025 72   CYS A SG   
1178 H H    . CYS A 72  ? 0.0869 0.0869 0.0869 0.0000  0.0000  0.0000  72   CYS A H    
1179 H HA   . CYS A 72  ? 0.0766 0.0766 0.0766 0.0000  0.0000  0.0000  72   CYS A HA   
1180 H HB2  . CYS A 72  ? 0.0854 0.0854 0.0854 0.0000  0.0000  0.0000  72   CYS A HB2  
1181 H HB3  . CYS A 72  ? 0.0854 0.0854 0.0854 0.0000  0.0000  0.0000  72   CYS A HB3  
1182 N N    . TYR A 73  ? 0.0625 0.0389 0.0653 -0.0048 -0.0236 0.0074  73   TYR A N    
1183 C CA   . TYR A 73  ? 0.0607 0.0444 0.0628 0.0011  -0.0257 0.0042  73   TYR A CA   
1184 C C    . TYR A 73  ? 0.0700 0.0409 0.0580 0.0017  -0.0202 0.0019  73   TYR A C    
1185 O O    . TYR A 73  ? 0.0740 0.0368 0.0694 -0.0027 -0.0173 0.0020  73   TYR A O    
1186 C CB   . TYR A 73  ? 0.0863 0.0492 0.0641 0.0118  -0.0278 -0.0009 73   TYR A CB   
1187 C CG   . TYR A 73  ? 0.0795 0.0521 0.0585 0.0042  -0.0248 0.0042  73   TYR A CG   
1188 C CD1  . TYR A 73  ? 0.0739 0.0461 0.0681 0.0011  -0.0202 0.0086  73   TYR A CD1  
1189 C CD2  . TYR A 73  ? 0.0776 0.0522 0.0629 0.0048  -0.0257 -0.0050 73   TYR A CD2  
1190 C CE1  . TYR A 73  ? 0.0753 0.0426 0.0687 -0.0056 -0.0088 0.0071  73   TYR A CE1  
1191 C CE2  . TYR A 73  ? 0.0805 0.0405 0.0693 -0.0063 -0.0166 0.0004  73   TYR A CE2  
1192 C CZ   . TYR A 73  ? 0.0809 0.0374 0.0673 0.0026  -0.0152 0.0105  73   TYR A CZ   
1193 O OH   . TYR A 73  ? 0.0746 0.0451 0.0838 0.0039  -0.0137 0.0132  73   TYR A OH   
1194 H H    . TYR A 73  ? 0.0666 0.0666 0.0666 0.0000  0.0000  0.0000  73   TYR A H    
1195 H HA   . TYR A 73  ? 0.0671 0.0671 0.0671 0.0000  0.0000  0.0000  73   TYR A HA   
1196 H HB2  . TYR A 73  ? 0.0798 0.0798 0.0798 0.0000  0.0000  0.0000  73   TYR A HB2  
1197 H HB3  . TYR A 73  ? 0.0798 0.0798 0.0798 0.0000  0.0000  0.0000  73   TYR A HB3  
1198 H HD1  . TYR A 73  ? 0.0752 0.0752 0.0752 0.0000  0.0000  0.0000  73   TYR A HD1  
1199 H HD2  . TYR A 73  ? 0.0770 0.0770 0.0770 0.0000  0.0000  0.0000  73   TYR A HD2  
1200 H HE1  . TYR A 73  ? 0.0746 0.0746 0.0746 0.0000  0.0000  0.0000  73   TYR A HE1  
1201 H HE2  . TYR A 73  ? 0.0761 0.0761 0.0761 0.0000  0.0000  0.0000  73   TYR A HE2  
1202 H HH   . TYR A 73  ? 0.1017 0.1017 0.1017 0.0000  0.0000  0.0000  73   TYR A HH   
1203 N N    . GLN A 74  ? 0.0639 0.0406 0.0827 0.0028  -0.0227 0.0072  74   GLN A N    
1204 C CA   . GLN A 74  ? 0.0715 0.0403 0.0725 0.0039  -0.0196 -0.0018 74   GLN A CA   
1205 C C    . GLN A 74  ? 0.0605 0.0513 0.0738 0.0065  -0.0119 -0.0069 74   GLN A C    
1206 O O    . GLN A 74  ? 0.0770 0.0439 0.0835 -0.0023 -0.0242 -0.0083 74   GLN A O    
1207 C CB   . GLN A 74  ? 0.0835 0.0549 0.0701 -0.0053 -0.0135 -0.0029 74   GLN A CB   
1208 C CG   . GLN A 74  ? 0.0824 0.0735 0.0878 0.0133  -0.0065 -0.0119 74   GLN A CG   
1209 C CD   . GLN A 74  ? 0.1633 0.1415 0.1145 0.0289  -0.0077 -0.0244 74   GLN A CD   
1210 O OE1  . GLN A 74  ? 0.2687 0.1849 0.1117 0.0248  0.0247  0.0130  74   GLN A OE1  
1211 N NE2  . GLN A 74  ? 0.1860 0.4586 0.1998 -0.1210 0.1110  -0.1136 74   GLN A NE2  
1212 H H    . GLN A 74  ? 0.0749 0.0749 0.0749 0.0000  0.0000  0.0000  74   GLN A H    
1213 H HA   . GLN A 74  ? 0.0737 0.0737 0.0737 0.0000  0.0000  0.0000  74   GLN A HA   
1214 H HB2  . GLN A 74  ? 0.0833 0.0833 0.0833 0.0000  0.0000  0.0000  74   GLN A HB2  
1215 H HB3  . GLN A 74  ? 0.0833 0.0833 0.0833 0.0000  0.0000  0.0000  74   GLN A HB3  
1216 H HG2  . GLN A 74  ? 0.0975 0.0975 0.0975 0.0000  0.0000  0.0000  74   GLN A HG2  
1217 H HG3  . GLN A 74  ? 0.0975 0.0975 0.0975 0.0000  0.0000  0.0000  74   GLN A HG3  
1218 H HE21 . GLN A 74  ? 0.3378 0.3378 0.3378 0.0000  0.0000  0.0000  74   GLN A HE21 
1219 H HE22 . GLN A 74  ? 0.3378 0.3378 0.3378 0.0000  0.0000  0.0000  74   GLN A HE22 
1220 N N    . SER A 75  ? 0.0647 0.0430 0.0679 0.0024  -0.0192 -0.0055 75   SER A N    
1221 C CA   . SER A 75  ? 0.0573 0.0453 0.0636 0.0022  -0.0186 -0.0084 75   SER A CA   
1222 C C    . SER A 75  ? 0.0631 0.0436 0.0787 -0.0034 -0.0099 0.0014  75   SER A C    
1223 O O    . SER A 75  ? 0.0675 0.0761 0.0892 -0.0007 0.0021  -0.0163 75   SER A O    
1224 C CB   . SER A 75  ? 0.0558 0.0455 0.0720 0.0016  -0.0175 -0.0071 75   SER A CB   
1225 O OG   . SER A 75  ? 0.0629 0.0449 0.0755 0.0071  -0.0173 -0.0091 75   SER A OG   
1226 H H    . SER A 75  ? 0.0702 0.0702 0.0702 0.0000  0.0000  0.0000  75   SER A H    
1227 H HA   . SER A 75  ? 0.0665 0.0665 0.0665 0.0000  0.0000  0.0000  75   SER A HA   
1228 H HB2  . SER A 75  ? 0.0693 0.0693 0.0693 0.0000  0.0000  0.0000  75   SER A HB2  
1229 H HB3  . SER A 75  ? 0.0693 0.0693 0.0693 0.0000  0.0000  0.0000  75   SER A HB3  
1230 H HG   . SER A 75  ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  75   SER A HG   
1231 N N    . TYR A 76  ? 0.0547 0.0441 0.0860 -0.0076 -0.0174 -0.0054 76   TYR A N    
1232 C CA   . TYR A 76  ? 0.0585 0.0562 0.1202 -0.0077 -0.0090 -0.0044 76   TYR A CA   
1233 C C    . TYR A 76  ? 0.0545 0.0471 0.1444 -0.0062 -0.0115 -0.0134 76   TYR A C    
1234 O O    . TYR A 76  ? 0.0681 0.0953 0.1870 0.0057  0.0209  -0.0066 76   TYR A O    
1235 C CB   . TYR A 76  ? 0.0662 0.0509 0.1486 -0.0061 -0.0317 -0.0140 76   TYR A CB   
1236 C CG   . TYR A 76  ? 0.0750 0.0521 0.1503 -0.0207 -0.0126 -0.0105 76   TYR A CG   
1237 C CD1  . TYR A 76  ? 0.1142 0.0738 0.1306 -0.0105 -0.0372 -0.0099 76   TYR A CD1  
1238 C CD2  . TYR A 76  ? 0.1071 0.0623 0.1624 -0.0006 0.0185  -0.0141 76   TYR A CD2  
1239 C CE1  . TYR A 76  ? 0.1264 0.0837 0.1561 -0.0321 -0.0541 0.0096  76   TYR A CE1  
1240 C CE2  . TYR A 76  ? 0.1307 0.0546 0.1925 -0.0049 -0.0033 -0.0069 76   TYR A CE2  
1241 C CZ   . TYR A 76  ? 0.1016 0.0614 0.1942 -0.0111 -0.0141 0.0071  76   TYR A CZ   
1242 O OH   . TYR A 76  ? 0.1638 0.0646 0.2063 0.0038  -0.0315 0.0189  76   TYR A OH   
1243 H H    . TYR A 76  ? 0.0738 0.0738 0.0738 0.0000  0.0000  0.0000  76   TYR A H    
1244 H HA   . TYR A 76  ? 0.0940 0.0940 0.0940 0.0000  0.0000  0.0000  76   TYR A HA   
1245 H HB2  . TYR A 76  ? 0.1063 0.1063 0.1063 0.0000  0.0000  0.0000  76   TYR A HB2  
1246 H HB3  . TYR A 76  ? 0.1063 0.1063 0.1063 0.0000  0.0000  0.0000  76   TYR A HB3  
1247 H HD1  . TYR A 76  ? 0.1274 0.1274 0.1274 0.0000  0.0000  0.0000  76   TYR A HD1  
1248 H HD2  . TYR A 76  ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  76   TYR A HD2  
1249 H HE1  . TYR A 76  ? 0.1464 0.1464 0.1464 0.0000  0.0000  0.0000  76   TYR A HE1  
1250 H HE2  . TYR A 76  ? 0.1511 0.1511 0.1511 0.0000  0.0000  0.0000  76   TYR A HE2  
1251 H HH   . TYR A 76  ? 0.2173 0.2173 0.2173 0.0000  0.0000  0.0000  76   TYR A HH   
1252 N N    . SER A 77  ? 0.0552 0.0450 0.1307 0.0040  -0.0140 -0.0138 77   SER A N    
1253 C CA   . SER A 77  ? 0.0519 0.0494 0.1342 0.0019  -0.0220 -0.0153 77   SER A CA   
1254 C C    . SER A 77  ? 0.0514 0.0470 0.1087 -0.0017 -0.0068 -0.0072 77   SER A C    
1255 O O    . SER A 77  ? 0.0596 0.0645 0.1297 0.0076  -0.0353 -0.0105 77   SER A O    
1256 C CB   . SER A 77  ? 0.0938 0.0626 0.1256 0.0272  -0.0442 -0.0177 77   SER A CB   
1257 O OG   . SER A 77  ? 0.1548 0.1493 0.2368 0.0618  -0.1142 -0.1005 77   SER A OG   
1258 H H    . SER A 77  ? 0.0923 0.0923 0.0923 0.0000  0.0000  0.0000  77   SER A H    
1259 H HA   . SER A 77  ? 0.0942 0.0942 0.0942 0.0000  0.0000  0.0000  77   SER A HA   
1260 H HB2  . SER A 77  ? 0.1127 0.1127 0.1127 0.0000  0.0000  0.0000  77   SER A HB2  
1261 H HB3  . SER A 77  ? 0.1127 0.1127 0.1127 0.0000  0.0000  0.0000  77   SER A HB3  
1262 H HG   . SER A 77  ? 0.2704 0.2704 0.2704 0.0000  0.0000  0.0000  77   SER A HG   
1263 N N    . THR A 78  ? 0.0513 0.0424 0.1060 -0.0018 -0.0028 -0.0033 78   THR A N    
1264 C CA   . THR A 78  ? 0.0545 0.0480 0.0923 -0.0033 -0.0045 -0.0049 78   THR A CA   
1265 C C    . THR A 78  ? 0.0616 0.0465 0.0760 -0.0083 -0.0114 -0.0083 78   THR A C    
1266 O O    . THR A 78  ? 0.0646 0.0663 0.0822 -0.0102 -0.0157 -0.0149 78   THR A O    
1267 C CB   . THR A 78  ? 0.0674 0.0630 0.0929 0.0052  -0.0039 -0.0169 78   THR A CB   
1268 O OG1  . THR A 78  ? 0.0734 0.0799 0.1057 0.0213  -0.0237 -0.0210 78   THR A OG1  
1269 C CG2  . THR A 78  ? 0.0804 0.1167 0.1056 0.0044  0.0118  -0.0072 78   THR A CG2  
1270 H H    . THR A 78  ? 0.0799 0.0799 0.0799 0.0000  0.0000  0.0000  78   THR A H    
1271 H HA   . THR A 78  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  78   THR A HA   
1272 H HB   . THR A 78  ? 0.0893 0.0893 0.0893 0.0000  0.0000  0.0000  78   THR A HB   
1273 H HG1  . THR A 78  ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  78   THR A HG1  
1274 H HG21 . THR A 78  ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  78   THR A HG21 
1275 H HG22 . THR A 78  ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  78   THR A HG22 
1276 H HG23 . THR A 78  ? 0.1513 0.1513 0.1513 0.0000  0.0000  0.0000  78   THR A HG23 
1277 N N    . MET A 79  ? 0.0719 0.0492 0.0623 -0.0201 -0.0115 -0.0032 79   MET A N    
1278 C CA   . MET A 79  ? 0.0712 0.0403 0.0634 -0.0115 -0.0138 -0.0030 79   MET A CA   
1279 C C    . MET A 79  ? 0.0596 0.0423 0.0676 -0.0124 -0.0147 -0.0026 79   MET A C    
1280 O O    . MET A 79  ? 0.0722 0.0473 0.0647 -0.0097 -0.0123 -0.0002 79   MET A O    
1281 C CB   A MET A 79  ? 0.0701 0.0516 0.0720 -0.0072 -0.0056 -0.0004 79   MET A CB   
1282 C CB   B MET A 79  ? 0.0916 0.0487 0.0585 0.0161  0.0027  0.0252  79   MET A CB   
1283 C CG   A MET A 79  ? 0.0672 0.0523 0.0713 0.0015  -0.0098 -0.0066 79   MET A CG   
1284 C CG   B MET A 79  ? 0.0734 0.0742 0.0504 0.0184  -0.0075 0.0200  79   MET A CG   
1285 S SD   A MET A 79  ? 0.0715 0.0638 0.0893 0.0111  -0.0188 -0.0007 79   MET A SD   
1286 S SD   B MET A 79  ? 0.1358 0.0435 0.0847 0.0017  -0.0291 0.0068  79   MET A SD   
1287 C CE   A MET A 79  ? 0.0891 0.0780 0.1042 0.0229  -0.0266 -0.0304 79   MET A CE   
1288 C CE   B MET A 79  ? 0.2491 0.0285 0.1408 0.0537  0.0574  0.0126  79   MET A CE   
1289 H H    . MET A 79  ? 0.0733 0.0733 0.0733 0.0000  0.0000  0.0000  79   MET A H    
1290 H HA   A MET A 79  ? 0.0700 0.0700 0.0700 0.0000  0.0000  0.0000  79   MET A HA   
1291 H HB2  A MET A 79  ? 0.0775 0.0775 0.0775 0.0000  0.0000  0.0000  79   MET A HB2  
1292 H HB2  B MET A 79  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  79   MET A HB2  
1293 H HB3  A MET A 79  ? 0.0775 0.0775 0.0775 0.0000  0.0000  0.0000  79   MET A HB3  
1294 H HB3  B MET A 79  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  79   MET A HB3  
1295 H HG2  A MET A 79  ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  79   MET A HG2  
1296 H HG2  B MET A 79  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  79   MET A HG2  
1297 H HG3  A MET A 79  ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  79   MET A HG3  
1298 H HG3  B MET A 79  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  79   MET A HG3  
1299 H HE1  A MET A 79  ? 0.1356 0.1356 0.1356 0.0000  0.0000  0.0000  79   MET A HE1  
1300 H HE1  B MET A 79  ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  79   MET A HE1  
1301 H HE2  A MET A 79  ? 0.1356 0.1356 0.1356 0.0000  0.0000  0.0000  79   MET A HE2  
1302 H HE2  B MET A 79  ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  79   MET A HE2  
1303 H HE3  A MET A 79  ? 0.1356 0.1356 0.1356 0.0000  0.0000  0.0000  79   MET A HE3  
1304 H HE3  B MET A 79  ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  79   MET A HE3  
1305 N N    . SER A 80  ? 0.0621 0.0463 0.0656 -0.0116 -0.0085 -0.0014 80   SER A N    
1306 C CA   . SER A 80  ? 0.0574 0.0409 0.0703 -0.0085 -0.0102 -0.0006 80   SER A CA   
1307 C C    . SER A 80  ? 0.0602 0.0352 0.0717 -0.0084 -0.0160 0.0061  80   SER A C    
1308 O O    . SER A 80  ? 0.0572 0.0527 0.0719 -0.0069 -0.0059 -0.0036 80   SER A O    
1309 C CB   . SER A 80  ? 0.0722 0.0537 0.0689 -0.0122 -0.0176 0.0066  80   SER A CB   
1310 O OG   . SER A 80  ? 0.0880 0.0453 0.0782 -0.0079 -0.0203 0.0101  80   SER A OG   
1311 H H    . SER A 80  ? 0.0695 0.0695 0.0695 0.0000  0.0000  0.0000  80   SER A H    
1312 H HA   . SER A 80  ? 0.0674 0.0674 0.0674 0.0000  0.0000  0.0000  80   SER A HA   
1313 H HB2  . SER A 80  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  80   SER A HB2  
1314 H HB3  . SER A 80  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  80   SER A HB3  
1315 H HG   . SER A 80  ? 0.1058 0.1058 0.1058 0.0000  0.0000  0.0000  80   SER A HG   
1316 N N    . ILE A 81  ? 0.0519 0.0375 0.0663 -0.0058 -0.0138 -0.0014 81   ILE A N    
1317 C CA   . ILE A 81  ? 0.0501 0.0381 0.0681 -0.0047 -0.0152 0.0011  81   ILE A CA   
1318 C C    . ILE A 81  ? 0.0567 0.0354 0.0662 -0.0030 -0.0154 0.0018  81   ILE A C    
1319 O O    . ILE A 81  ? 0.0567 0.0420 0.0819 0.0021  -0.0110 -0.0029 81   ILE A O    
1320 C CB   . ILE A 81  ? 0.0589 0.0426 0.0843 -0.0041 -0.0203 0.0099  81   ILE A CB   
1321 C CG1  . ILE A 81  ? 0.0841 0.0583 0.0756 -0.0104 -0.0209 0.0127  81   ILE A CG1  
1322 C CG2  . ILE A 81  ? 0.0720 0.0358 0.1059 -0.0017 -0.0181 0.0092  81   ILE A CG2  
1323 C CD1  . ILE A 81  ? 0.0931 0.1117 0.0946 -0.0059 -0.0138 0.0469  81   ILE A CD1  
1324 H H    . ILE A 81  ? 0.0622 0.0622 0.0622 0.0000  0.0000  0.0000  81   ILE A H    
1325 H HA   . ILE A 81  ? 0.0624 0.0624 0.0624 0.0000  0.0000  0.0000  81   ILE A HA   
1326 H HB   . ILE A 81  ? 0.0743 0.0743 0.0743 0.0000  0.0000  0.0000  81   ILE A HB   
1327 H HG12 . ILE A 81  ? 0.0871 0.0871 0.0871 0.0000  0.0000  0.0000  81   ILE A HG12 
1328 H HG13 . ILE A 81  ? 0.0871 0.0871 0.0871 0.0000  0.0000  0.0000  81   ILE A HG13 
1329 H HG21 . ILE A 81  ? 0.1069 0.1069 0.1069 0.0000  0.0000  0.0000  81   ILE A HG21 
1330 H HG22 . ILE A 81  ? 0.1069 0.1069 0.1069 0.0000  0.0000  0.0000  81   ILE A HG22 
1331 H HG23 . ILE A 81  ? 0.1069 0.1069 0.1069 0.0000  0.0000  0.0000  81   ILE A HG23 
1332 H HD11 . ILE A 81  ? 0.1497 0.1497 0.1497 0.0000  0.0000  0.0000  81   ILE A HD11 
1333 H HD12 . ILE A 81  ? 0.1497 0.1497 0.1497 0.0000  0.0000  0.0000  81   ILE A HD12 
1334 H HD13 . ILE A 81  ? 0.1497 0.1497 0.1497 0.0000  0.0000  0.0000  81   ILE A HD13 
1335 N N    . THR A 82  ? 0.0556 0.0363 0.0691 -0.0023 -0.0193 -0.0079 82   THR A N    
1336 C CA   . THR A 82  ? 0.0611 0.0316 0.0661 0.0000  -0.0152 -0.0048 82   THR A CA   
1337 C C    . THR A 82  ? 0.0608 0.0319 0.0709 -0.0045 -0.0156 0.0007  82   THR A C    
1338 O O    . THR A 82  ? 0.0645 0.0478 0.0695 0.0063  -0.0188 -0.0050 82   THR A O    
1339 C CB   . THR A 82  ? 0.0684 0.0388 0.0695 -0.0043 -0.0170 -0.0032 82   THR A CB   
1340 O OG1  . THR A 82  ? 0.0797 0.0409 0.0728 0.0031  -0.0269 -0.0012 82   THR A OG1  
1341 C CG2  . THR A 82  ? 0.0867 0.0395 0.0715 -0.0097 -0.0218 -0.0080 82   THR A CG2  
1342 H H    . THR A 82  ? 0.0645 0.0645 0.0645 0.0000  0.0000  0.0000  82   THR A H    
1343 H HA   . THR A 82  ? 0.0636 0.0636 0.0636 0.0000  0.0000  0.0000  82   THR A HA   
1344 H HB   . THR A 82  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  82   THR A HB   
1345 H HG1  . THR A 82  ? 0.0966 0.0966 0.0966 0.0000  0.0000  0.0000  82   THR A HG1  
1346 H HG21 . THR A 82  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  82   THR A HG21 
1347 H HG22 . THR A 82  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  82   THR A HG22 
1348 H HG23 . THR A 82  ? 0.0989 0.0989 0.0989 0.0000  0.0000  0.0000  82   THR A HG23 
1349 N N    . ASP A 83  ? 0.0691 0.0507 0.0706 -0.0067 -0.0084 -0.0098 83   ASP A N    
1350 C CA   . ASP A 83  ? 0.0830 0.0556 0.0664 -0.0113 -0.0144 -0.0028 83   ASP A CA   
1351 C C    . ASP A 83  ? 0.0714 0.0521 0.0660 -0.0032 -0.0185 -0.0089 83   ASP A C    
1352 O O    . ASP A 83  ? 0.0751 0.0553 0.1206 0.0083  -0.0190 -0.0296 83   ASP A O    
1353 C CB   A ASP A 83  ? 0.1124 0.0805 0.0654 -0.0239 0.0048  0.0020  83   ASP A CB   
1354 C CB   B ASP A 83  ? 0.1248 0.0926 0.0754 -0.0228 -0.0124 0.0112  83   ASP A CB   
1355 C CG   A ASP A 83  ? 0.1030 0.0759 0.0675 -0.0036 -0.0025 0.0074  83   ASP A CG   
1356 C CG   B ASP A 83  ? 0.1040 0.0829 0.1089 -0.0022 0.0192  0.0512  83   ASP A CG   
1357 O OD1  A ASP A 83  ? 0.2062 0.0761 0.1133 0.0126  -0.0449 -0.0079 83   ASP A OD1  
1358 O OD1  B ASP A 83  ? 0.0459 0.1901 0.3008 -0.0225 0.0279  -0.1863 83   ASP A OD1  
1359 O OD2  A ASP A 83  ? 0.1502 0.0816 0.0849 -0.0097 -0.0248 0.0040  83   ASP A OD2  
1360 O OD2  B ASP A 83  ? 0.1653 0.0846 0.3144 -0.0025 0.1269  0.0239  83   ASP A OD2  
1361 H H    . ASP A 83  ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  83   ASP A H    
1362 H HA   A ASP A 83  ? 0.0819 0.0819 0.0819 0.0000  0.0000  0.0000  83   ASP A HA   
1363 H HB2  A ASP A 83  ? 0.1033 0.1033 0.1033 0.0000  0.0000  0.0000  83   ASP A HB2  
1364 H HB2  B ASP A 83  ? 0.1172 0.1172 0.1172 0.0000  0.0000  0.0000  83   ASP A HB2  
1365 H HB3  A ASP A 83  ? 0.1033 0.1033 0.1033 0.0000  0.0000  0.0000  83   ASP A HB3  
1366 H HB3  B ASP A 83  ? 0.1172 0.1172 0.1172 0.0000  0.0000  0.0000  83   ASP A HB3  
1367 N N    . CYS A 84  ? 0.0766 0.0407 0.0692 0.0015  -0.0234 -0.0020 84   CYS A N    
1368 C CA   . CYS A 84  ? 0.0729 0.0404 0.0855 0.0034  -0.0368 -0.0063 84   CYS A CA   
1369 C C    . CYS A 84  ? 0.0798 0.0553 0.0820 0.0040  -0.0342 -0.0028 84   CYS A C    
1370 O O    . CYS A 84  ? 0.1210 0.0642 0.0970 0.0349  -0.0620 -0.0163 84   CYS A O    
1371 C CB   . CYS A 84  ? 0.0713 0.0392 0.0967 0.0003  -0.0305 0.0025  84   CYS A CB   
1372 S SG   . CYS A 84  ? 0.0752 0.0415 0.0884 0.0006  -0.0160 -0.0031 84   CYS A SG   
1373 H H    . CYS A 84  ? 0.0746 0.0746 0.0746 0.0000  0.0000  0.0000  84   CYS A H    
1374 H HA   . CYS A 84  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  84   CYS A HA   
1375 H HB2  . CYS A 84  ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  84   CYS A HB2  
1376 H HB3  . CYS A 84  ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  84   CYS A HB3  
1377 N N    . ARG A 85  ? 0.0924 0.0451 0.0790 0.0046  -0.0338 -0.0078 85   ARG A N    
1378 C CA   . ARG A 85  ? 0.0892 0.0577 0.0720 -0.0073 -0.0217 0.0054  85   ARG A CA   
1379 C C    . ARG A 85  ? 0.0871 0.0560 0.0566 -0.0014 -0.0167 -0.0016 85   ARG A C    
1380 O O    . ARG A 85  ? 0.0874 0.0552 0.0749 0.0039  -0.0279 0.0087  85   ARG A O    
1381 C CB   . ARG A 85  ? 0.1380 0.1107 0.1359 -0.0503 -0.0021 0.0165  85   ARG A CB   
1382 C CG   . ARG A 85  ? 0.2415 0.1992 0.1432 -0.0146 0.0499  0.0303  85   ARG A CG   
1383 C CD   . ARG A 85  ? 0.2700 0.3457 0.1685 -0.1354 0.0880  -0.0793 85   ARG A CD   
1384 N NE   . ARG A 85  ? 0.4204 0.3634 0.0862 -0.2105 0.0325  -0.0080 85   ARG A NE   
1385 C CZ   . ARG A 85  ? 0.5438 0.3580 0.1731 -0.3015 -0.0265 0.0592  85   ARG A CZ   
1386 N NH1  . ARG A 85  ? 0.7285 0.4458 0.1252 -0.2385 -0.0290 0.1073  85   ARG A NH1  
1387 N NH2  . ARG A 85  ? 0.9560 0.3831 0.1951 -0.3730 -0.1842 0.1461  85   ARG A NH2  
1388 H H    . ARG A 85  ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  85   ARG A H    
1389 H HA   . ARG A 85  ? 0.0875 0.0875 0.0875 0.0000  0.0000  0.0000  85   ARG A HA   
1390 H HB2  . ARG A 85  ? 0.1539 0.1539 0.1539 0.0000  0.0000  0.0000  85   ARG A HB2  
1391 H HB3  . ARG A 85  ? 0.1539 0.1539 0.1539 0.0000  0.0000  0.0000  85   ARG A HB3  
1392 H HG2  . ARG A 85  ? 0.2335 0.2335 0.2335 0.0000  0.0000  0.0000  85   ARG A HG2  
1393 H HG3  . ARG A 85  ? 0.2335 0.2335 0.2335 0.0000  0.0000  0.0000  85   ARG A HG3  
1394 H HD2  . ARG A 85  ? 0.3137 0.3137 0.3137 0.0000  0.0000  0.0000  85   ARG A HD2  
1395 H HD3  . ARG A 85  ? 0.3137 0.3137 0.3137 0.0000  0.0000  0.0000  85   ARG A HD3  
1396 H HE   . ARG A 85  ? 0.3480 0.3480 0.3480 0.0000  0.0000  0.0000  85   ARG A HE   
1397 H HH11 . ARG A 85  ? 0.5198 0.5198 0.5198 0.0000  0.0000  0.0000  85   ARG A HH11 
1398 H HH12 . ARG A 85  ? 0.5198 0.5198 0.5198 0.0000  0.0000  0.0000  85   ARG A HH12 
1399 H HH21 . ARG A 85  ? 0.6138 0.6138 0.6138 0.0000  0.0000  0.0000  85   ARG A HH21 
1400 H HH22 . ARG A 85  ? 0.6138 0.6138 0.6138 0.0000  0.0000  0.0000  85   ARG A HH22 
1401 N N    . GLU A 86  ? 0.0873 0.0533 0.0720 0.0010  -0.0242 0.0056  86   GLU A N    
1402 C CA   . GLU A 86  ? 0.0818 0.0514 0.0845 -0.0030 -0.0229 0.0067  86   GLU A CA   
1403 C C    . GLU A 86  ? 0.0951 0.0566 0.0752 -0.0044 -0.0279 0.0037  86   GLU A C    
1404 O O    . GLU A 86  ? 0.1605 0.0672 0.0715 -0.0070 0.0002  0.0119  86   GLU A O    
1405 C CB   . GLU A 86  ? 0.0890 0.0789 0.1237 0.0049  -0.0371 0.0087  86   GLU A CB   
1406 C CG   . GLU A 86  ? 0.1081 0.0978 0.1270 0.0110  -0.0322 -0.0104 86   GLU A CG   
1407 C CD   . GLU A 86  ? 0.1100 0.0815 0.1148 0.0034  -0.0333 -0.0050 86   GLU A CD   
1408 O OE1  . GLU A 86  ? 0.1348 0.1022 0.1851 0.0233  -0.0502 0.0119  86   GLU A OE1  
1409 O OE2  . GLU A 86  ? 0.1076 0.1009 0.1170 0.0060  -0.0206 -0.0031 86   GLU A OE2  
1410 H H    . GLU A 86  ? 0.0851 0.0851 0.0851 0.0000  0.0000  0.0000  86   GLU A H    
1411 H HA   . GLU A 86  ? 0.0870 0.0870 0.0870 0.0000  0.0000  0.0000  86   GLU A HA   
1412 H HB2  . GLU A 86  ? 0.1166 0.1166 0.1166 0.0000  0.0000  0.0000  86   GLU A HB2  
1413 H HB3  . GLU A 86  ? 0.1166 0.1166 0.1166 0.0000  0.0000  0.0000  86   GLU A HB3  
1414 H HG2  . GLU A 86  ? 0.1331 0.1331 0.1331 0.0000  0.0000  0.0000  86   GLU A HG2  
1415 H HG3  . GLU A 86  ? 0.1331 0.1331 0.1331 0.0000  0.0000  0.0000  86   GLU A HG3  
1416 N N    . THR A 87  ? 0.0862 0.0536 0.0737 -0.0040 -0.0151 0.0041  87   THR A N    
1417 C CA   . THR A 87  ? 0.0947 0.0602 0.0623 -0.0052 -0.0133 -0.0003 87   THR A CA   
1418 C C    . THR A 87  ? 0.1253 0.0680 0.0725 -0.0172 -0.0187 0.0019  87   THR A C    
1419 O O    . THR A 87  ? 0.1095 0.0968 0.1327 0.0155  -0.0572 -0.0362 87   THR A O    
1420 C CB   . THR A 87  ? 0.0881 0.0569 0.0809 -0.0029 -0.0083 -0.0075 87   THR A CB   
1421 O OG1  . THR A 87  ? 0.0971 0.0659 0.1006 0.0046  -0.0195 0.0094  87   THR A OG1  
1422 C CG2  . THR A 87  ? 0.1059 0.0745 0.1121 0.0100  -0.0415 -0.0047 87   THR A CG2  
1423 H H    . THR A 87  ? 0.0854 0.0854 0.0854 0.0000  0.0000  0.0000  87   THR A H    
1424 H HA   . THR A 87  ? 0.0869 0.0869 0.0869 0.0000  0.0000  0.0000  87   THR A HA   
1425 H HB   . THR A 87  ? 0.0903 0.0903 0.0903 0.0000  0.0000  0.0000  87   THR A HB   
1426 H HG1  . THR A 87  ? 0.1318 0.1318 0.1318 0.0000  0.0000  0.0000  87   THR A HG1  
1427 H HG21 . THR A 87  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  87   THR A HG21 
1428 H HG22 . THR A 87  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  87   THR A HG22 
1429 H HG23 . THR A 87  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  87   THR A HG23 
1430 N N    . GLY A 88  ? 0.1477 0.1461 0.0647 -0.0395 0.0017  -0.0227 88   GLY A N    
1431 C CA   . GLY A 88  ? 0.1695 0.2147 0.0854 -0.0770 -0.0114 -0.0186 88   GLY A CA   
1432 C C    . GLY A 88  ? 0.1489 0.1494 0.0772 -0.0226 -0.0075 -0.0315 88   GLY A C    
1433 O O    . GLY A 88  ? 0.2101 0.1801 0.1260 -0.0581 -0.0618 -0.0003 88   GLY A O    
1434 H H    . GLY A 88  ? 0.1434 0.1434 0.1434 0.0000  0.0000  0.0000  88   GLY A H    
1435 H HA2  . GLY A 88  ? 0.1878 0.1878 0.1878 0.0000  0.0000  0.0000  88   GLY A HA2  
1436 H HA3  . GLY A 88  ? 0.1878 0.1878 0.1878 0.0000  0.0000  0.0000  88   GLY A HA3  
1437 N N    . SER A 89  ? 0.1001 0.1132 0.0954 -0.0028 -0.0091 -0.0310 89   SER A N    
1438 C CA   . SER A 89  ? 0.1064 0.1080 0.1265 -0.0157 -0.0127 -0.0408 89   SER A CA   
1439 C C    . SER A 89  ? 0.1000 0.1083 0.1470 -0.0100 -0.0045 -0.0128 89   SER A C    
1440 O O    . SER A 89  ? 0.1176 0.1249 0.2041 -0.0305 0.0028  -0.0115 89   SER A O    
1441 C CB   . SER A 89  ? 0.1176 0.1116 0.1531 -0.0049 -0.0157 -0.0550 89   SER A CB   
1442 O OG   . SER A 89  ? 0.1282 0.1308 0.1583 -0.0067 -0.0366 -0.0379 89   SER A OG   
1443 H H    . SER A 89  ? 0.1235 0.1235 0.1235 0.0000  0.0000  0.0000  89   SER A H    
1444 H HA   . SER A 89  ? 0.1364 0.1364 0.1364 0.0000  0.0000  0.0000  89   SER A HA   
1445 H HB2  . SER A 89  ? 0.1529 0.1529 0.1529 0.0000  0.0000  0.0000  89   SER A HB2  
1446 H HB3  . SER A 89  ? 0.1529 0.1529 0.1529 0.0000  0.0000  0.0000  89   SER A HB3  
1447 H HG   . SER A 89  ? 0.2086 0.2086 0.2086 0.0000  0.0000  0.0000  89   SER A HG   
1448 N N    . SER A 90  ? 0.1159 0.0907 0.1294 0.0178  0.0295  0.0018  90   SER A N    
1449 C CA   . SER A 90  ? 0.1144 0.1185 0.1148 0.0463  0.0183  0.0290  90   SER A CA   
1450 C C    . SER A 90  ? 0.1082 0.0967 0.1321 0.0155  0.0260  0.0081  90   SER A C    
1451 O O    . SER A 90  ? 0.1319 0.1467 0.1035 0.0256  0.0107  0.0328  90   SER A O    
1452 C CB   A SER A 90  ? 0.1406 0.1413 0.0831 0.0700  -0.0218 -0.0012 90   SER A CB   
1453 C CB   B SER A 90  ? 0.1571 0.1734 0.0530 0.0537  0.0051  -0.0181 90   SER A CB   
1454 O OG   A SER A 90  ? 0.0992 0.1080 0.0594 0.0157  -0.0226 0.0146  90   SER A OG   
1455 O OG   B SER A 90  ? 0.0799 0.1361 0.0591 -0.0146 -0.0083 -0.0109 90   SER A OG   
1456 H H    . SER A 90  ? 0.1344 0.1344 0.1344 0.0000  0.0000  0.0000  90   SER A H    
1457 H HA   A SER A 90  ? 0.1391 0.1391 0.1391 0.0000  0.0000  0.0000  90   SER A HA   
1458 H HB2  A SER A 90  ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  90   SER A HB2  
1459 H HB2  B SER A 90  ? 0.1534 0.1534 0.1534 0.0000  0.0000  0.0000  90   SER A HB2  
1460 H HB3  A SER A 90  ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  90   SER A HB3  
1461 H HB3  B SER A 90  ? 0.1534 0.1534 0.1534 0.0000  0.0000  0.0000  90   SER A HB3  
1462 H HG   A SER A 90  ? 0.1332 0.1332 0.1332 0.0000  0.0000  0.0000  90   SER A HG   
1463 H HG   B SER A 90  ? 0.1377 0.1377 0.1377 0.0000  0.0000  0.0000  90   SER A HG   
1464 N N    . LYS A 91  ? 0.1170 0.0854 0.1052 0.0199  0.0108  0.0121  91   LYS A N    
1465 C CA   . LYS A 91  ? 0.1024 0.0829 0.0865 0.0106  -0.0034 0.0104  91   LYS A CA   
1466 C C    . LYS A 91  ? 0.0983 0.0716 0.0813 0.0002  -0.0122 -0.0006 91   LYS A C    
1467 O O    . LYS A 91  ? 0.1124 0.0928 0.0921 0.0053  -0.0164 -0.0078 91   LYS A O    
1468 C CB   . LYS A 91  ? 0.1553 0.0812 0.0951 0.0189  0.0165  -0.0060 91   LYS A CB   
1469 C CG   . LYS A 91  ? 0.1250 0.0990 0.0909 0.0000  -0.0051 -0.0099 91   LYS A CG   
1470 C CD   . LYS A 91  ? 0.1431 0.0996 0.0999 0.0287  -0.0017 -0.0019 91   LYS A CD   
1471 C CE   . LYS A 91  ? 0.1453 0.1207 0.1034 0.0185  -0.0342 -0.0023 91   LYS A CE   
1472 N NZ   . LYS A 91  ? 0.1025 0.0970 0.1138 0.0038  -0.0521 0.0007  91   LYS A NZ   
1473 H H    . LYS A 91  ? 0.1230 0.1230 0.1230 0.0000  0.0000  0.0000  91   LYS A H    
1474 H HA   . LYS A 91  ? 0.1088 0.1088 0.1088 0.0000  0.0000  0.0000  91   LYS A HA   
1475 H HB2  . LYS A 91  ? 0.1326 0.1326 0.1326 0.0000  0.0000  0.0000  91   LYS A HB2  
1476 H HB3  . LYS A 91  ? 0.1326 0.1326 0.1326 0.0000  0.0000  0.0000  91   LYS A HB3  
1477 H HG2  . LYS A 91  ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  91   LYS A HG2  
1478 H HG3  . LYS A 91  ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  91   LYS A HG3  
1479 H HD2  . LYS A 91  ? 0.1370 0.1370 0.1370 0.0000  0.0000  0.0000  91   LYS A HD2  
1480 H HD3  . LYS A 91  ? 0.1370 0.1370 0.1370 0.0000  0.0000  0.0000  91   LYS A HD3  
1481 H HE2  . LYS A 91  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  91   LYS A HE2  
1482 H HE3  . LYS A 91  ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  91   LYS A HE3  
1483 H HZ1  . LYS A 91  ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  91   LYS A HZ1  
1484 H HZ2  . LYS A 91  ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  91   LYS A HZ2  
1485 H HZ3  . LYS A 91  ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  91   LYS A HZ3  
1486 N N    . TYR A 92  ? 0.0808 0.0823 0.0812 -0.0001 -0.0166 -0.0048 92   TYR A N    
1487 C CA   . TYR A 92  ? 0.0843 0.0946 0.0779 -0.0090 -0.0194 -0.0113 92   TYR A CA   
1488 C C    . TYR A 92  ? 0.0870 0.1076 0.0893 -0.0063 -0.0187 0.0074  92   TYR A C    
1489 O O    . TYR A 92  ? 0.1039 0.1163 0.1130 -0.0268 -0.0313 -0.0013 92   TYR A O    
1490 C CB   . TYR A 92  ? 0.0961 0.0905 0.0889 0.0087  -0.0081 -0.0111 92   TYR A CB   
1491 C CG   . TYR A 92  ? 0.0802 0.1229 0.0910 -0.0119 -0.0156 -0.0252 92   TYR A CG   
1492 C CD1  . TYR A 92  ? 0.0742 0.1065 0.0934 -0.0159 -0.0042 -0.0224 92   TYR A CD1  
1493 C CD2  . TYR A 92  ? 0.0725 0.2253 0.1527 -0.0276 -0.0108 -0.1015 92   TYR A CD2  
1494 C CE1  . TYR A 92  ? 0.0954 0.1844 0.1213 -0.0510 0.0143  -0.0656 92   TYR A CE1  
1495 C CE2  . TYR A 92  ? 0.0916 0.2891 0.1929 -0.0503 0.0197  -0.1388 92   TYR A CE2  
1496 C CZ   . TYR A 92  ? 0.1100 0.2595 0.1476 -0.0891 0.0371  -0.1058 92   TYR A CZ   
1497 O OH   . TYR A 92  ? 0.1313 0.3900 0.2322 -0.1229 0.0760  -0.1920 92   TYR A OH   
1498 H H    . TYR A 92  ? 0.0978 0.0978 0.0978 0.0000  0.0000  0.0000  92   TYR A H    
1499 H HA   . TYR A 92  ? 0.1027 0.1027 0.1027 0.0000  0.0000  0.0000  92   TYR A HA   
1500 H HB2  . TYR A 92  ? 0.1102 0.1102 0.1102 0.0000  0.0000  0.0000  92   TYR A HB2  
1501 H HB3  . TYR A 92  ? 0.1102 0.1102 0.1102 0.0000  0.0000  0.0000  92   TYR A HB3  
1502 H HD1  . TYR A 92  ? 0.1097 0.1097 0.1097 0.0000  0.0000  0.0000  92   TYR A HD1  
1503 H HD2  . TYR A 92  ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  92   TYR A HD2  
1504 H HE1  . TYR A 92  ? 0.1605 0.1605 0.1605 0.0000  0.0000  0.0000  92   TYR A HE1  
1505 H HE2  . TYR A 92  ? 0.2294 0.2294 0.2294 0.0000  0.0000  0.0000  92   TYR A HE2  
1506 H HH   . TYR A 92  ? 0.3767 0.3767 0.3767 0.0000  0.0000  0.0000  92   TYR A HH   
1507 N N    . PRO A 93  ? 0.0886 0.1293 0.1008 -0.0176 -0.0166 0.0137  93   PRO A N    
1508 C CA   . PRO A 93  ? 0.0992 0.1496 0.0977 -0.0029 0.0062  0.0223  93   PRO A CA   
1509 C C    . PRO A 93  ? 0.1012 0.1492 0.0815 -0.0113 -0.0164 0.0230  93   PRO A C    
1510 O O    . PRO A 93  ? 0.1332 0.2922 0.0887 0.0507  -0.0004 0.0141  93   PRO A O    
1511 C CB   . PRO A 93  ? 0.1189 0.2106 0.1095 0.0012  0.0182  0.0353  93   PRO A CB   
1512 C CG   . PRO A 93  ? 0.1156 0.2318 0.1994 -0.0754 -0.0384 0.0691  93   PRO A CG   
1513 C CD   . PRO A 93  ? 0.1185 0.1965 0.1368 -0.0658 -0.0211 0.0313  93   PRO A CD   
1514 H HA   . PRO A 93  ? 0.1386 0.1386 0.1386 0.0000  0.0000  0.0000  93   PRO A HA   
1515 H HB2  . PRO A 93  ? 0.1755 0.1755 0.1755 0.0000  0.0000  0.0000  93   PRO A HB2  
1516 H HB3  . PRO A 93  ? 0.1755 0.1755 0.1755 0.0000  0.0000  0.0000  93   PRO A HB3  
1517 H HG2  . PRO A 93  ? 0.2187 0.2187 0.2187 0.0000  0.0000  0.0000  93   PRO A HG2  
1518 H HG3  . PRO A 93  ? 0.2187 0.2187 0.2187 0.0000  0.0000  0.0000  93   PRO A HG3  
1519 H HD2  . PRO A 93  ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  93   PRO A HD2  
1520 H HD3  . PRO A 93  ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  93   PRO A HD3  
1521 N N    . ASN A 94  ? 0.0875 0.0923 0.0919 -0.0147 -0.0165 -0.0014 94   ASN A N    
1522 C CA   . ASN A 94  ? 0.0898 0.0945 0.1065 -0.0150 -0.0304 0.0062  94   ASN A CA   
1523 C C    . ASN A 94  ? 0.0907 0.0766 0.1068 -0.0073 -0.0326 0.0004  94   ASN A C    
1524 O O    . ASN A 94  ? 0.1166 0.1162 0.1138 -0.0317 0.0145  -0.0392 94   ASN A O    
1525 C CB   . ASN A 94  ? 0.1166 0.0826 0.1467 -0.0069 -0.0271 0.0031  94   ASN A CB   
1526 C CG   . ASN A 94  ? 0.1522 0.0888 0.1531 -0.0254 -0.0546 0.0209  94   ASN A CG   
1527 O OD1  . ASN A 94  ? 0.2356 0.1459 0.1517 -0.0644 -0.0267 0.0194  94   ASN A OD1  
1528 N ND2  . ASN A 94  ? 0.1630 0.1541 0.1715 -0.0760 -0.0280 0.0008  94   ASN A ND2  
1529 H H    . ASN A 94  ? 0.1087 0.1087 0.1087 0.0000  0.0000  0.0000  94   ASN A H    
1530 H HA   . ASN A 94  ? 0.1163 0.1163 0.1163 0.0000  0.0000  0.0000  94   ASN A HA   
1531 H HB2  . ASN A 94  ? 0.1383 0.1383 0.1383 0.0000  0.0000  0.0000  94   ASN A HB2  
1532 H HB3  . ASN A 94  ? 0.1383 0.1383 0.1383 0.0000  0.0000  0.0000  94   ASN A HB3  
1533 H HD21 . ASN A 94  ? 0.1954 0.1954 0.1954 0.0000  0.0000  0.0000  94   ASN A HD21 
1534 H HD22 . ASN A 94  ? 0.1954 0.1954 0.1954 0.0000  0.0000  0.0000  94   ASN A HD22 
1535 N N    . CYS A 95  ? 0.0955 0.0846 0.0769 -0.0094 -0.0197 -0.0034 95   CYS A N    
1536 C CA   . CYS A 95  ? 0.0870 0.0707 0.0620 -0.0094 -0.0154 -0.0013 95   CYS A CA   
1537 C C    . CYS A 95  ? 0.0805 0.0667 0.0686 0.0061  -0.0259 0.0061  95   CYS A C    
1538 O O    . CYS A 95  ? 0.0980 0.1385 0.0632 0.0278  -0.0103 0.0174  95   CYS A O    
1539 C CB   . CYS A 95  ? 0.0772 0.0660 0.0701 -0.0016 -0.0270 -0.0029 95   CYS A CB   
1540 S SG   . CYS A 95  ? 0.0746 0.0852 0.0775 -0.0054 -0.0170 -0.0011 95   CYS A SG   
1541 H H    . CYS A 95  ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  95   CYS A H    
1542 H HA   . CYS A 95  ? 0.0879 0.0879 0.0879 0.0000  0.0000  0.0000  95   CYS A HA   
1543 H HB2  . CYS A 95  ? 0.0854 0.0854 0.0854 0.0000  0.0000  0.0000  95   CYS A HB2  
1544 H HB3  . CYS A 95  ? 0.0854 0.0854 0.0854 0.0000  0.0000  0.0000  95   CYS A HB3  
1545 N N    . ALA A 96  ? 0.0815 0.0750 0.0588 -0.0189 -0.0146 -0.0013 96   ALA A N    
1546 C CA   . ALA A 96  ? 0.0835 0.0550 0.0735 -0.0037 -0.0072 -0.0038 96   ALA A CA   
1547 C C    . ALA A 96  ? 0.0793 0.0468 0.0588 0.0013  -0.0165 0.0011  96   ALA A C    
1548 O O    . ALA A 96  ? 0.0759 0.0592 0.0683 -0.0062 -0.0185 -0.0016 96   ALA A O    
1549 C CB   . ALA A 96  ? 0.1300 0.0590 0.1822 -0.0230 0.0456  -0.0308 96   ALA A CB   
1550 H H    . ALA A 96  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  96   ALA A H    
1551 H HA   . ALA A 96  ? 0.0849 0.0849 0.0849 0.0000  0.0000  0.0000  96   ALA A HA   
1552 H HB1  . ALA A 96  ? 0.1855 0.1855 0.1855 0.0000  0.0000  0.0000  96   ALA A HB1  
1553 H HB2  . ALA A 96  ? 0.1855 0.1855 0.1855 0.0000  0.0000  0.0000  96   ALA A HB2  
1554 H HB3  . ALA A 96  ? 0.1855 0.1855 0.1855 0.0000  0.0000  0.0000  96   ALA A HB3  
1555 N N    . TYR A 97  ? 0.0830 0.0463 0.0589 -0.0006 -0.0204 0.0007  97   TYR A N    
1556 C CA   . TYR A 97  ? 0.0752 0.0426 0.0664 0.0028  -0.0278 0.0007  97   TYR A CA   
1557 C C    . TYR A 97  ? 0.0842 0.0497 0.0631 0.0057  -0.0290 -0.0061 97   TYR A C    
1558 O O    . TYR A 97  ? 0.0879 0.0560 0.0701 0.0084  -0.0269 0.0084  97   TYR A O    
1559 C CB   . TYR A 97  ? 0.0784 0.0459 0.0695 0.0095  -0.0255 -0.0037 97   TYR A CB   
1560 C CG   . TYR A 97  ? 0.0757 0.0473 0.0586 0.0045  -0.0198 -0.0079 97   TYR A CG   
1561 C CD1  . TYR A 97  ? 0.0731 0.0468 0.0664 0.0030  -0.0175 -0.0004 97   TYR A CD1  
1562 C CD2  . TYR A 97  ? 0.0903 0.0485 0.0578 0.0029  -0.0295 0.0023  97   TYR A CD2  
1563 C CE1  . TYR A 97  ? 0.0777 0.0491 0.0703 0.0035  -0.0117 0.0053  97   TYR A CE1  
1564 C CE2  . TYR A 97  ? 0.0807 0.0594 0.0579 -0.0127 -0.0227 0.0085  97   TYR A CE2  
1565 C CZ   . TYR A 97  ? 0.0767 0.0555 0.0651 0.0010  -0.0239 0.0008  97   TYR A CZ   
1566 O OH   . TYR A 97  ? 0.0755 0.0757 0.0820 0.0051  -0.0269 0.0063  97   TYR A OH   
1567 H H    . TYR A 97  ? 0.0752 0.0752 0.0752 0.0000  0.0000  0.0000  97   TYR A H    
1568 H HA   . TYR A 97  ? 0.0737 0.0737 0.0737 0.0000  0.0000  0.0000  97   TYR A HA   
1569 H HB2  . TYR A 97  ? 0.0775 0.0775 0.0775 0.0000  0.0000  0.0000  97   TYR A HB2  
1570 H HB3  . TYR A 97  ? 0.0775 0.0775 0.0775 0.0000  0.0000  0.0000  97   TYR A HB3  
1571 H HD1  . TYR A 97  ? 0.0745 0.0745 0.0745 0.0000  0.0000  0.0000  97   TYR A HD1  
1572 H HD2  . TYR A 97  ? 0.0787 0.0787 0.0787 0.0000  0.0000  0.0000  97   TYR A HD2  
1573 H HE1  . TYR A 97  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  97   TYR A HE1  
1574 H HE2  . TYR A 97  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  97   TYR A HE2  
1575 H HH   . TYR A 97  ? 0.1165 0.1165 0.1165 0.0000  0.0000  0.0000  97   TYR A HH   
1576 N N    . LYS A 98  ? 0.0806 0.0470 0.0621 0.0008  -0.0236 -0.0010 98   LYS A N    
1577 C CA   . LYS A 98  ? 0.0727 0.0515 0.0736 0.0075  -0.0191 -0.0106 98   LYS A CA   
1578 C C    . LYS A 98  ? 0.0638 0.0458 0.0734 -0.0014 -0.0178 -0.0070 98   LYS A C    
1579 O O    . LYS A 98  ? 0.0944 0.0416 0.0803 0.0069  -0.0292 -0.0059 98   LYS A O    
1580 C CB   . LYS A 98  ? 0.0991 0.0754 0.0741 0.0044  -0.0121 -0.0082 98   LYS A CB   
1581 C CG   . LYS A 98  ? 0.0983 0.1267 0.1065 0.0041  0.0150  -0.0218 98   LYS A CG   
1582 C CD   . LYS A 98  ? 0.2209 0.2997 0.2748 0.0943  -0.0847 -0.0484 98   LYS A CD   
1583 C CE   . LYS A 98  ? 0.1870 0.4520 0.4192 0.1611  -0.0414 -0.0685 98   LYS A CE   
1584 N NZ   . LYS A 98  ? 0.4337 0.4337 0.4337 0.0000  0.0000  0.0000  98   LYS A NZ   
1585 H H    . LYS A 98  ? 0.0759 0.0759 0.0759 0.0000  0.0000  0.0000  98   LYS A H    
1586 H HA   . LYS A 98  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  98   LYS A HA   
1587 H HB2  . LYS A 98  ? 0.0994 0.0994 0.0994 0.0000  0.0000  0.0000  98   LYS A HB2  
1588 H HB3  . LYS A 98  ? 0.0994 0.0994 0.0994 0.0000  0.0000  0.0000  98   LYS A HB3  
1589 H HG2  . LYS A 98  ? 0.1326 0.1326 0.1326 0.0000  0.0000  0.0000  98   LYS A HG2  
1590 H HG3  . LYS A 98  ? 0.1326 0.1326 0.1326 0.0000  0.0000  0.0000  98   LYS A HG3  
1591 H HD2  . LYS A 98  ? 0.3181 0.3181 0.3181 0.0000  0.0000  0.0000  98   LYS A HD2  
1592 H HD3  . LYS A 98  ? 0.3181 0.3181 0.3181 0.0000  0.0000  0.0000  98   LYS A HD3  
1593 H HE2  . LYS A 98  ? 0.4233 0.4233 0.4233 0.0000  0.0000  0.0000  98   LYS A HE2  
1594 H HE3  . LYS A 98  ? 0.4233 0.4233 0.4233 0.0000  0.0000  0.0000  98   LYS A HE3  
1595 H HZ1  . LYS A 98  ? 0.6505 0.6505 0.6505 0.0000  0.0000  0.0000  98   LYS A HZ1  
1596 H HZ2  . LYS A 98  ? 0.6505 0.6505 0.6505 0.0000  0.0000  0.0000  98   LYS A HZ2  
1597 H HZ3  . LYS A 98  ? 0.6505 0.6505 0.6505 0.0000  0.0000  0.0000  98   LYS A HZ3  
1598 N N    . THR A 99  ? 0.0735 0.0363 0.0690 0.0072  -0.0199 -0.0082 99   THR A N    
1599 C CA   . THR A 99  ? 0.0633 0.0432 0.0664 0.0017  -0.0219 -0.0089 99   THR A CA   
1600 C C    . THR A 99  ? 0.0644 0.0510 0.0766 0.0021  -0.0144 -0.0053 99   THR A C    
1601 O O    . THR A 99  ? 0.0682 0.0610 0.1138 0.0106  -0.0162 -0.0097 99   THR A O    
1602 C CB   . THR A 99  ? 0.0712 0.0357 0.0727 0.0025  -0.0226 -0.0010 99   THR A CB   
1603 O OG1  . THR A 99  ? 0.0747 0.0415 0.0775 -0.0011 -0.0158 -0.0039 99   THR A OG1  
1604 C CG2  . THR A 99  ? 0.0821 0.0471 0.0764 0.0023  -0.0328 -0.0032 99   THR A CG2  
1605 H H    . THR A 99  ? 0.0716 0.0716 0.0716 0.0000  0.0000  0.0000  99   THR A H    
1606 H HA   . THR A 99  ? 0.0692 0.0692 0.0692 0.0000  0.0000  0.0000  99   THR A HA   
1607 H HB   . THR A 99  ? 0.0718 0.0718 0.0718 0.0000  0.0000  0.0000  99   THR A HB   
1608 H HG1  . THR A 99  ? 0.0969 0.0969 0.0969 0.0000  0.0000  0.0000  99   THR A HG1  
1609 H HG21 . THR A 99  ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  99   THR A HG21 
1610 H HG22 . THR A 99  ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  99   THR A HG22 
1611 H HG23 . THR A 99  ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  99   THR A HG23 
1612 N N    . THR A 100 ? 0.0698 0.0545 0.0909 -0.0010 -0.0031 -0.0149 100  THR A N    
1613 C CA   . THR A 100 ? 0.0793 0.0723 0.1062 -0.0187 0.0164  -0.0312 100  THR A CA   
1614 C C    . THR A 100 ? 0.0735 0.0537 0.1084 -0.0075 0.0088  -0.0153 100  THR A C    
1615 O O    . THR A 100 ? 0.0747 0.0629 0.1133 0.0044  -0.0031 -0.0228 100  THR A O    
1616 C CB   . THR A 100 ? 0.1024 0.0995 0.1101 -0.0285 0.0248  -0.0203 100  THR A CB   
1617 O OG1  . THR A 100 ? 0.1126 0.1354 0.1096 -0.0278 0.0172  -0.0489 100  THR A OG1  
1618 C CG2  . THR A 100 ? 0.1384 0.3019 0.1191 -0.1256 0.0248  -0.0266 100  THR A CG2  
1619 H H    . THR A 100 ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  100  THR A H    
1620 H HA   . THR A 100 ? 0.1031 0.1031 0.1031 0.0000  0.0000  0.0000  100  THR A HA   
1621 H HB   . THR A 100 ? 0.1249 0.1249 0.1249 0.0000  0.0000  0.0000  100  THR A HB   
1622 H HG1  . THR A 100 ? 0.1787 0.1787 0.1787 0.0000  0.0000  0.0000  100  THR A HG1  
1623 H HG21 . THR A 100 ? 0.2798 0.2798 0.2798 0.0000  0.0000  0.0000  100  THR A HG21 
1624 H HG22 . THR A 100 ? 0.2798 0.2798 0.2798 0.0000  0.0000  0.0000  100  THR A HG22 
1625 H HG23 . THR A 100 ? 0.2798 0.2798 0.2798 0.0000  0.0000  0.0000  100  THR A HG23 
1626 N N    . GLN A 101 ? 0.0691 0.0552 0.1302 0.0041  -0.0125 -0.0263 101  GLN A N    
1627 C CA   . GLN A 101 ? 0.0805 0.0514 0.1083 0.0006  -0.0039 -0.0159 101  GLN A CA   
1628 C C    . GLN A 101 ? 0.0637 0.0583 0.1052 -0.0025 -0.0107 -0.0099 101  GLN A C    
1629 O O    . GLN A 101 ? 0.0882 0.0792 0.1277 -0.0082 0.0147  -0.0348 101  GLN A O    
1630 C CB   . GLN A 101 ? 0.0831 0.0734 0.1273 0.0066  -0.0185 -0.0106 101  GLN A CB   
1631 C CG   . GLN A 101 ? 0.1027 0.0851 0.1439 0.0068  -0.0027 0.0065  101  GLN A CG   
1632 C CD   . GLN A 101 ? 0.1225 0.0983 0.1765 0.0115  -0.0048 0.0239  101  GLN A CD   
1633 O OE1  . GLN A 101 ? 0.1213 0.1896 0.2044 0.0426  0.0167  0.0673  101  GLN A OE1  
1634 N NE2  . GLN A 101 ? 0.1407 0.1364 0.1325 0.0095  0.0086  0.0136  101  GLN A NE2  
1635 H H    . GLN A 101 ? 0.1018 0.1018 0.1018 0.0000  0.0000  0.0000  101  GLN A H    
1636 H HA   . GLN A 101 ? 0.0961 0.0961 0.0961 0.0000  0.0000  0.0000  101  GLN A HA   
1637 H HB2  . GLN A 101 ? 0.1135 0.1135 0.1135 0.0000  0.0000  0.0000  101  GLN A HB2  
1638 H HB3  . GLN A 101 ? 0.1135 0.1135 0.1135 0.0000  0.0000  0.0000  101  GLN A HB3  
1639 H HG2  . GLN A 101 ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  101  GLN A HG2  
1640 H HG3  . GLN A 101 ? 0.1327 0.1327 0.1327 0.0000  0.0000  0.0000  101  GLN A HG3  
1641 H HE21 . GLN A 101 ? 0.1638 0.1638 0.1638 0.0000  0.0000  0.0000  101  GLN A HE21 
1642 H HE22 . GLN A 101 ? 0.1638 0.1638 0.1638 0.0000  0.0000  0.0000  101  GLN A HE22 
1643 N N    . ALA A 102 ? 0.0628 0.0569 0.0957 0.0009  -0.0061 -0.0097 102  ALA A N    
1644 C CA   . ALA A 102 ? 0.0758 0.0647 0.0834 -0.0112 -0.0096 -0.0087 102  ALA A CA   
1645 C C    . ALA A 102 ? 0.0588 0.0549 0.0806 -0.0043 -0.0093 -0.0034 102  ALA A C    
1646 O O    . ALA A 102 ? 0.0591 0.0527 0.0874 -0.0021 -0.0109 0.0006  102  ALA A O    
1647 C CB   . ALA A 102 ? 0.1335 0.0798 0.0917 -0.0145 -0.0383 0.0007  102  ALA A CB   
1648 H H    . ALA A 102 ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  102  ALA A H    
1649 H HA   . ALA A 102 ? 0.0895 0.0895 0.0895 0.0000  0.0000  0.0000  102  ALA A HA   
1650 H HB1  . ALA A 102 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  102  ALA A HB1  
1651 H HB2  . ALA A 102 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  102  ALA A HB2  
1652 H HB3  . ALA A 102 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  102  ALA A HB3  
1653 N N    . ASN A 103 ? 0.0721 0.0591 0.0847 -0.0097 0.0038  -0.0035 103  ASN A N    
1654 C CA   . ASN A 103 ? 0.0841 0.0482 0.0916 -0.0112 -0.0034 0.0017  103  ASN A CA   
1655 C C    . ASN A 103 ? 0.0902 0.0562 0.0913 -0.0060 0.0070  0.0001  103  ASN A C    
1656 O O    . ASN A 103 ? 0.1081 0.0959 0.1575 0.0185  0.0615  0.0403  103  ASN A O    
1657 C CB   A ASN A 103 ? 0.0844 0.0841 0.1160 -0.0033 -0.0150 0.0096  103  ASN A CB   
1658 C CB   B ASN A 103 ? 0.0787 0.0402 0.0956 -0.0263 0.0013  -0.0113 103  ASN A CB   
1659 C CG   A ASN A 103 ? 0.0772 0.0937 0.1724 -0.0192 -0.0302 0.0387  103  ASN A CG   
1660 C CG   B ASN A 103 ? 0.0714 0.0371 0.1304 0.0015  -0.0382 -0.0062 103  ASN A CG   
1661 O OD1  A ASN A 103 ? 0.1275 0.0902 0.2229 0.0020  -0.0362 0.0509  103  ASN A OD1  
1662 O OD1  B ASN A 103 ? 0.0649 0.0535 0.1100 0.0016  -0.0242 -0.0037 103  ASN A OD1  
1663 N ND2  A ASN A 103 ? 0.1203 0.1021 0.1275 -0.0424 -0.0193 0.0376  103  ASN A ND2  
1664 N ND2  B ASN A 103 ? 0.0760 0.0735 0.1510 0.0174  -0.0432 -0.0228 103  ASN A ND2  
1665 H H    . ASN A 103 ? 0.0864 0.0864 0.0864 0.0000  0.0000  0.0000  103  ASN A H    
1666 H HA   A ASN A 103 ? 0.0895 0.0895 0.0895 0.0000  0.0000  0.0000  103  ASN A HA   
1667 H HB2  A ASN A 103 ? 0.1137 0.1137 0.1137 0.0000  0.0000  0.0000  103  ASN A HB2  
1668 H HB2  B ASN A 103 ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  103  ASN A HB2  
1669 H HB3  A ASN A 103 ? 0.1137 0.1137 0.1137 0.0000  0.0000  0.0000  103  ASN A HB3  
1670 H HB3  B ASN A 103 ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  103  ASN A HB3  
1671 H HD21 A ASN A 103 ? 0.1399 0.1399 0.1399 0.0000  0.0000  0.0000  103  ASN A HD21 
1672 H HD21 B ASN A 103 ? 0.1202 0.1202 0.1202 0.0000  0.0000  0.0000  103  ASN A HD21 
1673 H HD22 A ASN A 103 ? 0.1399 0.1399 0.1399 0.0000  0.0000  0.0000  103  ASN A HD22 
1674 H HD22 B ASN A 103 ? 0.1202 0.1202 0.1202 0.0000  0.0000  0.0000  103  ASN A HD22 
1675 N N    . LYS A 104 ? 0.0764 0.0551 0.0743 -0.0041 0.0032  -0.0024 104  LYS A N    
1676 C CA   . LYS A 104 ? 0.0897 0.0554 0.0650 -0.0078 0.0004  0.0015  104  LYS A CA   
1677 C C    . LYS A 104 ? 0.0733 0.0499 0.0709 -0.0065 -0.0073 0.0005  104  LYS A C    
1678 O O    . LYS A 104 ? 0.0770 0.0641 0.0614 0.0004  -0.0058 0.0028  104  LYS A O    
1679 C CB   . LYS A 104 ? 0.1312 0.0567 0.0777 -0.0143 -0.0128 -0.0092 104  LYS A CB   
1680 C CG   A LYS A 104 ? 0.1956 0.0637 0.0642 -0.0343 -0.0101 -0.0114 104  LYS A CG   
1681 C CG   B LYS A 104 ? 0.2099 0.0533 0.0965 0.0099  0.0130  -0.0057 104  LYS A CG   
1682 C CD   A LYS A 104 ? 0.2609 0.0817 0.0948 0.0031  0.0635  -0.0229 104  LYS A CD   
1683 C CD   B LYS A 104 ? 0.1839 0.1323 0.1129 0.0081  0.0019  -0.0321 104  LYS A CD   
1684 C CE   A LYS A 104 ? 0.2893 0.1482 0.1281 0.0189  0.0339  -0.0683 104  LYS A CE   
1685 C CE   B LYS A 104 ? 0.3105 0.1486 0.1117 -0.0121 -0.0272 -0.0137 104  LYS A CE   
1686 N NZ   A LYS A 104 ? 0.3397 0.3793 0.2069 0.0344  0.1284  -0.1709 104  LYS A NZ   
1687 N NZ   B LYS A 104 ? 0.3960 0.2129 0.1118 -0.0783 -0.0438 0.0020  104  LYS A NZ   
1688 H H    . LYS A 104 ? 0.0823 0.0823 0.0823 0.0000  0.0000  0.0000  104  LYS A H    
1689 H HA   . LYS A 104 ? 0.0841 0.0841 0.0841 0.0000  0.0000  0.0000  104  LYS A HA   
1690 H HB2  A LYS A 104 ? 0.1063 0.1063 0.1063 0.0000  0.0000  0.0000  104  LYS A HB2  
1691 H HB3  A LYS A 104 ? 0.1063 0.1063 0.1063 0.0000  0.0000  0.0000  104  LYS A HB3  
1692 H HG2  A LYS A 104 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  104  LYS A HG2  
1693 H HG2  B LYS A 104 ? 0.1439 0.1439 0.1439 0.0000  0.0000  0.0000  104  LYS A HG2  
1694 H HG3  A LYS A 104 ? 0.1294 0.1294 0.1294 0.0000  0.0000  0.0000  104  LYS A HG3  
1695 H HG3  B LYS A 104 ? 0.1439 0.1439 0.1439 0.0000  0.0000  0.0000  104  LYS A HG3  
1696 H HD2  A LYS A 104 ? 0.1749 0.1749 0.1749 0.0000  0.0000  0.0000  104  LYS A HD2  
1697 H HD2  B LYS A 104 ? 0.1716 0.1716 0.1716 0.0000  0.0000  0.0000  104  LYS A HD2  
1698 H HD3  A LYS A 104 ? 0.1749 0.1749 0.1749 0.0000  0.0000  0.0000  104  LYS A HD3  
1699 H HD3  B LYS A 104 ? 0.1716 0.1716 0.1716 0.0000  0.0000  0.0000  104  LYS A HD3  
1700 H HE2  A LYS A 104 ? 0.2262 0.2262 0.2262 0.0000  0.0000  0.0000  104  LYS A HE2  
1701 H HE2  B LYS A 104 ? 0.2284 0.2284 0.2284 0.0000  0.0000  0.0000  104  LYS A HE2  
1702 H HE3  A LYS A 104 ? 0.2262 0.2262 0.2262 0.0000  0.0000  0.0000  104  LYS A HE3  
1703 H HE3  B LYS A 104 ? 0.2284 0.2284 0.2284 0.0000  0.0000  0.0000  104  LYS A HE3  
1704 H HZ1  B LYS A 104 ? 0.3603 0.3603 0.3603 0.0000  0.0000  0.0000  104  LYS A HZ1  
1705 H HZ2  B LYS A 104 ? 0.3603 0.3603 0.3603 0.0000  0.0000  0.0000  104  LYS A HZ2  
1706 H HZ3  B LYS A 104 ? 0.3603 0.3603 0.3603 0.0000  0.0000  0.0000  104  LYS A HZ3  
1707 N N    . HIS A 105 ? 0.0870 0.0515 0.0761 -0.0024 0.0046  0.0017  105  HIS A N    
1708 C CA   . HIS A 105 ? 0.0932 0.0528 0.0702 0.0035  -0.0116 -0.0023 105  HIS A CA   
1709 C C    . HIS A 105 ? 0.0958 0.0775 0.0755 -0.0016 -0.0148 -0.0095 105  HIS A C    
1710 O O    . HIS A 105 ? 0.1105 0.2061 0.0912 -0.0194 -0.0274 -0.0494 105  HIS A O    
1711 C CB   . HIS A 105 ? 0.1219 0.0459 0.0885 0.0045  -0.0121 0.0106  105  HIS A CB   
1712 C CG   . HIS A 105 ? 0.1072 0.0554 0.1031 -0.0058 0.0224  -0.0010 105  HIS A CG   
1713 N ND1  . HIS A 105 ? 0.1009 0.0905 0.1237 -0.0119 0.0089  -0.0047 105  HIS A ND1  
1714 C CD2  . HIS A 105 ? 0.1285 0.1001 0.1249 0.0090  0.0386  -0.0059 105  HIS A CD2  
1715 C CE1  . HIS A 105 ? 0.1017 0.1039 0.1612 -0.0233 0.0256  -0.0073 105  HIS A CE1  
1716 N NE2  . HIS A 105 ? 0.1071 0.1466 0.2084 -0.0076 0.0658  -0.0102 105  HIS A NE2  
1717 H H    . HIS A 105 ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  105  HIS A H    
1718 H HA   . HIS A 105 ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  105  HIS A HA   
1719 H HB2  . HIS A 105 ? 0.1025 0.1025 0.1025 0.0000  0.0000  0.0000  105  HIS A HB2  
1720 H HB3  . HIS A 105 ? 0.1025 0.1025 0.1025 0.0000  0.0000  0.0000  105  HIS A HB3  
1721 H HD1  . HIS A 105 ? 0.1260 0.1260 0.1260 0.0000  0.0000  0.0000  105  HIS A HD1  
1722 H HD2  . HIS A 105 ? 0.1415 0.1415 0.1415 0.0000  0.0000  0.0000  105  HIS A HD2  
1723 H HE1  . HIS A 105 ? 0.1468 0.1468 0.1468 0.0000  0.0000  0.0000  105  HIS A HE1  
1724 N N    . ILE A 106 ? 0.0830 0.0446 0.0812 0.0088  -0.0302 -0.0102 106  ILE A N    
1725 C CA   . ILE A 106 ? 0.0807 0.0432 0.0849 0.0015  -0.0370 -0.0011 106  ILE A CA   
1726 C C    . ILE A 106 ? 0.0753 0.0347 0.0711 0.0006  -0.0243 0.0057  106  ILE A C    
1727 O O    . ILE A 106 ? 0.0718 0.0366 0.0823 -0.0020 -0.0327 0.0038  106  ILE A O    
1728 C CB   . ILE A 106 ? 0.0858 0.0350 0.0962 -0.0024 -0.0361 0.0116  106  ILE A CB   
1729 C CG1  . ILE A 106 ? 0.0821 0.0655 0.0858 -0.0145 -0.0187 0.0212  106  ILE A CG1  
1730 C CG2  . ILE A 106 ? 0.1225 0.0414 0.1484 -0.0040 -0.0564 0.0248  106  ILE A CG2  
1731 C CD1  . ILE A 106 ? 0.0859 0.0949 0.1067 -0.0092 -0.0098 0.0380  106  ILE A CD1  
1732 H H    . ILE A 106 ? 0.0835 0.0835 0.0835 0.0000  0.0000  0.0000  106  ILE A H    
1733 H HA   . ILE A 106 ? 0.0836 0.0836 0.0836 0.0000  0.0000  0.0000  106  ILE A HA   
1734 H HB   . ILE A 106 ? 0.0868 0.0868 0.0868 0.0000  0.0000  0.0000  106  ILE A HB   
1735 H HG12 . ILE A 106 ? 0.0933 0.0933 0.0933 0.0000  0.0000  0.0000  106  ILE A HG12 
1736 H HG13 . ILE A 106 ? 0.0933 0.0933 0.0933 0.0000  0.0000  0.0000  106  ILE A HG13 
1737 H HG21 . ILE A 106 ? 0.1562 0.1562 0.1562 0.0000  0.0000  0.0000  106  ILE A HG21 
1738 H HG22 . ILE A 106 ? 0.1562 0.1562 0.1562 0.0000  0.0000  0.0000  106  ILE A HG22 
1739 H HG23 . ILE A 106 ? 0.1562 0.1562 0.1562 0.0000  0.0000  0.0000  106  ILE A HG23 
1740 H HD11 . ILE A 106 ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  106  ILE A HD11 
1741 H HD12 . ILE A 106 ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  106  ILE A HD12 
1742 H HD13 . ILE A 106 ? 0.1437 0.1437 0.1437 0.0000  0.0000  0.0000  106  ILE A HD13 
1743 N N    . ILE A 107 ? 0.0737 0.0396 0.0690 0.0004  -0.0273 -0.0015 107  ILE A N    
1744 C CA   . ILE A 107 ? 0.0729 0.0467 0.0562 -0.0004 -0.0232 0.0064  107  ILE A CA   
1745 C C    . ILE A 107 ? 0.0715 0.0380 0.0657 -0.0028 -0.0186 0.0101  107  ILE A C    
1746 O O    . ILE A 107 ? 0.0761 0.0510 0.0680 -0.0047 -0.0272 0.0033  107  ILE A O    
1747 C CB   . ILE A 107 ? 0.0840 0.0562 0.0574 -0.0042 -0.0240 0.0070  107  ILE A CB   
1748 C CG1  A ILE A 107 ? 0.0880 0.0915 0.0709 -0.0160 -0.0174 0.0016  107  ILE A CG1  
1749 C CG1  B ILE A 107 ? 0.1018 0.0852 0.0628 0.0048  0.0100  -0.0031 107  ILE A CG1  
1750 C CG2  . ILE A 107 ? 0.0851 0.0612 0.0667 -0.0031 -0.0253 0.0130  107  ILE A CG2  
1751 C CD1  A ILE A 107 ? 0.1099 0.1193 0.0795 -0.0099 0.0083  0.0015  107  ILE A CD1  
1752 C CD1  B ILE A 107 ? 0.1050 0.0808 0.1048 0.0171  -0.0005 0.0190  107  ILE A CD1  
1753 H H    . ILE A 107 ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  107  ILE A H    
1754 H HA   . ILE A 107 ? 0.0703 0.0703 0.0703 0.0000  0.0000  0.0000  107  ILE A HA   
1755 H HB   A ILE A 107 ? 0.0790 0.0790 0.0790 0.0000  0.0000  0.0000  107  ILE A HB   
1756 H HG12 A ILE A 107 ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  107  ILE A HG12 
1757 H HG12 B ILE A 107 ? 0.0999 0.0999 0.0999 0.0000  0.0000  0.0000  107  ILE A HG12 
1758 H HG13 A ILE A 107 ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  107  ILE A HG13 
1759 H HG13 B ILE A 107 ? 0.0999 0.0999 0.0999 0.0000  0.0000  0.0000  107  ILE A HG13 
1760 H HG21 . ILE A 107 ? 0.1065 0.1065 0.1065 0.0000  0.0000  0.0000  107  ILE A HG21 
1761 H HG22 . ILE A 107 ? 0.1065 0.1065 0.1065 0.0000  0.0000  0.0000  107  ILE A HG22 
1762 H HG23 . ILE A 107 ? 0.1065 0.1065 0.1065 0.0000  0.0000  0.0000  107  ILE A HG23 
1763 H HD11 A ILE A 107 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  107  ILE A HD11 
1764 H HD11 B ILE A 107 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  107  ILE A HD11 
1765 H HD12 A ILE A 107 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  107  ILE A HD12 
1766 H HD12 B ILE A 107 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  107  ILE A HD12 
1767 H HD13 A ILE A 107 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  107  ILE A HD13 
1768 H HD13 B ILE A 107 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  107  ILE A HD13 
1769 N N    . VAL A 108 ? 0.0676 0.0449 0.0766 -0.0075 -0.0119 0.0043  108  VAL A N    
1770 C CA   . VAL A 108 ? 0.0683 0.0504 0.0743 -0.0088 -0.0137 0.0080  108  VAL A CA   
1771 C C    . VAL A 108 ? 0.0703 0.0607 0.0713 -0.0014 -0.0106 0.0148  108  VAL A C    
1772 O O    . VAL A 108 ? 0.0648 0.0497 0.1076 -0.0069 -0.0156 0.0200  108  VAL A O    
1773 C CB   . VAL A 108 ? 0.0722 0.0610 0.0805 -0.0013 -0.0050 0.0138  108  VAL A CB   
1774 C CG1  . VAL A 108 ? 0.0963 0.0715 0.0948 -0.0080 -0.0208 0.0333  108  VAL A CG1  
1775 C CG2  . VAL A 108 ? 0.0811 0.0842 0.0768 0.0046  -0.0076 0.0078  108  VAL A CG2  
1776 H H    . VAL A 108 ? 0.0756 0.0756 0.0756 0.0000  0.0000  0.0000  108  VAL A H    
1777 H HA   . VAL A 108 ? 0.0771 0.0771 0.0771 0.0000  0.0000  0.0000  108  VAL A HA   
1778 H HB   . VAL A 108 ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  108  VAL A HB   
1779 H HG11 . VAL A 108 ? 0.1312 0.1312 0.1312 0.0000  0.0000  0.0000  108  VAL A HG11 
1780 H HG12 . VAL A 108 ? 0.1312 0.1312 0.1312 0.0000  0.0000  0.0000  108  VAL A HG12 
1781 H HG13 . VAL A 108 ? 0.1312 0.1312 0.1312 0.0000  0.0000  0.0000  108  VAL A HG13 
1782 H HG21 . VAL A 108 ? 0.1211 0.1211 0.1211 0.0000  0.0000  0.0000  108  VAL A HG21 
1783 H HG22 . VAL A 108 ? 0.1211 0.1211 0.1211 0.0000  0.0000  0.0000  108  VAL A HG22 
1784 H HG23 . VAL A 108 ? 0.1211 0.1211 0.1211 0.0000  0.0000  0.0000  108  VAL A HG23 
1785 N N    . ALA A 109 ? 0.0668 0.0613 0.0753 -0.0157 -0.0182 0.0162  109  ALA A N    
1786 C CA   . ALA A 109 ? 0.0616 0.0787 0.0873 -0.0093 -0.0138 0.0275  109  ALA A CA   
1787 C C    . ALA A 109 ? 0.0599 0.0637 0.1003 -0.0038 -0.0168 0.0301  109  ALA A C    
1788 O O    . ALA A 109 ? 0.0747 0.0697 0.0917 -0.0106 -0.0065 0.0215  109  ALA A O    
1789 C CB   . ALA A 109 ? 0.0765 0.1222 0.1050 -0.0078 -0.0274 0.0266  109  ALA A CB   
1790 H H    . ALA A 109 ? 0.0814 0.0814 0.0814 0.0000  0.0000  0.0000  109  ALA A H    
1791 H HA   . ALA A 109 ? 0.0911 0.0911 0.0911 0.0000  0.0000  0.0000  109  ALA A HA   
1792 H HB1  . ALA A 109 ? 0.1519 0.1519 0.1519 0.0000  0.0000  0.0000  109  ALA A HB1  
1793 H HB2  . ALA A 109 ? 0.1519 0.1519 0.1519 0.0000  0.0000  0.0000  109  ALA A HB2  
1794 H HB3  . ALA A 109 ? 0.1519 0.1519 0.1519 0.0000  0.0000  0.0000  109  ALA A HB3  
1795 N N    . CYS A 110 ? 0.0701 0.0675 0.0861 -0.0047 -0.0182 0.0294  110  CYS A N    
1796 C CA   . CYS A 110 ? 0.0660 0.0676 0.0990 0.0057  -0.0095 0.0356  110  CYS A CA   
1797 C C    . CYS A 110 ? 0.0721 0.0672 0.1028 0.0023  -0.0237 0.0303  110  CYS A C    
1798 O O    . CYS A 110 ? 0.1104 0.0999 0.1404 0.0271  -0.0077 0.0618  110  CYS A O    
1799 C CB   . CYS A 110 ? 0.0758 0.0633 0.1035 0.0026  -0.0101 0.0223  110  CYS A CB   
1800 S SG   . CYS A 110 ? 0.0611 0.0687 0.0991 -0.0020 -0.0153 0.0136  110  CYS A SG   
1801 H H    . CYS A 110 ? 0.0895 0.0895 0.0895 0.0000  0.0000  0.0000  110  CYS A H    
1802 H HA   . CYS A 110 ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  110  CYS A HA   
1803 H HB2  . CYS A 110 ? 0.0970 0.0970 0.0970 0.0000  0.0000  0.0000  110  CYS A HB2  
1804 H HB3  . CYS A 110 ? 0.0970 0.0970 0.0970 0.0000  0.0000  0.0000  110  CYS A HB3  
1805 N N    . GLU A 111 ? 0.0658 0.0629 0.1217 0.0068  -0.0159 0.0333  111  GLU A N    
1806 C CA   . GLU A 111 ? 0.0731 0.0848 0.1607 0.0119  -0.0193 0.0357  111  GLU A CA   
1807 C C    . GLU A 111 ? 0.0686 0.0774 0.1611 0.0071  0.0003  0.0204  111  GLU A C    
1808 O O    . GLU A 111 ? 0.0855 0.0905 0.1681 0.0184  0.0237  0.0406  111  GLU A O    
1809 C CB   . GLU A 111 ? 0.0941 0.1745 0.2005 -0.0012 -0.0576 0.0200  111  GLU A CB   
1810 C CG   . GLU A 111 ? 0.2905 0.2905 0.2905 0.0000  0.0000  0.0000  111  GLU A CG   
1811 C CD   . GLU A 111 ? 0.6127 0.6127 0.6127 0.0000  0.0000  0.0000  111  GLU A CD   
1812 O OE1  . GLU A 111 ? 0.4185 0.4185 0.4185 0.0000  0.0000  0.0000  111  GLU A OE1  
1813 O OE2  . GLU A 111 ? 0.4262 0.4262 0.4262 0.0000  0.0000  0.0000  111  GLU A OE2  
1814 H H    . GLU A 111 ? 0.1002 0.1002 0.1002 0.0000  0.0000  0.0000  111  GLU A H    
1815 H HA   . GLU A 111 ? 0.1274 0.1274 0.1274 0.0000  0.0000  0.0000  111  GLU A HA   
1816 H HB2  . GLU A 111 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  111  GLU A HB2  
1817 H HB3  . GLU A 111 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  111  GLU A HB3  
1818 N N    . GLY A 112 ? 0.0894 0.0944 0.2027 0.0271  0.0225  0.0432  112  GLY A N    
1819 C CA   . GLY A 112 ? 0.0927 0.1441 0.2827 0.0329  0.0642  0.0346  112  GLY A CA   
1820 C C    . GLY A 112 ? 0.1253 0.1056 0.2407 0.0386  0.0731  0.0354  112  GLY A C    
1821 O O    . GLY A 112 ? 0.1123 0.0961 0.1918 0.0163  0.0612  0.0361  112  GLY A O    
1822 H H    . GLY A 112 ? 0.1546 0.1546 0.1546 0.0000  0.0000  0.0000  112  GLY A H    
1823 H HA2  . GLY A 112 ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  112  GLY A HA2  
1824 H HA3  . GLY A 112 ? 0.2078 0.2078 0.2078 0.0000  0.0000  0.0000  112  GLY A HA3  
1825 N N    . ASN A 113 ? 0.1631 0.1432 0.2615 0.0418  0.1093  0.0369  113  ASN A N    
1826 C CA   . ASN A 113 ? 0.2259 0.1749 0.2538 0.0474  0.1311  0.0082  113  ASN A CA   
1827 C C    . ASN A 113 ? 0.2709 0.2276 0.2732 0.1057  0.1652  0.0615  113  ASN A C    
1828 O O    . ASN A 113 ? 0.3334 0.2591 0.2855 0.0619  0.2099  0.0632  113  ASN A O    
1829 C CB   . ASN A 113 ? 0.2818 0.2003 0.2479 0.0903  0.1369  0.0163  113  ASN A CB   
1830 C CG   . ASN A 113 ? 0.2225 0.2225 0.2225 0.0000  0.0000  0.0000  113  ASN A CG   
1831 O OD1  . ASN A 113 ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  113  ASN A OD1  
1832 N ND2  . ASN A 113 ? 0.5437 0.5437 0.5437 0.0000  0.0000  0.0000  113  ASN A ND2  
1833 H H    . ASN A 113 ? 0.2271 0.2271 0.2271 0.0000  0.0000  0.0000  113  ASN A H    
1834 H HA   . ASN A 113 ? 0.2619 0.2619 0.2619 0.0000  0.0000  0.0000  113  ASN A HA   
1835 H HB2  . ASN A 113 ? 0.2921 0.2921 0.2921 0.0000  0.0000  0.0000  113  ASN A HB2  
1836 H HB3  . ASN A 113 ? 0.2921 0.2921 0.2921 0.0000  0.0000  0.0000  113  ASN A HB3  
1837 H HD21 . ASN A 113 ? 0.6525 0.6525 0.6525 0.0000  0.0000  0.0000  113  ASN A HD21 
1838 H HD22 . ASN A 113 ? 0.6525 0.6525 0.6525 0.0000  0.0000  0.0000  113  ASN A HD22 
1839 N N    . PRO A 114 ? 0.2747 0.1990 0.2375 0.0183  0.1698  0.0590  114  PRO A N    
1840 C CA   . PRO A 114 ? 0.2330 0.1207 0.1946 0.0104  0.0972  -0.0021 114  PRO A CA   
1841 C C    . PRO A 114 ? 0.1535 0.1044 0.1585 0.0193  0.0675  0.0390  114  PRO A C    
1842 O O    . PRO A 114 ? 0.1349 0.1312 0.1749 0.0069  0.0699  0.0351  114  PRO A O    
1843 C CB   . PRO A 114 ? 0.2925 0.2258 0.1336 -0.0198 0.0944  0.0332  114  PRO A CB   
1844 C CG   . PRO A 114 ? 0.2857 0.2120 0.1247 0.0108  0.0272  0.0365  114  PRO A CG   
1845 C CD   . PRO A 114 ? 0.2826 0.2410 0.1874 0.0524  0.1242  0.0687  114  PRO A CD   
1846 H HA   . PRO A 114 ? 0.2192 0.2192 0.2192 0.0000  0.0000  0.0000  114  PRO A HA   
1847 H HB2  . PRO A 114 ? 0.2608 0.2608 0.2608 0.0000  0.0000  0.0000  114  PRO A HB2  
1848 H HB3  . PRO A 114 ? 0.2608 0.2608 0.2608 0.0000  0.0000  0.0000  114  PRO A HB3  
1849 H HG2  . PRO A 114 ? 0.2490 0.2490 0.2490 0.0000  0.0000  0.0000  114  PRO A HG2  
1850 H HG3  . PRO A 114 ? 0.2490 0.2490 0.2490 0.0000  0.0000  0.0000  114  PRO A HG3  
1851 H HD2  . PRO A 114 ? 0.2843 0.2843 0.2843 0.0000  0.0000  0.0000  114  PRO A HD2  
1852 H HD3  . PRO A 114 ? 0.2843 0.2843 0.2843 0.0000  0.0000  0.0000  114  PRO A HD3  
1853 N N    . TYR A 115 ? 0.1322 0.0932 0.1197 0.0046  0.0330  0.0047  115  TYR A N    
1854 C CA   . TYR A 115 ? 0.1190 0.0617 0.1159 0.0130  0.0272  0.0073  115  TYR A CA   
1855 C C    . TYR A 115 ? 0.0920 0.0730 0.1010 -0.0004 -0.0057 0.0128  115  TYR A C    
1856 O O    . TYR A 115 ? 0.1098 0.0842 0.1461 -0.0061 -0.0351 0.0018  115  TYR A O    
1857 C CB   . TYR A 115 ? 0.1071 0.0606 0.1201 0.0019  0.0172  0.0027  115  TYR A CB   
1858 C CG   . TYR A 115 ? 0.0882 0.0511 0.1151 0.0073  0.0095  0.0173  115  TYR A CG   
1859 C CD1  . TYR A 115 ? 0.0776 0.0784 0.1339 0.0128  0.0149  0.0184  115  TYR A CD1  
1860 C CD2  . TYR A 115 ? 0.0751 0.0475 0.1005 0.0033  -0.0068 0.0107  115  TYR A CD2  
1861 C CE1  . TYR A 115 ? 0.0702 0.0835 0.1275 0.0145  0.0044  0.0246  115  TYR A CE1  
1862 C CE2  . TYR A 115 ? 0.0658 0.0459 0.1012 0.0038  -0.0035 0.0088  115  TYR A CE2  
1863 C CZ   . TYR A 115 ? 0.0756 0.0529 0.0995 0.0039  -0.0005 0.0157  115  TYR A CZ   
1864 O OH   . TYR A 115 ? 0.0731 0.0706 0.0979 0.0028  -0.0157 0.0157  115  TYR A OH   
1865 H H    . TYR A 115 ? 0.1381 0.1381 0.1381 0.0000  0.0000  0.0000  115  TYR A H    
1866 H HA   . TYR A 115 ? 0.1185 0.1185 0.1185 0.0000  0.0000  0.0000  115  TYR A HA   
1867 H HB2  . TYR A 115 ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  115  TYR A HB2  
1868 H HB3  . TYR A 115 ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  115  TYR A HB3  
1869 H HD1  . TYR A 115 ? 0.1160 0.1160 0.1160 0.0000  0.0000  0.0000  115  TYR A HD1  
1870 H HD2  . TYR A 115 ? 0.0893 0.0893 0.0893 0.0000  0.0000  0.0000  115  TYR A HD2  
1871 H HE1  . TYR A 115 ? 0.1125 0.1125 0.1125 0.0000  0.0000  0.0000  115  TYR A HE1  
1872 H HE2  . TYR A 115 ? 0.0851 0.0851 0.0851 0.0000  0.0000  0.0000  115  TYR A HE2  
1873 H HH   . TYR A 115 ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  115  TYR A HH   
1874 N N    . VAL A 116 ? 0.0774 0.0688 0.0931 0.0013  0.0028  0.0184  116  VAL A N    
1875 C CA   . VAL A 116 ? 0.0803 0.0662 0.0855 -0.0040 -0.0116 0.0190  116  VAL A CA   
1876 C C    . VAL A 116 ? 0.0662 0.0566 0.0946 0.0036  -0.0064 0.0256  116  VAL A C    
1877 O O    . VAL A 116 ? 0.0588 0.0592 0.0917 0.0052  -0.0123 0.0185  116  VAL A O    
1878 C CB   . VAL A 116 ? 0.1268 0.0792 0.0793 -0.0219 -0.0017 0.0105  116  VAL A CB   
1879 C CG1  . VAL A 116 ? 0.1722 0.1143 0.0750 -0.0266 -0.0011 0.0179  116  VAL A CG1  
1880 C CG2  . VAL A 116 ? 0.1265 0.1228 0.1262 -0.0392 0.0363  0.0181  116  VAL A CG2  
1881 H H    . VAL A 116 ? 0.0957 0.0957 0.0957 0.0000  0.0000  0.0000  116  VAL A H    
1882 H HA   . VAL A 116 ? 0.0928 0.0928 0.0928 0.0000  0.0000  0.0000  116  VAL A HA   
1883 H HB   . VAL A 116 ? 0.1141 0.1141 0.1141 0.0000  0.0000  0.0000  116  VAL A HB   
1884 H HG11 . VAL A 116 ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  116  VAL A HG11 
1885 H HG12 . VAL A 116 ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  116  VAL A HG12 
1886 H HG13 . VAL A 116 ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  116  VAL A HG13 
1887 H HG21 . VAL A 116 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  116  VAL A HG21 
1888 H HG22 . VAL A 116 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  116  VAL A HG22 
1889 H HG23 . VAL A 116 ? 0.1877 0.1877 0.1877 0.0000  0.0000  0.0000  116  VAL A HG23 
1890 N N    . PRO A 117 ? 0.0746 0.0646 0.0952 0.0119  -0.0112 0.0234  117  PRO A N    
1891 C CA   . PRO A 117 ? 0.0707 0.0493 0.1005 0.0038  -0.0059 0.0191  117  PRO A CA   
1892 C C    . PRO A 117 ? 0.0625 0.0535 0.1140 -0.0029 0.0030  0.0231  117  PRO A C    
1893 O O    . PRO A 117 ? 0.0927 0.0653 0.1044 -0.0069 0.0154  0.0180  117  PRO A O    
1894 C CB   . PRO A 117 ? 0.0853 0.0734 0.1554 0.0266  0.0081  0.0394  117  PRO A CB   
1895 C CG   . PRO A 117 ? 0.0807 0.0974 0.1907 0.0267  -0.0355 0.0288  117  PRO A CG   
1896 C CD   . PRO A 117 ? 0.0980 0.0839 0.1241 0.0207  -0.0312 0.0347  117  PRO A CD   
1897 H HA   . PRO A 117 ? 0.0881 0.0881 0.0881 0.0000  0.0000  0.0000  117  PRO A HA   
1898 H HB2  . PRO A 117 ? 0.1256 0.1256 0.1256 0.0000  0.0000  0.0000  117  PRO A HB2  
1899 H HB3  . PRO A 117 ? 0.1256 0.1256 0.1256 0.0000  0.0000  0.0000  117  PRO A HB3  
1900 H HG2  . PRO A 117 ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  117  PRO A HG2  
1901 H HG3  . PRO A 117 ? 0.1475 0.1475 0.1475 0.0000  0.0000  0.0000  117  PRO A HG3  
1902 H HD2  . PRO A 117 ? 0.1223 0.1223 0.1223 0.0000  0.0000  0.0000  117  PRO A HD2  
1903 H HD3  . PRO A 117 ? 0.1223 0.1223 0.1223 0.0000  0.0000  0.0000  117  PRO A HD3  
1904 N N    . VAL A 118 ? 0.0748 0.0699 0.1082 -0.0143 -0.0027 0.0171  118  VAL A N    
1905 C CA   . VAL A 118 ? 0.0748 0.0843 0.1231 -0.0217 0.0033  0.0182  118  VAL A CA   
1906 C C    . VAL A 118 ? 0.0788 0.0790 0.1116 -0.0230 -0.0117 0.0179  118  VAL A C    
1907 O O    . VAL A 118 ? 0.0883 0.1356 0.1528 -0.0488 0.0123  -0.0149 118  VAL A O    
1908 C CB   . VAL A 118 ? 0.0729 0.1003 0.1510 -0.0115 0.0069  0.0126  118  VAL A CB   
1909 C CG1  . VAL A 118 ? 0.0720 0.1195 0.1772 -0.0091 0.0140  0.0068  118  VAL A CG1  
1910 C CG2  . VAL A 118 ? 0.0735 0.1315 0.1679 -0.0031 -0.0142 0.0543  118  VAL A CG2  
1911 H H    . VAL A 118 ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  118  VAL A H    
1912 H HA   . VAL A 118 ? 0.1128 0.1128 0.1128 0.0000  0.0000  0.0000  118  VAL A HA   
1913 H HB   . VAL A 118 ? 0.1297 0.1297 0.1297 0.0000  0.0000  0.0000  118  VAL A HB   
1914 H HG11 . VAL A 118 ? 0.1843 0.1843 0.1843 0.0000  0.0000  0.0000  118  VAL A HG11 
1915 H HG12 . VAL A 118 ? 0.1843 0.1843 0.1843 0.0000  0.0000  0.0000  118  VAL A HG12 
1916 H HG13 . VAL A 118 ? 0.1843 0.1843 0.1843 0.0000  0.0000  0.0000  118  VAL A HG13 
1917 H HG21 . VAL A 118 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  118  VAL A HG21 
1918 H HG22 . VAL A 118 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  118  VAL A HG22 
1919 H HG23 . VAL A 118 ? 0.1864 0.1864 0.1864 0.0000  0.0000  0.0000  118  VAL A HG23 
1920 N N    . HIS A 119 ? 0.0713 0.0860 0.1086 -0.0172 -0.0085 0.0190  119  HIS A N    
1921 C CA   . HIS A 119 ? 0.0766 0.0870 0.0955 -0.0239 -0.0314 0.0073  119  HIS A CA   
1922 C C    . HIS A 119 ? 0.0924 0.0747 0.0803 -0.0259 -0.0109 0.0144  119  HIS A C    
1923 O O    . HIS A 119 ? 0.0774 0.0739 0.1040 -0.0206 -0.0066 -0.0035 119  HIS A O    
1924 C CB   . HIS A 119 ? 0.1126 0.1454 0.1116 -0.0155 -0.0213 0.0271  119  HIS A CB   
1925 C CG   . HIS A 119 ? 0.0976 0.2066 0.2052 -0.0007 -0.0601 0.0482  119  HIS A CG   
1926 N ND1  . HIS A 119 ? 0.1287 0.2761 0.2377 -0.0314 -0.0546 0.1037  119  HIS A ND1  
1927 C CD2  . HIS A 119 ? 0.1513 0.2189 0.3248 0.0141  -0.1081 0.1166  119  HIS A CD2  
1928 C CE1  . HIS A 119 ? 0.1018 0.3782 0.3420 -0.0108 -0.0829 0.1323  119  HIS A CE1  
1929 N NE2  . HIS A 119 ? 0.1638 0.3410 0.3739 0.0539  -0.0990 0.0864  119  HIS A NE2  
1930 H H    . HIS A 119 ? 0.1064 0.1064 0.1064 0.0000  0.0000  0.0000  119  HIS A H    
1931 H HA   . HIS A 119 ? 0.1037 0.1037 0.1037 0.0000  0.0000  0.0000  119  HIS A HA   
1932 H HB2  . HIS A 119 ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  119  HIS A HB2  
1933 H HB3  . HIS A 119 ? 0.1478 0.1478 0.1478 0.0000  0.0000  0.0000  119  HIS A HB3  
1934 H HD1  . HIS A 119 ? 0.2570 0.2570 0.2570 0.0000  0.0000  0.0000  119  HIS A HD1  
1935 H HD2  . HIS A 119 ? 0.2780 0.2780 0.2780 0.0000  0.0000  0.0000  119  HIS A HD2  
1936 H HE1  . HIS A 119 ? 0.3288 0.3288 0.3288 0.0000  0.0000  0.0000  119  HIS A HE1  
1937 N N    . PHE A 120 ? 0.0789 0.0727 0.1009 -0.0269 -0.0245 0.0186  120  PHE A N    
1938 C CA   . PHE A 120 ? 0.0987 0.0602 0.0832 -0.0239 -0.0299 0.0143  120  PHE A CA   
1939 C C    . PHE A 120 ? 0.0931 0.0514 0.0817 -0.0127 -0.0237 0.0058  120  PHE A C    
1940 O O    . PHE A 120 ? 0.1468 0.0855 0.0887 -0.0559 -0.0339 0.0067  120  PHE A O    
1941 C CB   . PHE A 120 ? 0.1119 0.0555 0.0899 -0.0221 -0.0211 0.0150  120  PHE A CB   
1942 C CG   . PHE A 120 ? 0.1126 0.0523 0.0982 -0.0170 -0.0251 0.0155  120  PHE A CG   
1943 C CD1  . PHE A 120 ? 0.1358 0.0517 0.1009 -0.0095 -0.0213 0.0129  120  PHE A CD1  
1944 C CD2  . PHE A 120 ? 0.1181 0.0696 0.1003 -0.0109 -0.0256 0.0250  120  PHE A CD2  
1945 C CE1  . PHE A 120 ? 0.1509 0.0650 0.1140 -0.0041 0.0016  0.0151  120  PHE A CE1  
1946 C CE2  . PHE A 120 ? 0.1235 0.0796 0.1194 -0.0170 -0.0374 0.0321  120  PHE A CE2  
1947 C CZ   . PHE A 120 ? 0.1273 0.0675 0.1303 -0.0025 -0.0011 0.0273  120  PHE A CZ   
1948 H H    . PHE A 120 ? 0.1011 0.1011 0.1011 0.0000  0.0000  0.0000  120  PHE A H    
1949 H HA   . PHE A 120 ? 0.0969 0.0969 0.0969 0.0000  0.0000  0.0000  120  PHE A HA   
1950 H HB2  . PHE A 120 ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  120  PHE A HB2  
1951 H HB3  . PHE A 120 ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  120  PHE A HB3  
1952 H HD1  . PHE A 120 ? 0.1154 0.1154 0.1154 0.0000  0.0000  0.0000  120  PHE A HD1  
1953 H HD2  . PHE A 120 ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  120  PHE A HD2  
1954 H HE1  . PHE A 120 ? 0.1320 0.1320 0.1320 0.0000  0.0000  0.0000  120  PHE A HE1  
1955 H HE2  . PHE A 120 ? 0.1291 0.1291 0.1291 0.0000  0.0000  0.0000  120  PHE A HE2  
1956 H HZ   . PHE A 120 ? 0.1301 0.1301 0.1301 0.0000  0.0000  0.0000  120  PHE A HZ   
1957 N N    . ASP A 121 ? 0.0780 0.0639 0.0673 -0.0073 -0.0274 0.0043  121  ASP A N    
1958 C CA   . ASP A 121 ? 0.0874 0.0626 0.0658 -0.0147 -0.0310 0.0055  121  ASP A CA   
1959 C C    . ASP A 121 ? 0.0815 0.1020 0.0725 -0.0159 -0.0292 -0.0016 121  ASP A C    
1960 O O    . ASP A 121 ? 0.0989 0.2063 0.1032 0.0050  -0.0357 -0.0677 121  ASP A O    
1961 C CB   . ASP A 121 ? 0.1012 0.0684 0.0787 -0.0166 -0.0369 0.0131  121  ASP A CB   
1962 C CG   . ASP A 121 ? 0.1061 0.0851 0.0732 -0.0270 -0.0381 0.0160  121  ASP A CG   
1963 O OD1  . ASP A 121 ? 0.0931 0.1587 0.0873 -0.0286 -0.0433 0.0423  121  ASP A OD1  
1964 O OD2  . ASP A 121 ? 0.0819 0.0960 0.0817 -0.0129 -0.0260 0.0144  121  ASP A OD2  
1965 H H    . ASP A 121 ? 0.0837 0.0837 0.0837 0.0000  0.0000  0.0000  121  ASP A H    
1966 H HA   . ASP A 121 ? 0.0864 0.0864 0.0864 0.0000  0.0000  0.0000  121  ASP A HA   
1967 H HB2  . ASP A 121 ? 0.0993 0.0993 0.0993 0.0000  0.0000  0.0000  121  ASP A HB2  
1968 H HB3  . ASP A 121 ? 0.0993 0.0993 0.0993 0.0000  0.0000  0.0000  121  ASP A HB3  
1969 N N    . ALA A 122 ? 0.0853 0.0717 0.0726 -0.0067 -0.0280 0.0002  122  ALA A N    
1970 C CA   . ALA A 122 ? 0.0880 0.0980 0.0785 0.0026  -0.0279 -0.0149 122  ALA A CA   
1971 C C    . ALA A 122 ? 0.0942 0.0629 0.0807 -0.0114 -0.0306 -0.0100 122  ALA A C    
1972 O O    . ALA A 122 ? 0.0912 0.0589 0.0775 -0.0032 -0.0262 -0.0084 122  ALA A O    
1973 C CB   . ALA A 122 ? 0.1031 0.2470 0.0786 0.0367  -0.0057 0.0157  122  ALA A CB   
1974 H H    . ALA A 122 ? 0.0918 0.0918 0.0918 0.0000  0.0000  0.0000  122  ALA A H    
1975 H HA   . ALA A 122 ? 0.1058 0.1058 0.1058 0.0000  0.0000  0.0000  122  ALA A HA   
1976 H HB1  . ALA A 122 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  122  ALA A HB1  
1977 H HB2  . ALA A 122 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  122  ALA A HB2  
1978 H HB3  . ALA A 122 ? 0.2143 0.2143 0.2143 0.0000  0.0000  0.0000  122  ALA A HB3  
1979 N N    . SER A 123 ? 0.0895 0.1479 0.0985 0.0112  -0.0213 -0.0550 123  SER A N    
1980 C CA   . SER A 123 ? 0.0928 0.1230 0.0907 -0.0015 -0.0140 -0.0125 123  SER A CA   
1981 C C    . SER A 123 ? 0.1093 0.1631 0.0821 -0.0107 -0.0032 -0.0329 123  SER A C    
1982 O O    . SER A 123 ? 0.1185 0.2435 0.0973 -0.0059 -0.0016 -0.0421 123  SER A O    
1983 C CB   . SER A 123 ? 0.1077 0.1750 0.1671 -0.0255 -0.0327 0.0534  123  SER A CB   
1984 O OG   . SER A 123 ? 0.1526 0.1357 0.2876 0.0131  -0.0220 -0.0163 123  SER A OG   
1985 H H    . SER A 123 ? 0.1344 0.1344 0.1344 0.0000  0.0000  0.0000  123  SER A H    
1986 H HA   . SER A 123 ? 0.1226 0.1226 0.1226 0.0000  0.0000  0.0000  123  SER A HA   
1987 H HB2  . SER A 123 ? 0.1800 0.1800 0.1800 0.0000  0.0000  0.0000  123  SER A HB2  
1988 H HB3  . SER A 123 ? 0.1800 0.1800 0.1800 0.0000  0.0000  0.0000  123  SER A HB3  
1989 H HG   . SER A 123 ? 0.2880 0.2880 0.2880 0.0000  0.0000  0.0000  123  SER A HG   
1990 N N    . VAL A 124 ? 0.1039 0.1034 0.0889 0.0061  -0.0066 -0.0121 124  VAL A N    
1991 C CA   . VAL A 124 ? 0.1282 0.1248 0.1012 -0.0048 0.0098  -0.0106 124  VAL A CA   
1992 C C    . VAL A 124 ? 0.1129 0.1469 0.1433 -0.0206 0.0315  -0.0120 124  VAL A C    
1993 O O    . VAL A 124 ? 0.1151 0.3261 0.2342 0.0097  0.0599  -0.0179 124  VAL A O    
1994 C CB   . VAL A 124 ? 0.1963 0.1551 0.1136 -0.0307 0.0037  0.0046  124  VAL A CB   
1995 C CG1  . VAL A 124 ? 0.6154 0.2907 0.1988 0.2112  -0.1991 -0.0733 124  VAL A CG1  
1996 C CG2  . VAL A 124 ? 0.2648 0.1063 0.1383 -0.0047 -0.0032 0.0219  124  VAL A CG2  
1997 O OXT  . VAL A 124 ? 0.1183 0.1973 0.1379 -0.0181 -0.0161 0.0597  124  VAL A OXT  
1998 H H    . VAL A 124 ? 0.1185 0.1185 0.1185 0.0000  0.0000  0.0000  124  VAL A H    
1999 H HA   . VAL A 124 ? 0.1417 0.1417 0.1417 0.0000  0.0000  0.0000  124  VAL A HA   
2000 H HB   . VAL A 124 ? 0.1861 0.1861 0.1861 0.0000  0.0000  0.0000  124  VAL A HB   
2001 H HG11 . VAL A 124 ? 0.5525 0.5525 0.5525 0.0000  0.0000  0.0000  124  VAL A HG11 
2002 H HG12 . VAL A 124 ? 0.5525 0.5525 0.5525 0.0000  0.0000  0.0000  124  VAL A HG12 
2003 H HG13 . VAL A 124 ? 0.5525 0.5525 0.5525 0.0000  0.0000  0.0000  124  VAL A HG13 
2004 H HG21 . VAL A 124 ? 0.2547 0.2547 0.2547 0.0000  0.0000  0.0000  124  VAL A HG21 
2005 H HG22 . VAL A 124 ? 0.2547 0.2547 0.2547 0.0000  0.0000  0.0000  124  VAL A HG22 
2006 H HG23 . VAL A 124 ? 0.2547 0.2547 0.2547 0.0000  0.0000  0.0000  124  VAL A HG23 
2007 N N    . LYS B 1   ? 0.0951 0.3285 0.1225 -0.0068 -0.0146 0.0266  1    LYS B N    
2008 C CA   . LYS B 1   ? 0.0483 0.1923 0.1230 -0.0016 -0.0117 0.0132  1    LYS B CA   
2009 C C    . LYS B 1   ? 0.0449 0.1644 0.1384 0.0032  -0.0354 -0.0005 1    LYS B C    
2010 O O    . LYS B 1   ? 0.0676 0.3687 0.1496 -0.0114 -0.0408 0.0479  1    LYS B O    
2011 C CB   . LYS B 1   ? 0.0477 0.1836 0.1288 -0.0075 -0.0044 -0.0449 1    LYS B CB   
2012 C CG   . LYS B 1   ? 0.0714 0.2192 0.1461 0.0093  0.0001  -0.0826 1    LYS B CG   
2013 C CD   . LYS B 1   ? 0.0810 0.2431 0.2368 -0.0300 0.0220  -0.1561 1    LYS B CD   
2014 C CE   . LYS B 1   ? 0.1195 0.1112 0.1887 0.0029  -0.0297 -0.0299 1    LYS B CE   
2015 N NZ   . LYS B 1   ? 0.1190 0.1208 0.1838 -0.0296 0.0301  -0.0708 1    LYS B NZ   
2016 H H1   . LYS B 1   ? 0.2731 0.2731 0.2731 0.0000  0.0000  0.0000  1    LYS B H1   
2017 H H2   . LYS B 1   ? 0.2731 0.2731 0.2731 0.0000  0.0000  0.0000  1    LYS B H2   
2018 H H3   . LYS B 1   ? 0.2731 0.2731 0.2731 0.0000  0.0000  0.0000  1    LYS B H3   
2019 H HA   . LYS B 1   ? 0.1454 0.1454 0.1454 0.0000  0.0000  0.0000  1    LYS B HA   
2020 H HB2  . LYS B 1   ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  1    LYS B HB2  
2021 H HB3  . LYS B 1   ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  1    LYS B HB3  
2022 H HG2  . LYS B 1   ? 0.1747 0.1747 0.1747 0.0000  0.0000  0.0000  1    LYS B HG2  
2023 H HG3  . LYS B 1   ? 0.1747 0.1747 0.1747 0.0000  0.0000  0.0000  1    LYS B HG3  
2024 H HD2  . LYS B 1   ? 0.2244 0.2244 0.2244 0.0000  0.0000  0.0000  1    LYS B HD2  
2025 H HD3  . LYS B 1   ? 0.2244 0.2244 0.2244 0.0000  0.0000  0.0000  1    LYS B HD3  
2026 H HE2  . LYS B 1   ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  1    LYS B HE2  
2027 H HE3  . LYS B 1   ? 0.1678 0.1678 0.1678 0.0000  0.0000  0.0000  1    LYS B HE3  
2028 H HZ1  . LYS B 1   ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  1    LYS B HZ1  
2029 H HZ2  . LYS B 1   ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  1    LYS B HZ2  
2030 H HZ3  . LYS B 1   ? 0.2118 0.2118 0.2118 0.0000  0.0000  0.0000  1    LYS B HZ3  
2031 N N    . GLU B 2   ? 0.0429 0.0853 0.1196 0.0039  -0.0146 -0.0283 2    GLU B N    
2032 C CA   . GLU B 2   ? 0.0438 0.0839 0.1530 0.0109  -0.0290 -0.0383 2    GLU B CA   
2033 C C    . GLU B 2   ? 0.0299 0.0806 0.1856 0.0042  -0.0066 -0.0549 2    GLU B C    
2034 O O    . GLU B 2   ? 0.0527 0.0644 0.1705 0.0003  -0.0269 -0.0304 2    GLU B O    
2035 C CB   . GLU B 2   ? 0.0436 0.0744 0.1425 0.0051  -0.0169 -0.0285 2    GLU B CB   
2036 C CG   . GLU B 2   ? 0.0500 0.0808 0.1930 0.0011  -0.0134 -0.0535 2    GLU B CG   
2037 C CD   . GLU B 2   ? 0.0576 0.0853 0.1793 0.0077  -0.0018 -0.0465 2    GLU B CD   
2038 O OE1  . GLU B 2   ? 0.1056 0.0926 0.1901 0.0403  -0.0228 -0.0391 2    GLU B OE1  
2039 O OE2  . GLU B 2   ? 0.1049 0.0816 0.1535 0.0199  0.0115  -0.0095 2    GLU B OE2  
2040 H H    . GLU B 2   ? 0.0992 0.0992 0.0992 0.0000  0.0000  0.0000  2    GLU B H    
2041 H HA   . GLU B 2   ? 0.1122 0.1122 0.1122 0.0000  0.0000  0.0000  2    GLU B HA   
2042 H HB2  . GLU B 2   ? 0.1042 0.1042 0.1042 0.0000  0.0000  0.0000  2    GLU B HB2  
2043 H HB3  . GLU B 2   ? 0.1042 0.1042 0.1042 0.0000  0.0000  0.0000  2    GLU B HB3  
2044 H HG2  . GLU B 2   ? 0.1296 0.1296 0.1296 0.0000  0.0000  0.0000  2    GLU B HG2  
2045 H HG3  . GLU B 2   ? 0.1296 0.1296 0.1296 0.0000  0.0000  0.0000  2    GLU B HG3  
2046 N N    . THR B 3   ? 0.0450 0.0910 0.2181 0.0053  -0.0304 -0.0708 3    THR B N    
2047 C CA   . THR B 3   ? 0.0486 0.0845 0.2426 0.0067  -0.0360 -0.0650 3    THR B CA   
2048 C C    . THR B 3   ? 0.0468 0.0657 0.2544 -0.0031 -0.0442 -0.0378 3    THR B C    
2049 O O    . THR B 3   ? 0.0496 0.0625 0.1836 -0.0015 -0.0229 -0.0222 3    THR B O    
2050 C CB   . THR B 3   ? 0.0554 0.1151 0.3260 0.0076  -0.0247 -0.1089 3    THR B CB   
2051 O OG1  . THR B 3   ? 0.0576 0.1650 0.3105 0.0135  -0.0430 -0.1496 3    THR B OG1  
2052 C CG2  . THR B 3   ? 0.0762 0.1796 0.4019 0.0064  0.0008  -0.1897 3    THR B CG2  
2053 H H    . THR B 3   ? 0.1416 0.1416 0.1416 0.0000  0.0000  0.0000  3    THR B H    
2054 H HA   . THR B 3   ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  3    THR B HA   
2055 H HB   . THR B 3   ? 0.1986 0.1986 0.1986 0.0000  0.0000  0.0000  3    THR B HB   
2056 H HG1  . THR B 3   ? 0.2666 0.2666 0.2666 0.0000  0.0000  0.0000  3    THR B HG1  
2057 H HG21 . THR B 3   ? 0.3288 0.3288 0.3288 0.0000  0.0000  0.0000  3    THR B HG21 
2058 H HG22 . THR B 3   ? 0.3288 0.3288 0.3288 0.0000  0.0000  0.0000  3    THR B HG22 
2059 H HG23 . THR B 3   ? 0.3288 0.3288 0.3288 0.0000  0.0000  0.0000  3    THR B HG23 
2060 N N    . ALA B 4   ? 0.0564 0.0621 0.2991 0.0044  -0.0559 -0.0104 4    ALA B N    
2061 C CA   . ALA B 4   ? 0.0481 0.0911 0.2716 -0.0064 -0.0411 0.0130  4    ALA B CA   
2062 C C    . ALA B 4   ? 0.0538 0.0580 0.2374 -0.0087 -0.0496 0.0028  4    ALA B C    
2063 O O    . ALA B 4   ? 0.0571 0.0696 0.1804 0.0007  -0.0327 0.0125  4    ALA B O    
2064 C CB   . ALA B 4   ? 0.0876 0.0990 0.3440 -0.0039 -0.0786 0.0653  4    ALA B CB   
2065 H H    . ALA B 4   ? 0.1671 0.1671 0.1671 0.0000  0.0000  0.0000  4    ALA B H    
2066 H HA   . ALA B 4   ? 0.1643 0.1643 0.1643 0.0000  0.0000  0.0000  4    ALA B HA   
2067 H HB1  . ALA B 4   ? 0.2652 0.2652 0.2652 0.0000  0.0000  0.0000  4    ALA B HB1  
2068 H HB2  . ALA B 4   ? 0.2652 0.2652 0.2652 0.0000  0.0000  0.0000  4    ALA B HB2  
2069 H HB3  . ALA B 4   ? 0.2652 0.2652 0.2652 0.0000  0.0000  0.0000  4    ALA B HB3  
2070 N N    . ALA B 5   ? 0.0516 0.0574 0.2383 -0.0002 -0.0347 -0.0271 5    ALA B N    
2071 C CA   . ALA B 5   ? 0.0504 0.0614 0.2171 -0.0027 -0.0307 -0.0236 5    ALA B CA   
2072 C C    . ALA B 5   ? 0.0482 0.0756 0.1618 -0.0020 -0.0183 -0.0449 5    ALA B C    
2073 O O    . ALA B 5   ? 0.0438 0.0709 0.1250 0.0010  -0.0164 -0.0259 5    ALA B O    
2074 C CB   . ALA B 5   ? 0.0626 0.0907 0.2762 -0.0012 -0.0336 -0.0698 5    ALA B CB   
2075 H H    . ALA B 5   ? 0.1389 0.1389 0.1389 0.0000  0.0000  0.0000  5    ALA B H    
2076 H HA   . ALA B 5   ? 0.1316 0.1316 0.1316 0.0000  0.0000  0.0000  5    ALA B HA   
2077 H HB1  . ALA B 5   ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  5    ALA B HB1  
2078 H HB2  . ALA B 5   ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  5    ALA B HB2  
2079 H HB3  . ALA B 5   ? 0.2147 0.2147 0.2147 0.0000  0.0000  0.0000  5    ALA B HB3  
2080 N N    . ALA B 6   ? 0.0455 0.0756 0.1791 -0.0038 -0.0106 -0.0531 6    ALA B N    
2081 C CA   . ALA B 6   ? 0.0457 0.1064 0.1236 -0.0047 -0.0083 -0.0467 6    ALA B CA   
2082 C C    . ALA B 6   ? 0.0397 0.0721 0.1140 -0.0023 -0.0059 -0.0233 6    ALA B C    
2083 O O    . ALA B 6   ? 0.0537 0.0866 0.1018 0.0018  -0.0029 -0.0148 6    ALA B O    
2084 C CB   . ALA B 6   ? 0.0550 0.1550 0.1355 -0.0159 0.0090  -0.0626 6    ALA B CB   
2085 H H    . ALA B 6   ? 0.1201 0.1201 0.1201 0.0000  0.0000  0.0000  6    ALA B H    
2086 H HA   . ALA B 6   ? 0.1103 0.1103 0.1103 0.0000  0.0000  0.0000  6    ALA B HA   
2087 H HB1  . ALA B 6   ? 0.1728 0.1728 0.1728 0.0000  0.0000  0.0000  6    ALA B HB1  
2088 H HB2  . ALA B 6   ? 0.1728 0.1728 0.1728 0.0000  0.0000  0.0000  6    ALA B HB2  
2089 H HB3  . ALA B 6   ? 0.1728 0.1728 0.1728 0.0000  0.0000  0.0000  6    ALA B HB3  
2090 N N    . LYS B 7   ? 0.0420 0.0618 0.1133 0.0002  -0.0126 -0.0179 7    LYS B N    
2091 C CA   . LYS B 7   ? 0.0471 0.0581 0.1069 -0.0015 -0.0210 -0.0186 7    LYS B CA   
2092 C C    . LYS B 7   ? 0.0480 0.0583 0.0849 0.0004  -0.0270 -0.0124 7    LYS B C    
2093 O O    . LYS B 7   ? 0.0549 0.0488 0.0941 0.0011  -0.0224 -0.0092 7    LYS B O    
2094 C CB   . LYS B 7   ? 0.0586 0.0888 0.1229 0.0013  -0.0324 -0.0056 7    LYS B CB   
2095 C CG   . LYS B 7   ? 0.0768 0.1717 0.1260 0.0322  -0.0469 -0.0431 7    LYS B CG   
2096 C CD   . LYS B 7   ? 0.0983 0.2380 0.1238 0.0460  -0.0493 -0.0415 7    LYS B CD   
2097 C CE   . LYS B 7   ? 0.1593 0.3228 0.1433 0.1063  -0.0615 -0.0775 7    LYS B CE   
2098 N NZ   . LYS B 7   ? 0.1629 0.8891 0.1630 0.2035  -0.0630 -0.1341 7    LYS B NZ   
2099 H H    . LYS B 7   ? 0.0869 0.0869 0.0869 0.0000  0.0000  0.0000  7    LYS B H    
2100 H HA   . LYS B 7   ? 0.0849 0.0849 0.0849 0.0000  0.0000  0.0000  7    LYS B HA   
2101 H HB2  . LYS B 7   ? 0.1082 0.1082 0.1082 0.0000  0.0000  0.0000  7    LYS B HB2  
2102 H HB3  . LYS B 7   ? 0.1082 0.1082 0.1082 0.0000  0.0000  0.0000  7    LYS B HB3  
2103 H HG2  . LYS B 7   ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  7    LYS B HG2  
2104 H HG3  . LYS B 7   ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  7    LYS B HG3  
2105 H HD2  . LYS B 7   ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  7    LYS B HD2  
2106 H HD3  . LYS B 7   ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  7    LYS B HD3  
2107 H HE2  . LYS B 7   ? 0.2501 0.2501 0.2501 0.0000  0.0000  0.0000  7    LYS B HE2  
2108 H HE3  . LYS B 7   ? 0.2501 0.2501 0.2501 0.0000  0.0000  0.0000  7    LYS B HE3  
2109 H HZ1  . LYS B 7   ? 0.6075 0.6075 0.6075 0.0000  0.0000  0.0000  7    LYS B HZ1  
2110 H HZ2  . LYS B 7   ? 0.6075 0.6075 0.6075 0.0000  0.0000  0.0000  7    LYS B HZ2  
2111 H HZ3  . LYS B 7   ? 0.6075 0.6075 0.6075 0.0000  0.0000  0.0000  7    LYS B HZ3  
2112 N N    . PHE B 8   ? 0.0442 0.0522 0.0937 0.0063  -0.0181 -0.0091 8    PHE B N    
2113 C CA   . PHE B 8   ? 0.0460 0.0516 0.0768 -0.0015 -0.0181 -0.0024 8    PHE B CA   
2114 C C    . PHE B 8   ? 0.0429 0.0451 0.0766 -0.0018 -0.0164 -0.0083 8    PHE B C    
2115 O O    . PHE B 8   ? 0.0478 0.0445 0.0785 -0.0004 -0.0106 -0.0009 8    PHE B O    
2116 C CB   . PHE B 8   ? 0.0498 0.0448 0.0899 0.0029  -0.0162 0.0034  8    PHE B CB   
2117 C CG   . PHE B 8   ? 0.0461 0.0419 0.0717 -0.0011 -0.0180 0.0053  8    PHE B CG   
2118 C CD1  . PHE B 8   ? 0.0582 0.0467 0.0657 0.0007  -0.0136 0.0055  8    PHE B CD1  
2119 C CD2  . PHE B 8   ? 0.0565 0.0528 0.0661 0.0026  -0.0191 -0.0013 8    PHE B CD2  
2120 C CE1  . PHE B 8   ? 0.0479 0.0463 0.0642 -0.0019 -0.0189 0.0087  8    PHE B CE1  
2121 C CE2  . PHE B 8   ? 0.0607 0.0567 0.0679 0.0031  -0.0077 0.0000  8    PHE B CE2  
2122 C CZ   . PHE B 8   ? 0.0507 0.0446 0.0775 0.0002  -0.0128 0.0055  8    PHE B CZ   
2123 H H    . PHE B 8   ? 0.0760 0.0760 0.0760 0.0000  0.0000  0.0000  8    PHE B H    
2124 H HA   . PHE B 8   ? 0.0698 0.0698 0.0698 0.0000  0.0000  0.0000  8    PHE B HA   
2125 H HB2  . PHE B 8   ? 0.0737 0.0737 0.0737 0.0000  0.0000  0.0000  8    PHE B HB2  
2126 H HB3  . PHE B 8   ? 0.0737 0.0737 0.0737 0.0000  0.0000  0.0000  8    PHE B HB3  
2127 H HD1  . PHE B 8   ? 0.0683 0.0683 0.0683 0.0000  0.0000  0.0000  8    PHE B HD1  
2128 H HD2  . PHE B 8   ? 0.0702 0.0702 0.0702 0.0000  0.0000  0.0000  8    PHE B HD2  
2129 H HE1  . PHE B 8   ? 0.0633 0.0633 0.0633 0.0000  0.0000  0.0000  8    PHE B HE1  
2130 H HE2  . PHE B 8   ? 0.0741 0.0741 0.0741 0.0000  0.0000  0.0000  8    PHE B HE2  
2131 H HZ   . PHE B 8   ? 0.0692 0.0692 0.0692 0.0000  0.0000  0.0000  8    PHE B HZ   
2132 N N    . GLU B 9   ? 0.0489 0.0478 0.0724 -0.0006 -0.0137 -0.0069 9    GLU B N    
2133 C CA   . GLU B 9   ? 0.0507 0.0660 0.0720 -0.0048 -0.0136 -0.0068 9    GLU B CA   
2134 C C    . GLU B 9   ? 0.0585 0.0584 0.0626 -0.0034 -0.0089 -0.0005 9    GLU B C    
2135 O O    . GLU B 9   ? 0.0538 0.0579 0.0795 -0.0027 -0.0120 0.0066  9    GLU B O    
2136 C CB   . GLU B 9   ? 0.0834 0.0742 0.0708 -0.0184 -0.0083 -0.0125 9    GLU B CB   
2137 C CG   A GLU B 9   ? 0.0649 0.0658 0.0748 -0.0312 -0.0284 -0.0096 9    GLU B CG   
2138 C CG   B GLU B 9   ? 0.0949 0.0767 0.0850 0.0025  -0.0181 -0.0090 9    GLU B CG   
2139 C CG   C GLU B 9   ? 0.1114 0.0833 0.0608 -0.0030 -0.0124 -0.0259 9    GLU B CG   
2140 C CD   A GLU B 9   ? 0.0919 0.0812 0.0848 0.0131  -0.0081 -0.0033 9    GLU B CD   
2141 C CD   B GLU B 9   ? 0.1679 0.0404 0.0755 0.0123  -0.0096 -0.0061 9    GLU B CD   
2142 C CD   C GLU B 9   ? 0.1068 0.1054 0.0538 -0.0043 0.0059  -0.0084 9    GLU B CD   
2143 O OE1  A GLU B 9   ? 0.1943 0.0841 0.0672 -0.0156 0.0094  -0.0035 9    GLU B OE1  
2144 O OE1  B GLU B 9   ? 0.2125 0.1351 0.0982 -0.0361 0.0584  -0.0251 9    GLU B OE1  
2145 O OE1  C GLU B 9   ? 0.1141 0.1305 0.2726 -0.0147 0.0781  -0.0963 9    GLU B OE1  
2146 O OE2  A GLU B 9   ? 0.0805 0.0858 0.1018 0.0009  -0.0046 -0.0093 9    GLU B OE2  
2147 O OE2  B GLU B 9   ? 0.1974 0.0913 0.0961 -0.0421 0.0344  -0.0375 9    GLU B OE2  
2148 O OE2  C GLU B 9   ? 0.1469 0.0914 0.0732 0.0031  -0.0304 -0.0141 9    GLU B OE2  
2149 H H    . GLU B 9   ? 0.0676 0.0676 0.0676 0.0000  0.0000  0.0000  9    GLU B H    
2150 H HA   . GLU B 9   ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  9    GLU B HA   
2151 H HB2  A GLU B 9   ? 0.0913 0.0913 0.0913 0.0000  0.0000  0.0000  9    GLU B HB2  
2152 H HB3  A GLU B 9   ? 0.0913 0.0913 0.0913 0.0000  0.0000  0.0000  9    GLU B HB3  
2153 H HG2  A GLU B 9   ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  9    GLU B HG2  
2154 H HG2  B GLU B 9   ? 0.1026 0.1026 0.1026 0.0000  0.0000  0.0000  9    GLU B HG2  
2155 H HG2  C GLU B 9   ? 0.1022 0.1022 0.1022 0.0000  0.0000  0.0000  9    GLU B HG2  
2156 H HG3  A GLU B 9   ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  9    GLU B HG3  
2157 H HG3  B GLU B 9   ? 0.1026 0.1026 0.1026 0.0000  0.0000  0.0000  9    GLU B HG3  
2158 H HG3  C GLU B 9   ? 0.1022 0.1022 0.1022 0.0000  0.0000  0.0000  9    GLU B HG3  
2159 N N    . ARG B 10  ? 0.0507 0.0501 0.0737 -0.0061 -0.0055 -0.0040 10   ARG B N    
2160 C CA   . ARG B 10  ? 0.0497 0.0546 0.0733 -0.0059 -0.0119 -0.0007 10   ARG B CA   
2161 C C    . ARG B 10  ? 0.0553 0.0467 0.0625 -0.0061 -0.0107 0.0015  10   ARG B C    
2162 O O    . ARG B 10  ? 0.0618 0.0455 0.0781 -0.0013 -0.0135 0.0065  10   ARG B O    
2163 C CB   . ARG B 10  ? 0.0436 0.0562 0.1028 -0.0076 -0.0003 -0.0080 10   ARG B CB   
2164 C CG   . ARG B 10  ? 0.0564 0.0574 0.0919 -0.0074 -0.0092 -0.0066 10   ARG B CG   
2165 C CD   . ARG B 10  ? 0.0544 0.0774 0.1170 -0.0112 -0.0009 -0.0177 10   ARG B CD   
2166 N NE   . ARG B 10  ? 0.0579 0.0661 0.1298 0.0063  -0.0159 -0.0201 10   ARG B NE   
2167 C CZ   . ARG B 10  ? 0.0782 0.0762 0.1328 0.0178  -0.0131 -0.0208 10   ARG B CZ   
2168 N NH1  . ARG B 10  ? 0.1251 0.0859 0.1234 0.0398  -0.0186 -0.0219 10   ARG B NH1  
2169 N NH2  . ARG B 10  ? 0.1327 0.1131 0.1340 0.0685  -0.0237 -0.0174 10   ARG B NH2  
2170 H H    . ARG B 10  ? 0.0698 0.0698 0.0698 0.0000  0.0000  0.0000  10   ARG B H    
2171 H HA   . ARG B 10  ? 0.0711 0.0711 0.0711 0.0000  0.0000  0.0000  10   ARG B HA   
2172 H HB2  . ARG B 10  ? 0.0811 0.0811 0.0811 0.0000  0.0000  0.0000  10   ARG B HB2  
2173 H HB3  . ARG B 10  ? 0.0811 0.0811 0.0811 0.0000  0.0000  0.0000  10   ARG B HB3  
2174 H HG2  . ARG B 10  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  10   ARG B HG2  
2175 H HG3  . ARG B 10  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  10   ARG B HG3  
2176 H HD2  . ARG B 10  ? 0.0995 0.0995 0.0995 0.0000  0.0000  0.0000  10   ARG B HD2  
2177 H HD3  . ARG B 10  ? 0.0995 0.0995 0.0995 0.0000  0.0000  0.0000  10   ARG B HD3  
2178 H HE   . ARG B 10  ? 0.1016 0.1016 0.1016 0.0000  0.0000  0.0000  10   ARG B HE   
2179 H HH11 . ARG B 10  ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  10   ARG B HH11 
2180 H HH12 . ARG B 10  ? 0.1337 0.1337 0.1337 0.0000  0.0000  0.0000  10   ARG B HH12 
2181 H HH21 . ARG B 10  ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  10   ARG B HH21 
2182 H HH22 . ARG B 10  ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  10   ARG B HH22 
2183 N N    . GLN B 11  ? 0.0519 0.0427 0.0673 -0.0043 -0.0137 -0.0011 11   GLN B N    
2184 C CA   . GLN B 11  ? 0.0608 0.0491 0.0626 -0.0073 -0.0178 -0.0024 11   GLN B CA   
2185 C C    . GLN B 11  ? 0.0629 0.0417 0.0636 0.0022  -0.0108 0.0047  11   GLN B C    
2186 O O    . GLN B 11  ? 0.0798 0.0509 0.0782 -0.0007 -0.0101 -0.0154 11   GLN B O    
2187 C CB   . GLN B 11  ? 0.0763 0.0624 0.0762 0.0014  -0.0272 -0.0023 11   GLN B CB   
2188 C CG   . GLN B 11  ? 0.0897 0.0700 0.1011 0.0035  -0.0432 -0.0146 11   GLN B CG   
2189 C CD   . GLN B 11  ? 0.0953 0.1139 0.1049 0.0111  -0.0529 -0.0184 11   GLN B CD   
2190 O OE1  . GLN B 11  ? 0.1675 0.1624 0.1174 -0.0356 -0.0467 -0.0025 11   GLN B OE1  
2191 N NE2  . GLN B 11  ? 0.1576 0.1030 0.1227 0.0170  -0.0523 0.0120  11   GLN B NE2  
2192 H H    . GLN B 11  ? 0.0647 0.0647 0.0647 0.0000  0.0000  0.0000  11   GLN B H    
2193 H HA   . GLN B 11  ? 0.0689 0.0689 0.0689 0.0000  0.0000  0.0000  11   GLN B HA   
2194 H HB2  . GLN B 11  ? 0.0860 0.0860 0.0860 0.0000  0.0000  0.0000  11   GLN B HB2  
2195 H HB3  . GLN B 11  ? 0.0860 0.0860 0.0860 0.0000  0.0000  0.0000  11   GLN B HB3  
2196 H HG2  . GLN B 11  ? 0.1044 0.1044 0.1044 0.0000  0.0000  0.0000  11   GLN B HG2  
2197 H HG3  . GLN B 11  ? 0.1044 0.1044 0.1044 0.0000  0.0000  0.0000  11   GLN B HG3  
2198 H HE21 . GLN B 11  ? 0.1532 0.1532 0.1532 0.0000  0.0000  0.0000  11   GLN B HE21 
2199 H HE22 . GLN B 11  ? 0.1532 0.1532 0.1532 0.0000  0.0000  0.0000  11   GLN B HE22 
2200 N N    . HIS B 12  ? 0.0536 0.0384 0.0552 0.0017  -0.0132 0.0007  12   HIS B N    
2201 C CA   . HIS B 12  ? 0.0495 0.0488 0.0584 0.0022  -0.0088 -0.0010 12   HIS B CA   
2202 C C    . HIS B 12  ? 0.0534 0.0493 0.0675 0.0051  -0.0117 -0.0049 12   HIS B C    
2203 O O    . HIS B 12  ? 0.0519 0.1186 0.0736 0.0183  -0.0114 -0.0249 12   HIS B O    
2204 C CB   . HIS B 12  ? 0.0571 0.0516 0.0706 -0.0012 -0.0030 0.0018  12   HIS B CB   
2205 C CG   . HIS B 12  ? 0.0624 0.0459 0.0638 0.0032  0.0006  0.0107  12   HIS B CG   
2206 N ND1  . HIS B 12  ? 0.0632 0.0436 0.0689 0.0039  -0.0165 0.0111  12   HIS B ND1  
2207 C CD2  . HIS B 12  ? 0.0714 0.0683 0.0784 0.0116  -0.0026 0.0139  12   HIS B CD2  
2208 C CE1  . HIS B 12  ? 0.0870 0.0538 0.0674 -0.0030 -0.0232 0.0134  12   HIS B CE1  
2209 N NE2  . HIS B 12  ? 0.0688 0.0869 0.0892 0.0048  -0.0154 0.0264  12   HIS B NE2  
2210 H H    . HIS B 12  ? 0.0589 0.0589 0.0589 0.0000  0.0000  0.0000  12   HIS B H    
2211 H HA   . HIS B 12  ? 0.0627 0.0627 0.0627 0.0000  0.0000  0.0000  12   HIS B HA   
2212 H HB2  . HIS B 12  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  12   HIS B HB2  
2213 H HB3  . HIS B 12  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  12   HIS B HB3  
2214 H HD1  . HIS B 12  ? 0.0703 0.0703 0.0703 0.0000  0.0000  0.0000  12   HIS B HD1  
2215 H HD2  . HIS B 12  ? 0.0873 0.0873 0.0873 0.0000  0.0000  0.0000  12   HIS B HD2  
2216 H HE1  . HIS B 12  ? 0.0832 0.0832 0.0832 0.0000  0.0000  0.0000  12   HIS B HE1  
2217 N N    . MET B 13  ? 0.0485 0.0420 0.0625 0.0007  -0.0130 0.0055  13   MET B N    
2218 C CA   . MET B 13  ? 0.0497 0.0353 0.0613 -0.0023 -0.0172 0.0082  13   MET B CA   
2219 C C    . MET B 13  ? 0.0524 0.0318 0.0560 -0.0019 -0.0150 0.0056  13   MET B C    
2220 O O    . MET B 13  ? 0.0532 0.0474 0.0845 -0.0039 -0.0155 0.0167  13   MET B O    
2221 C CB   . MET B 13  ? 0.0592 0.0418 0.0597 -0.0004 -0.0196 -0.0003 13   MET B CB   
2222 C CG   . MET B 13  ? 0.0575 0.0350 0.0841 -0.0005 -0.0218 -0.0007 13   MET B CG   
2223 S SD   . MET B 13  ? 0.0592 0.0408 0.0915 -0.0056 -0.0265 0.0115  13   MET B SD   
2224 C CE   . MET B 13  ? 0.0820 0.0523 0.1115 -0.0074 -0.0492 0.0079  13   MET B CE   
2225 H H    . MET B 13  ? 0.0612 0.0612 0.0612 0.0000  0.0000  0.0000  13   MET B H    
2226 H HA   . MET B 13  ? 0.0585 0.0585 0.0585 0.0000  0.0000  0.0000  13   MET B HA   
2227 H HB2  . MET B 13  ? 0.0643 0.0643 0.0643 0.0000  0.0000  0.0000  13   MET B HB2  
2228 H HB3  . MET B 13  ? 0.0643 0.0643 0.0643 0.0000  0.0000  0.0000  13   MET B HB3  
2229 H HG2  . MET B 13  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  13   MET B HG2  
2230 H HG3  . MET B 13  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  13   MET B HG3  
2231 H HE1  . MET B 13  ? 0.1230 0.1230 0.1230 0.0000  0.0000  0.0000  13   MET B HE1  
2232 H HE2  . MET B 13  ? 0.1230 0.1230 0.1230 0.0000  0.0000  0.0000  13   MET B HE2  
2233 H HE3  . MET B 13  ? 0.1230 0.1230 0.1230 0.0000  0.0000  0.0000  13   MET B HE3  
2234 N N    . ASP B 14  ? 0.0489 0.0329 0.0538 -0.0004 -0.0095 0.0048  14   ASP B N    
2235 C CA   . ASP B 14  ? 0.0486 0.0325 0.0536 0.0008  -0.0105 0.0039  14   ASP B CA   
2236 C C    . ASP B 14  ? 0.0534 0.0318 0.0460 -0.0003 -0.0089 0.0051  14   ASP B C    
2237 O O    . ASP B 14  ? 0.0520 0.0429 0.0451 0.0000  -0.0097 0.0010  14   ASP B O    
2238 C CB   . ASP B 14  ? 0.0567 0.0356 0.0536 0.0000  -0.0159 0.0069  14   ASP B CB   
2239 C CG   . ASP B 14  ? 0.0525 0.0317 0.0576 -0.0012 -0.0138 0.0105  14   ASP B CG   
2240 O OD1  . ASP B 14  ? 0.0709 0.0426 0.0546 -0.0015 -0.0137 0.0069  14   ASP B OD1  
2241 O OD2  . ASP B 14  ? 0.0678 0.0375 0.0663 0.0036  -0.0107 0.0046  14   ASP B OD2  
2242 H H    . ASP B 14  ? 0.0542 0.0542 0.0542 0.0000  0.0000  0.0000  14   ASP B H    
2243 H HA   . ASP B 14  ? 0.0540 0.0540 0.0540 0.0000  0.0000  0.0000  14   ASP B HA   
2244 H HB2  . ASP B 14  ? 0.0584 0.0584 0.0584 0.0000  0.0000  0.0000  14   ASP B HB2  
2245 H HB3  . ASP B 14  ? 0.0584 0.0584 0.0584 0.0000  0.0000  0.0000  14   ASP B HB3  
2246 N N    . SER B 15  ? 0.0651 0.0378 0.0486 -0.0002 -0.0043 -0.0047 15   SER B N    
2247 C CA   . SER B 15  ? 0.0761 0.0538 0.0494 -0.0120 -0.0117 -0.0058 15   SER B CA   
2248 C C    . SER B 15  ? 0.0759 0.0602 0.0487 -0.0075 -0.0136 -0.0034 15   SER B C    
2249 O O    . SER B 15  ? 0.0962 0.0841 0.0630 -0.0144 -0.0361 0.0000  15   SER B O    
2250 C CB   A SER B 15  ? 0.1175 0.0602 0.0802 -0.0136 -0.0266 -0.0126 15   SER B CB   
2251 C CB   B SER B 15  ? 0.0620 0.0517 0.0551 -0.0124 0.0080  -0.0206 15   SER B CB   
2252 O OG   A SER B 15  ? 0.1598 0.1109 0.1374 -0.0159 0.0353  -0.0713 15   SER B OG   
2253 O OG   B SER B 15  ? 0.0693 0.0398 0.0731 0.0008  0.0065  -0.0035 15   SER B OG   
2254 H H    . SER B 15  ? 0.0605 0.0605 0.0605 0.0000  0.0000  0.0000  15   SER B H    
2255 H HA   A SER B 15  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  15   SER B HA   
2256 H HB2  A SER B 15  ? 0.1032 0.1032 0.1032 0.0000  0.0000  0.0000  15   SER B HB2  
2257 H HB2  B SER B 15  ? 0.0675 0.0675 0.0675 0.0000  0.0000  0.0000  15   SER B HB2  
2258 H HB3  A SER B 15  ? 0.1032 0.1032 0.1032 0.0000  0.0000  0.0000  15   SER B HB3  
2259 H HB3  B SER B 15  ? 0.0675 0.0675 0.0675 0.0000  0.0000  0.0000  15   SER B HB3  
2260 H HG   A SER B 15  ? 0.2040 0.2040 0.2040 0.0000  0.0000  0.0000  15   SER B HG   
2261 H HG   B SER B 15  ? 0.0911 0.0911 0.0911 0.0000  0.0000  0.0000  15   SER B HG   
2262 N N    . SER B 16  ? 0.0660 0.0554 0.0461 0.0019  -0.0154 0.0039  16   SER B N    
2263 C CA   . SER B 16  ? 0.0741 0.0578 0.0439 -0.0011 -0.0098 0.0119  16   SER B CA   
2264 C C    . SER B 16  ? 0.0574 0.0588 0.0451 -0.0060 -0.0162 0.0120  16   SER B C    
2265 O O    . SER B 16  ? 0.0565 0.0734 0.0667 -0.0030 -0.0143 0.0318  16   SER B O    
2266 C CB   . SER B 16  ? 0.0691 0.0906 0.0652 0.0095  0.0006  0.0291  16   SER B CB   
2267 O OG   . SER B 16  ? 0.0612 0.0789 0.0827 -0.0117 -0.0162 0.0374  16   SER B OG   
2268 H H    . SER B 16  ? 0.0670 0.0670 0.0670 0.0000  0.0000  0.0000  16   SER B H    
2269 H HA   . SER B 16  ? 0.0703 0.0703 0.0703 0.0000  0.0000  0.0000  16   SER B HA   
2270 H HB2  . SER B 16  ? 0.0899 0.0899 0.0899 0.0000  0.0000  0.0000  16   SER B HB2  
2271 H HB3  . SER B 16  ? 0.0899 0.0899 0.0899 0.0000  0.0000  0.0000  16   SER B HB3  
2272 H HG   . SER B 16  ? 0.1115 0.1115 0.1115 0.0000  0.0000  0.0000  16   SER B HG   
2273 N N    . THR B 17  ? 0.0615 0.0450 0.0473 -0.0015 -0.0133 0.0096  17   THR B N    
2274 C CA   . THR B 17  ? 0.0493 0.0399 0.0532 -0.0021 -0.0151 0.0110  17   THR B CA   
2275 C C    . THR B 17  ? 0.0585 0.0401 0.0475 -0.0068 -0.0175 0.0047  17   THR B C    
2276 O O    . THR B 17  ? 0.0624 0.0470 0.0625 -0.0003 -0.0133 0.0198  17   THR B O    
2277 C CB   . THR B 17  ? 0.0536 0.0488 0.0648 -0.0038 -0.0159 0.0066  17   THR B CB   
2278 O OG1  . THR B 17  ? 0.0663 0.0534 0.0626 0.0058  -0.0091 0.0083  17   THR B OG1  
2279 C CG2  . THR B 17  ? 0.0610 0.0590 0.0615 0.0022  -0.0223 0.0016  17   THR B CG2  
2280 H H    . THR B 17  ? 0.0614 0.0614 0.0614 0.0000  0.0000  0.0000  17   THR B H    
2281 H HA   . THR B 17  ? 0.0569 0.0569 0.0569 0.0000  0.0000  0.0000  17   THR B HA   
2282 H HB   . THR B 17  ? 0.0669 0.0669 0.0669 0.0000  0.0000  0.0000  17   THR B HB   
2283 H HG1  . THR B 17  ? 0.0912 0.0912 0.0912 0.0000  0.0000  0.0000  17   THR B HG1  
2284 H HG21 . THR B 17  ? 0.0907 0.0907 0.0907 0.0000  0.0000  0.0000  17   THR B HG21 
2285 H HG22 . THR B 17  ? 0.0907 0.0907 0.0907 0.0000  0.0000  0.0000  17   THR B HG22 
2286 H HG23 . THR B 17  ? 0.0907 0.0907 0.0907 0.0000  0.0000  0.0000  17   THR B HG23 
2287 N N    . SER B 18  ? 0.0547 0.0366 0.0438 -0.0031 -0.0145 0.0087  18   SER B N    
2288 C CA   . SER B 18  ? 0.0621 0.0334 0.0428 -0.0102 -0.0126 0.0022  18   SER B CA   
2289 C C    . SER B 18  ? 0.0560 0.0313 0.0410 -0.0030 -0.0138 0.0035  18   SER B C    
2290 O O    . SER B 18  ? 0.0610 0.0379 0.0490 -0.0102 -0.0103 0.0039  18   SER B O    
2291 C CB   . SER B 18  ? 0.0619 0.0500 0.0524 -0.0143 -0.0199 0.0054  18   SER B CB   
2292 O OG   . SER B 18  ? 0.0631 0.0510 0.0679 -0.0023 -0.0225 0.0079  18   SER B OG   
2293 H H    . SER B 18  ? 0.0541 0.0541 0.0541 0.0000  0.0000  0.0000  18   SER B H    
2294 H HA   . SER B 18  ? 0.0553 0.0553 0.0553 0.0000  0.0000  0.0000  18   SER B HA   
2295 H HB2  . SER B 18  ? 0.0657 0.0657 0.0657 0.0000  0.0000  0.0000  18   SER B HB2  
2296 H HB3  . SER B 18  ? 0.0657 0.0657 0.0657 0.0000  0.0000  0.0000  18   SER B HB3  
2297 H HG   . SER B 18  ? 0.0909 0.0909 0.0909 0.0000  0.0000  0.0000  18   SER B HG   
2298 N N    . ALA B 19  ? 0.0597 0.0288 0.0409 -0.0071 -0.0120 0.0000  19   ALA B N    
2299 C CA   . ALA B 19  ? 0.0595 0.0350 0.0421 -0.0017 -0.0107 -0.0002 19   ALA B CA   
2300 C C    . ALA B 19  ? 0.0576 0.0325 0.0468 -0.0008 -0.0144 -0.0009 19   ALA B C    
2301 O O    . ALA B 19  ? 0.0684 0.0400 0.0471 -0.0124 -0.0122 -0.0006 19   ALA B O    
2302 C CB   . ALA B 19  ? 0.0587 0.0468 0.0674 -0.0003 -0.0074 -0.0060 19   ALA B CB   
2303 H H    . ALA B 19  ? 0.0518 0.0518 0.0518 0.0000  0.0000  0.0000  19   ALA B H    
2304 H HA   . ALA B 19  ? 0.0547 0.0547 0.0547 0.0000  0.0000  0.0000  19   ALA B HA   
2305 H HB1  . ALA B 19  ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  19   ALA B HB1  
2306 H HB2  . ALA B 19  ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  19   ALA B HB2  
2307 H HB3  . ALA B 19  ? 0.0865 0.0865 0.0865 0.0000  0.0000  0.0000  19   ALA B HB3  
2308 N N    . ALA B 20  ? 0.0664 0.0301 0.0462 -0.0069 -0.0158 0.0017  20   ALA B N    
2309 C CA   . ALA B 20  ? 0.0671 0.0356 0.0441 -0.0062 -0.0169 0.0000  20   ALA B CA   
2310 C C    . ALA B 20  ? 0.0666 0.0322 0.0533 -0.0058 -0.0211 -0.0023 20   ALA B C    
2311 O O    . ALA B 20  ? 0.0675 0.0419 0.0674 0.0051  -0.0147 0.0058  20   ALA B O    
2312 C CB   . ALA B 20  ? 0.0825 0.0399 0.0494 -0.0065 -0.0199 -0.0019 20   ALA B CB   
2313 H H    . ALA B 20  ? 0.0570 0.0570 0.0570 0.0000  0.0000  0.0000  20   ALA B H    
2314 H HA   . ALA B 20  ? 0.0588 0.0588 0.0588 0.0000  0.0000  0.0000  20   ALA B HA   
2315 H HB1  . ALA B 20  ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  20   ALA B HB1  
2316 H HB2  . ALA B 20  ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  20   ALA B HB2  
2317 H HB3  . ALA B 20  ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  20   ALA B HB3  
2318 N N    . SER B 21  ? 0.0603 0.0336 0.0517 -0.0028 -0.0162 0.0013  21   SER B N    
2319 C CA   . SER B 21  ? 0.0687 0.0461 0.0422 0.0006  -0.0182 0.0015  21   SER B CA   
2320 C C    . SER B 21  ? 0.0656 0.0385 0.0489 -0.0001 -0.0181 0.0039  21   SER B C    
2321 O O    . SER B 21  ? 0.0989 0.0564 0.0586 0.0243  -0.0347 -0.0024 21   SER B O    
2322 C CB   A SER B 21  ? 0.0786 0.0753 0.0516 0.0076  -0.0032 0.0121  21   SER B CB   
2323 C CB   B SER B 21  ? 0.0589 0.0589 0.0589 0.0000  0.0000  0.0000  21   SER B CB   
2324 O OG   A SER B 21  ? 0.0707 0.0597 0.0770 0.0032  -0.0085 0.0127  21   SER B OG   
2325 O OG   B SER B 21  ? 0.1092 0.1092 0.1092 0.0000  0.0000  0.0000  21   SER B OG   
2326 H H    . SER B 21  ? 0.0583 0.0583 0.0583 0.0000  0.0000  0.0000  21   SER B H    
2327 H HA   A SER B 21  ? 0.0628 0.0628 0.0628 0.0000  0.0000  0.0000  21   SER B HA   
2328 H HB2  A SER B 21  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  21   SER B HB2  
2329 H HB2  B SER B 21  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  21   SER B HB2  
2330 H HB3  A SER B 21  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  21   SER B HB3  
2331 H HB3  B SER B 21  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  21   SER B HB3  
2332 H HG   A SER B 21  ? 0.1037 0.1037 0.1037 0.0000  0.0000  0.0000  21   SER B HG   
2333 H HG   B SER B 21  ? 0.1638 0.1638 0.1638 0.0000  0.0000  0.0000  21   SER B HG   
2334 N N    . SER B 22  ? 0.0654 0.0315 0.0515 0.0018  -0.0247 -0.0008 22   SER B N    
2335 C CA   . SER B 22  ? 0.0691 0.0246 0.0582 0.0006  -0.0266 0.0004  22   SER B CA   
2336 C C    . SER B 22  ? 0.0645 0.0282 0.0482 -0.0040 -0.0207 0.0008  22   SER B C    
2337 O O    . SER B 22  ? 0.0651 0.0281 0.0534 0.0029  -0.0206 0.0006  22   SER B O    
2338 C CB   . SER B 22  ? 0.0856 0.0278 0.0600 -0.0035 -0.0242 0.0037  22   SER B CB   
2339 O OG   . SER B 22  ? 0.0849 0.0457 0.0583 -0.0107 -0.0190 0.0026  22   SER B OG   
2340 H H    . SER B 22  ? 0.0594 0.0594 0.0594 0.0000  0.0000  0.0000  22   SER B H    
2341 H HA   . SER B 22  ? 0.0607 0.0607 0.0607 0.0000  0.0000  0.0000  22   SER B HA   
2342 H HB2  . SER B 22  ? 0.0694 0.0694 0.0694 0.0000  0.0000  0.0000  22   SER B HB2  
2343 H HB3  . SER B 22  ? 0.0694 0.0694 0.0694 0.0000  0.0000  0.0000  22   SER B HB3  
2344 H HG   . SER B 22  ? 0.0945 0.0945 0.0945 0.0000  0.0000  0.0000  22   SER B HG   
2345 N N    . SER B 23  ? 0.0646 0.0338 0.0500 0.0026  -0.0178 -0.0064 23   SER B N    
2346 C CA   . SER B 23  ? 0.0683 0.0377 0.0489 -0.0018 -0.0229 0.0021  23   SER B CA   
2347 C C    . SER B 23  ? 0.0661 0.0243 0.0552 0.0021  -0.0212 -0.0053 23   SER B C    
2348 O O    . SER B 23  ? 0.0661 0.0437 0.0584 0.0003  -0.0252 -0.0012 23   SER B O    
2349 C CB   . SER B 23  ? 0.0766 0.0411 0.0569 0.0050  -0.0184 -0.0094 23   SER B CB   
2350 O OG   . SER B 23  ? 0.0763 0.0364 0.0869 0.0056  -0.0248 -0.0143 23   SER B OG   
2351 H H    . SER B 23  ? 0.0594 0.0594 0.0594 0.0000  0.0000  0.0000  23   SER B H    
2352 H HA   . SER B 23  ? 0.0619 0.0619 0.0619 0.0000  0.0000  0.0000  23   SER B HA   
2353 H HB2  . SER B 23  ? 0.0699 0.0699 0.0699 0.0000  0.0000  0.0000  23   SER B HB2  
2354 H HB3  . SER B 23  ? 0.0699 0.0699 0.0699 0.0000  0.0000  0.0000  23   SER B HB3  
2355 H HG   . SER B 23  ? 0.0998 0.0998 0.0998 0.0000  0.0000  0.0000  23   SER B HG   
2356 N N    . ASN B 24  ? 0.0639 0.0264 0.0505 0.0008  -0.0192 -0.0007 24   ASN B N    
2357 C CA   . ASN B 24  ? 0.0595 0.0288 0.0629 0.0015  -0.0212 -0.0007 24   ASN B CA   
2358 C C    . ASN B 24  ? 0.0648 0.0329 0.0551 0.0014  -0.0179 0.0019  24   ASN B C    
2359 O O    . ASN B 24  ? 0.0642 0.0320 0.0727 -0.0001 -0.0187 -0.0011 24   ASN B O    
2360 C CB   . ASN B 24  ? 0.0618 0.0310 0.0720 -0.0006 -0.0170 0.0004  24   ASN B CB   
2361 C CG   . ASN B 24  ? 0.0619 0.0361 0.0743 0.0017  -0.0060 0.0053  24   ASN B CG   
2362 O OD1  . ASN B 24  ? 0.0921 0.0408 0.0697 0.0090  -0.0084 0.0025  24   ASN B OD1  
2363 N ND2  . ASN B 24  ? 0.0761 0.0432 0.0754 0.0018  -0.0119 0.0134  24   ASN B ND2  
2364 H H    . ASN B 24  ? 0.0564 0.0564 0.0564 0.0000  0.0000  0.0000  24   ASN B H    
2365 H HA   . ASN B 24  ? 0.0605 0.0605 0.0605 0.0000  0.0000  0.0000  24   ASN B HA   
2366 H HB2  . ASN B 24  ? 0.0660 0.0660 0.0660 0.0000  0.0000  0.0000  24   ASN B HB2  
2367 H HB3  . ASN B 24  ? 0.0660 0.0660 0.0660 0.0000  0.0000  0.0000  24   ASN B HB3  
2368 H HD21 . ASN B 24  ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  24   ASN B HD21 
2369 H HD22 . ASN B 24  ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  24   ASN B HD22 
2370 N N    . TYR B 25  ? 0.0638 0.0271 0.0598 0.0057  -0.0218 -0.0020 25   TYR B N    
2371 C CA   . TYR B 25  ? 0.0649 0.0265 0.0548 0.0019  -0.0219 -0.0032 25   TYR B CA   
2372 C C    . TYR B 25  ? 0.0529 0.0282 0.0598 -0.0003 -0.0177 -0.0020 25   TYR B C    
2373 O O    . TYR B 25  ? 0.0604 0.0417 0.0608 0.0036  -0.0194 -0.0026 25   TYR B O    
2374 C CB   . TYR B 25  ? 0.0558 0.0356 0.0650 0.0024  -0.0226 -0.0089 25   TYR B CB   
2375 C CG   . TYR B 25  ? 0.0577 0.0330 0.0553 -0.0029 -0.0184 -0.0014 25   TYR B CG   
2376 C CD1  . TYR B 25  ? 0.0648 0.0336 0.0572 0.0041  -0.0248 -0.0027 25   TYR B CD1  
2377 C CD2  . TYR B 25  ? 0.0755 0.0323 0.0629 -0.0046 -0.0153 -0.0011 25   TYR B CD2  
2378 C CE1  . TYR B 25  ? 0.0768 0.0337 0.0561 0.0009  -0.0229 -0.0018 25   TYR B CE1  
2379 C CE2  . TYR B 25  ? 0.0998 0.0262 0.0632 0.0004  -0.0098 0.0027  25   TYR B CE2  
2380 C CZ   . TYR B 25  ? 0.0690 0.0245 0.0695 -0.0022 -0.0162 -0.0038 25   TYR B CZ   
2381 O OH   . TYR B 25  ? 0.0919 0.0295 0.0680 0.0007  -0.0094 -0.0042 25   TYR B OH   
2382 H H    . TYR B 25  ? 0.0603 0.0603 0.0603 0.0000  0.0000  0.0000  25   TYR B H    
2383 H HA   . TYR B 25  ? 0.0585 0.0585 0.0585 0.0000  0.0000  0.0000  25   TYR B HA   
2384 H HB2  . TYR B 25  ? 0.0626 0.0626 0.0626 0.0000  0.0000  0.0000  25   TYR B HB2  
2385 H HB3  . TYR B 25  ? 0.0626 0.0626 0.0626 0.0000  0.0000  0.0000  25   TYR B HB3  
2386 H HD1  . TYR B 25  ? 0.0622 0.0622 0.0622 0.0000  0.0000  0.0000  25   TYR B HD1  
2387 H HD2  . TYR B 25  ? 0.0683 0.0683 0.0683 0.0000  0.0000  0.0000  25   TYR B HD2  
2388 H HE1  . TYR B 25  ? 0.0666 0.0666 0.0666 0.0000  0.0000  0.0000  25   TYR B HE1  
2389 H HE2  . TYR B 25  ? 0.0756 0.0756 0.0756 0.0000  0.0000  0.0000  25   TYR B HE2  
2390 H HH   . TYR B 25  ? 0.0947 0.0947 0.0947 0.0000  0.0000  0.0000  25   TYR B HH   
2391 N N    . CYS B 26  ? 0.0631 0.0302 0.0520 -0.0008 -0.0195 -0.0016 26   CYS B N    
2392 C CA   . CYS B 26  ? 0.0585 0.0326 0.0616 -0.0007 -0.0248 -0.0037 26   CYS B CA   
2393 C C    . CYS B 26  ? 0.0664 0.0362 0.0595 -0.0016 -0.0260 0.0034  26   CYS B C    
2394 O O    . CYS B 26  ? 0.0616 0.0515 0.0770 0.0007  -0.0253 0.0101  26   CYS B O    
2395 C CB   . CYS B 26  ? 0.0677 0.0366 0.0566 -0.0006 -0.0255 -0.0010 26   CYS B CB   
2396 S SG   . CYS B 26  ? 0.0643 0.0353 0.0609 -0.0022 -0.0221 0.0003  26   CYS B SG   
2397 H H    . CYS B 26  ? 0.0581 0.0581 0.0581 0.0000  0.0000  0.0000  26   CYS B H    
2398 H HA   . CYS B 26  ? 0.0610 0.0610 0.0610 0.0000  0.0000  0.0000  26   CYS B HA   
2399 H HB2  . CYS B 26  ? 0.0643 0.0643 0.0643 0.0000  0.0000  0.0000  26   CYS B HB2  
2400 H HB3  . CYS B 26  ? 0.0643 0.0643 0.0643 0.0000  0.0000  0.0000  26   CYS B HB3  
2401 N N    . ASN B 27  ? 0.0732 0.0390 0.0647 -0.0041 -0.0263 0.0013  27   ASN B N    
2402 C CA   . ASN B 27  ? 0.0812 0.0512 0.0702 -0.0139 -0.0298 -0.0026 27   ASN B CA   
2403 C C    . ASN B 27  ? 0.0778 0.0593 0.0833 -0.0171 -0.0294 0.0112  27   ASN B C    
2404 O O    . ASN B 27  ? 0.0781 0.1472 0.0986 -0.0345 -0.0294 0.0297  27   ASN B O    
2405 C CB   . ASN B 27  ? 0.0996 0.0513 0.0713 -0.0141 -0.0319 0.0097  27   ASN B CB   
2406 C CG   . ASN B 27  ? 0.0926 0.0402 0.0736 -0.0122 -0.0313 0.0003  27   ASN B CG   
2407 O OD1  . ASN B 27  ? 0.1013 0.0618 0.0703 0.0086  -0.0306 0.0056  27   ASN B OD1  
2408 N ND2  . ASN B 27  ? 0.1099 0.0424 0.0843 0.0031  -0.0339 0.0037  27   ASN B ND2  
2409 H H    . ASN B 27  ? 0.0708 0.0708 0.0708 0.0000  0.0000  0.0000  27   ASN B H    
2410 H HA   . ASN B 27  ? 0.0811 0.0811 0.0811 0.0000  0.0000  0.0000  27   ASN B HA   
2411 H HB2  . ASN B 27  ? 0.0889 0.0889 0.0889 0.0000  0.0000  0.0000  27   ASN B HB2  
2412 H HB3  . ASN B 27  ? 0.0889 0.0889 0.0889 0.0000  0.0000  0.0000  27   ASN B HB3  
2413 H HD21 . ASN B 27  ? 0.0946 0.0946 0.0946 0.0000  0.0000  0.0000  27   ASN B HD21 
2414 H HD22 . ASN B 27  ? 0.0946 0.0946 0.0946 0.0000  0.0000  0.0000  27   ASN B HD22 
2415 N N    . GLN B 28  ? 0.0725 0.0399 0.0775 -0.0064 -0.0221 0.0023  28   GLN B N    
2416 C CA   . GLN B 28  ? 0.0714 0.0393 0.0873 -0.0073 -0.0169 0.0100  28   GLN B CA   
2417 C C    . GLN B 28  ? 0.0648 0.0491 0.0784 -0.0030 -0.0182 0.0039  28   GLN B C    
2418 O O    . GLN B 28  ? 0.0718 0.0551 0.1214 -0.0060 -0.0054 0.0148  28   GLN B O    
2419 C CB   . GLN B 28  ? 0.0801 0.0484 0.0778 0.0022  -0.0145 0.0052  28   GLN B CB   
2420 C CG   . GLN B 28  ? 0.1038 0.0386 0.0872 0.0044  -0.0049 0.0039  28   GLN B CG   
2421 C CD   . GLN B 28  ? 0.0917 0.0525 0.0980 0.0113  0.0082  0.0116  28   GLN B CD   
2422 O OE1  . GLN B 28  ? 0.1068 0.0755 0.1184 0.0084  0.0268  0.0213  28   GLN B OE1  
2423 N NE2  . GLN B 28  ? 0.1060 0.0782 0.0843 0.0209  0.0066  0.0150  28   GLN B NE2  
2424 H H    . GLN B 28  ? 0.0760 0.0760 0.0760 0.0000  0.0000  0.0000  28   GLN B H    
2425 H HA   . GLN B 28  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  28   GLN B HA   
2426 H HB2  . GLN B 28  ? 0.0825 0.0825 0.0825 0.0000  0.0000  0.0000  28   GLN B HB2  
2427 H HB3  . GLN B 28  ? 0.0825 0.0825 0.0825 0.0000  0.0000  0.0000  28   GLN B HB3  
2428 H HG2  . GLN B 28  ? 0.0918 0.0918 0.0918 0.0000  0.0000  0.0000  28   GLN B HG2  
2429 H HG3  . GLN B 28  ? 0.0918 0.0918 0.0918 0.0000  0.0000  0.0000  28   GLN B HG3  
2430 H HE21 . GLN B 28  ? 0.1074 0.1074 0.1074 0.0000  0.0000  0.0000  28   GLN B HE21 
2431 H HE22 . GLN B 28  ? 0.1074 0.1074 0.1074 0.0000  0.0000  0.0000  28   GLN B HE22 
2432 N N    . MET B 29  ? 0.0629 0.0432 0.0773 -0.0012 -0.0121 0.0050  29   MET B N    
2433 C CA   . MET B 29  ? 0.0703 0.0422 0.0807 -0.0072 -0.0052 0.0008  29   MET B CA   
2434 C C    . MET B 29  ? 0.0614 0.0437 0.0934 -0.0026 -0.0065 -0.0050 29   MET B C    
2435 O O    . MET B 29  ? 0.0717 0.0516 0.0978 0.0022  -0.0077 -0.0047 29   MET B O    
2436 C CB   A MET B 29  ? 0.0720 0.0435 0.0982 -0.0072 -0.0066 -0.0052 29   MET B CB   
2437 C CB   B MET B 29  ? 0.0657 0.0402 0.0659 0.0003  -0.0036 0.0021  29   MET B CB   
2438 C CG   A MET B 29  ? 0.0760 0.0835 0.1302 0.0080  -0.0438 -0.0185 29   MET B CG   
2439 C CG   B MET B 29  ? 0.0855 0.0280 0.0773 0.0014  -0.0148 -0.0143 29   MET B CG   
2440 S SD   A MET B 29  ? 0.1129 0.2764 0.0882 0.0442  -0.0321 -0.0480 29   MET B SD   
2441 S SD   B MET B 29  ? 0.0812 0.0936 0.0774 0.0136  -0.0275 -0.0217 29   MET B SD   
2442 C CE   A MET B 29  ? 0.1311 0.2154 0.2889 0.0685  -0.0982 -0.1686 29   MET B CE   
2443 C CE   B MET B 29  ? 0.0538 0.0939 0.1257 -0.0150 -0.0250 -0.0153 29   MET B CE   
2444 H H    . MET B 29  ? 0.0733 0.0733 0.0733 0.0000  0.0000  0.0000  29   MET B H    
2445 H HA   A MET B 29  ? 0.0773 0.0773 0.0773 0.0000  0.0000  0.0000  29   MET B HA   
2446 H HB2  A MET B 29  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  29   MET B HB2  
2447 H HB2  B MET B 29  ? 0.0688 0.0688 0.0688 0.0000  0.0000  0.0000  29   MET B HB2  
2448 H HB3  A MET B 29  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  29   MET B HB3  
2449 H HB3  B MET B 29  ? 0.0688 0.0688 0.0688 0.0000  0.0000  0.0000  29   MET B HB3  
2450 H HG2  A MET B 29  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  29   MET B HG2  
2451 H HG2  B MET B 29  ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  29   MET B HG2  
2452 H HG3  A MET B 29  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  29   MET B HG3  
2453 H HG3  B MET B 29  ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  29   MET B HG3  
2454 H HE1  A MET B 29  ? 0.3176 0.3176 0.3176 0.0000  0.0000  0.0000  29   MET B HE1  
2455 H HE1  B MET B 29  ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  29   MET B HE1  
2456 H HE2  A MET B 29  ? 0.3176 0.3176 0.3176 0.0000  0.0000  0.0000  29   MET B HE2  
2457 H HE2  B MET B 29  ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  29   MET B HE2  
2458 H HE3  A MET B 29  ? 0.3176 0.3176 0.3176 0.0000  0.0000  0.0000  29   MET B HE3  
2459 H HE3  B MET B 29  ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  29   MET B HE3  
2460 N N    . MET B 30  ? 0.0735 0.0469 0.0798 0.0064  -0.0153 0.0035  30   MET B N    
2461 C CA   . MET B 30  ? 0.0687 0.0527 0.0933 0.0061  -0.0136 0.0110  30   MET B CA   
2462 C C    . MET B 30  ? 0.0723 0.0562 0.0945 0.0019  -0.0156 0.0054  30   MET B C    
2463 O O    . MET B 30  ? 0.0749 0.0738 0.1423 0.0110  -0.0155 0.0192  30   MET B O    
2464 C CB   . MET B 30  ? 0.0790 0.0476 0.0812 0.0047  -0.0283 0.0112  30   MET B CB   
2465 C CG   . MET B 30  ? 0.0724 0.0460 0.0867 0.0037  -0.0308 0.0055  30   MET B CG   
2466 S SD   . MET B 30  ? 0.0857 0.0451 0.0798 -0.0070 -0.0370 0.0061  30   MET B SD   
2467 C CE   . MET B 30  ? 0.0862 0.0499 0.0892 -0.0009 -0.0373 0.0052  30   MET B CE   
2468 H H    . MET B 30  ? 0.0800 0.0800 0.0800 0.0000  0.0000  0.0000  30   MET B H    
2469 H HA   . MET B 30  ? 0.0859 0.0859 0.0859 0.0000  0.0000  0.0000  30   MET B HA   
2470 H HB2  . MET B 30  ? 0.0831 0.0831 0.0831 0.0000  0.0000  0.0000  30   MET B HB2  
2471 H HB3  . MET B 30  ? 0.0831 0.0831 0.0831 0.0000  0.0000  0.0000  30   MET B HB3  
2472 H HG2  . MET B 30  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  30   MET B HG2  
2473 H HG3  . MET B 30  ? 0.0821 0.0821 0.0821 0.0000  0.0000  0.0000  30   MET B HG3  
2474 H HE1  . MET B 30  ? 0.1126 0.1126 0.1126 0.0000  0.0000  0.0000  30   MET B HE1  
2475 H HE2  . MET B 30  ? 0.1126 0.1126 0.1126 0.0000  0.0000  0.0000  30   MET B HE2  
2476 H HE3  . MET B 30  ? 0.1126 0.1126 0.1126 0.0000  0.0000  0.0000  30   MET B HE3  
2477 N N    . LYS B 31  ? 0.0721 0.0566 0.0982 -0.0071 -0.0147 0.0014  31   LYS B N    
2478 C CA   . LYS B 31  ? 0.0758 0.0785 0.1100 -0.0209 -0.0175 -0.0039 31   LYS B CA   
2479 C C    . LYS B 31  ? 0.0741 0.0574 0.1139 -0.0174 -0.0129 0.0087  31   LYS B C    
2480 O O    . LYS B 31  ? 0.0651 0.0891 0.1213 -0.0081 -0.0164 0.0084  31   LYS B O    
2481 C CB   . LYS B 31  ? 0.1198 0.0791 0.1394 -0.0265 -0.0239 -0.0059 31   LYS B CB   
2482 C CG   . LYS B 31  ? 0.1482 0.0997 0.1865 -0.0416 -0.0087 -0.0094 31   LYS B CG   
2483 C CD   . LYS B 31  ? 0.2959 0.1508 0.5467 -0.1122 -0.0127 0.0920  31   LYS B CD   
2484 H H    . LYS B 31  ? 0.0907 0.0907 0.0907 0.0000  0.0000  0.0000  31   LYS B H    
2485 H HA   . LYS B 31  ? 0.1058 0.1058 0.1058 0.0000  0.0000  0.0000  31   LYS B HA   
2486 H HB2  . LYS B 31  ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  31   LYS B HB2  
2487 H HB3  . LYS B 31  ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  31   LYS B HB3  
2488 H HG2  . LYS B 31  ? 0.1738 0.1738 0.1738 0.0000  0.0000  0.0000  31   LYS B HG2  
2489 H HG3  . LYS B 31  ? 0.1738 0.1738 0.1738 0.0000  0.0000  0.0000  31   LYS B HG3  
2490 N N    . SER B 32  ? 0.0787 0.0605 0.1021 0.0007  0.0005  0.0131  32   SER B N    
2491 C CA   . SER B 32  ? 0.0839 0.0817 0.1038 -0.0002 0.0042  0.0084  32   SER B CA   
2492 C C    . SER B 32  ? 0.0722 0.0839 0.1009 0.0028  -0.0002 0.0015  32   SER B C    
2493 O O    . SER B 32  ? 0.0984 0.1028 0.1372 0.0067  0.0253  0.0045  32   SER B O    
2494 C CB   A SER B 32  ? 0.1268 0.0957 0.0959 0.0207  0.0149  0.0148  32   SER B CB   
2495 C CB   B SER B 32  ? 0.1167 0.1241 0.1030 0.0027  -0.0287 0.0629  32   SER B CB   
2496 O OG   A SER B 32  ? 0.0968 0.1909 0.0895 0.0085  -0.0068 0.0049  32   SER B OG   
2497 O OG   B SER B 32  ? 0.1905 0.1844 0.1110 -0.0212 -0.0270 0.0553  32   SER B OG   
2498 H H    . SER B 32  ? 0.0965 0.0965 0.0965 0.0000  0.0000  0.0000  32   SER B H    
2499 H HA   A SER B 32  ? 0.1078 0.1078 0.1078 0.0000  0.0000  0.0000  32   SER B HA   
2500 H HB2  A SER B 32  ? 0.1273 0.1273 0.1273 0.0000  0.0000  0.0000  32   SER B HB2  
2501 H HB2  B SER B 32  ? 0.1375 0.1375 0.1375 0.0000  0.0000  0.0000  32   SER B HB2  
2502 H HB3  A SER B 32  ? 0.1273 0.1273 0.1273 0.0000  0.0000  0.0000  32   SER B HB3  
2503 H HB3  B SER B 32  ? 0.1375 0.1375 0.1375 0.0000  0.0000  0.0000  32   SER B HB3  
2504 H HG   A SER B 32  ? 0.1886 0.1886 0.1886 0.0000  0.0000  0.0000  32   SER B HG   
2505 H HG   B SER B 32  ? 0.2429 0.2429 0.2429 0.0000  0.0000  0.0000  32   SER B HG   
2506 N N    . ARG B 33  ? 0.0649 0.0637 0.1014 -0.0098 -0.0026 -0.0040 33   ARG B N    
2507 C CA   . ARG B 33  ? 0.0653 0.0637 0.1127 -0.0010 -0.0118 -0.0124 33   ARG B CA   
2508 C C    . ARG B 33  ? 0.0834 0.0630 0.1098 0.0057  -0.0130 -0.0077 33   ARG B C    
2509 O O    . ARG B 33  ? 0.0927 0.0731 0.1482 0.0130  -0.0153 -0.0116 33   ARG B O    
2510 C CB   . ARG B 33  ? 0.0770 0.0618 0.1047 -0.0003 -0.0026 -0.0013 33   ARG B CB   
2511 C CG   . ARG B 33  ? 0.0659 0.0610 0.1100 -0.0043 -0.0097 -0.0007 33   ARG B CG   
2512 C CD   . ARG B 33  ? 0.0722 0.0664 0.1058 -0.0181 -0.0113 0.0209  33   ARG B CD   
2513 N NE   . ARG B 33  ? 0.0788 0.0673 0.1110 -0.0153 -0.0193 0.0320  33   ARG B NE   
2514 C CZ   . ARG B 33  ? 0.0675 0.0836 0.0913 -0.0034 -0.0173 0.0192  33   ARG B CZ   
2515 N NH1  . ARG B 33  ? 0.0620 0.0509 0.0926 -0.0106 -0.0189 0.0149  33   ARG B NH1  
2516 N NH2  . ARG B 33  ? 0.0940 0.1065 0.1085 -0.0209 -0.0345 0.0442  33   ARG B NH2  
2517 H H    . ARG B 33  ? 0.0919 0.0919 0.0919 0.0000  0.0000  0.0000  33   ARG B H    
2518 H HA   . ARG B 33  ? 0.0966 0.0966 0.0966 0.0000  0.0000  0.0000  33   ARG B HA   
2519 H HB2  . ARG B 33  ? 0.0974 0.0974 0.0974 0.0000  0.0000  0.0000  33   ARG B HB2  
2520 H HB3  . ARG B 33  ? 0.0974 0.0974 0.0974 0.0000  0.0000  0.0000  33   ARG B HB3  
2521 H HG2  . ARG B 33  ? 0.0947 0.0947 0.0947 0.0000  0.0000  0.0000  33   ARG B HG2  
2522 H HG3  . ARG B 33  ? 0.0947 0.0947 0.0947 0.0000  0.0000  0.0000  33   ARG B HG3  
2523 H HD2  . ARG B 33  ? 0.0978 0.0978 0.0978 0.0000  0.0000  0.0000  33   ARG B HD2  
2524 H HD3  . ARG B 33  ? 0.0978 0.0978 0.0978 0.0000  0.0000  0.0000  33   ARG B HD3  
2525 H HE   . ARG B 33  ? 0.1028 0.1028 0.1028 0.0000  0.0000  0.0000  33   ARG B HE   
2526 H HH11 . ARG B 33  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  33   ARG B HH11 
2527 H HH12 . ARG B 33  ? 0.0822 0.0822 0.0822 0.0000  0.0000  0.0000  33   ARG B HH12 
2528 H HH21 . ARG B 33  ? 0.1236 0.1236 0.1236 0.0000  0.0000  0.0000  33   ARG B HH21 
2529 H HH22 . ARG B 33  ? 0.1236 0.1236 0.1236 0.0000  0.0000  0.0000  33   ARG B HH22 
2530 N N    . ASN B 34  ? 0.0815 0.0789 0.1293 0.0028  -0.0234 0.0053  34   ASN B N    
2531 C CA   . ASN B 34  ? 0.0887 0.1234 0.1254 0.0002  -0.0189 -0.0093 34   ASN B CA   
2532 C C    . ASN B 34  ? 0.0875 0.1333 0.1308 0.0157  -0.0201 0.0166  34   ASN B C    
2533 O O    . ASN B 34  ? 0.1033 0.3816 0.1950 0.1054  -0.0025 0.0987  34   ASN B O    
2534 C CB   A ASN B 34  ? 0.0678 0.2253 0.1806 0.0136  0.0184  -0.0333 34   ASN B CB   
2535 C CB   B ASN B 34  ? 0.0881 0.1515 0.1260 0.0194  -0.0388 -0.0333 34   ASN B CB   
2536 C CG   A ASN B 34  ? 0.1775 0.3372 0.1940 -0.0279 0.0753  -0.0130 34   ASN B CG   
2537 C CG   B ASN B 34  ? 0.0960 0.2473 0.1505 0.0241  -0.0663 -0.0640 34   ASN B CG   
2538 O OD1  A ASN B 34  ? 0.2926 0.3987 0.4522 -0.0265 0.2212  0.0881  34   ASN B OD1  
2539 O OD1  B ASN B 34  ? 0.0892 0.2794 0.2810 -0.0151 0.0030  -0.1584 34   ASN B OD1  
2540 N ND2  A ASN B 34  ? 0.2811 0.5252 0.4586 0.0343  0.2085  -0.1158 34   ASN B ND2  
2541 N ND2  B ASN B 34  ? 0.0906 0.3660 0.3503 0.0995  -0.0307 -0.1342 34   ASN B ND2  
2542 H H    . ASN B 34  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  34   ASN B H    
2543 H HA   A ASN B 34  ? 0.1350 0.1350 0.1350 0.0000  0.0000  0.0000  34   ASN B HA   
2544 H HB2  A ASN B 34  ? 0.1895 0.1895 0.1895 0.0000  0.0000  0.0000  34   ASN B HB2  
2545 H HB2  B ASN B 34  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  34   ASN B HB2  
2546 H HB3  A ASN B 34  ? 0.1895 0.1895 0.1895 0.0000  0.0000  0.0000  34   ASN B HB3  
2547 H HB3  B ASN B 34  ? 0.1463 0.1463 0.1463 0.0000  0.0000  0.0000  34   ASN B HB3  
2548 H HD21 A ASN B 34  ? 0.5060 0.5060 0.5060 0.0000  0.0000  0.0000  34   ASN B HD21 
2549 H HD21 B ASN B 34  ? 0.3227 0.3227 0.3227 0.0000  0.0000  0.0000  34   ASN B HD21 
2550 H HD22 A ASN B 34  ? 0.5060 0.5060 0.5060 0.0000  0.0000  0.0000  34   ASN B HD22 
2551 H HD22 B ASN B 34  ? 0.3227 0.3227 0.3227 0.0000  0.0000  0.0000  34   ASN B HD22 
2552 N N    . LEU B 35  ? 0.0884 0.1014 0.1247 0.0202  -0.0184 0.0175  35   LEU B N    
2553 C CA   . LEU B 35  ? 0.0981 0.1088 0.1083 0.0178  -0.0138 0.0206  35   LEU B CA   
2554 C C    . LEU B 35  ? 0.0890 0.1292 0.1190 -0.0159 -0.0392 0.0177  35   LEU B C    
2555 O O    . LEU B 35  ? 0.1370 0.1564 0.1008 -0.0486 -0.0346 0.0188  35   LEU B O    
2556 C CB   . LEU B 35  ? 0.1062 0.0763 0.1132 0.0078  -0.0175 0.0080  35   LEU B CB   
2557 C CG   . LEU B 35  ? 0.1551 0.0888 0.1848 -0.0255 0.0482  -0.0199 35   LEU B CG   
2558 C CD1  . LEU B 35  ? 0.1539 0.1047 0.1857 -0.0466 0.0303  -0.0537 35   LEU B CD1  
2559 C CD2  . LEU B 35  ? 0.1404 0.0671 0.3939 0.0000  0.0803  -0.0242 35   LEU B CD2  
2560 H H    . LEU B 35  ? 0.1258 0.1258 0.1258 0.0000  0.0000  0.0000  35   LEU B H    
2561 H HA   . LEU B 35  ? 0.1260 0.1260 0.1260 0.0000  0.0000  0.0000  35   LEU B HA   
2562 H HB2  . LEU B 35  ? 0.1183 0.1183 0.1183 0.0000  0.0000  0.0000  35   LEU B HB2  
2563 H HB3  . LEU B 35  ? 0.1183 0.1183 0.1183 0.0000  0.0000  0.0000  35   LEU B HB3  
2564 H HG   . LEU B 35  ? 0.1715 0.1715 0.1715 0.0000  0.0000  0.0000  35   LEU B HG   
2565 H HD11 . LEU B 35  ? 0.2221 0.2221 0.2221 0.0000  0.0000  0.0000  35   LEU B HD11 
2566 H HD12 . LEU B 35  ? 0.2221 0.2221 0.2221 0.0000  0.0000  0.0000  35   LEU B HD12 
2567 H HD13 . LEU B 35  ? 0.2221 0.2221 0.2221 0.0000  0.0000  0.0000  35   LEU B HD13 
2568 H HD21 . LEU B 35  ? 0.3007 0.3007 0.3007 0.0000  0.0000  0.0000  35   LEU B HD21 
2569 H HD22 . LEU B 35  ? 0.3007 0.3007 0.3007 0.0000  0.0000  0.0000  35   LEU B HD22 
2570 H HD23 . LEU B 35  ? 0.3007 0.3007 0.3007 0.0000  0.0000  0.0000  35   LEU B HD23 
2571 N N    . THR B 36  ? 0.0925 0.1298 0.1247 -0.0050 -0.0118 0.0192  36   THR B N    
2572 C CA   . THR B 36  ? 0.1099 0.1441 0.1261 -0.0251 -0.0431 -0.0134 36   THR B CA   
2573 C C    . THR B 36  ? 0.1093 0.1543 0.1279 -0.0205 -0.0039 -0.0096 36   THR B C    
2574 O O    . THR B 36  ? 0.1244 0.1874 0.2221 -0.0545 -0.0481 -0.0124 36   THR B O    
2575 C CB   . THR B 36  ? 0.1299 0.1279 0.1318 -0.0289 -0.0521 -0.0072 36   THR B CB   
2576 O OG1  . THR B 36  ? 0.1250 0.1627 0.1286 -0.0195 -0.0244 -0.0124 36   THR B OG1  
2577 C CG2  . THR B 36  ? 0.1094 0.1580 0.1537 -0.0046 -0.0469 -0.0427 36   THR B CG2  
2578 H H    . THR B 36  ? 0.1388 0.1388 0.1388 0.0000  0.0000  0.0000  36   THR B H    
2579 H HA   . THR B 36  ? 0.1520 0.1520 0.1520 0.0000  0.0000  0.0000  36   THR B HA   
2580 H HB   . THR B 36  ? 0.1558 0.1558 0.1558 0.0000  0.0000  0.0000  36   THR B HB   
2581 H HG1  . THR B 36  ? 0.2081 0.2081 0.2081 0.0000  0.0000  0.0000  36   THR B HG1  
2582 H HG21 . THR B 36  ? 0.2105 0.2105 0.2105 0.0000  0.0000  0.0000  36   THR B HG21 
2583 H HG22 . THR B 36  ? 0.2105 0.2105 0.2105 0.0000  0.0000  0.0000  36   THR B HG22 
2584 H HG23 . THR B 36  ? 0.2105 0.2105 0.2105 0.0000  0.0000  0.0000  36   THR B HG23 
2585 N N    . LYS B 37  ? 0.1072 0.2158 0.1745 -0.0101 -0.0201 0.0215  37   LYS B N    
2586 C CA   . LYS B 37  ? 0.0853 0.3260 0.2241 -0.0391 -0.0120 0.0401  37   LYS B CA   
2587 C C    . LYS B 37  ? 0.1180 0.2092 0.1979 -0.0325 0.0130  0.0026  37   LYS B C    
2588 O O    . LYS B 37  ? 0.1458 0.2329 0.2793 -0.0405 -0.0069 0.0149  37   LYS B O    
2589 C CB   . LYS B 37  ? 0.1075 0.5121 0.1593 -0.0281 -0.0031 -0.0064 37   LYS B CB   
2590 H H    . LYS B 37  ? 0.1990 0.1990 0.1990 0.0000  0.0000  0.0000  37   LYS B H    
2591 H HA   . LYS B 37  ? 0.2542 0.2542 0.2542 0.0000  0.0000  0.0000  37   LYS B HA   
2592 N N    . ASP B 38  ? 0.1133 0.2318 0.1790 -0.0139 0.0003  0.0330  38   ASP B N    
2593 C CA   . ASP B 38  ? 0.1363 0.3155 0.1878 0.0595  -0.0311 -0.0150 38   ASP B CA   
2594 C C    . ASP B 38  ? 0.1190 0.1916 0.1512 0.0155  -0.0334 0.0062  38   ASP B C    
2595 O O    . ASP B 38  ? 0.1170 0.2841 0.1963 -0.0101 -0.0769 0.0277  38   ASP B O    
2596 C CB   . ASP B 38  ? 0.2339 0.3173 0.2792 0.0928  -0.0022 -0.0325 38   ASP B CB   
2597 C CG   . ASP B 38  ? 0.3466 0.3466 0.3466 0.0000  0.0000  0.0000  38   ASP B CG   
2598 O OD1  . ASP B 38  ? 0.3744 0.3744 0.3744 0.0000  0.0000  0.0000  38   ASP B OD1  
2599 O OD2  . ASP B 38  ? 0.3559 0.3559 0.3559 0.0000  0.0000  0.0000  38   ASP B OD2  
2600 H H    . ASP B 38  ? 0.2096 0.2096 0.2096 0.0000  0.0000  0.0000  38   ASP B H    
2601 H HA   . ASP B 38  ? 0.2558 0.2558 0.2558 0.0000  0.0000  0.0000  38   ASP B HA   
2602 H HB2  . ASP B 38  ? 0.3321 0.3321 0.3321 0.0000  0.0000  0.0000  38   ASP B HB2  
2603 H HB3  . ASP B 38  ? 0.3321 0.3321 0.3321 0.0000  0.0000  0.0000  38   ASP B HB3  
2604 N N    . ARG B 39  ? 0.1125 0.2131 0.1381 -0.0104 -0.0518 0.0123  39   ARG B N    
2605 C CA   . ARG B 39  ? 0.1131 0.1340 0.1181 -0.0138 -0.0570 0.0240  39   ARG B CA   
2606 C C    . ARG B 39  ? 0.1118 0.1086 0.1038 -0.0197 -0.0621 0.0077  39   ARG B C    
2607 O O    . ARG B 39  ? 0.1398 0.1699 0.1048 0.0002  -0.0557 -0.0035 39   ARG B O    
2608 C CB   . ARG B 39  ? 0.1573 0.1124 0.1307 0.0298  -0.0684 -0.0087 39   ARG B CB   
2609 C CG   . ARG B 39  ? 0.1995 0.1182 0.1452 0.0121  -0.0229 -0.0234 39   ARG B CG   
2610 C CD   . ARG B 39  ? 0.1988 0.1433 0.2166 0.0113  0.0136  0.0013  39   ARG B CD   
2611 N NE   . ARG B 39  ? 0.2943 0.1796 0.3612 -0.0369 0.0548  -0.0118 39   ARG B NE   
2612 C CZ   . ARG B 39  ? 0.1859 0.2139 0.1635 -0.0111 -0.0746 0.0037  39   ARG B CZ   
2613 N NH1  . ARG B 39  ? 0.2174 0.1059 0.1262 0.0498  -0.0490 -0.0080 39   ARG B NH1  
2614 N NH2  . ARG B 39  ? 0.3188 0.1851 0.1664 0.0028  -0.1000 -0.0364 39   ARG B NH2  
2615 H H    . ARG B 39  ? 0.1854 0.1854 0.1854 0.0000  0.0000  0.0000  39   ARG B H    
2616 H HA   . ARG B 39  ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  39   ARG B HA   
2617 H HB2  . ARG B 39  ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  39   ARG B HB2  
2618 H HB3  . ARG B 39  ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  39   ARG B HB3  
2619 H HG2  . ARG B 39  ? 0.1852 0.1852 0.1852 0.0000  0.0000  0.0000  39   ARG B HG2  
2620 H HG3  . ARG B 39  ? 0.1852 0.1852 0.1852 0.0000  0.0000  0.0000  39   ARG B HG3  
2621 H HD2  . ARG B 39  ? 0.2235 0.2235 0.2235 0.0000  0.0000  0.0000  39   ARG B HD2  
2622 H HD3  . ARG B 39  ? 0.2235 0.2235 0.2235 0.0000  0.0000  0.0000  39   ARG B HD3  
2623 H HE   . ARG B 39  ? 0.3341 0.3341 0.3341 0.0000  0.0000  0.0000  39   ARG B HE   
2624 H HH11 . ARG B 39  ? 0.1797 0.1797 0.1797 0.0000  0.0000  0.0000  39   ARG B HH11 
2625 H HH12 . ARG B 39  ? 0.1797 0.1797 0.1797 0.0000  0.0000  0.0000  39   ARG B HH12 
2626 H HH21 . ARG B 39  ? 0.2681 0.2681 0.2681 0.0000  0.0000  0.0000  39   ARG B HH21 
2627 H HH22 . ARG B 39  ? 0.2681 0.2681 0.2681 0.0000  0.0000  0.0000  39   ARG B HH22 
2628 N N    . CYS B 40  ? 0.0998 0.0931 0.0903 -0.0120 -0.0540 -0.0046 40   CYS B N    
2629 C CA   . CYS B 40  ? 0.0970 0.0812 0.1016 -0.0185 -0.0640 0.0140  40   CYS B CA   
2630 C C    . CYS B 40  ? 0.1107 0.0617 0.0918 -0.0119 -0.0517 0.0020  40   CYS B C    
2631 O O    . CYS B 40  ? 0.1596 0.0859 0.0941 -0.0287 -0.0599 0.0226  40   CYS B O    
2632 C CB   . CYS B 40  ? 0.1035 0.0827 0.1047 -0.0171 -0.0344 0.0059  40   CYS B CB   
2633 S SG   . CYS B 40  ? 0.1107 0.0688 0.1303 -0.0140 -0.0641 0.0041  40   CYS B SG   
2634 H H    . CYS B 40  ? 0.1134 0.1134 0.1134 0.0000  0.0000  0.0000  40   CYS B H    
2635 H HA   . CYS B 40  ? 0.1120 0.1120 0.1120 0.0000  0.0000  0.0000  40   CYS B HA   
2636 H HB2  . CYS B 40  ? 0.1163 0.1163 0.1163 0.0000  0.0000  0.0000  40   CYS B HB2  
2637 H HB3  . CYS B 40  ? 0.1163 0.1163 0.1163 0.0000  0.0000  0.0000  40   CYS B HB3  
2638 N N    . LYS B 41  ? 0.0937 0.0593 0.0961 -0.0078 -0.0480 0.0110  41   LYS B N    
2639 C CA   . LYS B 41  ? 0.0884 0.0539 0.0936 -0.0015 -0.0450 0.0141  41   LYS B CA   
2640 C C    . LYS B 41  ? 0.0982 0.0454 0.0872 0.0049  -0.0440 0.0034  41   LYS B C    
2641 O O    . LYS B 41  ? 0.1006 0.0602 0.1084 0.0120  -0.0486 0.0152  41   LYS B O    
2642 C CB   . LYS B 41  ? 0.0966 0.0584 0.0842 -0.0041 -0.0357 0.0026  41   LYS B CB   
2643 C CG   . LYS B 41  ? 0.0961 0.0521 0.1056 0.0028  -0.0402 0.0080  41   LYS B CG   
2644 C CD   . LYS B 41  ? 0.1118 0.0636 0.1125 -0.0024 -0.0320 -0.0005 41   LYS B CD   
2645 C CE   . LYS B 41  ? 0.1557 0.0707 0.1105 -0.0102 -0.0556 0.0153  41   LYS B CE   
2646 N NZ   . LYS B 41  ? 0.1174 0.0794 0.1214 -0.0006 -0.0135 -0.0043 41   LYS B NZ   
2647 H H    . LYS B 41  ? 0.0997 0.0997 0.0997 0.0000  0.0000  0.0000  41   LYS B H    
2648 H HA   . LYS B 41  ? 0.0944 0.0944 0.0944 0.0000  0.0000  0.0000  41   LYS B HA   
2649 H HB2  . LYS B 41  ? 0.0956 0.0956 0.0956 0.0000  0.0000  0.0000  41   LYS B HB2  
2650 H HB3  . LYS B 41  ? 0.0956 0.0956 0.0956 0.0000  0.0000  0.0000  41   LYS B HB3  
2651 H HG2  . LYS B 41  ? 0.1014 0.1014 0.1014 0.0000  0.0000  0.0000  41   LYS B HG2  
2652 H HG3  . LYS B 41  ? 0.1014 0.1014 0.1014 0.0000  0.0000  0.0000  41   LYS B HG3  
2653 H HD2  . LYS B 41  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  41   LYS B HD2  
2654 H HD3  . LYS B 41  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  41   LYS B HD3  
2655 H HE2  . LYS B 41  ? 0.1348 0.1348 0.1348 0.0000  0.0000  0.0000  41   LYS B HE2  
2656 H HE3  . LYS B 41  ? 0.1348 0.1348 0.1348 0.0000  0.0000  0.0000  41   LYS B HE3  
2657 H HZ1  . LYS B 41  ? 0.1591 0.1591 0.1591 0.0000  0.0000  0.0000  41   LYS B HZ1  
2658 H HZ2  . LYS B 41  ? 0.1591 0.1591 0.1591 0.0000  0.0000  0.0000  41   LYS B HZ2  
2659 H HZ3  . LYS B 41  ? 0.1591 0.1591 0.1591 0.0000  0.0000  0.0000  41   LYS B HZ3  
2660 N N    . PRO B 42  ? 0.0914 0.0574 0.0915 0.0100  -0.0351 0.0053  42   PRO B N    
2661 C CA   . PRO B 42  ? 0.1139 0.0588 0.0761 0.0051  -0.0355 -0.0109 42   PRO B CA   
2662 C C    . PRO B 42  ? 0.0987 0.0615 0.0636 0.0167  -0.0193 0.0007  42   PRO B C    
2663 O O    . PRO B 42  ? 0.1049 0.0780 0.1090 0.0261  -0.0297 -0.0063 42   PRO B O    
2664 C CB   A PRO B 42  ? 0.1072 0.0899 0.0699 0.0089  -0.0400 -0.0172 42   PRO B CB   
2665 C CB   B PRO B 42  ? 0.1491 0.1429 0.0687 0.0439  -0.0609 -0.0170 42   PRO B CB   
2666 C CG   A PRO B 42  ? 0.1026 0.0761 0.0789 -0.0126 -0.0413 -0.0105 42   PRO B CG   
2667 C CG   B PRO B 42  ? 0.1427 0.1405 0.0703 0.0223  -0.0405 0.0202  42   PRO B CG   
2668 C CD   A PRO B 42  ? 0.0920 0.0727 0.0771 -0.0028 -0.0321 0.0092  42   PRO B CD   
2669 C CD   B PRO B 42  ? 0.1339 0.0924 0.0860 0.0374  -0.0464 0.0193  42   PRO B CD   
2670 H HA   A PRO B 42  ? 0.0994 0.0994 0.0994 0.0000  0.0000  0.0000  42   PRO B HA   
2671 H HB2  A PRO B 42  ? 0.1068 0.1068 0.1068 0.0000  0.0000  0.0000  42   PRO B HB2  
2672 H HB2  B PRO B 42  ? 0.1443 0.1443 0.1443 0.0000  0.0000  0.0000  42   PRO B HB2  
2673 H HB3  A PRO B 42  ? 0.1068 0.1068 0.1068 0.0000  0.0000  0.0000  42   PRO B HB3  
2674 H HB3  B PRO B 42  ? 0.1443 0.1443 0.1443 0.0000  0.0000  0.0000  42   PRO B HB3  
2675 H HG2  A PRO B 42  ? 0.1030 0.1030 0.1030 0.0000  0.0000  0.0000  42   PRO B HG2  
2676 H HG2  B PRO B 42  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  42   PRO B HG2  
2677 H HG3  A PRO B 42  ? 0.1030 0.1030 0.1030 0.0000  0.0000  0.0000  42   PRO B HG3  
2678 H HG3  B PRO B 42  ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  42   PRO B HG3  
2679 H HD2  A PRO B 42  ? 0.0968 0.0968 0.0968 0.0000  0.0000  0.0000  42   PRO B HD2  
2680 H HD2  B PRO B 42  ? 0.1249 0.1249 0.1249 0.0000  0.0000  0.0000  42   PRO B HD2  
2681 H HD3  A PRO B 42  ? 0.0968 0.0968 0.0968 0.0000  0.0000  0.0000  42   PRO B HD3  
2682 H HD3  B PRO B 42  ? 0.1249 0.1249 0.1249 0.0000  0.0000  0.0000  42   PRO B HD3  
2683 N N    . VAL B 43  ? 0.0869 0.0610 0.0654 0.0176  -0.0357 0.0019  43   VAL B N    
2684 C CA   . VAL B 43  ? 0.0974 0.0857 0.0609 0.0143  -0.0325 -0.0006 43   VAL B CA   
2685 C C    . VAL B 43  ? 0.0780 0.0766 0.0674 0.0055  -0.0311 0.0009  43   VAL B C    
2686 O O    . VAL B 43  ? 0.1075 0.0917 0.0732 0.0272  -0.0391 -0.0125 43   VAL B O    
2687 C CB   A VAL B 43  ? 0.0953 0.1205 0.0686 -0.0022 -0.0129 0.0056  43   VAL B CB   
2688 C CB   B VAL B 43  ? 0.0937 0.1695 0.0618 -0.0018 -0.0295 0.0032  43   VAL B CB   
2689 C CG1  A VAL B 43  ? 0.0938 0.2224 0.0888 -0.0541 -0.0210 0.0421  43   VAL B CG1  
2690 C CG1  B VAL B 43  ? 0.2834 0.1981 0.0629 0.0391  0.0526  0.0241  43   VAL B CG1  
2691 C CG2  A VAL B 43  ? 0.1388 0.1337 0.1164 -0.0315 0.0086  -0.0155 43   VAL B CG2  
2692 C CG2  B VAL B 43  ? 0.1355 0.1290 0.1369 -0.0030 -0.0173 0.0647  43   VAL B CG2  
2693 H H    . VAL B 43  ? 0.0852 0.0852 0.0852 0.0000  0.0000  0.0000  43   VAL B H    
2694 H HA   A VAL B 43  ? 0.0975 0.0975 0.0975 0.0000  0.0000  0.0000  43   VAL B HA   
2695 H HB   A VAL B 43  ? 0.1137 0.1137 0.1137 0.0000  0.0000  0.0000  43   VAL B HB   
2696 H HB   B VAL B 43  ? 0.1299 0.1299 0.1299 0.0000  0.0000  0.0000  43   VAL B HB   
2697 H HG11 A VAL B 43  ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  43   VAL B HG11 
2698 H HG11 B VAL B 43  ? 0.2722 0.2722 0.2722 0.0000  0.0000  0.0000  43   VAL B HG11 
2699 H HG12 A VAL B 43  ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  43   VAL B HG12 
2700 H HG12 B VAL B 43  ? 0.2722 0.2722 0.2722 0.0000  0.0000  0.0000  43   VAL B HG12 
2701 H HG13 A VAL B 43  ? 0.2025 0.2025 0.2025 0.0000  0.0000  0.0000  43   VAL B HG13 
2702 H HG13 B VAL B 43  ? 0.2722 0.2722 0.2722 0.0000  0.0000  0.0000  43   VAL B HG13 
2703 H HG21 A VAL B 43  ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  43   VAL B HG21 
2704 H HG21 B VAL B 43  ? 0.2007 0.2007 0.2007 0.0000  0.0000  0.0000  43   VAL B HG21 
2705 H HG22 A VAL B 43  ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  43   VAL B HG22 
2706 H HG22 B VAL B 43  ? 0.2007 0.2007 0.2007 0.0000  0.0000  0.0000  43   VAL B HG22 
2707 H HG23 A VAL B 43  ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  43   VAL B HG23 
2708 H HG23 B VAL B 43  ? 0.2007 0.2007 0.2007 0.0000  0.0000  0.0000  43   VAL B HG23 
2709 N N    . ASN B 44  ? 0.0789 0.0519 0.0568 -0.0006 -0.0304 0.0025  44   ASN B N    
2710 C CA   . ASN B 44  ? 0.0883 0.0468 0.0599 -0.0099 -0.0328 0.0001  44   ASN B CA   
2711 C C    . ASN B 44  ? 0.1081 0.0424 0.0792 -0.0086 -0.0553 0.0077  44   ASN B C    
2712 O O    . ASN B 44  ? 0.2269 0.0355 0.2706 0.0090  -0.1996 -0.0105 44   ASN B O    
2713 C CB   . ASN B 44  ? 0.1051 0.0632 0.0621 -0.0198 -0.0126 -0.0067 44   ASN B CB   
2714 C CG   . ASN B 44  ? 0.1210 0.0480 0.0788 -0.0108 -0.0093 -0.0030 44   ASN B CG   
2715 O OD1  . ASN B 44  ? 0.1571 0.0668 0.0944 0.0238  -0.0345 -0.0037 44   ASN B OD1  
2716 N ND2  . ASN B 44  ? 0.0928 0.0581 0.0643 0.0041  -0.0076 -0.0017 44   ASN B ND2  
2717 H H    . ASN B 44  ? 0.0751 0.0751 0.0751 0.0000  0.0000  0.0000  44   ASN B H    
2718 H HA   . ASN B 44  ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  44   ASN B HA   
2719 H HB2  . ASN B 44  ? 0.0922 0.0922 0.0922 0.0000  0.0000  0.0000  44   ASN B HB2  
2720 H HB3  . ASN B 44  ? 0.0922 0.0922 0.0922 0.0000  0.0000  0.0000  44   ASN B HB3  
2721 H HD21 . ASN B 44  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  44   ASN B HD21 
2722 H HD22 . ASN B 44  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  44   ASN B HD22 
2723 N N    . THR B 45  ? 0.0745 0.0329 0.0494 -0.0081 -0.0200 0.0032  45   THR B N    
2724 C CA   . THR B 45  ? 0.0704 0.0308 0.0494 -0.0012 -0.0148 0.0028  45   THR B CA   
2725 C C    . THR B 45  ? 0.0610 0.0291 0.0485 -0.0059 -0.0233 -0.0008 45   THR B C    
2726 O O    . THR B 45  ? 0.0661 0.0460 0.0556 0.0111  -0.0192 -0.0043 45   THR B O    
2727 C CB   . THR B 45  ? 0.0782 0.0429 0.0476 -0.0046 -0.0142 0.0086  45   THR B CB   
2728 O OG1  . THR B 45  ? 0.0849 0.0685 0.0556 -0.0083 -0.0035 0.0061  45   THR B OG1  
2729 C CG2  . THR B 45  ? 0.0753 0.0439 0.0791 -0.0115 -0.0208 0.0103  45   THR B CG2  
2730 H H    . THR B 45  ? 0.0627 0.0627 0.0627 0.0000  0.0000  0.0000  45   THR B H    
2731 H HA   . THR B 45  ? 0.0603 0.0603 0.0603 0.0000  0.0000  0.0000  45   THR B HA   
2732 H HB   . THR B 45  ? 0.0675 0.0675 0.0675 0.0000  0.0000  0.0000  45   THR B HB   
2733 H HG1  . THR B 45  ? 0.1045 0.1045 0.1045 0.0000  0.0000  0.0000  45   THR B HG1  
2734 H HG21 . THR B 45  ? 0.0992 0.0992 0.0992 0.0000  0.0000  0.0000  45   THR B HG21 
2735 H HG22 . THR B 45  ? 0.0992 0.0992 0.0992 0.0000  0.0000  0.0000  45   THR B HG22 
2736 H HG23 . THR B 45  ? 0.0992 0.0992 0.0992 0.0000  0.0000  0.0000  45   THR B HG23 
2737 N N    . PHE B 46  ? 0.0532 0.0312 0.0432 -0.0020 -0.0166 -0.0009 46   PHE B N    
2738 C CA   . PHE B 46  ? 0.0504 0.0336 0.0448 -0.0018 -0.0156 0.0006  46   PHE B CA   
2739 C C    . PHE B 46  ? 0.0589 0.0253 0.0441 -0.0005 -0.0160 -0.0013 46   PHE B C    
2740 O O    . PHE B 46  ? 0.0487 0.0448 0.0628 0.0019  -0.0120 -0.0184 46   PHE B O    
2741 C CB   . PHE B 46  ? 0.0571 0.0377 0.0491 -0.0025 -0.0155 0.0025  46   PHE B CB   
2742 C CG   . PHE B 46  ? 0.0597 0.0386 0.0580 -0.0098 -0.0200 0.0053  46   PHE B CG   
2743 C CD1  . PHE B 46  ? 0.0720 0.0522 0.0710 -0.0096 -0.0019 -0.0029 46   PHE B CD1  
2744 C CD2  . PHE B 46  ? 0.0674 0.0401 0.0607 -0.0080 -0.0202 0.0011  46   PHE B CD2  
2745 C CE1  . PHE B 46  ? 0.0642 0.0636 0.1114 -0.0174 0.0032  0.0127  46   PHE B CE1  
2746 C CE2  . PHE B 46  ? 0.0776 0.0554 0.0784 -0.0208 -0.0311 0.0024  46   PHE B CE2  
2747 C CZ   . PHE B 46  ? 0.0652 0.0703 0.1139 -0.0277 -0.0227 0.0200  46   PHE B CZ   
2748 H H    . PHE B 46  ? 0.0510 0.0510 0.0510 0.0000  0.0000  0.0000  46   PHE B H    
2749 H HA   . PHE B 46  ? 0.0515 0.0515 0.0515 0.0000  0.0000  0.0000  46   PHE B HA   
2750 H HB2  . PHE B 46  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  46   PHE B HB2  
2751 H HB3  . PHE B 46  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  46   PHE B HB3  
2752 H HD1  . PHE B 46  ? 0.0781 0.0781 0.0781 0.0000  0.0000  0.0000  46   PHE B HD1  
2753 H HD2  . PHE B 46  ? 0.0674 0.0674 0.0674 0.0000  0.0000  0.0000  46   PHE B HD2  
2754 H HE1  . PHE B 46  ? 0.0956 0.0956 0.0956 0.0000  0.0000  0.0000  46   PHE B HE1  
2755 H HE2  . PHE B 46  ? 0.0846 0.0846 0.0846 0.0000  0.0000  0.0000  46   PHE B HE2  
2756 H HZ   . PHE B 46  ? 0.0998 0.0998 0.0998 0.0000  0.0000  0.0000  46   PHE B HZ   
2757 N N    . VAL B 47  ? 0.0471 0.0364 0.0448 -0.0032 -0.0106 -0.0039 47   VAL B N    
2758 C CA   . VAL B 47  ? 0.0469 0.0307 0.0415 0.0005  -0.0082 -0.0033 47   VAL B CA   
2759 C C    . VAL B 47  ? 0.0465 0.0254 0.0465 -0.0026 -0.0056 -0.0022 47   VAL B C    
2760 O O    . VAL B 47  ? 0.0492 0.0392 0.0463 0.0029  -0.0057 -0.0007 47   VAL B O    
2761 C CB   . VAL B 47  ? 0.0586 0.0341 0.0456 0.0012  -0.0121 0.0019  47   VAL B CB   
2762 C CG1  . VAL B 47  ? 0.0704 0.0299 0.0572 -0.0056 -0.0146 -0.0014 47   VAL B CG1  
2763 C CG2  . VAL B 47  ? 0.0784 0.0359 0.0580 0.0013  -0.0164 0.0120  47   VAL B CG2  
2764 H H    . VAL B 47  ? 0.0513 0.0513 0.0513 0.0000  0.0000  0.0000  47   VAL B H    
2765 H HA   . VAL B 47  ? 0.0476 0.0476 0.0476 0.0000  0.0000  0.0000  47   VAL B HA   
2766 H HB   . VAL B 47  ? 0.0553 0.0553 0.0553 0.0000  0.0000  0.0000  47   VAL B HB   
2767 H HG11 . VAL B 47  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  47   VAL B HG11 
2768 H HG12 . VAL B 47  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  47   VAL B HG12 
2769 H HG13 . VAL B 47  ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  47   VAL B HG13 
2770 H HG21 . VAL B 47  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  47   VAL B HG21 
2771 H HG22 . VAL B 47  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  47   VAL B HG22 
2772 H HG23 . VAL B 47  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  47   VAL B HG23 
2773 N N    . HIS B 48  ? 0.0415 0.0278 0.0443 -0.0009 -0.0126 0.0019  48   HIS B N    
2774 C CA   . HIS B 48  ? 0.0520 0.0304 0.0397 -0.0042 -0.0140 0.0013  48   HIS B CA   
2775 C C    . HIS B 48  ? 0.0542 0.0288 0.0468 -0.0015 -0.0131 0.0008  48   HIS B C    
2776 O O    . HIS B 48  ? 0.0534 0.0398 0.0631 0.0012  -0.0190 -0.0075 48   HIS B O    
2777 C CB   . HIS B 48  ? 0.0531 0.0321 0.0441 0.0009  -0.0106 0.0020  48   HIS B CB   
2778 C CG   . HIS B 48  ? 0.0531 0.0273 0.0464 0.0010  -0.0079 0.0025  48   HIS B CG   
2779 N ND1  . HIS B 48  ? 0.0596 0.0338 0.0507 -0.0097 -0.0012 -0.0039 48   HIS B ND1  
2780 C CD2  . HIS B 48  ? 0.0646 0.0345 0.0416 0.0069  -0.0065 0.0007  48   HIS B CD2  
2781 C CE1  . HIS B 48  ? 0.0679 0.0464 0.0562 -0.0074 -0.0152 -0.0068 48   HIS B CE1  
2782 N NE2  . HIS B 48  ? 0.0736 0.0443 0.0486 0.0000  -0.0082 -0.0094 48   HIS B NE2  
2783 H H    . HIS B 48  ? 0.0455 0.0455 0.0455 0.0000  0.0000  0.0000  48   HIS B H    
2784 H HA   . HIS B 48  ? 0.0489 0.0489 0.0489 0.0000  0.0000  0.0000  48   HIS B HA   
2785 H HB2  . HIS B 48  ? 0.0517 0.0517 0.0517 0.0000  0.0000  0.0000  48   HIS B HB2  
2786 H HB3  . HIS B 48  ? 0.0517 0.0517 0.0517 0.0000  0.0000  0.0000  48   HIS B HB3  
2787 H HD1  . HIS B 48  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  48   HIS B HD1  
2788 H HD2  . HIS B 48  ? 0.0562 0.0562 0.0562 0.0000  0.0000  0.0000  48   HIS B HD2  
2789 H HE1  . HIS B 48  ? 0.0683 0.0683 0.0683 0.0000  0.0000  0.0000  48   HIS B HE1  
2790 N N    . GLU B 49  ? 0.0517 0.0345 0.0472 0.0033  -0.0127 -0.0068 49   GLU B N    
2791 C CA   . GLU B 49  ? 0.0576 0.0340 0.0456 -0.0021 -0.0125 -0.0031 49   GLU B CA   
2792 C C    . GLU B 49  ? 0.0624 0.0307 0.0425 0.0008  -0.0101 -0.0018 49   GLU B C    
2793 O O    . GLU B 49  ? 0.0607 0.0437 0.0570 -0.0038 -0.0107 -0.0192 49   GLU B O    
2794 C CB   . GLU B 49  ? 0.0625 0.0317 0.0486 -0.0007 -0.0063 -0.0001 49   GLU B CB   
2795 C CG   . GLU B 49  ? 0.0729 0.0429 0.0526 -0.0002 0.0016  -0.0060 49   GLU B CG   
2796 C CD   . GLU B 49  ? 0.0722 0.0417 0.0559 -0.0122 -0.0009 -0.0064 49   GLU B CD   
2797 O OE1  . GLU B 49  ? 0.0643 0.0734 0.0621 -0.0110 -0.0027 -0.0230 49   GLU B OE1  
2798 O OE2  . GLU B 49  ? 0.0631 0.0587 0.0647 -0.0036 0.0048  -0.0158 49   GLU B OE2  
2799 H H    . GLU B 49  ? 0.0533 0.0533 0.0533 0.0000  0.0000  0.0000  49   GLU B H    
2800 H HA   . GLU B 49  ? 0.0548 0.0548 0.0548 0.0000  0.0000  0.0000  49   GLU B HA   
2801 H HB2  . GLU B 49  ? 0.0571 0.0571 0.0571 0.0000  0.0000  0.0000  49   GLU B HB2  
2802 H HB3  . GLU B 49  ? 0.0571 0.0571 0.0571 0.0000  0.0000  0.0000  49   GLU B HB3  
2803 H HG2  . GLU B 49  ? 0.0674 0.0674 0.0674 0.0000  0.0000  0.0000  49   GLU B HG2  
2804 H HG3  . GLU B 49  ? 0.0674 0.0674 0.0674 0.0000  0.0000  0.0000  49   GLU B HG3  
2805 N N    . SER B 50  ? 0.0550 0.0323 0.0492 -0.0008 -0.0137 -0.0081 50   SER B N    
2806 C CA   . SER B 50  ? 0.0687 0.0336 0.0394 -0.0027 -0.0073 -0.0071 50   SER B CA   
2807 C C    . SER B 50  ? 0.0571 0.0301 0.0479 -0.0086 -0.0082 -0.0102 50   SER B C    
2808 O O    . SER B 50  ? 0.0586 0.0377 0.0455 -0.0006 -0.0048 0.0006  50   SER B O    
2809 C CB   A SER B 50  ? 0.1082 0.0337 0.0363 0.0026  -0.0314 -0.0148 50   SER B CB   
2810 C CB   B SER B 50  ? 0.0703 0.0481 0.0450 0.0029  -0.0026 0.0029  50   SER B CB   
2811 O OG   A SER B 50  ? 0.1091 0.0489 0.0486 0.0268  -0.0274 -0.0118 50   SER B OG   
2812 O OG   B SER B 50  ? 0.0733 0.0301 0.0637 0.0031  -0.0253 -0.0014 50   SER B OG   
2813 H H    . SER B 50  ? 0.0546 0.0546 0.0546 0.0000  0.0000  0.0000  50   SER B H    
2814 H HA   A SER B 50  ? 0.0567 0.0567 0.0567 0.0000  0.0000  0.0000  50   SER B HA   
2815 H HB2  A SER B 50  ? 0.0713 0.0713 0.0713 0.0000  0.0000  0.0000  50   SER B HB2  
2816 H HB2  B SER B 50  ? 0.0654 0.0654 0.0654 0.0000  0.0000  0.0000  50   SER B HB2  
2817 H HB3  A SER B 50  ? 0.0713 0.0713 0.0713 0.0000  0.0000  0.0000  50   SER B HB3  
2818 H HB3  B SER B 50  ? 0.0654 0.0654 0.0654 0.0000  0.0000  0.0000  50   SER B HB3  
2819 H HG   A SER B 50  ? 0.1033 0.1033 0.1033 0.0000  0.0000  0.0000  50   SER B HG   
2820 H HG   B SER B 50  ? 0.0835 0.0835 0.0835 0.0000  0.0000  0.0000  50   SER B HG   
2821 N N    . LEU B 51  ? 0.0594 0.0374 0.0666 -0.0055 0.0013  -0.0058 51   LEU B N    
2822 C CA   . LEU B 51  ? 0.0520 0.0430 0.0841 -0.0027 -0.0026 -0.0099 51   LEU B CA   
2823 C C    . LEU B 51  ? 0.0497 0.0443 0.0571 -0.0026 -0.0060 -0.0043 51   LEU B C    
2824 O O    . LEU B 51  ? 0.0528 0.0569 0.0601 -0.0043 -0.0138 0.0063  51   LEU B O    
2825 C CB   . LEU B 51  ? 0.0646 0.0574 0.1244 -0.0109 0.0010  -0.0029 51   LEU B CB   
2826 C CG   . LEU B 51  ? 0.0606 0.0690 0.1599 0.0024  0.0022  -0.0148 51   LEU B CG   
2827 C CD1  . LEU B 51  ? 0.0655 0.0941 0.1583 0.0073  -0.0217 -0.0098 51   LEU B CD1  
2828 C CD2  . LEU B 51  ? 0.0700 0.0930 0.2738 -0.0025 0.0358  0.0210  51   LEU B CD2  
2829 H H    . LEU B 51  ? 0.0654 0.0654 0.0654 0.0000  0.0000  0.0000  51   LEU B H    
2830 H HA   . LEU B 51  ? 0.0717 0.0717 0.0717 0.0000  0.0000  0.0000  51   LEU B HA   
2831 H HB2  . LEU B 51  ? 0.0985 0.0985 0.0985 0.0000  0.0000  0.0000  51   LEU B HB2  
2832 H HB3  . LEU B 51  ? 0.0985 0.0985 0.0985 0.0000  0.0000  0.0000  51   LEU B HB3  
2833 H HG   . LEU B 51  ? 0.1158 0.1158 0.1158 0.0000  0.0000  0.0000  51   LEU B HG   
2834 H HD11 . LEU B 51  ? 0.1589 0.1589 0.1589 0.0000  0.0000  0.0000  51   LEU B HD11 
2835 H HD12 . LEU B 51  ? 0.1589 0.1589 0.1589 0.0000  0.0000  0.0000  51   LEU B HD12 
2836 H HD13 . LEU B 51  ? 0.1589 0.1589 0.1589 0.0000  0.0000  0.0000  51   LEU B HD13 
2837 H HD21 . LEU B 51  ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  51   LEU B HD21 
2838 H HD22 . LEU B 51  ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  51   LEU B HD22 
2839 H HD23 . LEU B 51  ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  51   LEU B HD23 
2840 N N    . ALA B 52  ? 0.0574 0.0366 0.0523 -0.0007 -0.0065 0.0009  52   ALA B N    
2841 C CA   . ALA B 52  ? 0.0578 0.0293 0.0519 0.0036  -0.0067 -0.0037 52   ALA B CA   
2842 C C    . ALA B 52  ? 0.0551 0.0332 0.0454 -0.0022 -0.0159 -0.0047 52   ALA B C    
2843 O O    . ALA B 52  ? 0.0627 0.0311 0.0515 -0.0003 -0.0077 0.0007  52   ALA B O    
2844 C CB   . ALA B 52  ? 0.0838 0.0514 0.0449 -0.0060 -0.0030 -0.0086 52   ALA B CB   
2845 H H    . ALA B 52  ? 0.0585 0.0585 0.0585 0.0000  0.0000  0.0000  52   ALA B H    
2846 H HA   . ALA B 52  ? 0.0556 0.0556 0.0556 0.0000  0.0000  0.0000  52   ALA B HA   
2847 H HB1  . ALA B 52  ? 0.0900 0.0900 0.0900 0.0000  0.0000  0.0000  52   ALA B HB1  
2848 H HB2  . ALA B 52  ? 0.0900 0.0900 0.0900 0.0000  0.0000  0.0000  52   ALA B HB2  
2849 H HB3  . ALA B 52  ? 0.0900 0.0900 0.0900 0.0000  0.0000  0.0000  52   ALA B HB3  
2850 N N    . ASP B 53  ? 0.0527 0.0301 0.0465 0.0006  -0.0094 -0.0016 53   ASP B N    
2851 C CA   . ASP B 53  ? 0.0492 0.0332 0.0512 -0.0009 -0.0098 0.0015  53   ASP B CA   
2852 C C    . ASP B 53  ? 0.0530 0.0361 0.0504 -0.0008 -0.0123 -0.0029 53   ASP B C    
2853 O O    . ASP B 53  ? 0.0631 0.0442 0.0532 -0.0132 -0.0147 0.0087  53   ASP B O    
2854 C CB   . ASP B 53  ? 0.0495 0.0369 0.0578 0.0022  -0.0095 -0.0079 53   ASP B CB   
2855 C CG   . ASP B 53  ? 0.0662 0.0429 0.0553 0.0046  -0.0153 -0.0113 53   ASP B CG   
2856 O OD1  . ASP B 53  ? 0.0639 0.0527 0.0717 -0.0029 -0.0170 -0.0106 53   ASP B OD1  
2857 O OD2  . ASP B 53  ? 0.1238 0.0467 0.0904 -0.0008 -0.0581 0.0011  53   ASP B OD2  
2858 H H    . ASP B 53  ? 0.0517 0.0517 0.0517 0.0000  0.0000  0.0000  53   ASP B H    
2859 H HA   . ASP B 53  ? 0.0534 0.0534 0.0534 0.0000  0.0000  0.0000  53   ASP B HA   
2860 H HB2  . ASP B 53  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  53   ASP B HB2  
2861 H HB3  . ASP B 53  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  53   ASP B HB3  
2862 N N    . VAL B 54  ? 0.0517 0.0349 0.0429 -0.0033 -0.0133 -0.0031 54   VAL B N    
2863 C CA   . VAL B 54  ? 0.0522 0.0442 0.0471 0.0023  -0.0104 -0.0025 54   VAL B CA   
2864 C C    . VAL B 54  ? 0.0442 0.0424 0.0496 0.0014  -0.0159 -0.0024 54   VAL B C    
2865 O O    . VAL B 54  ? 0.0586 0.0520 0.0453 0.0010  -0.0093 0.0004  54   VAL B O    
2866 C CB   . VAL B 54  ? 0.0508 0.0449 0.0520 -0.0011 -0.0116 -0.0078 54   VAL B CB   
2867 C CG1  . VAL B 54  ? 0.0609 0.0585 0.0634 -0.0019 -0.0208 -0.0094 54   VAL B CG1  
2868 C CG2  . VAL B 54  ? 0.0573 0.0401 0.0642 -0.0016 -0.0149 -0.0135 54   VAL B CG2  
2869 H H    . VAL B 54  ? 0.0518 0.0518 0.0518 0.0000  0.0000  0.0000  54   VAL B H    
2870 H HA   . VAL B 54  ? 0.0574 0.0574 0.0574 0.0000  0.0000  0.0000  54   VAL B HA   
2871 H HB   . VAL B 54  ? 0.0591 0.0591 0.0591 0.0000  0.0000  0.0000  54   VAL B HB   
2872 H HG11 . VAL B 54  ? 0.0914 0.0914 0.0914 0.0000  0.0000  0.0000  54   VAL B HG11 
2873 H HG12 . VAL B 54  ? 0.0914 0.0914 0.0914 0.0000  0.0000  0.0000  54   VAL B HG12 
2874 H HG13 . VAL B 54  ? 0.0914 0.0914 0.0914 0.0000  0.0000  0.0000  54   VAL B HG13 
2875 H HG21 . VAL B 54  ? 0.0808 0.0808 0.0808 0.0000  0.0000  0.0000  54   VAL B HG21 
2876 H HG22 . VAL B 54  ? 0.0808 0.0808 0.0808 0.0000  0.0000  0.0000  54   VAL B HG22 
2877 H HG23 . VAL B 54  ? 0.0808 0.0808 0.0808 0.0000  0.0000  0.0000  54   VAL B HG23 
2878 N N    . GLN B 55  ? 0.0601 0.0506 0.0506 0.0082  -0.0048 0.0004  55   GLN B N    
2879 C CA   . GLN B 55  ? 0.0548 0.0567 0.0563 0.0122  -0.0152 0.0010  55   GLN B CA   
2880 C C    . GLN B 55  ? 0.0644 0.0490 0.0515 0.0128  -0.0041 0.0039  55   GLN B C    
2881 O O    . GLN B 55  ? 0.0626 0.0558 0.0716 0.0182  -0.0107 0.0186  55   GLN B O    
2882 C CB   . GLN B 55  ? 0.0602 0.0541 0.0652 0.0132  -0.0049 0.0030  55   GLN B CB   
2883 C CG   . GLN B 55  ? 0.0569 0.0806 0.0671 0.0122  -0.0070 0.0034  55   GLN B CG   
2884 C CD   . GLN B 55  ? 0.0541 0.1098 0.0782 -0.0007 -0.0051 0.0013  55   GLN B CD   
2885 O OE1  . GLN B 55  ? 0.0769 0.2541 0.0715 -0.0602 -0.0040 -0.0184 55   GLN B OE1  
2886 N NE2  . GLN B 55  ? 0.0657 0.1313 0.0822 -0.0080 0.0000  -0.0123 55   GLN B NE2  
2887 H H    . GLN B 55  ? 0.0645 0.0645 0.0645 0.0000  0.0000  0.0000  55   GLN B H    
2888 H HA   . GLN B 55  ? 0.0671 0.0671 0.0671 0.0000  0.0000  0.0000  55   GLN B HA   
2889 H HB2  . GLN B 55  ? 0.0718 0.0718 0.0718 0.0000  0.0000  0.0000  55   GLN B HB2  
2890 H HB3  . GLN B 55  ? 0.0718 0.0718 0.0718 0.0000  0.0000  0.0000  55   GLN B HB3  
2891 H HG2  . GLN B 55  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  55   GLN B HG2  
2892 H HG3  . GLN B 55  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  55   GLN B HG3  
2893 H HE21 . GLN B 55  ? 0.1117 0.1117 0.1117 0.0000  0.0000  0.0000  55   GLN B HE21 
2894 H HE22 . GLN B 55  ? 0.1117 0.1117 0.1117 0.0000  0.0000  0.0000  55   GLN B HE22 
2895 N N    . ALA B 56  ? 0.0655 0.0339 0.0448 0.0108  -0.0099 0.0044  56   ALA B N    
2896 C CA   . ALA B 56  ? 0.0650 0.0336 0.0491 0.0048  -0.0158 -0.0028 56   ALA B CA   
2897 C C    . ALA B 56  ? 0.0635 0.0321 0.0455 0.0095  -0.0186 0.0002  56   ALA B C    
2898 O O    . ALA B 56  ? 0.0653 0.0328 0.0505 0.0025  -0.0186 -0.0027 56   ALA B O    
2899 C CB   . ALA B 56  ? 0.0791 0.0525 0.0470 0.0061  -0.0248 0.0013  56   ALA B CB   
2900 H H    . ALA B 56  ? 0.0576 0.0576 0.0576 0.0000  0.0000  0.0000  56   ALA B H    
2901 H HA   . ALA B 56  ? 0.0590 0.0590 0.0590 0.0000  0.0000  0.0000  56   ALA B HA   
2902 H HB1  . ALA B 56  ? 0.0893 0.0893 0.0893 0.0000  0.0000  0.0000  56   ALA B HB1  
2903 H HB2  . ALA B 56  ? 0.0893 0.0893 0.0893 0.0000  0.0000  0.0000  56   ALA B HB2  
2904 H HB3  . ALA B 56  ? 0.0893 0.0893 0.0893 0.0000  0.0000  0.0000  56   ALA B HB3  
2905 N N    . VAL B 57  ? 0.0597 0.0328 0.0384 0.0041  -0.0142 0.0011  57   VAL B N    
2906 C CA   . VAL B 57  ? 0.0549 0.0351 0.0377 0.0033  -0.0109 0.0024  57   VAL B CA   
2907 C C    . VAL B 57  ? 0.0539 0.0304 0.0429 -0.0003 -0.0160 0.0000  57   VAL B C    
2908 O O    . VAL B 57  ? 0.0658 0.0307 0.0457 -0.0038 -0.0156 0.0047  57   VAL B O    
2909 C CB   . VAL B 57  ? 0.0587 0.0278 0.0442 -0.0001 -0.0141 -0.0009 57   VAL B CB   
2910 C CG1  . VAL B 57  ? 0.0712 0.0354 0.0443 0.0035  -0.0113 -0.0012 57   VAL B CG1  
2911 C CG2  . VAL B 57  ? 0.0632 0.0340 0.0499 0.0036  -0.0083 0.0016  57   VAL B CG2  
2912 H H    . VAL B 57  ? 0.0524 0.0524 0.0524 0.0000  0.0000  0.0000  57   VAL B H    
2913 H HA   . VAL B 57  ? 0.0510 0.0510 0.0510 0.0000  0.0000  0.0000  57   VAL B HA   
2914 H HB   . VAL B 57  ? 0.0523 0.0523 0.0523 0.0000  0.0000  0.0000  57   VAL B HB   
2915 H HG11 . VAL B 57  ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  57   VAL B HG11 
2916 H HG12 . VAL B 57  ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  57   VAL B HG12 
2917 H HG13 . VAL B 57  ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  57   VAL B HG13 
2918 H HG21 . VAL B 57  ? 0.0736 0.0736 0.0736 0.0000  0.0000  0.0000  57   VAL B HG21 
2919 H HG22 . VAL B 57  ? 0.0736 0.0736 0.0736 0.0000  0.0000  0.0000  57   VAL B HG22 
2920 H HG23 . VAL B 57  ? 0.0736 0.0736 0.0736 0.0000  0.0000  0.0000  57   VAL B HG23 
2921 N N    . CYS B 58  ? 0.0562 0.0317 0.0509 0.0006  -0.0165 0.0066  58   CYS B N    
2922 C CA   . CYS B 58  ? 0.0580 0.0337 0.0576 0.0007  -0.0237 0.0079  58   CYS B CA   
2923 C C    . CYS B 58  ? 0.0616 0.0300 0.0563 0.0031  -0.0162 0.0031  58   CYS B C    
2924 O O    . CYS B 58  ? 0.0736 0.0335 0.0750 0.0076  -0.0294 0.0053  58   CYS B O    
2925 C CB   . CYS B 58  ? 0.0582 0.0449 0.0668 0.0005  -0.0129 0.0070  58   CYS B CB   
2926 S SG   . CYS B 58  ? 0.0593 0.0506 0.0879 -0.0054 -0.0083 0.0115  58   CYS B SG   
2927 H H    . CYS B 58  ? 0.0555 0.0555 0.0555 0.0000  0.0000  0.0000  58   CYS B H    
2928 H HA   . CYS B 58  ? 0.0598 0.0598 0.0598 0.0000  0.0000  0.0000  58   CYS B HA   
2929 H HB2  . CYS B 58  ? 0.0679 0.0679 0.0679 0.0000  0.0000  0.0000  58   CYS B HB2  
2930 H HB3  . CYS B 58  ? 0.0679 0.0679 0.0679 0.0000  0.0000  0.0000  58   CYS B HB3  
2931 N N    . SER B 59  ? 0.0586 0.0321 0.0556 0.0007  -0.0183 0.0057  59   SER B N    
2932 C CA   . SER B 59  ? 0.0596 0.0260 0.0634 0.0013  -0.0139 0.0009  59   SER B CA   
2933 C C    . SER B 59  ? 0.0593 0.0273 0.0587 0.0027  -0.0147 -0.0009 59   SER B C    
2934 O O    . SER B 59  ? 0.0674 0.0348 0.0783 -0.0071 -0.0101 -0.0069 59   SER B O    
2935 C CB   A SER B 59  ? 0.0851 0.0452 0.0671 0.0003  -0.0127 -0.0013 59   SER B CB   
2936 C CB   B SER B 59  ? 0.0732 0.0378 0.0715 -0.0183 -0.0035 -0.0253 59   SER B CB   
2937 O OG   A SER B 59  ? 0.1808 0.0702 0.0625 -0.0174 -0.0576 0.0218  59   SER B OG   
2938 O OG   B SER B 59  ? 0.0893 0.0734 0.0717 -0.0043 -0.0010 -0.0085 59   SER B OG   
2939 H H    . SER B 59  ? 0.0585 0.0585 0.0585 0.0000  0.0000  0.0000  59   SER B H    
2940 H HA   A SER B 59  ? 0.0597 0.0597 0.0597 0.0000  0.0000  0.0000  59   SER B HA   
2941 H HB2  A SER B 59  ? 0.0789 0.0789 0.0789 0.0000  0.0000  0.0000  59   SER B HB2  
2942 H HB2  B SER B 59  ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  59   SER B HB2  
2943 H HB3  A SER B 59  ? 0.0789 0.0789 0.0789 0.0000  0.0000  0.0000  59   SER B HB3  
2944 H HB3  B SER B 59  ? 0.0730 0.0730 0.0730 0.0000  0.0000  0.0000  59   SER B HB3  
2945 H HG   A SER B 59  ? 0.1567 0.1567 0.1567 0.0000  0.0000  0.0000  59   SER B HG   
2946 H HG   B SER B 59  ? 0.1172 0.1172 0.1172 0.0000  0.0000  0.0000  59   SER B HG   
2947 N N    . GLN B 60  ? 0.0543 0.0288 0.0640 0.0028  -0.0148 -0.0009 60   GLN B N    
2948 C CA   . GLN B 60  ? 0.0584 0.0317 0.0586 -0.0001 -0.0154 0.0037  60   GLN B CA   
2949 C C    . GLN B 60  ? 0.0526 0.0367 0.0626 0.0016  -0.0189 0.0066  60   GLN B C    
2950 O O    . GLN B 60  ? 0.0849 0.0393 0.0720 0.0112  -0.0094 0.0124  60   GLN B O    
2951 C CB   . GLN B 60  ? 0.0604 0.0328 0.0524 0.0074  -0.0140 0.0027  60   GLN B CB   
2952 C CG   . GLN B 60  ? 0.0711 0.0284 0.0561 0.0034  -0.0210 -0.0017 60   GLN B CG   
2953 C CD   . GLN B 60  ? 0.0888 0.0385 0.0541 0.0118  -0.0152 0.0000  60   GLN B CD   
2954 O OE1  . GLN B 60  ? 0.0742 0.0353 0.0569 0.0123  -0.0144 -0.0022 60   GLN B OE1  
2955 N NE2  . GLN B 60  ? 0.5167 0.0689 0.0631 0.1392  -0.0270 0.0069  60   GLN B NE2  
2956 H H    . GLN B 60  ? 0.0588 0.0588 0.0588 0.0000  0.0000  0.0000  60   GLN B H    
2957 H HA   . GLN B 60  ? 0.0595 0.0595 0.0595 0.0000  0.0000  0.0000  60   GLN B HA   
2958 H HB2  . GLN B 60  ? 0.0583 0.0583 0.0583 0.0000  0.0000  0.0000  60   GLN B HB2  
2959 H HB3  . GLN B 60  ? 0.0583 0.0583 0.0583 0.0000  0.0000  0.0000  60   GLN B HB3  
2960 H HG2  . GLN B 60  ? 0.0623 0.0623 0.0623 0.0000  0.0000  0.0000  60   GLN B HG2  
2961 H HG3  . GLN B 60  ? 0.0623 0.0623 0.0623 0.0000  0.0000  0.0000  60   GLN B HG3  
2962 H HE21 . GLN B 60  ? 0.2595 0.2595 0.2595 0.0000  0.0000  0.0000  60   GLN B HE21 
2963 H HE22 . GLN B 60  ? 0.2595 0.2595 0.2595 0.0000  0.0000  0.0000  60   GLN B HE22 
2964 N N    . LYS B 61  ? 0.0663 0.0389 0.0606 -0.0002 -0.0122 0.0038  61   LYS B N    
2965 C CA   . LYS B 61  ? 0.0692 0.0488 0.0544 -0.0119 -0.0154 0.0066  61   LYS B CA   
2966 C C    . LYS B 61  ? 0.0730 0.0487 0.0533 -0.0088 -0.0125 0.0118  61   LYS B C    
2967 O O    . LYS B 61  ? 0.0771 0.0371 0.0905 -0.0108 -0.0333 0.0137  61   LYS B O    
2968 C CB   . LYS B 61  ? 0.0597 0.0738 0.0702 -0.0061 -0.0069 0.0027  61   LYS B CB   
2969 C CG   . LYS B 61  ? 0.0814 0.1225 0.0711 -0.0056 0.0052  0.0163  61   LYS B CG   
2970 C CD   . LYS B 61  ? 0.1330 0.1964 0.1128 0.0057  0.0389  -0.0175 61   LYS B CD   
2971 C CE   . LYS B 61  ? 0.1615 0.3188 0.1244 0.0380  0.0544  0.0075  61   LYS B CE   
2972 N NZ   . LYS B 61  ? 0.4378 0.5490 0.1899 0.2320  0.1387  0.0702  61   LYS B NZ   
2973 H H    . LYS B 61  ? 0.0662 0.0662 0.0662 0.0000  0.0000  0.0000  61   LYS B H    
2974 H HA   . LYS B 61  ? 0.0689 0.0689 0.0689 0.0000  0.0000  0.0000  61   LYS B HA   
2975 H HB2  . LYS B 61  ? 0.0814 0.0814 0.0814 0.0000  0.0000  0.0000  61   LYS B HB2  
2976 H HB3  . LYS B 61  ? 0.0814 0.0814 0.0814 0.0000  0.0000  0.0000  61   LYS B HB3  
2977 H HG2  . LYS B 61  ? 0.1101 0.1101 0.1101 0.0000  0.0000  0.0000  61   LYS B HG2  
2978 H HG3  . LYS B 61  ? 0.1101 0.1101 0.1101 0.0000  0.0000  0.0000  61   LYS B HG3  
2979 H HD2  . LYS B 61  ? 0.1768 0.1768 0.1768 0.0000  0.0000  0.0000  61   LYS B HD2  
2980 H HD3  . LYS B 61  ? 0.1768 0.1768 0.1768 0.0000  0.0000  0.0000  61   LYS B HD3  
2981 H HE2  . LYS B 61  ? 0.2419 0.2419 0.2419 0.0000  0.0000  0.0000  61   LYS B HE2  
2982 H HE3  . LYS B 61  ? 0.2419 0.2419 0.2419 0.0000  0.0000  0.0000  61   LYS B HE3  
2983 H HZ1  . LYS B 61  ? 0.5883 0.5883 0.5883 0.0000  0.0000  0.0000  61   LYS B HZ1  
2984 H HZ2  . LYS B 61  ? 0.5883 0.5883 0.5883 0.0000  0.0000  0.0000  61   LYS B HZ2  
2985 H HZ3  . LYS B 61  ? 0.5883 0.5883 0.5883 0.0000  0.0000  0.0000  61   LYS B HZ3  
2986 N N    . ASN B 62  ? 0.0738 0.0352 0.0618 -0.0049 -0.0229 0.0034  62   ASN B N    
2987 C CA   . ASN B 62  ? 0.0747 0.0356 0.0549 -0.0012 -0.0212 0.0027  62   ASN B CA   
2988 C C    . ASN B 62  ? 0.0712 0.0431 0.0533 -0.0024 -0.0126 0.0093  62   ASN B C    
2989 O O    . ASN B 62  ? 0.0937 0.0633 0.0656 -0.0254 -0.0107 0.0021  62   ASN B O    
2990 C CB   . ASN B 62  ? 0.0845 0.0346 0.0644 0.0006  -0.0251 0.0038  62   ASN B CB   
2991 C CG   . ASN B 62  ? 0.0933 0.0384 0.0593 0.0020  -0.0304 0.0057  62   ASN B CG   
2992 O OD1  . ASN B 62  ? 0.0963 0.0461 0.0770 0.0060  -0.0342 -0.0002 62   ASN B OD1  
2993 N ND2  . ASN B 62  ? 0.0811 0.0513 0.1000 0.0051  -0.0312 0.0046  62   ASN B ND2  
2994 H H    . ASN B 62  ? 0.0683 0.0683 0.0683 0.0000  0.0000  0.0000  62   ASN B H    
2995 H HA   . ASN B 62  ? 0.0660 0.0660 0.0660 0.0000  0.0000  0.0000  62   ASN B HA   
2996 H HB2  . ASN B 62  ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  62   ASN B HB2  
2997 H HB3  . ASN B 62  ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  62   ASN B HB3  
2998 H HD21 . ASN B 62  ? 0.0930 0.0930 0.0930 0.0000  0.0000  0.0000  62   ASN B HD21 
2999 H HD22 . ASN B 62  ? 0.0930 0.0930 0.0930 0.0000  0.0000  0.0000  62   ASN B HD22 
3000 N N    . VAL B 63  ? 0.0796 0.0444 0.0483 -0.0105 -0.0151 0.0031  63   VAL B N    
3001 C CA   . VAL B 63  ? 0.0883 0.0481 0.0523 -0.0143 -0.0096 0.0017  63   VAL B CA   
3002 C C    . VAL B 63  ? 0.0915 0.0489 0.0543 -0.0112 -0.0157 0.0012  63   VAL B C    
3003 O O    . VAL B 63  ? 0.0830 0.0718 0.0573 -0.0127 -0.0196 -0.0006 63   VAL B O    
3004 C CB   . VAL B 63  ? 0.0971 0.0541 0.0578 -0.0071 -0.0071 -0.0072 63   VAL B CB   
3005 C CG1  . VAL B 63  ? 0.0947 0.0703 0.0892 0.0027  -0.0171 0.0023  63   VAL B CG1  
3006 C CG2  . VAL B 63  ? 0.0980 0.0492 0.0857 -0.0048 -0.0105 -0.0014 63   VAL B CG2  
3007 H H    . VAL B 63  ? 0.0689 0.0689 0.0689 0.0000  0.0000  0.0000  63   VAL B H    
3008 H HA   . VAL B 63  ? 0.0755 0.0755 0.0755 0.0000  0.0000  0.0000  63   VAL B HA   
3009 H HB   . VAL B 63  ? 0.0836 0.0836 0.0836 0.0000  0.0000  0.0000  63   VAL B HB   
3010 H HG11 . VAL B 63  ? 0.1270 0.1270 0.1270 0.0000  0.0000  0.0000  63   VAL B HG11 
3011 H HG12 . VAL B 63  ? 0.1270 0.1270 0.1270 0.0000  0.0000  0.0000  63   VAL B HG12 
3012 H HG13 . VAL B 63  ? 0.1270 0.1270 0.1270 0.0000  0.0000  0.0000  63   VAL B HG13 
3013 H HG21 . VAL B 63  ? 0.1164 0.1164 0.1164 0.0000  0.0000  0.0000  63   VAL B HG21 
3014 H HG22 . VAL B 63  ? 0.1164 0.1164 0.1164 0.0000  0.0000  0.0000  63   VAL B HG22 
3015 H HG23 . VAL B 63  ? 0.1164 0.1164 0.1164 0.0000  0.0000  0.0000  63   VAL B HG23 
3016 N N    . ALA B 64  ? 0.0973 0.0725 0.0502 -0.0169 -0.0182 0.0001  64   ALA B N    
3017 C CA   . ALA B 64  ? 0.1128 0.0676 0.0551 -0.0216 -0.0214 0.0003  64   ALA B CA   
3018 C C    . ALA B 64  ? 0.1043 0.0648 0.0606 -0.0157 -0.0298 0.0067  64   ALA B C    
3019 O O    . ALA B 64  ? 0.0960 0.0695 0.1203 -0.0078 -0.0203 0.0099  64   ALA B O    
3020 C CB   . ALA B 64  ? 0.1468 0.1283 0.0577 -0.0427 -0.0299 0.0100  64   ALA B CB   
3021 H H    . ALA B 64  ? 0.0880 0.0880 0.0880 0.0000  0.0000  0.0000  64   ALA B H    
3022 H HA   . ALA B 64  ? 0.0942 0.0942 0.0942 0.0000  0.0000  0.0000  64   ALA B HA   
3023 H HB1  . ALA B 64  ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  64   ALA B HB1  
3024 H HB2  . ALA B 64  ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  64   ALA B HB2  
3025 H HB3  . ALA B 64  ? 0.1664 0.1664 0.1664 0.0000  0.0000  0.0000  64   ALA B HB3  
3026 N N    . CYS B 65  ? 0.0920 0.0692 0.0763 -0.0102 -0.0303 0.0061  65   CYS B N    
3027 C CA   . CYS B 65  ? 0.1087 0.0649 0.0589 -0.0211 -0.0370 0.0133  65   CYS B CA   
3028 C C    . CYS B 65  ? 0.1380 0.0777 0.0566 -0.0310 -0.0421 0.0132  65   CYS B C    
3029 O O    . CYS B 65  ? 0.2399 0.0897 0.0709 -0.0159 -0.0679 0.0232  65   CYS B O    
3030 C CB   . CYS B 65  ? 0.0916 0.1165 0.0715 -0.0285 -0.0285 0.0077  65   CYS B CB   
3031 S SG   . CYS B 65  ? 0.0814 0.1304 0.0916 -0.0081 -0.0290 -0.0027 65   CYS B SG   
3032 H H    . CYS B 65  ? 0.0950 0.0950 0.0950 0.0000  0.0000  0.0000  65   CYS B H    
3033 H HA   . CYS B 65  ? 0.0930 0.0930 0.0930 0.0000  0.0000  0.0000  65   CYS B HA   
3034 H HB2  . CYS B 65  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  65   CYS B HB2  
3035 H HB3  . CYS B 65  ? 0.1118 0.1118 0.1118 0.0000  0.0000  0.0000  65   CYS B HB3  
3036 N N    . LYS B 66  ? 0.1115 0.0844 0.0572 -0.0373 -0.0450 0.0229  66   LYS B N    
3037 C CA   . LYS B 66  ? 0.1140 0.0767 0.0589 -0.0312 -0.0354 0.0142  66   LYS B CA   
3038 C C    . LYS B 66  ? 0.1270 0.0683 0.0710 -0.0326 -0.0529 0.0124  66   LYS B C    
3039 O O    . LYS B 66  ? 0.1428 0.0948 0.0688 -0.0434 -0.0583 0.0230  66   LYS B O    
3040 C CB   . LYS B 66  ? 0.1160 0.1088 0.0854 -0.0320 -0.0302 0.0025  66   LYS B CB   
3041 C CG   A LYS B 66  ? 0.1339 0.2041 0.1183 0.0253  -0.0065 0.0340  66   LYS B CG   
3042 C CG   B LYS B 66  ? 0.1052 0.1346 0.0666 -0.0259 -0.0171 -0.0140 66   LYS B CG   
3043 C CD   A LYS B 66  ? 0.1875 0.2855 0.1706 -0.0474 0.0325  0.0540  66   LYS B CD   
3044 C CD   B LYS B 66  ? 0.1536 0.1958 0.1120 0.0026  -0.0236 0.0242  66   LYS B CD   
3045 C CE   A LYS B 66  ? 0.1761 0.4709 0.1912 0.0322  0.0433  0.1276  66   LYS B CE   
3046 C CE   B LYS B 66  ? 0.1209 0.2837 0.2838 0.0724  -0.0357 0.0417  66   LYS B CE   
3047 N NZ   A LYS B 66  ? 0.0573 0.5674 0.1913 0.0599  -0.0105 0.1570  66   LYS B NZ   
3048 N NZ   B LYS B 66  ? 0.3731 0.4611 0.3665 0.2719  -0.0246 -0.0956 66   LYS B NZ   
3049 H H    . LYS B 66  ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  66   LYS B H    
3050 H HA   . LYS B 66  ? 0.0998 0.0998 0.0998 0.0000  0.0000  0.0000  66   LYS B HA   
3051 H HB2  A LYS B 66  ? 0.1241 0.1241 0.1241 0.0000  0.0000  0.0000  66   LYS B HB2  
3052 H HB3  A LYS B 66  ? 0.1241 0.1241 0.1241 0.0000  0.0000  0.0000  66   LYS B HB3  
3053 H HG2  A LYS B 66  ? 0.1825 0.1825 0.1825 0.0000  0.0000  0.0000  66   LYS B HG2  
3054 H HG2  B LYS B 66  ? 0.1226 0.1226 0.1226 0.0000  0.0000  0.0000  66   LYS B HG2  
3055 H HG3  A LYS B 66  ? 0.1825 0.1825 0.1825 0.0000  0.0000  0.0000  66   LYS B HG3  
3056 H HG3  B LYS B 66  ? 0.1226 0.1226 0.1226 0.0000  0.0000  0.0000  66   LYS B HG3  
3057 H HD2  A LYS B 66  ? 0.2575 0.2575 0.2575 0.0000  0.0000  0.0000  66   LYS B HD2  
3058 H HD2  B LYS B 66  ? 0.1845 0.1845 0.1845 0.0000  0.0000  0.0000  66   LYS B HD2  
3059 H HD3  A LYS B 66  ? 0.2575 0.2575 0.2575 0.0000  0.0000  0.0000  66   LYS B HD3  
3060 H HD3  B LYS B 66  ? 0.1845 0.1845 0.1845 0.0000  0.0000  0.0000  66   LYS B HD3  
3061 H HE2  A LYS B 66  ? 0.3352 0.3352 0.3352 0.0000  0.0000  0.0000  66   LYS B HE2  
3062 H HE2  B LYS B 66  ? 0.2753 0.2753 0.2753 0.0000  0.0000  0.0000  66   LYS B HE2  
3063 H HE3  A LYS B 66  ? 0.3352 0.3352 0.3352 0.0000  0.0000  0.0000  66   LYS B HE3  
3064 H HE3  B LYS B 66  ? 0.2753 0.2753 0.2753 0.0000  0.0000  0.0000  66   LYS B HE3  
3065 H HZ1  A LYS B 66  ? 0.4079 0.4079 0.4079 0.0000  0.0000  0.0000  66   LYS B HZ1  
3066 H HZ1  B LYS B 66  ? 0.6003 0.6003 0.6003 0.0000  0.0000  0.0000  66   LYS B HZ1  
3067 H HZ2  A LYS B 66  ? 0.4079 0.4079 0.4079 0.0000  0.0000  0.0000  66   LYS B HZ2  
3068 H HZ2  B LYS B 66  ? 0.6003 0.6003 0.6003 0.0000  0.0000  0.0000  66   LYS B HZ2  
3069 H HZ3  A LYS B 66  ? 0.4079 0.4079 0.4079 0.0000  0.0000  0.0000  66   LYS B HZ3  
3070 H HZ3  B LYS B 66  ? 0.6003 0.6003 0.6003 0.0000  0.0000  0.0000  66   LYS B HZ3  
3071 N N    . IAS B 67  ? 0.1120 0.0887 0.0642 -0.0398 -0.0435 0.0196  67   IAS B N    
3072 C CA   . IAS B 67  ? 0.1054 0.0827 0.0831 -0.0264 -0.0306 0.0075  67   IAS B CA   
3073 C C    . IAS B 67  ? 0.0851 0.0764 0.0838 -0.0057 -0.0358 0.0011  67   IAS B C    
3074 O O    . IAS B 67  ? 0.1038 0.1171 0.1178 -0.0179 -0.0345 -0.0086 67   IAS B O    
3075 C CB   . IAS B 67  ? 0.1181 0.0921 0.1499 -0.0158 -0.0386 0.0225  67   IAS B CB   
3076 C CG   . IAS B 67  ? 0.1796 0.0869 0.2105 -0.0221 0.0405  0.0038  67   IAS B CG   
3077 O OD1  . IAS B 67  ? 0.5047 0.1034 0.2227 -0.0204 0.1613  -0.0175 67   IAS B OD1  
3078 H H    . IAS B 67  ? 0.1060 0.1060 0.1060 0.0000  0.0000  0.0000  67   IAS B H    
3079 H HA   . IAS B 67  ? 0.1084 0.1084 0.1084 0.0000  0.0000  0.0000  67   IAS B HA   
3080 H HB2  . IAS B 67  ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  67   IAS B HB2  
3081 H HB3  . IAS B 67  ? 0.1440 0.1440 0.1440 0.0000  0.0000  0.0000  67   IAS B HB3  
3082 N N    . GLY B 68  ? 0.1078 0.1019 0.2562 -0.0130 -0.0019 0.0364  68   GLY B N    
3083 C CA   . GLY B 68  ? 0.1158 0.0791 0.2477 -0.0038 -0.0078 -0.0032 68   GLY B CA   
3084 C C    . GLY B 68  ? 0.1002 0.0872 0.2622 -0.0119 -0.0401 0.0266  68   GLY B C    
3085 O O    . GLY B 68  ? 0.1890 0.1479 0.2083 -0.0417 -0.0845 0.0565  68   GLY B O    
3086 H H    . GLY B 68  ? 0.1863 0.1863 0.1863 0.0000  0.0000  0.0000  68   GLY B H    
3087 H HA2  . GLY B 68  ? 0.1771 0.1771 0.1771 0.0000  0.0000  0.0000  68   GLY B HA2  
3088 H HA3  . GLY B 68  ? 0.1771 0.1771 0.1771 0.0000  0.0000  0.0000  68   GLY B HA3  
3089 N N    . GLN B 69  ? 0.1124 0.1028 0.1752 -0.0109 -0.0258 0.0377  69   GLN B N    
3090 C CA   . GLN B 69  ? 0.1245 0.0791 0.1484 -0.0224 -0.0602 0.0360  69   GLN B CA   
3091 C C    . GLN B 69  ? 0.1053 0.0768 0.1267 0.0154  -0.0368 0.0238  69   GLN B C    
3092 O O    . GLN B 69  ? 0.1294 0.0935 0.1130 -0.0102 -0.0433 0.0056  69   GLN B O    
3093 C CB   . GLN B 69  ? 0.1048 0.1146 0.2318 0.0194  -0.0574 0.0203  69   GLN B CB   
3094 C CG   . GLN B 69  ? 0.1276 0.1843 0.3248 0.0437  -0.0498 0.0395  69   GLN B CG   
3095 C CD   . GLN B 69  ? 0.0980 0.1007 0.2895 0.0092  -0.0563 -0.0524 69   GLN B CD   
3096 O OE1  . GLN B 69  ? 0.2198 0.3022 0.2689 -0.0685 -0.1018 -0.0084 69   GLN B OE1  
3097 N NE2  . GLN B 69  ? 0.2730 0.1302 0.3101 -0.0296 -0.0874 -0.0397 69   GLN B NE2  
3098 H H    . GLN B 69  ? 0.1562 0.1562 0.1562 0.0000  0.0000  0.0000  69   GLN B H    
3099 H HA   . GLN B 69  ? 0.1408 0.1408 0.1408 0.0000  0.0000  0.0000  69   GLN B HA   
3100 H HB2  . GLN B 69  ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  69   GLN B HB2  
3101 H HB3  . GLN B 69  ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  69   GLN B HB3  
3102 H HG2  . GLN B 69  ? 0.2547 0.2547 0.2547 0.0000  0.0000  0.0000  69   GLN B HG2  
3103 H HG3  . GLN B 69  ? 0.2547 0.2547 0.2547 0.0000  0.0000  0.0000  69   GLN B HG3  
3104 H HE21 . GLN B 69  ? 0.2853 0.2853 0.2853 0.0000  0.0000  0.0000  69   GLN B HE21 
3105 H HE22 . GLN B 69  ? 0.2853 0.2853 0.2853 0.0000  0.0000  0.0000  69   GLN B HE22 
3106 N N    . THR B 70  ? 0.0929 0.0846 0.0891 0.0165  -0.0271 0.0067  70   THR B N    
3107 C CA   . THR B 70  ? 0.0983 0.0702 0.1034 0.0181  -0.0281 0.0214  70   THR B CA   
3108 C C    . THR B 70  ? 0.0834 0.0509 0.1029 0.0035  -0.0382 0.0191  70   THR B C    
3109 O O    . THR B 70  ? 0.1169 0.0881 0.1411 -0.0298 -0.0550 0.0383  70   THR B O    
3110 C CB   . THR B 70  ? 0.0976 0.0668 0.1089 0.0158  -0.0137 0.0143  70   THR B CB   
3111 O OG1  . THR B 70  ? 0.1157 0.0684 0.1070 0.0174  -0.0112 0.0239  70   THR B OG1  
3112 C CG2  . THR B 70  ? 0.1659 0.0907 0.1269 0.0183  0.0324  0.0128  70   THR B CG2  
3113 H H    . THR B 70  ? 0.1066 0.1066 0.1066 0.0000  0.0000  0.0000  70   THR B H    
3114 H HA   . THR B 70  ? 0.1088 0.1088 0.1088 0.0000  0.0000  0.0000  70   THR B HA   
3115 H HB   . THR B 70  ? 0.1093 0.1093 0.1093 0.0000  0.0000  0.0000  70   THR B HB   
3116 H HG1  . THR B 70  ? 0.1455 0.1455 0.1455 0.0000  0.0000  0.0000  70   THR B HG1  
3117 H HG21 . THR B 70  ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  70   THR B HG21 
3118 H HG22 . THR B 70  ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  70   THR B HG22 
3119 H HG23 . THR B 70  ? 0.1918 0.1918 0.1918 0.0000  0.0000  0.0000  70   THR B HG23 
3120 N N    . ASN B 71  ? 0.0921 0.0750 0.0871 -0.0083 -0.0394 0.0150  71   ASN B N    
3121 C CA   . ASN B 71  ? 0.0933 0.0734 0.0851 0.0101  -0.0382 0.0113  71   ASN B CA   
3122 C C    . ASN B 71  ? 0.0762 0.0561 0.0840 -0.0028 -0.0403 0.0054  71   ASN B C    
3123 O O    . ASN B 71  ? 0.0960 0.0475 0.0941 -0.0009 -0.0137 0.0075  71   ASN B O    
3124 C CB   . ASN B 71  ? 0.1106 0.1266 0.1208 0.0303  -0.0134 0.0466  71   ASN B CB   
3125 C CG   . ASN B 71  ? 0.1065 0.1712 0.1869 0.0011  -0.0110 0.0670  71   ASN B CG   
3126 O OD1  . ASN B 71  ? 0.1155 0.1460 0.2738 -0.0125 -0.0408 0.0165  71   ASN B OD1  
3127 N ND2  . ASN B 71  ? 0.1234 0.2576 0.3216 -0.0085 -0.0230 0.1519  71   ASN B ND2  
3128 H H    . ASN B 71  ? 0.1017 0.1017 0.1017 0.0000  0.0000  0.0000  71   ASN B H    
3129 H HA   . ASN B 71  ? 0.1007 0.1007 0.1007 0.0000  0.0000  0.0000  71   ASN B HA   
3130 H HB2  . ASN B 71  ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  71   ASN B HB2  
3131 H HB3  . ASN B 71  ? 0.1432 0.1432 0.1432 0.0000  0.0000  0.0000  71   ASN B HB3  
3132 H HD21 . ASN B 71  ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  71   ASN B HD21 
3133 H HD22 . ASN B 71  ? 0.2810 0.2810 0.2810 0.0000  0.0000  0.0000  71   ASN B HD22 
3134 N N    . CYS B 72  ? 0.0825 0.0537 0.0685 0.0030  -0.0300 0.0213  72   CYS B N    
3135 C CA   . CYS B 72  ? 0.0704 0.0514 0.0597 -0.0023 -0.0231 0.0140  72   CYS B CA   
3136 C C    . CYS B 72  ? 0.0743 0.0392 0.0463 -0.0021 -0.0225 0.0067  72   CYS B C    
3137 O O    . CYS B 72  ? 0.0767 0.0391 0.0503 -0.0080 -0.0221 0.0069  72   CYS B O    
3138 C CB   . CYS B 72  ? 0.0796 0.0535 0.0632 -0.0166 -0.0253 0.0087  72   CYS B CB   
3139 S SG   . CYS B 72  ? 0.1020 0.0921 0.0636 -0.0418 -0.0266 0.0046  72   CYS B SG   
3140 H H    . CYS B 72  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  72   CYS B H    
3141 H HA   . CYS B 72  ? 0.0726 0.0726 0.0726 0.0000  0.0000  0.0000  72   CYS B HA   
3142 H HB2  . CYS B 72  ? 0.0785 0.0785 0.0785 0.0000  0.0000  0.0000  72   CYS B HB2  
3143 H HB3  . CYS B 72  ? 0.0785 0.0785 0.0785 0.0000  0.0000  0.0000  72   CYS B HB3  
3144 N N    . TYR B 73  ? 0.0626 0.0343 0.0505 -0.0066 -0.0211 0.0063  73   TYR B N    
3145 C CA   . TYR B 73  ? 0.0608 0.0327 0.0541 -0.0004 -0.0247 0.0038  73   TYR B CA   
3146 C C    . TYR B 73  ? 0.0642 0.0371 0.0465 -0.0023 -0.0209 0.0036  73   TYR B C    
3147 O O    . TYR B 73  ? 0.0662 0.0306 0.0590 -0.0049 -0.0144 0.0024  73   TYR B O    
3148 C CB   . TYR B 73  ? 0.0819 0.0459 0.0481 0.0052  -0.0257 0.0004  73   TYR B CB   
3149 C CG   . TYR B 73  ? 0.0806 0.0474 0.0426 0.0062  -0.0174 0.0024  73   TYR B CG   
3150 C CD1  . TYR B 73  ? 0.0822 0.0391 0.0537 0.0006  -0.0093 0.0068  73   TYR B CD1  
3151 C CD2  . TYR B 73  ? 0.0814 0.0431 0.0493 0.0036  -0.0227 -0.0041 73   TYR B CD2  
3152 C CE1  . TYR B 73  ? 0.0709 0.0440 0.0662 0.0002  -0.0151 0.0030  73   TYR B CE1  
3153 C CE2  . TYR B 73  ? 0.0794 0.0427 0.0621 -0.0074 -0.0205 0.0026  73   TYR B CE2  
3154 C CZ   . TYR B 73  ? 0.0822 0.0355 0.0612 -0.0014 -0.0193 0.0076  73   TYR B CZ   
3155 O OH   . TYR B 73  ? 0.0866 0.0365 0.0810 0.0056  -0.0197 0.0042  73   TYR B OH   
3156 H H    . TYR B 73  ? 0.0590 0.0590 0.0590 0.0000  0.0000  0.0000  73   TYR B H    
3157 H HA   . TYR B 73  ? 0.0590 0.0590 0.0590 0.0000  0.0000  0.0000  73   TYR B HA   
3158 H HB2  . TYR B 73  ? 0.0703 0.0703 0.0703 0.0000  0.0000  0.0000  73   TYR B HB2  
3159 H HB3  . TYR B 73  ? 0.0703 0.0703 0.0703 0.0000  0.0000  0.0000  73   TYR B HB3  
3160 H HD1  . TYR B 73  ? 0.0700 0.0700 0.0700 0.0000  0.0000  0.0000  73   TYR B HD1  
3161 H HD2  . TYR B 73  ? 0.0695 0.0695 0.0695 0.0000  0.0000  0.0000  73   TYR B HD2  
3162 H HE1  . TYR B 73  ? 0.0724 0.0724 0.0724 0.0000  0.0000  0.0000  73   TYR B HE1  
3163 H HE2  . TYR B 73  ? 0.0737 0.0737 0.0737 0.0000  0.0000  0.0000  73   TYR B HE2  
3164 H HH   . TYR B 73  ? 0.1021 0.1021 0.1021 0.0000  0.0000  0.0000  73   TYR B HH   
3165 N N    . GLN B 74  ? 0.0660 0.0323 0.0644 -0.0043 -0.0232 0.0069  74   GLN B N    
3166 C CA   . GLN B 74  ? 0.0621 0.0344 0.0560 -0.0029 -0.0181 -0.0016 74   GLN B CA   
3167 C C    . GLN B 74  ? 0.0608 0.0374 0.0540 0.0027  -0.0151 0.0014  74   GLN B C    
3168 O O    . GLN B 74  ? 0.0826 0.0360 0.0675 -0.0047 -0.0237 -0.0046 74   GLN B O    
3169 C CB   . GLN B 74  ? 0.0738 0.0477 0.0592 -0.0048 -0.0110 -0.0007 74   GLN B CB   
3170 C CG   . GLN B 74  ? 0.0751 0.0689 0.0713 0.0003  -0.0093 -0.0071 74   GLN B CG   
3171 C CD   . GLN B 74  ? 0.1198 0.1142 0.1278 0.0085  0.0328  -0.0234 74   GLN B CD   
3172 O OE1  . GLN B 74  ? 0.1885 0.1928 0.1003 0.0096  0.0387  0.0169  74   GLN B OE1  
3173 N NE2  . GLN B 74  ? 0.1356 0.2609 0.1386 -0.0431 0.0595  -0.0376 74   GLN B NE2  
3174 H H    . GLN B 74  ? 0.0651 0.0651 0.0651 0.0000  0.0000  0.0000  74   GLN B H    
3175 H HA   . GLN B 74  ? 0.0610 0.0610 0.0610 0.0000  0.0000  0.0000  74   GLN B HA   
3176 H HB2  . GLN B 74  ? 0.0723 0.0723 0.0723 0.0000  0.0000  0.0000  74   GLN B HB2  
3177 H HB3  . GLN B 74  ? 0.0723 0.0723 0.0723 0.0000  0.0000  0.0000  74   GLN B HB3  
3178 H HG2  . GLN B 74  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  74   GLN B HG2  
3179 H HG3  . GLN B 74  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  74   GLN B HG3  
3180 H HE21 . GLN B 74  ? 0.2140 0.2140 0.2140 0.0000  0.0000  0.0000  74   GLN B HE21 
3181 H HE22 . GLN B 74  ? 0.2140 0.2140 0.2140 0.0000  0.0000  0.0000  74   GLN B HE22 
3182 N N    . SER B 75  ? 0.0618 0.0329 0.0522 -0.0013 -0.0209 -0.0031 75   SER B N    
3183 C CA   . SER B 75  ? 0.0542 0.0312 0.0504 -0.0007 -0.0145 -0.0024 75   SER B CA   
3184 C C    . SER B 75  ? 0.0501 0.0383 0.0633 0.0004  -0.0134 -0.0003 75   SER B C    
3185 O O    . SER B 75  ? 0.0649 0.0724 0.0739 -0.0083 -0.0035 -0.0158 75   SER B O    
3186 C CB   . SER B 75  ? 0.0502 0.0368 0.0538 0.0035  -0.0111 0.0002  75   SER B CB   
3187 O OG   . SER B 75  ? 0.0543 0.0384 0.0611 0.0069  -0.0171 -0.0088 75   SER B OG   
3188 H H    . SER B 75  ? 0.0588 0.0588 0.0588 0.0000  0.0000  0.0000  75   SER B H    
3189 H HA   . SER B 75  ? 0.0543 0.0543 0.0543 0.0000  0.0000  0.0000  75   SER B HA   
3190 H HB2  . SER B 75  ? 0.0564 0.0564 0.0564 0.0000  0.0000  0.0000  75   SER B HB2  
3191 H HB3  . SER B 75  ? 0.0564 0.0564 0.0564 0.0000  0.0000  0.0000  75   SER B HB3  
3192 H HG   . SER B 75  ? 0.0769 0.0769 0.0769 0.0000  0.0000  0.0000  75   SER B HG   
3193 N N    . TYR B 76  ? 0.0533 0.0338 0.0640 -0.0034 -0.0179 -0.0035 76   TYR B N    
3194 C CA   . TYR B 76  ? 0.0598 0.0350 0.0847 -0.0079 -0.0152 -0.0014 76   TYR B CA   
3195 C C    . TYR B 76  ? 0.0553 0.0452 0.0849 0.0019  -0.0143 -0.0051 76   TYR B C    
3196 O O    . TYR B 76  ? 0.0579 0.0809 0.1198 0.0089  0.0045  0.0088  76   TYR B O    
3197 C CB   . TYR B 76  ? 0.0728 0.0435 0.1173 -0.0014 -0.0421 -0.0156 76   TYR B CB   
3198 C CG   . TYR B 76  ? 0.0704 0.0391 0.1124 -0.0053 -0.0299 -0.0065 76   TYR B CG   
3199 C CD1  . TYR B 76  ? 0.1065 0.0421 0.1308 -0.0050 -0.0342 -0.0080 76   TYR B CD1  
3200 C CD2  . TYR B 76  ? 0.1034 0.0467 0.1362 -0.0040 0.0040  -0.0043 76   TYR B CD2  
3201 C CE1  . TYR B 76  ? 0.1310 0.0564 0.1545 -0.0181 -0.0688 0.0254  76   TYR B CE1  
3202 C CE2  . TYR B 76  ? 0.1178 0.0550 0.1624 -0.0032 0.0039  -0.0180 76   TYR B CE2  
3203 C CZ   . TYR B 76  ? 0.0940 0.0451 0.1957 -0.0079 -0.0370 0.0069  76   TYR B CZ   
3204 O OH   . TYR B 76  ? 0.1423 0.0543 0.2427 0.0118  -0.0360 0.0015  76   TYR B OH   
3205 H H    . TYR B 76  ? 0.0604 0.0604 0.0604 0.0000  0.0000  0.0000  76   TYR B H    
3206 H HA   . TYR B 76  ? 0.0718 0.0718 0.0718 0.0000  0.0000  0.0000  76   TYR B HA   
3207 H HB2  . TYR B 76  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  76   TYR B HB2  
3208 H HB3  . TYR B 76  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  76   TYR B HB3  
3209 H HD1  . TYR B 76  ? 0.1117 0.1117 0.1117 0.0000  0.0000  0.0000  76   TYR B HD1  
3210 H HD2  . TYR B 76  ? 0.1145 0.1145 0.1145 0.0000  0.0000  0.0000  76   TYR B HD2  
3211 H HE1  . TYR B 76  ? 0.1367 0.1367 0.1367 0.0000  0.0000  0.0000  76   TYR B HE1  
3212 H HE2  . TYR B 76  ? 0.1340 0.1340 0.1340 0.0000  0.0000  0.0000  76   TYR B HE2  
3213 H HH   . TYR B 76  ? 0.2196 0.2196 0.2196 0.0000  0.0000  0.0000  76   TYR B HH   
3214 N N    . SER B 77  ? 0.0517 0.0387 0.0763 0.0061  -0.0104 -0.0018 77   SER B N    
3215 C CA   . SER B 77  ? 0.0532 0.0371 0.0741 0.0077  -0.0140 -0.0075 77   SER B CA   
3216 C C    . SER B 77  ? 0.0454 0.0372 0.0616 0.0014  -0.0092 0.0006  77   SER B C    
3217 O O    . SER B 77  ? 0.0733 0.0490 0.0989 0.0176  -0.0380 -0.0156 77   SER B O    
3218 C CB   A SER B 77  ? 0.0924 0.0647 0.0617 0.0350  -0.0131 -0.0035 77   SER B CB   
3219 C CB   B SER B 77  ? 0.0778 0.0315 0.0551 -0.0165 -0.0089 -0.0232 77   SER B CB   
3220 O OG   A SER B 77  ? 0.3096 0.0842 0.0834 -0.0467 0.0006  -0.0369 77   SER B OG   
3221 O OG   B SER B 77  ? 0.0557 0.0456 0.0827 0.0040  -0.0038 -0.0071 77   SER B OG   
3222 H H    . SER B 77  ? 0.0667 0.0667 0.0667 0.0000  0.0000  0.0000  77   SER B H    
3223 H HA   A SER B 77  ? 0.0657 0.0657 0.0657 0.0000  0.0000  0.0000  77   SER B HA   
3224 H HB2  A SER B 77  ? 0.0875 0.0875 0.0875 0.0000  0.0000  0.0000  77   SER B HB2  
3225 H HB2  B SER B 77  ? 0.0657 0.0657 0.0657 0.0000  0.0000  0.0000  77   SER B HB2  
3226 H HB3  A SER B 77  ? 0.0875 0.0875 0.0875 0.0000  0.0000  0.0000  77   SER B HB3  
3227 H HB3  B SER B 77  ? 0.0657 0.0657 0.0657 0.0000  0.0000  0.0000  77   SER B HB3  
3228 H HG   A SER B 77  ? 0.2386 0.2386 0.2386 0.0000  0.0000  0.0000  77   SER B HG   
3229 H HG   B SER B 77  ? 0.0919 0.0919 0.0919 0.0000  0.0000  0.0000  77   SER B HG   
3230 N N    . THR B 78  ? 0.0403 0.0295 0.0735 0.0016  -0.0094 -0.0033 78   THR B N    
3231 C CA   . THR B 78  ? 0.0439 0.0332 0.0678 -0.0071 -0.0050 -0.0001 78   THR B CA   
3232 C C    . THR B 78  ? 0.0470 0.0330 0.0629 -0.0031 -0.0084 0.0012  78   THR B C    
3233 O O    . THR B 78  ? 0.0703 0.0995 0.0648 -0.0390 -0.0144 0.0089  78   THR B O    
3234 C CB   . THR B 78  ? 0.0557 0.0366 0.0802 -0.0018 0.0092  -0.0035 78   THR B CB   
3235 O OG1  . THR B 78  ? 0.0536 0.0584 0.0848 -0.0051 0.0120  0.0023  78   THR B OG1  
3236 C CG2  . THR B 78  ? 0.0644 0.0501 0.1157 -0.0042 0.0152  -0.0236 78   THR B CG2  
3237 H H    . THR B 78  ? 0.0574 0.0574 0.0574 0.0000  0.0000  0.0000  78   THR B H    
3238 H HA   . THR B 78  ? 0.0579 0.0579 0.0579 0.0000  0.0000  0.0000  78   THR B HA   
3239 H HB   . THR B 78  ? 0.0690 0.0690 0.0690 0.0000  0.0000  0.0000  78   THR B HB   
3240 H HG1  . THR B 78  ? 0.0984 0.0984 0.0984 0.0000  0.0000  0.0000  78   THR B HG1  
3241 H HG21 . THR B 78  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  78   THR B HG21 
3242 H HG22 . THR B 78  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  78   THR B HG22 
3243 H HG23 . THR B 78  ? 0.1151 0.1151 0.1151 0.0000  0.0000  0.0000  78   THR B HG23 
3244 N N    . MET B 79  ? 0.0483 0.0324 0.0536 -0.0070 -0.0016 -0.0014 79   MET B N    
3245 C CA   . MET B 79  ? 0.0515 0.0330 0.0499 -0.0068 0.0008  -0.0065 79   MET B CA   
3246 C C    . MET B 79  ? 0.0451 0.0321 0.0563 -0.0040 -0.0056 -0.0063 79   MET B C    
3247 O O    . MET B 79  ? 0.0696 0.0339 0.0509 -0.0078 0.0000  -0.0068 79   MET B O    
3248 C CB   A MET B 79  ? 0.0464 0.0397 0.0556 -0.0038 -0.0042 -0.0034 79   MET B CB   
3249 C CB   B MET B 79  ? 0.0856 0.0102 0.0442 0.0078  0.0166  0.0204  79   MET B CB   
3250 C CG   A MET B 79  ? 0.0498 0.0451 0.0593 -0.0034 -0.0066 -0.0008 79   MET B CG   
3251 C CG   B MET B 79  ? 0.0727 0.0327 0.0552 0.0034  0.0116  0.0124  79   MET B CG   
3252 S SD   A MET B 79  ? 0.0531 0.0486 0.0640 0.0077  -0.0127 -0.0055 79   MET B SD   
3253 S SD   B MET B 79  ? 0.0948 0.0346 0.0536 0.0012  -0.0101 -0.0088 79   MET B SD   
3254 C CE   A MET B 79  ? 0.0973 0.0494 0.0851 0.0237  -0.0070 -0.0182 79   MET B CE   
3255 C CE   B MET B 79  ? 0.1340 0.0496 0.0441 0.0248  -0.0358 0.0095  79   MET B CE   
3256 H H    . MET B 79  ? 0.0537 0.0537 0.0537 0.0000  0.0000  0.0000  79   MET B H    
3257 H HA   A MET B 79  ? 0.0538 0.0538 0.0538 0.0000  0.0000  0.0000  79   MET B HA   
3258 H HB2  A MET B 79  ? 0.0567 0.0567 0.0567 0.0000  0.0000  0.0000  79   MET B HB2  
3259 H HB2  B MET B 79  ? 0.0560 0.0560 0.0560 0.0000  0.0000  0.0000  79   MET B HB2  
3260 H HB3  A MET B 79  ? 0.0567 0.0567 0.0567 0.0000  0.0000  0.0000  79   MET B HB3  
3261 H HB3  B MET B 79  ? 0.0560 0.0560 0.0560 0.0000  0.0000  0.0000  79   MET B HB3  
3262 H HG2  A MET B 79  ? 0.0617 0.0617 0.0617 0.0000  0.0000  0.0000  79   MET B HG2  
3263 H HG2  B MET B 79  ? 0.0642 0.0642 0.0642 0.0000  0.0000  0.0000  79   MET B HG2  
3264 H HG3  A MET B 79  ? 0.0617 0.0617 0.0617 0.0000  0.0000  0.0000  79   MET B HG3  
3265 H HG3  B MET B 79  ? 0.0642 0.0642 0.0642 0.0000  0.0000  0.0000  79   MET B HG3  
3266 H HE1  A MET B 79  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  79   MET B HE1  
3267 H HE1  B MET B 79  ? 0.1139 0.1139 0.1139 0.0000  0.0000  0.0000  79   MET B HE1  
3268 H HE2  A MET B 79  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  79   MET B HE2  
3269 H HE2  B MET B 79  ? 0.1139 0.1139 0.1139 0.0000  0.0000  0.0000  79   MET B HE2  
3270 H HE3  A MET B 79  ? 0.1159 0.1159 0.1159 0.0000  0.0000  0.0000  79   MET B HE3  
3271 H HE3  B MET B 79  ? 0.1139 0.1139 0.1139 0.0000  0.0000  0.0000  79   MET B HE3  
3272 N N    . SER B 80  ? 0.0531 0.0285 0.0497 -0.0057 -0.0037 -0.0028 80   SER B N    
3273 C CA   . SER B 80  ? 0.0415 0.0298 0.0531 -0.0062 -0.0063 -0.0022 80   SER B CA   
3274 C C    . SER B 80  ? 0.0447 0.0262 0.0533 -0.0064 -0.0052 -0.0020 80   SER B C    
3275 O O    . SER B 80  ? 0.0489 0.0416 0.0521 -0.0045 -0.0035 -0.0070 80   SER B O    
3276 C CB   . SER B 80  ? 0.0526 0.0352 0.0512 -0.0036 -0.0078 0.0013  80   SER B CB   
3277 O OG   . SER B 80  ? 0.0676 0.0356 0.0489 -0.0029 -0.0084 0.0036  80   SER B OG   
3278 H H    . SER B 80  ? 0.0526 0.0526 0.0526 0.0000  0.0000  0.0000  80   SER B H    
3279 H HA   . SER B 80  ? 0.0498 0.0498 0.0498 0.0000  0.0000  0.0000  80   SER B HA   
3280 H HB2  . SER B 80  ? 0.0556 0.0556 0.0556 0.0000  0.0000  0.0000  80   SER B HB2  
3281 H HB3  . SER B 80  ? 0.0556 0.0556 0.0556 0.0000  0.0000  0.0000  80   SER B HB3  
3282 H HG   . SER B 80  ? 0.0760 0.0760 0.0760 0.0000  0.0000  0.0000  80   SER B HG   
3283 N N    . ILE B 81  ? 0.0500 0.0292 0.0465 -0.0039 -0.0031 -0.0041 81   ILE B N    
3284 C CA   . ILE B 81  ? 0.0484 0.0263 0.0509 -0.0033 -0.0099 -0.0012 81   ILE B CA   
3285 C C    . ILE B 81  ? 0.0578 0.0263 0.0463 -0.0043 -0.0095 -0.0022 81   ILE B C    
3286 O O    . ILE B 81  ? 0.0497 0.0362 0.0652 -0.0023 -0.0055 -0.0086 81   ILE B O    
3287 C CB   . ILE B 81  ? 0.0554 0.0412 0.0589 -0.0063 -0.0138 0.0074  81   ILE B CB   
3288 C CG1  . ILE B 81  ? 0.0805 0.0652 0.0532 -0.0083 -0.0034 0.0103  81   ILE B CG1  
3289 C CG2  . ILE B 81  ? 0.0720 0.0372 0.0833 -0.0084 -0.0103 0.0096  81   ILE B CG2  
3290 C CD1  . ILE B 81  ? 0.0989 0.1322 0.0695 -0.0199 -0.0102 0.0322  81   ILE B CD1  
3291 H H    . ILE B 81  ? 0.0503 0.0503 0.0503 0.0000  0.0000  0.0000  81   ILE B H    
3292 H HA   . ILE B 81  ? 0.0502 0.0502 0.0502 0.0000  0.0000  0.0000  81   ILE B HA   
3293 H HB   . ILE B 81  ? 0.0622 0.0622 0.0622 0.0000  0.0000  0.0000  81   ILE B HB   
3294 H HG12 . ILE B 81  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  81   ILE B HG12 
3295 H HG13 . ILE B 81  ? 0.0795 0.0795 0.0795 0.0000  0.0000  0.0000  81   ILE B HG13 
3296 H HG21 . ILE B 81  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  81   ILE B HG21 
3297 H HG22 . ILE B 81  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  81   ILE B HG22 
3298 H HG23 . ILE B 81  ? 0.0963 0.0963 0.0963 0.0000  0.0000  0.0000  81   ILE B HG23 
3299 H HD11 . ILE B 81  ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  81   ILE B HD11 
3300 H HD12 . ILE B 81  ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  81   ILE B HD12 
3301 H HD13 . ILE B 81  ? 0.1502 0.1502 0.1502 0.0000  0.0000  0.0000  81   ILE B HD13 
3302 N N    . THR B 82  ? 0.0506 0.0279 0.0533 -0.0044 -0.0104 -0.0100 82   THR B N    
3303 C CA   . THR B 82  ? 0.0611 0.0285 0.0508 -0.0061 -0.0089 -0.0069 82   THR B CA   
3304 C C    . THR B 82  ? 0.0616 0.0302 0.0489 -0.0059 -0.0109 -0.0070 82   THR B C    
3305 O O    . THR B 82  ? 0.0603 0.0433 0.0535 0.0013  -0.0145 -0.0047 82   THR B O    
3306 C CB   . THR B 82  ? 0.0581 0.0362 0.0481 -0.0094 -0.0116 -0.0071 82   THR B CB   
3307 O OG1  . THR B 82  ? 0.0691 0.0324 0.0475 -0.0001 -0.0143 -0.0057 82   THR B OG1  
3308 C CG2  . THR B 82  ? 0.0857 0.0308 0.0545 -0.0158 -0.0170 -0.0045 82   THR B CG2  
3309 H H    . THR B 82  ? 0.0527 0.0527 0.0527 0.0000  0.0000  0.0000  82   THR B H    
3310 H HA   . THR B 82  ? 0.0561 0.0561 0.0561 0.0000  0.0000  0.0000  82   THR B HA   
3311 H HB   . THR B 82  ? 0.0570 0.0570 0.0570 0.0000  0.0000  0.0000  82   THR B HB   
3312 H HG1  . THR B 82  ? 0.0745 0.0745 0.0745 0.0000  0.0000  0.0000  82   THR B HG1  
3313 H HG21 . THR B 82  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  82   THR B HG21 
3314 H HG22 . THR B 82  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  82   THR B HG22 
3315 H HG23 . THR B 82  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  82   THR B HG23 
3316 N N    . ASP B 83  ? 0.0609 0.0430 0.0465 -0.0021 -0.0071 -0.0107 83   ASP B N    
3317 C CA   . ASP B 83  ? 0.0726 0.0506 0.0451 -0.0115 -0.0121 -0.0023 83   ASP B CA   
3318 C C    . ASP B 83  ? 0.0756 0.0453 0.0479 -0.0041 -0.0190 -0.0097 83   ASP B C    
3319 O O    . ASP B 83  ? 0.0751 0.0462 0.0803 0.0037  -0.0186 -0.0177 83   ASP B O    
3320 C CB   . ASP B 83  ? 0.0903 0.0883 0.0543 -0.0187 0.0026  -0.0025 83   ASP B CB   
3321 C CG   . ASP B 83  ? 0.1063 0.0840 0.0623 -0.0143 0.0035  -0.0060 83   ASP B CG   
3322 O OD1  . ASP B 83  ? 0.1613 0.0904 0.0649 -0.0009 -0.0155 0.0012  83   ASP B OD1  
3323 O OD2  . ASP B 83  ? 0.1586 0.0987 0.0970 -0.0015 -0.0300 -0.0236 83   ASP B OD2  
3324 H H    . ASP B 83  ? 0.0602 0.0602 0.0602 0.0000  0.0000  0.0000  83   ASP B H    
3325 H HA   . ASP B 83  ? 0.0673 0.0673 0.0673 0.0000  0.0000  0.0000  83   ASP B HA   
3326 H HB2  . ASP B 83  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  83   ASP B HB2  
3327 H HB3  . ASP B 83  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  83   ASP B HB3  
3328 N N    . CYS B 84  ? 0.0717 0.0437 0.0561 -0.0016 -0.0228 -0.0031 84   CYS B N    
3329 C CA   . CYS B 84  ? 0.0791 0.0358 0.0617 -0.0008 -0.0307 -0.0039 84   CYS B CA   
3330 C C    . CYS B 84  ? 0.0780 0.0520 0.0672 -0.0059 -0.0309 -0.0068 84   CYS B C    
3331 O O    . CYS B 84  ? 0.1209 0.0532 0.0798 0.0156  -0.0552 -0.0036 84   CYS B O    
3332 C CB   . CYS B 84  ? 0.0728 0.0401 0.0755 -0.0035 -0.0320 0.0069  84   CYS B CB   
3333 S SG   . CYS B 84  ? 0.0749 0.0346 0.0699 0.0002  -0.0181 -0.0006 84   CYS B SG   
3334 H H    . CYS B 84  ? 0.0686 0.0686 0.0686 0.0000  0.0000  0.0000  84   CYS B H    
3335 H HA   . CYS B 84  ? 0.0707 0.0707 0.0707 0.0000  0.0000  0.0000  84   CYS B HA   
3336 H HB2  . CYS B 84  ? 0.0754 0.0754 0.0754 0.0000  0.0000  0.0000  84   CYS B HB2  
3337 H HB3  . CYS B 84  ? 0.0754 0.0754 0.0754 0.0000  0.0000  0.0000  84   CYS B HB3  
3338 N N    . ARG B 85  ? 0.0888 0.0512 0.0629 -0.0009 -0.0382 -0.0056 85   ARG B N    
3339 C CA   . ARG B 85  ? 0.1149 0.0473 0.0634 -0.0097 -0.0371 0.0046  85   ARG B CA   
3340 C C    . ARG B 85  ? 0.1017 0.0514 0.0570 0.0000  -0.0215 -0.0052 85   ARG B C    
3341 O O    . ARG B 85  ? 0.1035 0.0535 0.0759 0.0123  -0.0463 -0.0059 85   ARG B O    
3342 C CB   A ARG B 85  ? 0.1424 0.0718 0.1089 0.0021  -0.0061 0.0168  85   ARG B CB   
3343 C CB   B ARG B 85  ? 0.1722 0.0917 0.0754 -0.0458 -0.0181 0.0095  85   ARG B CB   
3344 C CG   A ARG B 85  ? 0.1419 0.1142 0.0913 -0.0087 -0.0067 -0.0027 85   ARG B CG   
3345 C CG   B ARG B 85  ? 0.1442 0.1156 0.0939 -0.0302 0.0113  -0.0181 85   ARG B CG   
3346 C CD   A ARG B 85  ? 0.1661 0.1053 0.0762 0.0064  0.0055  -0.0119 85   ARG B CD   
3347 C CD   B ARG B 85  ? 0.1687 0.1650 0.0724 -0.0491 0.0093  -0.0275 85   ARG B CD   
3348 N NE   A ARG B 85  ? 0.1065 0.1011 0.0883 -0.0164 -0.0151 -0.0083 85   ARG B NE   
3349 N NE   B ARG B 85  ? 0.1673 0.1397 0.0862 -0.0402 0.0167  -0.0446 85   ARG B NE   
3350 C CZ   A ARG B 85  ? 0.1070 0.0971 0.0794 -0.0113 0.0007  -0.0015 85   ARG B CZ   
3351 C CZ   B ARG B 85  ? 0.1829 0.1602 0.1706 0.0068  -0.0132 -0.0058 85   ARG B CZ   
3352 N NH1  A ARG B 85  ? 0.1264 0.0910 0.0796 0.0011  -0.0193 0.0098  85   ARG B NH1  
3353 N NH1  B ARG B 85  ? 0.2465 0.2680 0.1507 -0.0087 -0.0066 -0.0208 85   ARG B NH1  
3354 N NH2  A ARG B 85  ? 0.1335 0.0893 0.0742 -0.0075 -0.0095 0.0106  85   ARG B NH2  
3355 N NH2  B ARG B 85  ? 0.3084 0.1714 0.1549 -0.0445 -0.0502 0.0292  85   ARG B NH2  
3356 H H    . ARG B 85  ? 0.0812 0.0812 0.0812 0.0000  0.0000  0.0000  85   ARG B H    
3357 H HA   A ARG B 85  ? 0.0902 0.0902 0.0902 0.0000  0.0000  0.0000  85   ARG B HA   
3358 H HB2  A ARG B 85  ? 0.1292 0.1292 0.1292 0.0000  0.0000  0.0000  85   ARG B HB2  
3359 H HB2  B ARG B 85  ? 0.1358 0.1358 0.1358 0.0000  0.0000  0.0000  85   ARG B HB2  
3360 H HB3  A ARG B 85  ? 0.1292 0.1292 0.1292 0.0000  0.0000  0.0000  85   ARG B HB3  
3361 H HB3  B ARG B 85  ? 0.1358 0.1358 0.1358 0.0000  0.0000  0.0000  85   ARG B HB3  
3362 H HG2  A ARG B 85  ? 0.1389 0.1389 0.1389 0.0000  0.0000  0.0000  85   ARG B HG2  
3363 H HG2  B ARG B 85  ? 0.1415 0.1415 0.1415 0.0000  0.0000  0.0000  85   ARG B HG2  
3364 H HG3  A ARG B 85  ? 0.1389 0.1389 0.1389 0.0000  0.0000  0.0000  85   ARG B HG3  
3365 H HG3  B ARG B 85  ? 0.1415 0.1415 0.1415 0.0000  0.0000  0.0000  85   ARG B HG3  
3366 H HD2  A ARG B 85  ? 0.1391 0.1391 0.1391 0.0000  0.0000  0.0000  85   ARG B HD2  
3367 H HD2  B ARG B 85  ? 0.1625 0.1625 0.1625 0.0000  0.0000  0.0000  85   ARG B HD2  
3368 H HD3  A ARG B 85  ? 0.1391 0.1391 0.1391 0.0000  0.0000  0.0000  85   ARG B HD3  
3369 H HD3  B ARG B 85  ? 0.1625 0.1625 0.1625 0.0000  0.0000  0.0000  85   ARG B HD3  
3370 H HE   A ARG B 85  ? 0.1184 0.1184 0.1184 0.0000  0.0000  0.0000  85   ARG B HE   
3371 H HE   B ARG B 85  ? 0.1573 0.1573 0.1573 0.0000  0.0000  0.0000  85   ARG B HE   
3372 H HH11 A ARG B 85  ? 0.1188 0.1188 0.1188 0.0000  0.0000  0.0000  85   ARG B HH11 
3373 H HH11 B ARG B 85  ? 0.2661 0.2661 0.2661 0.0000  0.0000  0.0000  85   ARG B HH11 
3374 H HH12 A ARG B 85  ? 0.1188 0.1188 0.1188 0.0000  0.0000  0.0000  85   ARG B HH12 
3375 H HH12 B ARG B 85  ? 0.2661 0.2661 0.2661 0.0000  0.0000  0.0000  85   ARG B HH12 
3376 H HH21 A ARG B 85  ? 0.1188 0.1188 0.1188 0.0000  0.0000  0.0000  85   ARG B HH21 
3377 H HH21 B ARG B 85  ? 0.2538 0.2538 0.2538 0.0000  0.0000  0.0000  85   ARG B HH21 
3378 H HH22 A ARG B 85  ? 0.1188 0.1188 0.1188 0.0000  0.0000  0.0000  85   ARG B HH22 
3379 H HH22 B ARG B 85  ? 0.2538 0.2538 0.2538 0.0000  0.0000  0.0000  85   ARG B HH22 
3380 N N    . GLU B 86  ? 0.0905 0.0479 0.0641 0.0052  -0.0367 -0.0042 86   GLU B N    
3381 C CA   . GLU B 86  ? 0.0945 0.0471 0.0736 -0.0003 -0.0328 0.0000  86   GLU B CA   
3382 C C    . GLU B 86  ? 0.1304 0.0478 0.0606 -0.0090 -0.0346 0.0015  86   GLU B C    
3383 O O    . GLU B 86  ? 0.1630 0.0615 0.0713 0.0008  -0.0061 -0.0015 86   GLU B O    
3384 C CB   A GLU B 86  ? 0.1048 0.0688 0.0896 -0.0256 -0.0416 0.0072  86   GLU B CB   
3385 C CB   B GLU B 86  ? 0.1347 0.0599 0.1523 0.0055  -0.1109 -0.0013 86   GLU B CB   
3386 C CG   A GLU B 86  ? 0.0913 0.0652 0.0761 0.0044  -0.0410 0.0080  86   GLU B CG   
3387 C CG   B GLU B 86  ? 0.1394 0.1269 0.2146 -0.0036 -0.0700 0.0016  86   GLU B CG   
3388 C CD   A GLU B 86  ? 0.0826 0.0748 0.0922 -0.0018 -0.0459 0.0094  86   GLU B CD   
3389 C CD   B GLU B 86  ? 0.1325 0.1313 0.1507 -0.0388 -0.0418 0.0663  86   GLU B CD   
3390 O OE1  A GLU B 86  ? 0.1350 0.1787 0.1757 -0.0794 -0.1130 0.1129  86   GLU B OE1  
3391 O OE1  B GLU B 86  ? 0.1828 0.1208 0.3337 -0.0230 -0.1713 0.0044  86   GLU B OE1  
3392 O OE2  A GLU B 86  ? 0.1203 0.0943 0.0743 0.0109  -0.0416 0.0188  86   GLU B OE2  
3393 O OE2  B GLU B 86  ? 0.0781 0.1281 0.1386 0.0059  -0.0153 0.0411  86   GLU B OE2  
3394 H H    . GLU B 86  ? 0.0809 0.0809 0.0809 0.0000  0.0000  0.0000  86   GLU B H    
3395 H HA   A GLU B 86  ? 0.0861 0.0861 0.0861 0.0000  0.0000  0.0000  86   GLU B HA   
3396 H HB2  A GLU B 86  ? 0.1052 0.1052 0.1052 0.0000  0.0000  0.0000  86   GLU B HB2  
3397 H HB2  B GLU B 86  ? 0.1388 0.1388 0.1388 0.0000  0.0000  0.0000  86   GLU B HB2  
3398 H HB3  A GLU B 86  ? 0.1052 0.1052 0.1052 0.0000  0.0000  0.0000  86   GLU B HB3  
3399 H HB3  B GLU B 86  ? 0.1388 0.1388 0.1388 0.0000  0.0000  0.0000  86   GLU B HB3  
3400 H HG2  A GLU B 86  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  86   GLU B HG2  
3401 H HG2  B GLU B 86  ? 0.1924 0.1924 0.1924 0.0000  0.0000  0.0000  86   GLU B HG2  
3402 H HG3  A GLU B 86  ? 0.0931 0.0931 0.0931 0.0000  0.0000  0.0000  86   GLU B HG3  
3403 H HG3  B GLU B 86  ? 0.1924 0.1924 0.1924 0.0000  0.0000  0.0000  86   GLU B HG3  
3404 N N    . THR B 87  ? 0.1198 0.0530 0.0648 -0.0042 -0.0240 0.0013  87   THR B N    
3405 C CA   . THR B 87  ? 0.1266 0.0537 0.0676 -0.0090 -0.0175 -0.0002 87   THR B CA   
3406 C C    . THR B 87  ? 0.1143 0.0672 0.0707 0.0092  -0.0171 -0.0086 87   THR B C    
3407 O O    . THR B 87  ? 0.1368 0.0857 0.0720 0.0103  -0.0323 -0.0148 87   THR B O    
3408 C CB   . THR B 87  ? 0.1152 0.0514 0.0797 -0.0087 -0.0144 -0.0043 87   THR B CB   
3409 O OG1  . THR B 87  ? 0.1092 0.0621 0.1208 0.0043  -0.0011 0.0136  87   THR B OG1  
3410 C CG2  . THR B 87  ? 0.1612 0.0679 0.0841 0.0004  -0.0367 0.0006  87   THR B CG2  
3411 H H    . THR B 87  ? 0.0950 0.0950 0.0950 0.0000  0.0000  0.0000  87   THR B H    
3412 H HA   . THR B 87  ? 0.0992 0.0992 0.0992 0.0000  0.0000  0.0000  87   THR B HA   
3413 H HB   . THR B 87  ? 0.0985 0.0985 0.0985 0.0000  0.0000  0.0000  87   THR B HB   
3414 H HG1  . THR B 87  ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  87   THR B HG1  
3415 H HG21 . THR B 87  ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  87   THR B HG21 
3416 H HG22 . THR B 87  ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  87   THR B HG22 
3417 H HG23 . THR B 87  ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  87   THR B HG23 
3418 N N    . GLY B 88  ? 0.1481 0.0893 0.0764 -0.0120 -0.0098 -0.0188 88   GLY B N    
3419 C CA   . GLY B 88  ? 0.1745 0.0995 0.0666 -0.0099 -0.0028 -0.0157 88   GLY B CA   
3420 C C    . GLY B 88  ? 0.1523 0.1158 0.0712 0.0015  -0.0329 -0.0265 88   GLY B C    
3421 O O    . GLY B 88  ? 0.2060 0.2008 0.0953 -0.0351 -0.0599 0.0073  88   GLY B O    
3422 H H    . GLY B 88  ? 0.1255 0.1255 0.1255 0.0000  0.0000  0.0000  88   GLY B H    
3423 H HA2  . GLY B 88  ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  88   GLY B HA2  
3424 H HA3  . GLY B 88  ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  88   GLY B HA3  
3425 N N    . SER B 89  ? 0.1459 0.0846 0.0841 -0.0064 -0.0298 -0.0126 89   SER B N    
3426 C CA   . SER B 89  ? 0.1317 0.0933 0.1264 -0.0182 -0.0388 -0.0233 89   SER B CA   
3427 C C    . SER B 89  ? 0.1113 0.0974 0.1495 -0.0168 -0.0585 0.0036  89   SER B C    
3428 O O    . SER B 89  ? 0.1287 0.1257 0.2303 -0.0101 -0.0238 -0.0182 89   SER B O    
3429 C CB   . SER B 89  ? 0.1507 0.0896 0.1644 -0.0174 -0.0153 -0.0061 89   SER B CB   
3430 O OG   . SER B 89  ? 0.1514 0.1047 0.1538 -0.0119 -0.0154 0.0055  89   SER B OG   
3431 H H    . SER B 89  ? 0.1259 0.1259 0.1259 0.0000  0.0000  0.0000  89   SER B H    
3432 H HA   . SER B 89  ? 0.1406 0.1406 0.1406 0.0000  0.0000  0.0000  89   SER B HA   
3433 H HB2  . SER B 89  ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  89   SER B HB2  
3434 H HB3  . SER B 89  ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  89   SER B HB3  
3435 H HG   . SER B 89  ? 0.2049 0.2049 0.2049 0.0000  0.0000  0.0000  89   SER B HG   
3436 N N    . SER B 90  ? 0.1130 0.1178 0.0818 -0.0024 -0.0308 -0.0041 90   SER B N    
3437 C CA   . SER B 90  ? 0.1004 0.1236 0.0978 -0.0004 -0.0491 0.0141  90   SER B CA   
3438 C C    . SER B 90  ? 0.1170 0.1369 0.0812 -0.0061 -0.0437 0.0093  90   SER B C    
3439 O O    . SER B 90  ? 0.1408 0.1727 0.0968 -0.0052 -0.0533 0.0337  90   SER B O    
3440 C CB   . SER B 90  ? 0.0971 0.1211 0.0811 0.0045  -0.0318 -0.0043 90   SER B CB   
3441 O OG   . SER B 90  ? 0.1107 0.1224 0.0830 0.0058  -0.0393 0.0023  90   SER B OG   
3442 N N    . LYS B 91  ? 0.1135 0.1112 0.1013 -0.0019 -0.0527 0.0162  91   LYS B N    
3443 C CA   . LYS B 91  ? 0.1321 0.0892 0.1312 -0.0065 -0.0669 0.0180  91   LYS B CA   
3444 C C    . LYS B 91  ? 0.1094 0.0655 0.1445 -0.0115 -0.0589 0.0149  91   LYS B C    
3445 O O    . LYS B 91  ? 0.1246 0.0806 0.1822 -0.0101 -0.0520 0.0158  91   LYS B O    
3446 C CB   . LYS B 91  ? 0.2026 0.1218 0.1423 -0.0232 -0.0809 0.0037  91   LYS B CB   
3447 C CG   A LYS B 91  ? 0.1435 0.2407 0.1141 -0.0314 -0.0612 -0.0196 91   LYS B CG   
3448 C CG   B LYS B 91  ? 0.1637 0.2138 0.1300 -0.0260 -0.0607 -0.0135 91   LYS B CG   
3449 C CD   A LYS B 91  ? 0.1977 0.2851 0.1420 0.0594  -0.0587 0.0180  91   LYS B CD   
3450 C CD   B LYS B 91  ? 0.1127 0.1231 0.1101 -0.0084 -0.0243 0.0248  91   LYS B CD   
3451 C CE   A LYS B 91  ? 0.2017 0.2603 0.1100 -0.0007 -0.0657 -0.0111 91   LYS B CE   
3452 C CE   B LYS B 91  ? 0.1169 0.1150 0.1142 0.0124  -0.0029 -0.0087 91   LYS B CE   
3453 N NZ   A LYS B 91  ? 0.1244 0.1205 0.1395 -0.0116 -0.0937 0.0286  91   LYS B NZ   
3454 N NZ   B LYS B 91  ? 0.1025 0.0982 0.1070 0.0454  -0.0217 -0.0019 91   LYS B NZ   
3455 H H    . LYS B 91  ? 0.1305 0.1305 0.1305 0.0000  0.0000  0.0000  91   LYS B H    
3456 H HA   . LYS B 91  ? 0.1410 0.1410 0.1410 0.0000  0.0000  0.0000  91   LYS B HA   
3457 H HB2  A LYS B 91  ? 0.1867 0.1867 0.1867 0.0000  0.0000  0.0000  91   LYS B HB2  
3458 H HB3  A LYS B 91  ? 0.1867 0.1867 0.1867 0.0000  0.0000  0.0000  91   LYS B HB3  
3459 H HG2  A LYS B 91  ? 0.1993 0.1993 0.1993 0.0000  0.0000  0.0000  91   LYS B HG2  
3460 H HG2  B LYS B 91  ? 0.2030 0.2030 0.2030 0.0000  0.0000  0.0000  91   LYS B HG2  
3461 H HG3  A LYS B 91  ? 0.1993 0.1993 0.1993 0.0000  0.0000  0.0000  91   LYS B HG3  
3462 H HG3  B LYS B 91  ? 0.2030 0.2030 0.2030 0.0000  0.0000  0.0000  91   LYS B HG3  
3463 H HD2  A LYS B 91  ? 0.2499 0.2499 0.2499 0.0000  0.0000  0.0000  91   LYS B HD2  
3464 H HD2  B LYS B 91  ? 0.1384 0.1384 0.1384 0.0000  0.0000  0.0000  91   LYS B HD2  
3465 H HD3  A LYS B 91  ? 0.2499 0.2499 0.2499 0.0000  0.0000  0.0000  91   LYS B HD3  
3466 H HD3  B LYS B 91  ? 0.1384 0.1384 0.1384 0.0000  0.0000  0.0000  91   LYS B HD3  
3467 H HE2  A LYS B 91  ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  91   LYS B HE2  
3468 H HE2  B LYS B 91  ? 0.1384 0.1384 0.1384 0.0000  0.0000  0.0000  91   LYS B HE2  
3469 H HE3  A LYS B 91  ? 0.2289 0.2289 0.2289 0.0000  0.0000  0.0000  91   LYS B HE3  
3470 H HE3  B LYS B 91  ? 0.1384 0.1384 0.1384 0.0000  0.0000  0.0000  91   LYS B HE3  
3471 H HZ1  A LYS B 91  ? 0.1921 0.1921 0.1921 0.0000  0.0000  0.0000  91   LYS B HZ1  
3472 H HZ1  B LYS B 91  ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  91   LYS B HZ1  
3473 H HZ2  A LYS B 91  ? 0.1921 0.1921 0.1921 0.0000  0.0000  0.0000  91   LYS B HZ2  
3474 H HZ2  B LYS B 91  ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  91   LYS B HZ2  
3475 H HZ3  A LYS B 91  ? 0.1921 0.1921 0.1921 0.0000  0.0000  0.0000  91   LYS B HZ3  
3476 H HZ3  B LYS B 91  ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  91   LYS B HZ3  
3477 N N    . TYR B 92  ? 0.1065 0.0812 0.1582 -0.0156 -0.0631 0.0139  92   TYR B N    
3478 C CA   . TYR B 92  ? 0.0906 0.0740 0.1677 -0.0032 -0.0516 0.0082  92   TYR B CA   
3479 C C    . TYR B 92  ? 0.1075 0.1008 0.1710 -0.0260 -0.0532 -0.0026 92   TYR B C    
3480 O O    . TYR B 92  ? 0.1428 0.1000 0.2214 -0.0302 -0.0842 0.0029  92   TYR B O    
3481 C CB   . TYR B 92  ? 0.1001 0.0922 0.1893 -0.0112 -0.0464 0.0227  92   TYR B CB   
3482 C CG   . TYR B 92  ? 0.0945 0.0848 0.2212 -0.0074 -0.0573 0.0111  92   TYR B CG   
3483 C CD1  . TYR B 92  ? 0.0863 0.1073 0.2228 -0.0120 -0.0147 -0.0094 92   TYR B CD1  
3484 C CD2  . TYR B 92  ? 0.0933 0.1861 0.2481 -0.0201 -0.0398 -0.0099 92   TYR B CD2  
3485 C CE1  . TYR B 92  ? 0.1069 0.1204 0.2072 -0.0105 -0.0386 -0.0178 92   TYR B CE1  
3486 C CE2  . TYR B 92  ? 0.0939 0.1631 0.2727 -0.0096 -0.0299 -0.0491 92   TYR B CE2  
3487 C CZ   . TYR B 92  ? 0.1024 0.1865 0.2455 -0.0328 -0.0103 -0.0225 92   TYR B CZ   
3488 O OH   . TYR B 92  ? 0.1273 0.2552 0.3319 -0.0279 -0.0032 -0.0781 92   TYR B OH   
3489 H H    . TYR B 92  ? 0.1383 0.1383 0.1383 0.0000  0.0000  0.0000  92   TYR B H    
3490 H HA   . TYR B 92  ? 0.1330 0.1330 0.1330 0.0000  0.0000  0.0000  92   TYR B HA   
3491 H HB2  . TYR B 92  ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  92   TYR B HB2  
3492 H HB3  . TYR B 92  ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  92   TYR B HB3  
3493 H HD1  . TYR B 92  ? 0.1665 0.1665 0.1665 0.0000  0.0000  0.0000  92   TYR B HD1  
3494 H HD2  . TYR B 92  ? 0.2110 0.2110 0.2110 0.0000  0.0000  0.0000  92   TYR B HD2  
3495 H HE1  . TYR B 92  ? 0.1738 0.1738 0.1738 0.0000  0.0000  0.0000  92   TYR B HE1  
3496 H HE2  . TYR B 92  ? 0.2119 0.2119 0.2119 0.0000  0.0000  0.0000  92   TYR B HE2  
3497 H HH   . TYR B 92  ? 0.3572 0.3572 0.3572 0.0000  0.0000  0.0000  92   TYR B HH   
3498 N N    . PRO B 93  ? 0.1149 0.0821 0.2261 -0.0291 -0.0437 0.0144  93   PRO B N    
3499 C CA   . PRO B 93  ? 0.1195 0.0953 0.1897 -0.0292 -0.0196 0.0003  93   PRO B CA   
3500 C C    . PRO B 93  ? 0.1039 0.0943 0.1709 -0.0166 -0.0164 0.0290  93   PRO B C    
3501 O O    . PRO B 93  ? 0.1725 0.1661 0.1709 -0.0224 -0.0510 0.0175  93   PRO B O    
3502 C CB   . PRO B 93  ? 0.1365 0.1759 0.2358 -0.0423 0.0001  0.0166  93   PRO B CB   
3503 C CG   . PRO B 93  ? 0.1815 0.1634 0.2617 -0.0943 -0.0156 0.0504  93   PRO B CG   
3504 C CD   . PRO B 93  ? 0.1357 0.1049 0.2679 -0.0564 -0.0360 0.0091  93   PRO B CD   
3505 H HA   . PRO B 93  ? 0.1617 0.1617 0.1617 0.0000  0.0000  0.0000  93   PRO B HA   
3506 H HB2  . PRO B 93  ? 0.2194 0.2194 0.2194 0.0000  0.0000  0.0000  93   PRO B HB2  
3507 H HB3  . PRO B 93  ? 0.2194 0.2194 0.2194 0.0000  0.0000  0.0000  93   PRO B HB3  
3508 H HG2  . PRO B 93  ? 0.2427 0.2427 0.2427 0.0000  0.0000  0.0000  93   PRO B HG2  
3509 H HG3  . PRO B 93  ? 0.2427 0.2427 0.2427 0.0000  0.0000  0.0000  93   PRO B HG3  
3510 H HD2  . PRO B 93  ? 0.2034 0.2034 0.2034 0.0000  0.0000  0.0000  93   PRO B HD2  
3511 H HD3  . PRO B 93  ? 0.2034 0.2034 0.2034 0.0000  0.0000  0.0000  93   PRO B HD3  
3512 N N    . ASN B 94  ? 0.1081 0.0873 0.1697 -0.0207 -0.0254 0.0201  94   ASN B N    
3513 C CA   . ASN B 94  ? 0.1299 0.0831 0.1771 -0.0124 -0.0503 0.0428  94   ASN B CA   
3514 C C    . ASN B 94  ? 0.0940 0.0859 0.1462 0.0004  -0.0154 0.0313  94   ASN B C    
3515 O O    . ASN B 94  ? 0.1497 0.1254 0.1383 -0.0226 -0.0383 0.0129  94   ASN B O    
3516 C CB   . ASN B 94  ? 0.1772 0.0826 0.2301 -0.0177 -0.0553 0.0162  94   ASN B CB   
3517 C CG   . ASN B 94  ? 0.2375 0.0928 0.3514 -0.0306 0.0147  0.0163  94   ASN B CG   
3518 O OD1  . ASN B 94  ? 0.5244 0.2165 0.4152 -0.1579 0.1263  0.0837  94   ASN B OD1  
3519 N ND2  . ASN B 94  ? 0.1887 0.1099 0.5547 -0.0464 -0.0791 0.0105  94   ASN B ND2  
3520 H H    . ASN B 94  ? 0.1460 0.1460 0.1460 0.0000  0.0000  0.0000  94   ASN B H    
3521 H HA   . ASN B 94  ? 0.1560 0.1560 0.1560 0.0000  0.0000  0.0000  94   ASN B HA   
3522 H HB2  . ASN B 94  ? 0.1959 0.1959 0.1959 0.0000  0.0000  0.0000  94   ASN B HB2  
3523 H HB3  . ASN B 94  ? 0.1959 0.1959 0.1959 0.0000  0.0000  0.0000  94   ASN B HB3  
3524 H HD21 . ASN B 94  ? 0.3413 0.3413 0.3413 0.0000  0.0000  0.0000  94   ASN B HD21 
3525 H HD22 . ASN B 94  ? 0.3413 0.3413 0.3413 0.0000  0.0000  0.0000  94   ASN B HD22 
3526 N N    . CYS B 95  ? 0.0925 0.0915 0.1686 -0.0084 -0.0339 0.0334  95   CYS B N    
3527 C CA   . CYS B 95  ? 0.0779 0.1047 0.1231 -0.0060 -0.0338 0.0287  95   CYS B CA   
3528 C C    . CYS B 95  ? 0.0934 0.1016 0.1043 0.0105  -0.0362 0.0297  95   CYS B C    
3529 O O    . CYS B 95  ? 0.1048 0.2667 0.1589 0.0301  -0.0067 0.1326  95   CYS B O    
3530 C CB   . CYS B 95  ? 0.1033 0.0941 0.0956 0.0018  -0.0408 0.0100  95   CYS B CB   
3531 S SG   . CYS B 95  ? 0.0888 0.0821 0.1331 -0.0082 -0.0239 0.0176  95   CYS B SG   
3532 H H    . CYS B 95  ? 0.1411 0.1411 0.1411 0.0000  0.0000  0.0000  95   CYS B H    
3533 H HA   . CYS B 95  ? 0.1222 0.1222 0.1222 0.0000  0.0000  0.0000  95   CYS B HA   
3534 H HB2  . CYS B 95  ? 0.1172 0.1172 0.1172 0.0000  0.0000  0.0000  95   CYS B HB2  
3535 H HB3  . CYS B 95  ? 0.1172 0.1172 0.1172 0.0000  0.0000  0.0000  95   CYS B HB3  
3536 N N    . ALA B 96  ? 0.0776 0.0693 0.0777 -0.0098 -0.0304 0.0067  96   ALA B N    
3537 C CA   . ALA B 96  ? 0.0833 0.0578 0.0925 0.0015  -0.0306 0.0054  96   ALA B CA   
3538 C C    . ALA B 96  ? 0.0853 0.0543 0.0647 0.0001  -0.0284 -0.0122 96   ALA B C    
3539 O O    . ALA B 96  ? 0.0947 0.0622 0.0651 -0.0065 -0.0363 0.0016  96   ALA B O    
3540 C CB   . ALA B 96  ? 0.1011 0.0624 0.1428 -0.0160 -0.0246 -0.0113 96   ALA B CB   
3541 H H    . ALA B 96  ? 0.0899 0.0899 0.0899 0.0000  0.0000  0.0000  96   ALA B H    
3542 H HA   . ALA B 96  ? 0.0935 0.0935 0.0935 0.0000  0.0000  0.0000  96   ALA B HA   
3543 H HB1  . ALA B 96  ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  96   ALA B HB1  
3544 H HB2  . ALA B 96  ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  96   ALA B HB2  
3545 H HB3  . ALA B 96  ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  96   ALA B HB3  
3546 N N    . TYR B 97  ? 0.0883 0.0458 0.0630 0.0032  -0.0335 -0.0044 97   TYR B N    
3547 C CA   . TYR B 97  ? 0.0848 0.0430 0.0677 0.0065  -0.0376 -0.0051 97   TYR B CA   
3548 C C    . TYR B 97  ? 0.0838 0.0451 0.0610 0.0112  -0.0383 -0.0108 97   TYR B C    
3549 O O    . TYR B 97  ? 0.0910 0.0547 0.0744 0.0113  -0.0346 -0.0040 97   TYR B O    
3550 C CB   . TYR B 97  ? 0.0831 0.0480 0.0646 0.0102  -0.0367 -0.0076 97   TYR B CB   
3551 C CG   . TYR B 97  ? 0.0839 0.0448 0.0674 0.0060  -0.0367 -0.0088 97   TYR B CG   
3552 C CD1  . TYR B 97  ? 0.0946 0.0444 0.0680 0.0076  -0.0268 -0.0038 97   TYR B CD1  
3553 C CD2  . TYR B 97  ? 0.0956 0.0457 0.0625 0.0056  -0.0314 -0.0024 97   TYR B CD2  
3554 C CE1  . TYR B 97  ? 0.0850 0.0478 0.0822 0.0090  -0.0321 0.0060  97   TYR B CE1  
3555 C CE2  . TYR B 97  ? 0.0789 0.0505 0.0741 0.0000  -0.0301 0.0002  97   TYR B CE2  
3556 C CZ   . TYR B 97  ? 0.0780 0.0504 0.0842 0.0076  -0.0333 0.0034  97   TYR B CZ   
3557 O OH   . TYR B 97  ? 0.0845 0.0676 0.1045 0.0079  -0.0357 0.0088  97   TYR B OH   
3558 H H    . TYR B 97  ? 0.0789 0.0789 0.0789 0.0000  0.0000  0.0000  97   TYR B H    
3559 H HA   . TYR B 97  ? 0.0781 0.0781 0.0781 0.0000  0.0000  0.0000  97   TYR B HA   
3560 H HB2  . TYR B 97  ? 0.0783 0.0783 0.0783 0.0000  0.0000  0.0000  97   TYR B HB2  
3561 H HB3  . TYR B 97  ? 0.0783 0.0783 0.0783 0.0000  0.0000  0.0000  97   TYR B HB3  
3562 H HD1  . TYR B 97  ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  97   TYR B HD1  
3563 H HD2  . TYR B 97  ? 0.0816 0.0816 0.0816 0.0000  0.0000  0.0000  97   TYR B HD2  
3564 H HE1  . TYR B 97  ? 0.0860 0.0860 0.0860 0.0000  0.0000  0.0000  97   TYR B HE1  
3565 H HE2  . TYR B 97  ? 0.0814 0.0814 0.0814 0.0000  0.0000  0.0000  97   TYR B HE2  
3566 H HH   . TYR B 97  ? 0.1283 0.1283 0.1283 0.0000  0.0000  0.0000  97   TYR B HH   
3567 N N    . LYS B 98  ? 0.0861 0.0490 0.0627 0.0059  -0.0309 -0.0096 98   LYS B N    
3568 C CA   . LYS B 98  ? 0.0797 0.0562 0.0688 0.0146  -0.0289 -0.0196 98   LYS B CA   
3569 C C    . LYS B 98  ? 0.0703 0.0489 0.0599 0.0038  -0.0228 -0.0125 98   LYS B C    
3570 O O    . LYS B 98  ? 0.0966 0.0440 0.0683 0.0043  -0.0350 -0.0059 98   LYS B O    
3571 C CB   . LYS B 98  ? 0.1012 0.0869 0.0642 0.0058  -0.0218 -0.0186 98   LYS B CB   
3572 C CG   . LYS B 98  ? 0.0897 0.1980 0.0832 0.0131  -0.0114 -0.0183 98   LYS B CG   
3573 C CD   . LYS B 98  ? 0.1395 0.2644 0.1515 0.0813  0.0047  0.0404  98   LYS B CD   
3574 C CE   . LYS B 98  ? 0.1301 0.4091 0.1922 0.0908  0.0311  0.0354  98   LYS B CE   
3575 N NZ   . LYS B 98  ? 0.3800 0.3800 0.3800 0.0000  0.0000  0.0000  98   LYS B NZ   
3576 H H    . LYS B 98  ? 0.0792 0.0792 0.0792 0.0000  0.0000  0.0000  98   LYS B H    
3577 H HA   . LYS B 98  ? 0.0818 0.0818 0.0818 0.0000  0.0000  0.0000  98   LYS B HA   
3578 H HB2  . LYS B 98  ? 0.1009 0.1009 0.1009 0.0000  0.0000  0.0000  98   LYS B HB2  
3579 H HB3  . LYS B 98  ? 0.1009 0.1009 0.1009 0.0000  0.0000  0.0000  98   LYS B HB3  
3580 H HG2  . LYS B 98  ? 0.1483 0.1483 0.1483 0.0000  0.0000  0.0000  98   LYS B HG2  
3581 H HG3  . LYS B 98  ? 0.1483 0.1483 0.1483 0.0000  0.0000  0.0000  98   LYS B HG3  
3582 H HD2  . LYS B 98  ? 0.2221 0.2221 0.2221 0.0000  0.0000  0.0000  98   LYS B HD2  
3583 H HD3  . LYS B 98  ? 0.2221 0.2221 0.2221 0.0000  0.0000  0.0000  98   LYS B HD3  
3584 H HE2  . LYS B 98  ? 0.2926 0.2926 0.2926 0.0000  0.0000  0.0000  98   LYS B HE2  
3585 H HE3  . LYS B 98  ? 0.2926 0.2926 0.2926 0.0000  0.0000  0.0000  98   LYS B HE3  
3586 H HZ1  . LYS B 98  ? 0.5699 0.5699 0.5699 0.0000  0.0000  0.0000  98   LYS B HZ1  
3587 H HZ2  . LYS B 98  ? 0.5699 0.5699 0.5699 0.0000  0.0000  0.0000  98   LYS B HZ2  
3588 H HZ3  . LYS B 98  ? 0.5699 0.5699 0.5699 0.0000  0.0000  0.0000  98   LYS B HZ3  
3589 N N    . THR B 99  ? 0.0668 0.0347 0.0632 0.0035  -0.0224 -0.0115 99   THR B N    
3590 C CA   . THR B 99  ? 0.0646 0.0336 0.0533 0.0040  -0.0204 -0.0083 99   THR B CA   
3591 C C    . THR B 99  ? 0.0595 0.0502 0.0579 -0.0030 -0.0168 -0.0098 99   THR B C    
3592 O O    . THR B 99  ? 0.0760 0.0561 0.0831 0.0093  -0.0134 -0.0161 99   THR B O    
3593 C CB   . THR B 99  ? 0.0621 0.0368 0.0574 0.0001  -0.0195 -0.0061 99   THR B CB   
3594 O OG1  . THR B 99  ? 0.0682 0.0396 0.0634 -0.0019 -0.0172 -0.0030 99   THR B OG1  
3595 C CG2  . THR B 99  ? 0.0710 0.0407 0.0561 -0.0051 -0.0226 -0.0049 99   THR B CG2  
3596 H H    . THR B 99  ? 0.0659 0.0659 0.0659 0.0000  0.0000  0.0000  99   THR B H    
3597 H HA   . THR B 99  ? 0.0607 0.0607 0.0607 0.0000  0.0000  0.0000  99   THR B HA   
3598 H HB   . THR B 99  ? 0.0626 0.0626 0.0626 0.0000  0.0000  0.0000  99   THR B HB   
3599 H HG1  . THR B 99  ? 0.0855 0.0855 0.0855 0.0000  0.0000  0.0000  99   THR B HG1  
3600 H HG21 . THR B 99  ? 0.0838 0.0838 0.0838 0.0000  0.0000  0.0000  99   THR B HG21 
3601 H HG22 . THR B 99  ? 0.0838 0.0838 0.0838 0.0000  0.0000  0.0000  99   THR B HG22 
3602 H HG23 . THR B 99  ? 0.0838 0.0838 0.0838 0.0000  0.0000  0.0000  99   THR B HG23 
3603 N N    . THR B 100 ? 0.0605 0.0461 0.0644 -0.0039 -0.0079 -0.0171 100  THR B N    
3604 C CA   . THR B 100 ? 0.0671 0.0634 0.0781 -0.0096 0.0012  -0.0284 100  THR B CA   
3605 C C    . THR B 100 ? 0.0587 0.0537 0.0674 -0.0112 0.0017  -0.0185 100  THR B C    
3606 O O    . THR B 100 ? 0.0749 0.0542 0.0765 0.0071  -0.0174 -0.0232 100  THR B O    
3607 C CB   . THR B 100 ? 0.0943 0.1090 0.0642 -0.0329 0.0008  -0.0315 100  THR B CB   
3608 O OG1  . THR B 100 ? 0.0972 0.1177 0.0751 -0.0233 0.0009  -0.0407 100  THR B OG1  
3609 C CG2  . THR B 100 ? 0.0850 0.1859 0.0899 -0.0469 0.0133  -0.0296 100  THR B CG2  
3610 H H    . THR B 100 ? 0.0684 0.0684 0.0684 0.0000  0.0000  0.0000  100  THR B H    
3611 H HA   . THR B 100 ? 0.0835 0.0835 0.0835 0.0000  0.0000  0.0000  100  THR B HA   
3612 H HB   . THR B 100 ? 0.1070 0.1070 0.1070 0.0000  0.0000  0.0000  100  THR B HB   
3613 H HG1  . THR B 100 ? 0.1450 0.1450 0.1450 0.0000  0.0000  0.0000  100  THR B HG1  
3614 H HG21 . THR B 100 ? 0.1804 0.1804 0.1804 0.0000  0.0000  0.0000  100  THR B HG21 
3615 H HG22 . THR B 100 ? 0.1804 0.1804 0.1804 0.0000  0.0000  0.0000  100  THR B HG22 
3616 H HG23 . THR B 100 ? 0.1804 0.1804 0.1804 0.0000  0.0000  0.0000  100  THR B HG23 
3617 N N    . GLN B 101 ? 0.0569 0.0381 0.0689 -0.0017 -0.0053 -0.0179 101  GLN B N    
3618 C CA   . GLN B 101 ? 0.0528 0.0383 0.0596 -0.0021 -0.0049 -0.0135 101  GLN B CA   
3619 C C    . GLN B 101 ? 0.0552 0.0437 0.0615 -0.0068 -0.0040 -0.0087 101  GLN B C    
3620 O O    . GLN B 101 ? 0.0708 0.0538 0.0843 0.0002  0.0167  -0.0209 101  GLN B O    
3621 C CB   . GLN B 101 ? 0.0656 0.0467 0.0692 0.0008  -0.0041 -0.0043 101  GLN B CB   
3622 C CG   . GLN B 101 ? 0.0711 0.0505 0.0901 0.0054  0.0023  -0.0012 101  GLN B CG   
3623 C CD   . GLN B 101 ? 0.0728 0.0720 0.1057 0.0100  0.0000  0.0103  101  GLN B CD   
3624 O OE1  . GLN B 101 ? 0.0917 0.2131 0.1713 0.0508  0.0274  0.0978  101  GLN B OE1  
3625 N NE2  . GLN B 101 ? 0.0824 0.0933 0.0850 0.0074  -0.0106 0.0087  101  GLN B NE2  
3626 H H    . GLN B 101 ? 0.0655 0.0655 0.0655 0.0000  0.0000  0.0000  101  GLN B H    
3627 H HA   . GLN B 101 ? 0.0603 0.0603 0.0603 0.0000  0.0000  0.0000  101  GLN B HA   
3628 H HB2  . GLN B 101 ? 0.0726 0.0726 0.0726 0.0000  0.0000  0.0000  101  GLN B HB2  
3629 H HB3  . GLN B 101 ? 0.0726 0.0726 0.0726 0.0000  0.0000  0.0000  101  GLN B HB3  
3630 H HG2  . GLN B 101 ? 0.0847 0.0847 0.0847 0.0000  0.0000  0.0000  101  GLN B HG2  
3631 H HG3  . GLN B 101 ? 0.0847 0.0847 0.0847 0.0000  0.0000  0.0000  101  GLN B HG3  
3632 H HE21 . GLN B 101 ? 0.1042 0.1042 0.1042 0.0000  0.0000  0.0000  101  GLN B HE21 
3633 H HE22 . GLN B 101 ? 0.1042 0.1042 0.1042 0.0000  0.0000  0.0000  101  GLN B HE22 
3634 N N    . ALA B 102 ? 0.0604 0.0403 0.0587 -0.0034 0.0029  -0.0106 102  ALA B N    
3635 C CA   . ALA B 102 ? 0.0775 0.0421 0.0616 -0.0065 0.0077  -0.0082 102  ALA B CA   
3636 C C    . ALA B 102 ? 0.0666 0.0380 0.0658 -0.0005 0.0064  -0.0036 102  ALA B C    
3637 O O    . ALA B 102 ? 0.0570 0.0456 0.0587 -0.0052 0.0006  -0.0118 102  ALA B O    
3638 C CB   . ALA B 102 ? 0.1097 0.0632 0.0674 -0.0153 -0.0014 -0.0086 102  ALA B CB   
3639 H H    . ALA B 102 ? 0.0638 0.0638 0.0638 0.0000  0.0000  0.0000  102  ALA B H    
3640 H HA   . ALA B 102 ? 0.0724 0.0724 0.0724 0.0000  0.0000  0.0000  102  ALA B HA   
3641 H HB1  . ALA B 102 ? 0.1202 0.1202 0.1202 0.0000  0.0000  0.0000  102  ALA B HB1  
3642 H HB2  . ALA B 102 ? 0.1202 0.1202 0.1202 0.0000  0.0000  0.0000  102  ALA B HB2  
3643 H HB3  . ALA B 102 ? 0.1202 0.1202 0.1202 0.0000  0.0000  0.0000  102  ALA B HB3  
3644 N N    . ASN B 103 ? 0.0816 0.0416 0.0732 -0.0142 0.0202  -0.0142 103  ASN B N    
3645 C CA   . ASN B 103 ? 0.0810 0.0352 0.0765 -0.0094 0.0137  -0.0112 103  ASN B CA   
3646 C C    . ASN B 103 ? 0.0697 0.0458 0.0792 -0.0118 0.0113  -0.0084 103  ASN B C    
3647 O O    . ASN B 103 ? 0.0939 0.0568 0.1056 0.0005  0.0423  0.0001  103  ASN B O    
3648 C CB   . ASN B 103 ? 0.0810 0.0411 0.1022 -0.0041 0.0017  -0.0118 103  ASN B CB   
3649 C CG   . ASN B 103 ? 0.0736 0.0633 0.1009 0.0024  -0.0008 -0.0026 103  ASN B CG   
3650 O OD1  . ASN B 103 ? 0.1169 0.0539 0.1460 0.0090  0.0255  -0.0033 103  ASN B OD1  
3651 N ND2  . ASN B 103 ? 0.0911 0.0652 0.0919 0.0100  -0.0083 -0.0021 103  ASN B ND2  
3652 H H    . ASN B 103 ? 0.0785 0.0785 0.0785 0.0000  0.0000  0.0000  103  ASN B H    
3653 H HA   . ASN B 103 ? 0.0771 0.0771 0.0771 0.0000  0.0000  0.0000  103  ASN B HA   
3654 H HB2  . ASN B 103 ? 0.0897 0.0897 0.0897 0.0000  0.0000  0.0000  103  ASN B HB2  
3655 H HB3  . ASN B 103 ? 0.0897 0.0897 0.0897 0.0000  0.0000  0.0000  103  ASN B HB3  
3656 H HD21 . ASN B 103 ? 0.0993 0.0993 0.0993 0.0000  0.0000  0.0000  103  ASN B HD21 
3657 H HD22 . ASN B 103 ? 0.0993 0.0993 0.0993 0.0000  0.0000  0.0000  103  ASN B HD22 
3658 N N    . LYS B 104 ? 0.0664 0.0467 0.0613 -0.0121 0.0081  -0.0056 104  LYS B N    
3659 C CA   . LYS B 104 ? 0.0830 0.0418 0.0597 -0.0061 0.0025  -0.0061 104  LYS B CA   
3660 C C    . LYS B 104 ? 0.0569 0.0523 0.0540 -0.0076 -0.0012 -0.0055 104  LYS B C    
3661 O O    . LYS B 104 ? 0.0708 0.0637 0.0511 0.0022  0.0041  0.0020  104  LYS B O    
3662 C CB   . LYS B 104 ? 0.1263 0.0620 0.0787 -0.0239 -0.0200 -0.0042 104  LYS B CB   
3663 C CG   . LYS B 104 ? 0.2210 0.0616 0.0766 -0.0270 -0.0202 -0.0151 104  LYS B CG   
3664 C CD   . LYS B 104 ? 0.2315 0.0851 0.1053 -0.0333 0.0317  -0.0154 104  LYS B CD   
3665 C CE   A LYS B 104 ? 0.3086 0.1490 0.1144 -0.0411 0.0302  -0.0562 104  LYS B CE   
3666 C CE   B LYS B 104 ? 0.3042 0.0926 0.1232 0.0434  0.0551  0.0117  104  LYS B CE   
3667 N NZ   A LYS B 104 ? 0.4211 0.4045 0.1996 -0.0119 0.1959  -0.1014 104  LYS B NZ   
3668 N NZ   B LYS B 104 ? 0.5421 0.1698 0.0668 0.1714  -0.0089 -0.0296 104  LYS B NZ   
3669 H H    . LYS B 104 ? 0.0698 0.0698 0.0698 0.0000  0.0000  0.0000  104  LYS B H    
3670 H HA   . LYS B 104 ? 0.0738 0.0738 0.0738 0.0000  0.0000  0.0000  104  LYS B HA   
3671 H HB2  . LYS B 104 ? 0.1068 0.1068 0.1068 0.0000  0.0000  0.0000  104  LYS B HB2  
3672 H HB3  . LYS B 104 ? 0.1068 0.1068 0.1068 0.0000  0.0000  0.0000  104  LYS B HB3  
3673 H HG2  . LYS B 104 ? 0.1436 0.1436 0.1436 0.0000  0.0000  0.0000  104  LYS B HG2  
3674 H HG3  . LYS B 104 ? 0.1436 0.1436 0.1436 0.0000  0.0000  0.0000  104  LYS B HG3  
3675 H HD2  A LYS B 104 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  104  LYS B HD2  
3676 H HD3  A LYS B 104 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  104  LYS B HD3  
3677 H HE2  A LYS B 104 ? 0.2287 0.2287 0.2287 0.0000  0.0000  0.0000  104  LYS B HE2  
3678 H HE2  B LYS B 104 ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  104  LYS B HE2  
3679 H HE3  A LYS B 104 ? 0.2287 0.2287 0.2287 0.0000  0.0000  0.0000  104  LYS B HE3  
3680 H HE3  B LYS B 104 ? 0.2080 0.2080 0.2080 0.0000  0.0000  0.0000  104  LYS B HE3  
3681 H HZ1  A LYS B 104 ? 0.5126 0.5126 0.5126 0.0000  0.0000  0.0000  104  LYS B HZ1  
3682 H HZ1  B LYS B 104 ? 0.3893 0.3893 0.3893 0.0000  0.0000  0.0000  104  LYS B HZ1  
3683 H HZ2  A LYS B 104 ? 0.5126 0.5126 0.5126 0.0000  0.0000  0.0000  104  LYS B HZ2  
3684 H HZ2  B LYS B 104 ? 0.3893 0.3893 0.3893 0.0000  0.0000  0.0000  104  LYS B HZ2  
3685 H HZ3  A LYS B 104 ? 0.5126 0.5126 0.5126 0.0000  0.0000  0.0000  104  LYS B HZ3  
3686 H HZ3  B LYS B 104 ? 0.3893 0.3893 0.3893 0.0000  0.0000  0.0000  104  LYS B HZ3  
3687 N N    . HIS B 105 ? 0.0680 0.0476 0.0598 -0.0046 0.0044  -0.0057 105  HIS B N    
3688 C CA   . HIS B 105 ? 0.0596 0.0491 0.0540 -0.0054 -0.0049 -0.0029 105  HIS B CA   
3689 C C    . HIS B 105 ? 0.0621 0.0633 0.0526 -0.0033 -0.0108 -0.0078 105  HIS B C    
3690 O O    . HIS B 105 ? 0.0696 0.1994 0.0749 -0.0182 -0.0083 -0.0633 105  HIS B O    
3691 C CB   . HIS B 105 ? 0.0685 0.0501 0.0744 -0.0053 -0.0035 -0.0009 105  HIS B CB   
3692 C CG   . HIS B 105 ? 0.0666 0.0554 0.0836 -0.0019 0.0076  0.0032  105  HIS B CG   
3693 N ND1  . HIS B 105 ? 0.0829 0.1152 0.0928 -0.0274 -0.0057 -0.0056 105  HIS B ND1  
3694 C CD2  . HIS B 105 ? 0.0784 0.1213 0.1831 0.0039  0.0329  -0.0420 105  HIS B CD2  
3695 C CE1  . HIS B 105 ? 0.0742 0.0978 0.1523 -0.0109 -0.0082 0.0078  105  HIS B CE1  
3696 N NE2  . HIS B 105 ? 0.0662 0.1150 0.2360 -0.0047 -0.0013 0.0052  105  HIS B NE2  
3697 H H    . HIS B 105 ? 0.0702 0.0702 0.0702 0.0000  0.0000  0.0000  105  HIS B H    
3698 H HA   . HIS B 105 ? 0.0651 0.0651 0.0651 0.0000  0.0000  0.0000  105  HIS B HA   
3699 H HB2  . HIS B 105 ? 0.0773 0.0773 0.0773 0.0000  0.0000  0.0000  105  HIS B HB2  
3700 H HB3  . HIS B 105 ? 0.0773 0.0773 0.0773 0.0000  0.0000  0.0000  105  HIS B HB3  
3701 H HD1  . HIS B 105 ? 0.1164 0.1164 0.1164 0.0000  0.0000  0.0000  105  HIS B HD1  
3702 H HD2  . HIS B 105 ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  105  HIS B HD2  
3703 H HE1  . HIS B 105 ? 0.1297 0.1297 0.1297 0.0000  0.0000  0.0000  105  HIS B HE1  
3704 N N    . ILE B 106 ? 0.0569 0.0418 0.0559 0.0032  -0.0162 -0.0066 106  ILE B N    
3705 C CA   . ILE B 106 ? 0.0589 0.0335 0.0582 0.0016  -0.0162 -0.0033 106  ILE B CA   
3706 C C    . ILE B 106 ? 0.0557 0.0314 0.0523 -0.0008 -0.0072 -0.0002 106  ILE B C    
3707 O O    . ILE B 106 ? 0.0682 0.0321 0.0598 -0.0055 -0.0225 0.0025  106  ILE B O    
3708 C CB   . ILE B 106 ? 0.0621 0.0289 0.0686 -0.0065 -0.0207 0.0092  106  ILE B CB   
3709 C CG1  . ILE B 106 ? 0.0689 0.0459 0.0604 -0.0098 -0.0052 0.0076  106  ILE B CG1  
3710 C CG2  . ILE B 106 ? 0.0742 0.0328 0.0954 0.0050  -0.0231 0.0118  106  ILE B CG2  
3711 C CD1  . ILE B 106 ? 0.0688 0.0729 0.0700 -0.0074 -0.0083 0.0245  106  ILE B CD1  
3712 H H    . ILE B 106 ? 0.0618 0.0618 0.0618 0.0000  0.0000  0.0000  106  ILE B H    
3713 H HA   . ILE B 106 ? 0.0602 0.0602 0.0602 0.0000  0.0000  0.0000  106  ILE B HA   
3714 H HB   . ILE B 106 ? 0.0638 0.0638 0.0638 0.0000  0.0000  0.0000  106  ILE B HB   
3715 H HG12 . ILE B 106 ? 0.0700 0.0700 0.0700 0.0000  0.0000  0.0000  106  ILE B HG12 
3716 H HG13 . ILE B 106 ? 0.0700 0.0700 0.0700 0.0000  0.0000  0.0000  106  ILE B HG13 
3717 H HG21 . ILE B 106 ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  106  ILE B HG21 
3718 H HG22 . ILE B 106 ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  106  ILE B HG22 
3719 H HG23 . ILE B 106 ? 0.1012 0.1012 0.1012 0.0000  0.0000  0.0000  106  ILE B HG23 
3720 H HD11 . ILE B 106 ? 0.1059 0.1059 0.1059 0.0000  0.0000  0.0000  106  ILE B HD11 
3721 H HD12 . ILE B 106 ? 0.1059 0.1059 0.1059 0.0000  0.0000  0.0000  106  ILE B HD12 
3722 H HD13 . ILE B 106 ? 0.1059 0.1059 0.1059 0.0000  0.0000  0.0000  106  ILE B HD13 
3723 N N    . ILE B 107 ? 0.0590 0.0318 0.0553 -0.0012 -0.0181 -0.0020 107  ILE B N    
3724 C CA   . ILE B 107 ? 0.0588 0.0369 0.0478 -0.0037 -0.0187 0.0058  107  ILE B CA   
3725 C C    . ILE B 107 ? 0.0651 0.0358 0.0492 -0.0010 -0.0187 0.0099  107  ILE B C    
3726 O O    . ILE B 107 ? 0.0644 0.0391 0.0610 -0.0086 -0.0198 -0.0001 107  ILE B O    
3727 C CB   . ILE B 107 ? 0.0719 0.0445 0.0475 -0.0117 -0.0155 0.0012  107  ILE B CB   
3728 C CG1  A ILE B 107 ? 0.0728 0.0614 0.0573 -0.0104 -0.0132 0.0023  107  ILE B CG1  
3729 C CG1  B ILE B 107 ? 0.0850 0.0389 0.0571 -0.0137 0.0189  -0.0046 107  ILE B CG1  
3730 C CG2  . ILE B 107 ? 0.0946 0.0493 0.0554 -0.0053 -0.0244 0.0140  107  ILE B CG2  
3731 C CD1  A ILE B 107 ? 0.0742 0.1379 0.0586 -0.0101 0.0024  -0.0012 107  ILE B CD1  
3732 C CD1  B ILE B 107 ? 0.0974 0.0622 0.0938 0.0051  -0.0017 0.0070  107  ILE B CD1  
3733 H H    . ILE B 107 ? 0.0585 0.0585 0.0585 0.0000  0.0000  0.0000  107  ILE B H    
3734 H HA   . ILE B 107 ? 0.0574 0.0574 0.0574 0.0000  0.0000  0.0000  107  ILE B HA   
3735 H HB   A ILE B 107 ? 0.0655 0.0655 0.0655 0.0000  0.0000  0.0000  107  ILE B HB   
3736 H HG12 A ILE B 107 ? 0.0766 0.0766 0.0766 0.0000  0.0000  0.0000  107  ILE B HG12 
3737 H HG12 B ILE B 107 ? 0.0723 0.0723 0.0723 0.0000  0.0000  0.0000  107  ILE B HG12 
3738 H HG13 A ILE B 107 ? 0.0766 0.0766 0.0766 0.0000  0.0000  0.0000  107  ILE B HG13 
3739 H HG13 B ILE B 107 ? 0.0723 0.0723 0.0723 0.0000  0.0000  0.0000  107  ILE B HG13 
3740 H HG21 . ILE B 107 ? 0.0997 0.0997 0.0997 0.0000  0.0000  0.0000  107  ILE B HG21 
3741 H HG22 . ILE B 107 ? 0.0997 0.0997 0.0997 0.0000  0.0000  0.0000  107  ILE B HG22 
3742 H HG23 . ILE B 107 ? 0.0997 0.0997 0.0997 0.0000  0.0000  0.0000  107  ILE B HG23 
3743 H HD11 A ILE B 107 ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  107  ILE B HD11 
3744 H HD11 B ILE B 107 ? 0.1267 0.1267 0.1267 0.0000  0.0000  0.0000  107  ILE B HD11 
3745 H HD12 A ILE B 107 ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  107  ILE B HD12 
3746 H HD12 B ILE B 107 ? 0.1267 0.1267 0.1267 0.0000  0.0000  0.0000  107  ILE B HD12 
3747 H HD13 A ILE B 107 ? 0.1354 0.1354 0.1354 0.0000  0.0000  0.0000  107  ILE B HD13 
3748 H HD13 B ILE B 107 ? 0.1267 0.1267 0.1267 0.0000  0.0000  0.0000  107  ILE B HD13 
3749 N N    . VAL B 108 ? 0.0612 0.0368 0.0606 -0.0040 -0.0124 0.0022  108  VAL B N    
3750 C CA   . VAL B 108 ? 0.0577 0.0378 0.0683 -0.0039 -0.0125 0.0030  108  VAL B CA   
3751 C C    . VAL B 108 ? 0.0565 0.0393 0.0662 -0.0062 -0.0144 0.0024  108  VAL B C    
3752 O O    . VAL B 108 ? 0.0624 0.0407 0.0921 -0.0061 -0.0208 0.0134  108  VAL B O    
3753 C CB   . VAL B 108 ? 0.0604 0.0563 0.0718 0.0034  -0.0074 0.0138  108  VAL B CB   
3754 C CG1  . VAL B 108 ? 0.0852 0.0605 0.0961 -0.0046 -0.0179 0.0260  108  VAL B CG1  
3755 C CG2  . VAL B 108 ? 0.0758 0.0719 0.0691 0.0101  -0.0045 0.0022  108  VAL B CG2  
3756 H H    . VAL B 108 ? 0.0635 0.0635 0.0635 0.0000  0.0000  0.0000  108  VAL B H    
3757 H HA   . VAL B 108 ? 0.0655 0.0655 0.0655 0.0000  0.0000  0.0000  108  VAL B HA   
3758 H HB   . VAL B 108 ? 0.0754 0.0754 0.0754 0.0000  0.0000  0.0000  108  VAL B HB   
3759 H HG11 . VAL B 108 ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  108  VAL B HG11 
3760 H HG12 . VAL B 108 ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  108  VAL B HG12 
3761 H HG13 . VAL B 108 ? 0.1208 0.1208 0.1208 0.0000  0.0000  0.0000  108  VAL B HG13 
3762 H HG21 . VAL B 108 ? 0.1083 0.1083 0.1083 0.0000  0.0000  0.0000  108  VAL B HG21 
3763 H HG22 . VAL B 108 ? 0.1083 0.1083 0.1083 0.0000  0.0000  0.0000  108  VAL B HG22 
3764 H HG23 . VAL B 108 ? 0.1083 0.1083 0.1083 0.0000  0.0000  0.0000  108  VAL B HG23 
3765 N N    . ALA B 109 ? 0.0634 0.0388 0.0708 -0.0004 -0.0224 0.0050  109  ALA B N    
3766 C CA   . ALA B 109 ? 0.0581 0.0554 0.0701 0.0017  -0.0194 0.0035  109  ALA B CA   
3767 C C    . ALA B 109 ? 0.0611 0.0429 0.0728 0.0010  -0.0221 0.0109  109  ALA B C    
3768 O O    . ALA B 109 ? 0.0744 0.0497 0.0808 -0.0022 -0.0043 0.0103  109  ALA B O    
3769 C CB   . ALA B 109 ? 0.0694 0.1039 0.0798 -0.0015 -0.0312 0.0004  109  ALA B CB   
3770 H H    . ALA B 109 ? 0.0692 0.0692 0.0692 0.0000  0.0000  0.0000  109  ALA B H    
3771 H HA   . ALA B 109 ? 0.0735 0.0735 0.0735 0.0000  0.0000  0.0000  109  ALA B HA   
3772 H HB1  . ALA B 109 ? 0.1265 0.1265 0.1265 0.0000  0.0000  0.0000  109  ALA B HB1  
3773 H HB2  . ALA B 109 ? 0.1265 0.1265 0.1265 0.0000  0.0000  0.0000  109  ALA B HB2  
3774 H HB3  . ALA B 109 ? 0.1265 0.1265 0.1265 0.0000  0.0000  0.0000  109  ALA B HB3  
3775 N N    . CYS B 110 ? 0.0657 0.0553 0.0740 0.0069  -0.0119 0.0124  110  CYS B N    
3776 C CA   . CYS B 110 ? 0.0656 0.0468 0.0806 0.0066  -0.0185 0.0008  110  CYS B CA   
3777 C C    . CYS B 110 ? 0.0736 0.0588 0.0894 0.0175  -0.0166 0.0129  110  CYS B C    
3778 O O    . CYS B 110 ? 0.1217 0.0983 0.1029 0.0549  0.0010  0.0323  110  CYS B O    
3779 C CB   . CYS B 110 ? 0.0650 0.0454 0.0969 0.0026  -0.0151 0.0036  110  CYS B CB   
3780 S SG   . CYS B 110 ? 0.0565 0.0489 0.0898 -0.0021 -0.0191 -0.0020 110  CYS B SG   
3781 H H    . CYS B 110 ? 0.0780 0.0780 0.0780 0.0000  0.0000  0.0000  110  CYS B H    
3782 H HA   . CYS B 110 ? 0.0773 0.0773 0.0773 0.0000  0.0000  0.0000  110  CYS B HA   
3783 H HB2  . CYS B 110 ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  110  CYS B HB2  
3784 H HB3  . CYS B 110 ? 0.0828 0.0828 0.0828 0.0000  0.0000  0.0000  110  CYS B HB3  
3785 N N    . GLU B 111 ? 0.0763 0.0681 0.0934 0.0234  -0.0140 0.0013  111  GLU B N    
3786 C CA   . GLU B 111 ? 0.0947 0.1053 0.1032 0.0555  -0.0103 0.0147  111  GLU B CA   
3787 C C    . GLU B 111 ? 0.0881 0.0879 0.1169 0.0306  -0.0186 -0.0103 111  GLU B C    
3788 O O    . GLU B 111 ? 0.0918 0.0977 0.1167 0.0275  -0.0059 -0.0164 111  GLU B O    
3789 C CB   . GLU B 111 ? 0.1096 0.2421 0.1283 0.0849  -0.0304 -0.0189 111  GLU B CB   
3790 C CG   . GLU B 111 ? 0.2813 0.3212 0.3094 0.1501  -0.1984 -0.1547 111  GLU B CG   
3791 C CD   . GLU B 111 ? 0.4230 0.4230 0.4230 0.0000  0.0000  0.0000  111  GLU B CD   
3792 O OE1  . GLU B 111 ? 0.5241 0.5241 0.5241 0.0000  0.0000  0.0000  111  GLU B OE1  
3793 O OE2  . GLU B 111 ? 0.8177 0.8177 0.8177 0.0000  0.0000  0.0000  111  GLU B OE2  
3794 H H    . GLU B 111 ? 0.0951 0.0951 0.0951 0.0000  0.0000  0.0000  111  GLU B H    
3795 H HA   . GLU B 111 ? 0.1212 0.1212 0.1212 0.0000  0.0000  0.0000  111  GLU B HA   
3796 H HB2  . GLU B 111 ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  111  GLU B HB2  
3797 H HB3  . GLU B 111 ? 0.1920 0.1920 0.1920 0.0000  0.0000  0.0000  111  GLU B HB3  
3798 H HG2  . GLU B 111 ? 0.3648 0.3648 0.3648 0.0000  0.0000  0.0000  111  GLU B HG2  
3799 H HG3  . GLU B 111 ? 0.3648 0.3648 0.3648 0.0000  0.0000  0.0000  111  GLU B HG3  
3800 N N    . GLY B 112 ? 0.0928 0.1052 0.1386 0.0364  -0.0016 -0.0148 112  GLY B N    
3801 C CA   . GLY B 112 ? 0.0919 0.1094 0.1366 0.0242  0.0096  -0.0226 112  GLY B CA   
3802 C C    . GLY B 112 ? 0.0947 0.0891 0.1465 0.0065  0.0208  -0.0147 112  GLY B C    
3803 O O    . GLY B 112 ? 0.1122 0.1062 0.1608 0.0159  0.0172  -0.0153 112  GLY B O    
3804 H H    . GLY B 112 ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  112  GLY B H    
3805 H HA2  . GLY B 112 ? 0.1351 0.1351 0.1351 0.0000  0.0000  0.0000  112  GLY B HA2  
3806 H HA3  . GLY B 112 ? 0.1351 0.1351 0.1351 0.0000  0.0000  0.0000  112  GLY B HA3  
3807 N N    . ASN B 113 ? 0.1273 0.1350 0.1888 0.0174  0.0293  -0.0676 113  ASN B N    
3808 C CA   . ASN B 113 ? 0.1460 0.1461 0.1819 -0.0010 0.0210  -0.0530 113  ASN B CA   
3809 C C    . ASN B 113 ? 0.1386 0.1854 0.1824 -0.0396 0.0566  -0.0612 113  ASN B C    
3810 O O    . ASN B 113 ? 0.1508 0.2971 0.1849 -0.0489 0.0513  -0.0996 113  ASN B O    
3811 C CB   . ASN B 113 ? 0.2222 0.1647 0.2310 0.0323  0.0204  -0.1081 113  ASN B CB   
3812 C CG   A ASN B 113 ? 0.2504 0.2504 0.2504 0.0000  0.0000  0.0000  113  ASN B CG   
3813 C CG   B ASN B 113 ? 0.1645 0.1645 0.1645 0.0000  0.0000  0.0000  113  ASN B CG   
3814 O OD1  A ASN B 113 ? 0.2351 0.2351 0.2351 0.0000  0.0000  0.0000  113  ASN B OD1  
3815 O OD1  B ASN B 113 ? 0.2371 0.2371 0.2371 0.0000  0.0000  0.0000  113  ASN B OD1  
3816 N ND2  A ASN B 113 ? 0.3361 0.3361 0.3361 0.0000  0.0000  0.0000  113  ASN B ND2  
3817 N ND2  B ASN B 113 ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  113  ASN B ND2  
3818 H H    . ASN B 113 ? 0.1805 0.1805 0.1805 0.0000  0.0000  0.0000  113  ASN B H    
3819 H HA   . ASN B 113 ? 0.1896 0.1896 0.1896 0.0000  0.0000  0.0000  113  ASN B HA   
3820 H HB2  A ASN B 113 ? 0.2472 0.2472 0.2472 0.0000  0.0000  0.0000  113  ASN B HB2  
3821 H HB3  A ASN B 113 ? 0.2472 0.2472 0.2472 0.0000  0.0000  0.0000  113  ASN B HB3  
3822 H HD21 A ASN B 113 ? 0.4033 0.4033 0.4033 0.0000  0.0000  0.0000  113  ASN B HD21 
3823 H HD21 B ASN B 113 ? 0.2153 0.2153 0.2153 0.0000  0.0000  0.0000  113  ASN B HD21 
3824 H HD22 A ASN B 113 ? 0.4033 0.4033 0.4033 0.0000  0.0000  0.0000  113  ASN B HD22 
3825 H HD22 B ASN B 113 ? 0.2153 0.2153 0.2153 0.0000  0.0000  0.0000  113  ASN B HD22 
3826 N N    . PRO B 114 ? 0.1453 0.1950 0.1306 -0.0432 0.0467  -0.0486 114  PRO B N    
3827 C CA   . PRO B 114 ? 0.1569 0.1768 0.1267 -0.0541 0.0289  -0.0681 114  PRO B CA   
3828 C C    . PRO B 114 ? 0.1272 0.0953 0.1080 -0.0266 0.0208  -0.0305 114  PRO B C    
3829 O O    . PRO B 114 ? 0.1042 0.1122 0.1347 -0.0260 0.0207  -0.0351 114  PRO B O    
3830 C CB   . PRO B 114 ? 0.1549 0.1742 0.1269 -0.0387 0.0141  -0.0387 114  PRO B CB   
3831 C CG   . PRO B 114 ? 0.1555 0.2590 0.2003 -0.0650 0.0354  -0.0110 114  PRO B CG   
3832 C CD   . PRO B 114 ? 0.1819 0.2057 0.1821 -0.0526 0.0323  -0.0248 114  PRO B CD   
3833 H HA   . PRO B 114 ? 0.1842 0.1842 0.1842 0.0000  0.0000  0.0000  114  PRO B HA   
3834 H HB2  . PRO B 114 ? 0.1824 0.1824 0.1824 0.0000  0.0000  0.0000  114  PRO B HB2  
3835 H HB3  . PRO B 114 ? 0.1824 0.1824 0.1824 0.0000  0.0000  0.0000  114  PRO B HB3  
3836 H HG2  . PRO B 114 ? 0.2460 0.2460 0.2460 0.0000  0.0000  0.0000  114  PRO B HG2  
3837 H HG3  . PRO B 114 ? 0.2460 0.2460 0.2460 0.0000  0.0000  0.0000  114  PRO B HG3  
3838 H HD2  . PRO B 114 ? 0.2278 0.2278 0.2278 0.0000  0.0000  0.0000  114  PRO B HD2  
3839 H HD3  . PRO B 114 ? 0.2278 0.2278 0.2278 0.0000  0.0000  0.0000  114  PRO B HD3  
3840 N N    . TYR B 115 ? 0.1051 0.0878 0.1101 -0.0144 0.0120  -0.0347 115  TYR B N    
3841 C CA   . TYR B 115 ? 0.1004 0.0657 0.0974 -0.0029 0.0070  -0.0187 115  TYR B CA   
3842 C C    . TYR B 115 ? 0.0937 0.0621 0.1000 -0.0059 -0.0057 -0.0160 115  TYR B C    
3843 O O    . TYR B 115 ? 0.1047 0.0659 0.1255 -0.0136 -0.0264 -0.0204 115  TYR B O    
3844 C CB   . TYR B 115 ? 0.0970 0.0535 0.1484 -0.0044 0.0066  -0.0267 115  TYR B CB   
3845 C CG   . TYR B 115 ? 0.0927 0.0440 0.1257 -0.0060 0.0009  -0.0117 115  TYR B CG   
3846 C CD1  . TYR B 115 ? 0.0747 0.1000 0.1474 0.0213  -0.0048 0.0005  115  TYR B CD1  
3847 C CD2  . TYR B 115 ? 0.0768 0.0355 0.1222 -0.0017 -0.0260 -0.0044 115  TYR B CD2  
3848 C CE1  . TYR B 115 ? 0.0755 0.1130 0.1390 0.0158  -0.0127 0.0208  115  TYR B CE1  
3849 C CE2  . TYR B 115 ? 0.0739 0.0389 0.1163 -0.0043 -0.0071 -0.0005 115  TYR B CE2  
3850 C CZ   . TYR B 115 ? 0.0723 0.0477 0.1292 0.0067  -0.0236 -0.0041 115  TYR B CZ   
3851 O OH   . TYR B 115 ? 0.0835 0.0703 0.1153 0.0000  -0.0155 0.0121  115  TYR B OH   
3852 H H    . TYR B 115 ? 0.1212 0.1212 0.1212 0.0000  0.0000  0.0000  115  TYR B H    
3853 H HA   . TYR B 115 ? 0.1054 0.1054 0.1054 0.0000  0.0000  0.0000  115  TYR B HA   
3854 H HB2  . TYR B 115 ? 0.1196 0.1196 0.1196 0.0000  0.0000  0.0000  115  TYR B HB2  
3855 H HB3  . TYR B 115 ? 0.1196 0.1196 0.1196 0.0000  0.0000  0.0000  115  TYR B HB3  
3856 H HD1  . TYR B 115 ? 0.1288 0.1288 0.1288 0.0000  0.0000  0.0000  115  TYR B HD1  
3857 H HD2  . TYR B 115 ? 0.0938 0.0938 0.0938 0.0000  0.0000  0.0000  115  TYR B HD2  
3858 H HE1  . TYR B 115 ? 0.1311 0.1311 0.1311 0.0000  0.0000  0.0000  115  TYR B HE1  
3859 H HE2  . TYR B 115 ? 0.0917 0.0917 0.0917 0.0000  0.0000  0.0000  115  TYR B HE2  
3860 H HH   . TYR B 115 ? 0.1346 0.1346 0.1346 0.0000  0.0000  0.0000  115  TYR B HH   
3861 N N    . VAL B 116 ? 0.0699 0.0658 0.0879 -0.0059 -0.0119 -0.0158 116  VAL B N    
3862 C CA   . VAL B 116 ? 0.0796 0.0660 0.0781 -0.0088 -0.0108 -0.0023 116  VAL B CA   
3863 C C    . VAL B 116 ? 0.0529 0.0459 0.0757 -0.0044 -0.0137 0.0016  116  VAL B C    
3864 O O    . VAL B 116 ? 0.0590 0.0558 0.0751 0.0059  -0.0152 0.0055  116  VAL B O    
3865 C CB   . VAL B 116 ? 0.1172 0.0749 0.0800 -0.0341 -0.0043 -0.0050 116  VAL B CB   
3866 C CG1  . VAL B 116 ? 0.1720 0.1422 0.0721 -0.0391 0.0092  -0.0198 116  VAL B CG1  
3867 C CG2  . VAL B 116 ? 0.1491 0.1219 0.1085 -0.0681 0.0372  -0.0312 116  VAL B CG2  
3868 H H    . VAL B 116 ? 0.0894 0.0894 0.0894 0.0000  0.0000  0.0000  116  VAL B H    
3869 H HA   . VAL B 116 ? 0.0895 0.0895 0.0895 0.0000  0.0000  0.0000  116  VAL B HA   
3870 H HB   . VAL B 116 ? 0.1088 0.1088 0.1088 0.0000  0.0000  0.0000  116  VAL B HB   
3871 H HG11 . VAL B 116 ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  116  VAL B HG11 
3872 H HG12 . VAL B 116 ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  116  VAL B HG12 
3873 H HG13 . VAL B 116 ? 0.1931 0.1931 0.1931 0.0000  0.0000  0.0000  116  VAL B HG13 
3874 H HG21 . VAL B 116 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  116  VAL B HG21 
3875 H HG22 . VAL B 116 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  116  VAL B HG22 
3876 H HG23 . VAL B 116 ? 0.1897 0.1897 0.1897 0.0000  0.0000  0.0000  116  VAL B HG23 
3877 N N    . PRO B 117 ? 0.0529 0.0493 0.0789 0.0005  -0.0218 0.0097  117  PRO B N    
3878 C CA   . PRO B 117 ? 0.0500 0.0440 0.0824 -0.0026 -0.0095 0.0065  117  PRO B CA   
3879 C C    . PRO B 117 ? 0.0495 0.0477 0.0875 0.0018  -0.0104 -0.0069 117  PRO B C    
3880 O O    . PRO B 117 ? 0.0574 0.0629 0.0888 -0.0140 -0.0069 -0.0010 117  PRO B O    
3881 C CB   . PRO B 117 ? 0.0539 0.0428 0.1215 0.0033  -0.0150 0.0096  117  PRO B CB   
3882 C CG   . PRO B 117 ? 0.0622 0.0562 0.1281 0.0002  -0.0262 0.0269  117  PRO B CG   
3883 C CD   . PRO B 117 ? 0.0712 0.0578 0.1066 -0.0135 -0.0448 0.0255  117  PRO B CD   
3884 H HA   . PRO B 117 ? 0.0705 0.0705 0.0705 0.0000  0.0000  0.0000  117  PRO B HA   
3885 H HB2  . PRO B 117 ? 0.0873 0.0873 0.0873 0.0000  0.0000  0.0000  117  PRO B HB2  
3886 H HB3  . PRO B 117 ? 0.0873 0.0873 0.0873 0.0000  0.0000  0.0000  117  PRO B HB3  
3887 H HG2  . PRO B 117 ? 0.0985 0.0985 0.0985 0.0000  0.0000  0.0000  117  PRO B HG2  
3888 H HG3  . PRO B 117 ? 0.0985 0.0985 0.0985 0.0000  0.0000  0.0000  117  PRO B HG3  
3889 H HD2  . PRO B 117 ? 0.0942 0.0942 0.0942 0.0000  0.0000  0.0000  117  PRO B HD2  
3890 H HD3  . PRO B 117 ? 0.0942 0.0942 0.0942 0.0000  0.0000  0.0000  117  PRO B HD3  
3891 N N    . VAL B 118 ? 0.0535 0.0523 0.0761 -0.0041 -0.0108 0.0016  118  VAL B N    
3892 C CA   . VAL B 118 ? 0.0583 0.0663 0.0850 -0.0102 -0.0158 -0.0076 118  VAL B CA   
3893 C C    . VAL B 118 ? 0.0640 0.0661 0.0994 -0.0100 -0.0094 -0.0139 118  VAL B C    
3894 O O    . VAL B 118 ? 0.0811 0.1335 0.1489 -0.0484 0.0074  -0.0663 118  VAL B O    
3895 C CB   . VAL B 118 ? 0.0534 0.1003 0.1002 0.0020  -0.0193 -0.0197 118  VAL B CB   
3896 C CG1  . VAL B 118 ? 0.0617 0.0953 0.1256 0.0099  -0.0076 -0.0229 118  VAL B CG1  
3897 C CG2  . VAL B 118 ? 0.0849 0.0889 0.1215 0.0250  -0.0209 0.0053  118  VAL B CG2  
3898 H H    . VAL B 118 ? 0.0728 0.0728 0.0728 0.0000  0.0000  0.0000  118  VAL B H    
3899 H HA   . VAL B 118 ? 0.0838 0.0838 0.0838 0.0000  0.0000  0.0000  118  VAL B HA   
3900 H HB   . VAL B 118 ? 0.1016 0.1016 0.1016 0.0000  0.0000  0.0000  118  VAL B HB   
3901 H HG11 . VAL B 118 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  118  VAL B HG11 
3902 H HG12 . VAL B 118 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  118  VAL B HG12 
3903 H HG13 . VAL B 118 ? 0.1413 0.1413 0.1413 0.0000  0.0000  0.0000  118  VAL B HG13 
3904 H HG21 . VAL B 118 ? 0.1477 0.1477 0.1477 0.0000  0.0000  0.0000  118  VAL B HG21 
3905 H HG22 . VAL B 118 ? 0.1477 0.1477 0.1477 0.0000  0.0000  0.0000  118  VAL B HG22 
3906 H HG23 . VAL B 118 ? 0.1477 0.1477 0.1477 0.0000  0.0000  0.0000  118  VAL B HG23 
3907 N N    . HIS B 119 ? 0.0618 0.0548 0.0783 -0.0019 -0.0229 -0.0055 119  HIS B N    
3908 C CA   . HIS B 119 ? 0.0738 0.0584 0.0747 -0.0114 -0.0150 -0.0065 119  HIS B CA   
3909 C C    . HIS B 119 ? 0.0744 0.0521 0.0623 -0.0065 -0.0119 0.0020  119  HIS B C    
3910 O O    . HIS B 119 ? 0.0692 0.0523 0.0927 -0.0109 -0.0088 -0.0081 119  HIS B O    
3911 C CB   . HIS B 119 ? 0.1104 0.0873 0.0760 -0.0187 -0.0342 0.0018  119  HIS B CB   
3912 C CG   . HIS B 119 ? 0.1087 0.1052 0.1270 -0.0041 -0.0415 -0.0127 119  HIS B CG   
3913 N ND1  . HIS B 119 ? 0.1202 0.1601 0.1973 -0.0125 -0.0654 0.0348  119  HIS B ND1  
3914 C CD2  . HIS B 119 ? 0.1595 0.1139 0.2378 0.0094  -0.1133 0.0473  119  HIS B CD2  
3915 C CE1  . HIS B 119 ? 0.0973 0.1831 0.2942 0.0053  -0.0921 0.0286  119  HIS B CE1  
3916 N NE2  . HIS B 119 ? 0.1610 0.1368 0.3250 0.0173  -0.1309 -0.0028 119  HIS B NE2  
3917 H H    . HIS B 119 ? 0.0779 0.0779 0.0779 0.0000  0.0000  0.0000  119  HIS B H    
3918 H HA   . HIS B 119 ? 0.0827 0.0827 0.0827 0.0000  0.0000  0.0000  119  HIS B HA   
3919 H HB2  . HIS B 119 ? 0.1094 0.1094 0.1094 0.0000  0.0000  0.0000  119  HIS B HB2  
3920 H HB3  . HIS B 119 ? 0.1094 0.1094 0.1094 0.0000  0.0000  0.0000  119  HIS B HB3  
3921 H HD1  . HIS B 119 ? 0.1910 0.1910 0.1910 0.0000  0.0000  0.0000  119  HIS B HD1  
3922 H HD2  . HIS B 119 ? 0.2045 0.2045 0.2045 0.0000  0.0000  0.0000  119  HIS B HD2  
3923 H HE1  . HIS B 119 ? 0.2299 0.2299 0.2299 0.0000  0.0000  0.0000  119  HIS B HE1  
3924 N N    . PHE B 120 ? 0.0720 0.0434 0.0754 -0.0117 -0.0142 -0.0021 120  PHE B N    
3925 C CA   . PHE B 120 ? 0.0668 0.0450 0.0619 -0.0103 -0.0106 -0.0033 120  PHE B CA   
3926 C C    . PHE B 120 ? 0.0747 0.0397 0.0696 -0.0114 -0.0167 0.0035  120  PHE B C    
3927 O O    . PHE B 120 ? 0.1025 0.0550 0.0707 -0.0272 -0.0274 -0.0063 120  PHE B O    
3928 C CB   . PHE B 120 ? 0.0779 0.0465 0.0710 -0.0162 -0.0116 0.0029  120  PHE B CB   
3929 C CG   . PHE B 120 ? 0.0797 0.0363 0.0632 -0.0130 -0.0095 0.0033  120  PHE B CG   
3930 C CD1  . PHE B 120 ? 0.0885 0.0503 0.0675 -0.0058 -0.0115 0.0023  120  PHE B CD1  
3931 C CD2  . PHE B 120 ? 0.0920 0.0515 0.0643 -0.0108 -0.0140 0.0128  120  PHE B CD2  
3932 C CE1  . PHE B 120 ? 0.0918 0.0528 0.0813 -0.0008 0.0051  0.0123  120  PHE B CE1  
3933 C CE2  . PHE B 120 ? 0.0924 0.0653 0.0844 -0.0201 -0.0265 0.0257  120  PHE B CE2  
3934 C CZ   . PHE B 120 ? 0.0822 0.0572 0.0964 -0.0091 -0.0138 0.0273  120  PHE B CZ   
3935 H H    . PHE B 120 ? 0.0762 0.0762 0.0762 0.0000  0.0000  0.0000  120  PHE B H    
3936 H HA   . PHE B 120 ? 0.0695 0.0695 0.0695 0.0000  0.0000  0.0000  120  PHE B HA   
3937 H HB2  . PHE B 120 ? 0.0781 0.0781 0.0781 0.0000  0.0000  0.0000  120  PHE B HB2  
3938 H HB3  . PHE B 120 ? 0.0781 0.0781 0.0781 0.0000  0.0000  0.0000  120  PHE B HB3  
3939 H HD1  . PHE B 120 ? 0.0825 0.0825 0.0825 0.0000  0.0000  0.0000  120  PHE B HD1  
3940 H HD2  . PHE B 120 ? 0.0831 0.0831 0.0831 0.0000  0.0000  0.0000  120  PHE B HD2  
3941 H HE1  . PHE B 120 ? 0.0904 0.0904 0.0904 0.0000  0.0000  0.0000  120  PHE B HE1  
3942 H HE2  . PHE B 120 ? 0.0969 0.0969 0.0969 0.0000  0.0000  0.0000  120  PHE B HE2  
3943 H HZ   . PHE B 120 ? 0.0944 0.0944 0.0944 0.0000  0.0000  0.0000  120  PHE B HZ   
3944 N N    . ASP B 121 ? 0.0657 0.0475 0.0561 -0.0102 -0.0237 0.0068  121  ASP B N    
3945 C CA   . ASP B 121 ? 0.0690 0.0542 0.0564 -0.0094 -0.0289 0.0079  121  ASP B CA   
3946 C C    . ASP B 121 ? 0.1016 0.0580 0.0466 -0.0148 -0.0285 0.0000  121  ASP B C    
3947 O O    . ASP B 121 ? 0.0974 0.0993 0.0650 0.0068  -0.0301 -0.0151 121  ASP B O    
3948 C CB   . ASP B 121 ? 0.0888 0.0474 0.0609 -0.0130 -0.0330 0.0115  121  ASP B CB   
3949 C CG   . ASP B 121 ? 0.0881 0.0581 0.0523 -0.0066 -0.0311 0.0058  121  ASP B CG   
3950 O OD1  . ASP B 121 ? 0.0796 0.0910 0.0613 -0.0125 -0.0334 0.0160  121  ASP B OD1  
3951 O OD2  . ASP B 121 ? 0.0824 0.0862 0.0656 -0.0189 -0.0265 0.0229  121  ASP B OD2  
3952 H H    . ASP B 121 ? 0.0678 0.0678 0.0678 0.0000  0.0000  0.0000  121  ASP B H    
3953 H HA   . ASP B 121 ? 0.0718 0.0718 0.0718 0.0000  0.0000  0.0000  121  ASP B HA   
3954 H HB2  . ASP B 121 ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  121  ASP B HB2  
3955 H HB3  . ASP B 121 ? 0.0788 0.0788 0.0788 0.0000  0.0000  0.0000  121  ASP B HB3  
3956 N N    . ALA B 122 ? 0.0766 0.0577 0.0508 -0.0084 -0.0189 0.0002  122  ALA B N    
3957 C CA   . ALA B 122 ? 0.0864 0.0897 0.0541 -0.0161 -0.0140 -0.0066 122  ALA B CA   
3958 C C    . ALA B 122 ? 0.0716 0.0626 0.0601 -0.0069 -0.0082 -0.0114 122  ALA B C    
3959 O O    . ALA B 122 ? 0.0781 0.0492 0.0524 -0.0049 -0.0125 -0.0048 122  ALA B O    
3960 C CB   . ALA B 122 ? 0.1161 0.1251 0.0637 -0.0141 -0.0081 0.0215  122  ALA B CB   
3961 H H    . ALA B 122 ? 0.0740 0.0740 0.0740 0.0000  0.0000  0.0000  122  ALA B H    
3962 H HA   . ALA B 122 ? 0.0921 0.0921 0.0921 0.0000  0.0000  0.0000  122  ALA B HA   
3963 H HB1  . ALA B 122 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  122  ALA B HB1  
3964 H HB2  . ALA B 122 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  122  ALA B HB2  
3965 H HB3  . ALA B 122 ? 0.1525 0.1525 0.1525 0.0000  0.0000  0.0000  122  ALA B HB3  
3966 N N    . SER B 123 ? 0.0820 0.1503 0.0725 0.0186  -0.0164 -0.0522 123  SER B N    
3967 C CA   . SER B 123 ? 0.0821 0.1175 0.0637 0.0042  -0.0057 -0.0283 123  SER B CA   
3968 C C    . SER B 123 ? 0.0785 0.1164 0.0737 0.0051  0.0000  -0.0232 123  SER B C    
3969 O O    . SER B 123 ? 0.1228 0.2160 0.0708 -0.0102 -0.0011 -0.0417 123  SER B O    
3970 C CB   . SER B 123 ? 0.0939 0.1422 0.1073 -0.0078 -0.0010 -0.0111 123  SER B CB   
3971 O OG   . SER B 123 ? 0.1186 0.0960 0.2313 0.0018  -0.0360 -0.0179 123  SER B OG   
3972 H H    . SER B 123 ? 0.1220 0.1220 0.1220 0.0000  0.0000  0.0000  123  SER B H    
3973 H HA   . SER B 123 ? 0.1054 0.1054 0.1054 0.0000  0.0000  0.0000  123  SER B HA   
3974 H HB2  . SER B 123 ? 0.1373 0.1373 0.1373 0.0000  0.0000  0.0000  123  SER B HB2  
3975 H HB3  . SER B 123 ? 0.1373 0.1373 0.1373 0.0000  0.0000  0.0000  123  SER B HB3  
3976 H HG   . SER B 123 ? 0.2229 0.2229 0.2229 0.0000  0.0000  0.0000  123  SER B HG   
3977 N N    . VAL B 124 ? 0.0837 0.1116 0.0657 0.0075  -0.0046 -0.0168 124  VAL B N    
3978 C CA   . VAL B 124 ? 0.0919 0.0989 0.0709 -0.0056 0.0056  -0.0035 124  VAL B CA   
3979 C C    . VAL B 124 ? 0.0817 0.1059 0.0749 0.0005  0.0126  0.0086  124  VAL B C    
3980 O O    . VAL B 124 ? 0.0947 0.1464 0.0938 0.0085  0.0222  0.0035  124  VAL B O    
3981 C CB   . VAL B 124 ? 0.1798 0.1082 0.0977 0.0223  -0.0010 0.0214  124  VAL B CB   
3982 C CG1  . VAL B 124 ? 0.4083 0.3665 0.1677 0.0816  -0.1125 0.0644  124  VAL B CG1  
3983 C CG2  . VAL B 124 ? 0.1955 0.1075 0.1297 -0.0073 0.0200  -0.0023 124  VAL B CG2  
3984 O OXT  . VAL B 124 ? 0.0898 0.1593 0.0726 -0.0075 0.0073  0.0220  124  VAL B OXT  
3985 H H    . VAL B 124 ? 0.1044 0.1044 0.1044 0.0000  0.0000  0.0000  124  VAL B H    
3986 H HA   . VAL B 124 ? 0.1046 0.1046 0.1046 0.0000  0.0000  0.0000  124  VAL B HA   
3987 H HB   . VAL B 124 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  124  VAL B HB   
3988 H HG11 . VAL B 124 ? 0.4713 0.4713 0.4713 0.0000  0.0000  0.0000  124  VAL B HG11 
3989 H HG12 . VAL B 124 ? 0.4713 0.4713 0.4713 0.0000  0.0000  0.0000  124  VAL B HG12 
3990 H HG13 . VAL B 124 ? 0.4713 0.4713 0.4713 0.0000  0.0000  0.0000  124  VAL B HG13 
3991 H HG21 . VAL B 124 ? 0.2163 0.2163 0.2163 0.0000  0.0000  0.0000  124  VAL B HG21 
3992 H HG22 . VAL B 124 ? 0.2163 0.2163 0.2163 0.0000  0.0000  0.0000  124  VAL B HG22 
3993 H HG23 . VAL B 124 ? 0.2163 0.2163 0.2163 0.0000  0.0000  0.0000  124  VAL B HG23 
3994 S S    . SO4 C .   ? 0.0707 0.1361 0.1338 -0.0323 -0.0450 0.0583  125  SO4 A S    
3995 O O1   . SO4 C .   ? 0.3295 0.2670 0.1557 0.1150  -0.1223 0.0079  125  SO4 A O1   
3996 O O2   . SO4 C .   ? 0.0497 0.1046 0.3642 -0.0077 -0.0143 -0.0598 125  SO4 A O2   
3997 O O3   . SO4 C .   ? 0.1525 0.1546 0.1477 -0.0530 0.0184  -0.0029 125  SO4 A O3   
3998 O O4   . SO4 C .   ? 0.1267 0.1359 0.1929 -0.0822 -0.0828 0.0838  125  SO4 A O4   
3999 C C    . ACT D .   ? 0.1415 0.1193 0.1672 0.0182  -0.0371 -0.0051 600  ACT A C    
4000 O O    . ACT D .   ? 0.1077 0.0402 0.0875 0.0146  -0.0160 0.0225  600  ACT A O    
4001 O OXT  . ACT D .   ? 0.1451 0.2675 0.1118 0.0637  -0.0210 0.0468  600  ACT A OXT  
4002 C CH3  . ACT D .   ? 0.1436 0.2847 0.1780 -0.0325 -0.0448 0.1267  600  ACT A CH3  
4003 C C1   . IPA E .   ? 0.5539 0.1608 0.1189 0.0721  -0.0448 0.0233  800  IPA A C1   
4004 C C2   . IPA E .   ? 0.6868 0.1291 0.1925 0.0703  0.0484  0.0537  800  IPA A C2   
4005 C C3   . IPA E .   ? 0.6961 0.1478 0.1374 -0.0535 0.0968  -0.0107 800  IPA A C3   
4006 O O2   . IPA E .   ? 1.0244 0.2103 0.2114 0.1028  -0.0579 -0.0300 800  IPA A O2   
4007 C C1   . IPA F .   ? 0.2654 0.5539 0.2228 -0.0441 -0.1828 0.0920  801  IPA A C1   
4008 C C2   . IPA F .   ? 0.2351 0.1487 0.2282 -0.0920 0.0248  -0.0168 801  IPA A C2   
4009 C C3   . IPA F .   ? 0.3120 0.2295 0.5737 0.0959  -0.0083 0.2001  801  IPA A C3   
4010 O O2   . IPA F .   ? 0.1501 0.1162 0.1933 0.0079  -0.0634 -0.0193 801  IPA A O2   
4011 C C1   . IPA G .   ? 0.4286 0.1137 0.2772 0.0619  -0.1958 -0.0012 802  IPA A C1   
4012 C C2   . IPA G .   ? 0.2295 0.1138 0.2623 0.0621  -0.0679 -0.0259 802  IPA A C2   
4013 C C3   . IPA G .   ? 0.2975 0.1612 0.2193 0.0749  0.0127  0.0461  802  IPA A C3   
4014 O O2   . IPA G .   ? 0.3779 0.0734 0.3132 0.0063  -0.1955 0.0240  802  IPA A O2   
4015 C C1   . IPA H .   ? 0.2939 0.0835 0.1214 0.0106  0.0212  0.0108  803  IPA A C1   
4016 C C2   . IPA H .   ? 0.1334 0.1713 0.1996 -0.0283 -0.0256 0.0494  803  IPA A C2   
4017 C C3   . IPA H .   ? 0.2004 0.1417 0.2094 -0.0366 -0.0846 0.0668  803  IPA A C3   
4018 O O2   . IPA H .   ? 0.1892 0.1241 0.2718 0.0016  -0.0680 -0.0030 803  IPA A O2   
4019 S S    . SO4 I .   ? 0.0723 0.0731 0.0693 -0.0151 -0.0314 0.0109  125  SO4 B S    
4020 O O1   . SO4 I .   ? 0.1723 0.0994 0.0619 -0.0146 -0.0232 0.0159  125  SO4 B O1   
4021 O O2   . SO4 I .   ? 0.1024 0.0664 0.1424 0.0151  -0.0570 -0.0071 125  SO4 B O2   
4022 O O3   . SO4 I .   ? 0.1227 0.0832 0.0937 0.0047  -0.0253 0.0106  125  SO4 B O3   
4023 O O4   . SO4 I .   ? 0.1197 0.0647 0.2322 -0.0120 0.0303  -0.0181 125  SO4 B O4   
4024 S S    . SO4 J .   ? 0.1190 0.0610 0.0907 0.0016  0.0189  0.0063  126  SO4 B S    
4025 O O1   . SO4 J .   ? 0.1812 0.0648 0.0778 0.0125  0.0089  0.0242  126  SO4 B O1   
4026 O O2   . SO4 J .   ? 0.1518 0.0700 0.2282 0.0072  0.0854  0.0140  126  SO4 B O2   
4027 O O3   . SO4 J .   ? 0.0788 0.0617 0.0800 -0.0024 -0.0214 -0.0084 126  SO4 B O3   
4028 O O4   . SO4 J .   ? 0.1201 0.0722 0.0891 -0.0061 0.0146  0.0055  126  SO4 B O4   
4029 C C    . ACT K .   ? 0.1066 0.0419 0.0562 -0.0029 -0.0239 0.0062  600  ACT B C    
4030 O O    . ACT K .   ? 0.1345 0.0555 0.0561 -0.0050 -0.0316 0.0099  600  ACT B O    
4031 O OXT  . ACT K .   ? 0.1128 0.0614 0.0500 0.0185  -0.0309 0.0076  600  ACT B OXT  
4032 C CH3  . ACT K .   ? 0.1118 0.1138 0.0862 0.0224  -0.0167 0.0516  600  ACT B CH3  
4033 C C    . ACT L .   ? 0.1503 0.1932 0.1202 0.0632  -0.0210 0.0123  601  ACT B C    
4034 O O    . ACT L .   ? 0.1445 0.1858 0.1536 0.0545  -0.0165 -0.0142 601  ACT B O    
4035 O OXT  . ACT L .   ? 0.2086 0.2274 0.1863 0.0830  -0.0747 -0.0493 601  ACT B OXT  
4036 C CH3  . ACT L .   ? 0.1856 0.1221 0.1787 0.0449  0.0180  0.0013  601  ACT B CH3  
4037 C C    . ACT M .   ? 0.1679 0.5809 0.2151 0.1357  -0.0713 -0.1132 602  ACT B C    
4038 O O    . ACT M .   ? 0.3213 0.2949 0.1615 0.1141  0.0453  0.0148  602  ACT B O    
4039 O OXT  . ACT M .   ? 0.3068 0.6192 0.2677 -0.2332 0.0692  -0.1895 602  ACT B OXT  
4040 C CH3  . ACT M .   ? 0.2696 0.4911 0.6837 0.1671  -0.2164 -0.3727 602  ACT B CH3  
4041 C C1   . IPA N .   ? 0.6470 0.1567 0.2301 0.1175  -0.0708 -0.0139 800  IPA B C1   
4042 C C2   . IPA N .   ? 0.4939 0.1044 0.2536 0.0383  0.0851  0.0104  800  IPA B C2   
4043 C C3   . IPA N .   ? 0.6523 0.1080 0.1293 0.0846  -0.0372 0.0039  800  IPA B C3   
4044 O O2   . IPA N .   ? 0.6930 0.3674 0.1879 -0.0655 0.0889  0.0626  800  IPA B O2   
4045 C C1   . IPA O .   ? 0.1770 0.0655 0.1373 0.0027  0.0049  0.0038  801  IPA B C1   
4046 C C2   . IPA O .   ? 0.1466 0.1772 0.1237 0.0183  -0.0086 -0.0224 801  IPA B C2   
4047 C C3   . IPA O .   ? 0.1721 0.0971 0.1541 0.0315  -0.0357 -0.0078 801  IPA B C3   
4048 O O2   . IPA O .   ? 0.1599 0.1046 0.2278 0.0062  -0.0609 0.0058  801  IPA B O2   
4049 C C1   . IPA P .   ? 0.2456 0.1889 0.3166 -0.0128 -0.1491 -0.0816 804  IPA B C1   
4050 C C2   . IPA P .   ? 0.1283 0.2785 0.1731 0.0512  -0.0671 -0.0114 804  IPA B C2   
4051 C C3   . IPA P .   ? 0.2204 0.2594 0.1289 -0.0258 -0.0723 -0.0044 804  IPA B C3   
4052 O O2   . IPA P .   ? 0.2282 0.2663 0.1375 0.0372  -0.0184 0.0465  804  IPA B O2   
4053 C C1   . IPA Q .   ? 0.3908 0.2098 0.5344 0.1556  -0.1766 -0.1255 805  IPA B C1   
4054 C C2   . IPA Q .   ? 0.3842 0.4185 0.4299 0.2747  -0.0987 -0.1524 805  IPA B C2   
4055 C C3   . IPA Q .   ? 0.1432 0.0793 0.6780 -0.0183 -0.0591 0.0037  805  IPA B C3   
4056 O O2   . IPA Q .   ? 0.5661 0.2418 0.3548 0.0966  0.0063  -0.0656 805  IPA B O2   
4057 O O    . HOH R .   ? 0.2315 0.2009 0.5734 -0.0487 -0.2064 0.1106  2001 HOH A O    
4058 O O    . HOH R .   ? 0.7106 0.4535 0.6474 -0.0612 -0.5025 0.0510  2002 HOH A O    
4059 O O    . HOH R .   ? 0.1610 0.2920 0.2554 -0.0320 0.0468  -0.1267 2003 HOH A O    
4060 O O    . HOH R .   ? 0.3473 0.4663 0.4303 -0.1229 0.0197  0.1590  2004 HOH A O    
4061 O O    . HOH R .   ? 0.3851 0.2942 0.4516 0.0229  -0.2355 0.0068  2005 HOH A O    
4062 O O    . HOH R .   ? 0.1722 0.2776 0.1766 0.0349  0.0028  -0.0370 2006 HOH A O    
4063 O O    . HOH R .   ? 0.5349 0.4768 0.3071 0.0224  -0.1178 0.0370  2007 HOH A O    
4064 O O    . HOH R .   ? 0.0876 0.0718 0.1564 0.0179  -0.0035 -0.0032 2008 HOH A O    
4065 O O    . HOH R .   ? 0.3777 0.6286 0.1764 0.2798  -0.0229 -0.0918 2009 HOH A O    
4066 O O    . HOH R .   ? 0.1769 0.5417 0.4106 0.1279  -0.0637 0.0952  2010 HOH A O    
4067 O O    . HOH R .   ? 0.1771 0.1527 0.1070 0.0085  -0.0065 -0.0278 2011 HOH A O    
4068 O O    . HOH R .   ? 0.2539 0.2382 0.2136 -0.0402 0.0423  -0.0424 2012 HOH A O    
4069 O O    . HOH R .   ? 0.1842 0.3263 0.2116 -0.0112 -0.0397 -0.1203 2013 HOH A O    
4070 O O    . HOH R .   ? 0.2483 0.3562 0.4217 -0.0518 0.1046  0.0306  2014 HOH A O    
4071 O O    . HOH R .   ? 0.3082 0.1649 0.3358 0.1515  0.1539  0.0988  2015 HOH A O    
4072 O O    . HOH R .   ? 0.1331 0.0867 0.2633 -0.0023 0.0308  -0.0388 2016 HOH A O    
4073 O O    . HOH R .   ? 0.4360 0.5103 0.5358 0.0871  -0.1058 -0.0471 2017 HOH A O    
4074 O O    . HOH R .   ? 0.2561 0.3442 0.1785 0.0101  -0.0109 0.0113  2018 HOH A O    
4075 O O    . HOH R .   ? 0.3200 0.3592 0.2905 0.0484  -0.1475 -0.0079 2019 HOH A O    
4076 O O    . HOH R .   ? 0.2004 0.1962 0.1216 0.0701  -0.0245 -0.0361 2020 HOH A O    
4077 O O    . HOH R .   ? 0.2570 0.2920 0.1599 -0.0317 0.0538  -0.0163 2021 HOH A O    
4078 O O    . HOH R .   ? 0.3068 0.4114 0.1859 -0.1855 0.0139  -0.0379 2022 HOH A O    
4079 O O    . HOH R .   ? 0.2530 0.4751 0.5712 -0.1560 0.0517  0.1766  2023 HOH A O    
4080 O O    . HOH R .   ? 0.3553 0.3404 0.3319 0.0125  -0.0099 0.0093  2024 HOH A O    
4081 O O    . HOH R .   ? 0.2828 0.2703 0.2622 0.0149  0.0058  0.0041  2025 HOH A O    
4082 O O    . HOH R .   ? 0.1625 0.1715 0.2361 0.0196  0.0426  0.0278  2026 HOH A O    
4083 O O    . HOH R .   ? 0.2571 0.3400 0.4182 0.0189  -0.2026 -0.0629 2027 HOH A O    
4084 O O    . HOH R .   ? 0.1566 0.2175 0.2397 -0.0168 0.0783  -0.0366 2028 HOH A O    
4085 O O    . HOH R .   ? 0.2494 0.1596 0.2242 0.0187  -0.0565 -0.0269 2029 HOH A O    
4086 O O    . HOH R .   ? 0.1890 0.1781 0.1278 0.0149  -0.0435 -0.0005 2030 HOH A O    
4087 O O    . HOH R .   ? 0.2594 0.5153 0.1826 -0.0549 0.0618  -0.0123 2031 HOH A O    
4088 O O    . HOH R .   ? 0.8779 0.8466 0.3661 0.2443  0.2552  -0.0371 2032 HOH A O    
4089 O O    . HOH R .   ? 0.5447 0.7599 0.4323 -0.2300 0.0002  0.1288  2033 HOH A O    
4090 O O    . HOH R .   ? 0.2047 0.3879 0.3941 -0.0488 0.0757  -0.1767 2034 HOH A O    
4091 O O    . HOH R .   ? 0.1743 0.1888 0.1934 0.0787  -0.0272 -0.0644 2035 HOH A O    
4092 O O    . HOH R .   ? 0.3945 0.3214 0.6729 0.0559  0.3059  -0.0675 2036 HOH A O    
4093 O O    . HOH R .   ? 0.2019 0.1695 0.1197 0.0260  -0.0066 0.0104  2037 HOH A O    
4094 O O    . HOH R .   ? 0.1982 0.1079 0.2500 0.0454  0.0173  0.0480  2038 HOH A O    
4095 O O    . HOH R .   ? 0.1861 0.5106 0.2873 0.1390  0.0375  0.1168  2039 HOH A O    
4096 O O    . HOH R .   ? 0.2028 0.1116 0.1021 -0.0434 -0.0684 0.0369  2040 HOH A O    
4097 O O    . HOH R .   ? 0.1483 0.1427 0.1391 0.0461  -0.0039 -0.0254 2041 HOH A O    
4098 O O    . HOH R .   ? 0.2854 0.2146 0.4607 0.0069  0.0140  -0.1905 2042 HOH A O    
4099 O O    . HOH R .   ? 0.3020 0.3190 0.2595 -0.0754 0.0274  0.0171  2043 HOH A O    
4100 O O    . HOH R .   ? 0.2059 0.2105 0.3372 -0.0664 -0.0996 0.0527  2044 HOH A O    
4101 O O    . HOH R .   ? 0.0853 0.0726 0.0877 0.0063  -0.0212 0.0224  2045 HOH A O    
4102 O O    . HOH R .   ? 0.1653 0.3344 0.5632 -0.0678 0.0193  0.0693  2046 HOH A O    
4103 O O    . HOH R .   ? 0.1428 0.2775 0.1479 -0.0063 0.0264  0.0253  2047 HOH A O    
4104 O O    . HOH R .   ? 0.5977 0.4128 0.1550 0.1800  -0.0043 0.0235  2048 HOH A O    
4105 O O    . HOH R .   ? 0.2326 0.2391 0.1264 0.0744  0.0075  0.0018  2049 HOH A O    
4106 O O    . HOH R .   ? 0.1522 0.5423 0.2514 0.1255  0.0288  0.1873  2050 HOH A O    
4107 O O    . HOH R .   ? 0.1240 0.1158 0.1334 -0.0349 -0.0569 0.0207  2051 HOH A O    
4108 O O    . HOH R .   ? 0.2001 0.2389 0.2933 -0.0232 -0.0509 -0.1114 2052 HOH A O    
4109 O O    . HOH R .   ? 0.2277 0.2588 0.2610 -0.0532 -0.0382 -0.0862 2053 HOH A O    
4110 O O    . HOH R .   ? 0.1834 0.1447 0.1353 -0.0107 0.0336  -0.0282 2054 HOH A O    
4111 O O    . HOH R .   ? 0.3252 0.1563 0.5911 -0.0676 -0.0344 -0.0473 2055 HOH A O    
4112 O O    . HOH R .   ? 0.3780 0.4003 0.3718 0.0053  0.0092  -0.0131 2056 HOH A O    
4113 O O    . HOH R .   ? 0.0741 0.0527 0.1256 0.0052  -0.0211 -0.0010 2057 HOH A O    
4114 O O    . HOH R .   ? 0.4814 0.4604 0.5195 0.0460  0.0194  0.0290  2058 HOH A O    
4115 O O    . HOH R .   ? 0.5491 0.3064 0.2537 0.0877  0.1198  -0.0025 2059 HOH A O    
4116 O O    . HOH R .   ? 0.1192 0.0997 0.0890 0.0216  -0.0312 0.0052  2060 HOH A O    
4117 O O    . HOH R .   ? 0.2737 0.3822 0.2566 0.0709  -0.0605 -0.1696 2061 HOH A O    
4118 O O    . HOH R .   ? 0.1478 0.0873 0.2024 0.0305  0.0179  0.0268  2062 HOH A O    
4119 O O    . HOH R .   ? 0.2228 0.4745 0.3235 0.0386  -0.0357 0.2632  2063 HOH A O    
4120 O O    . HOH R .   ? 0.1108 0.1037 0.1739 -0.0023 0.0292  0.0433  2064 HOH A O    
4121 O O    . HOH R .   ? 0.1206 0.2096 0.5182 -0.0281 0.0311  0.0465  2065 HOH A O    
4122 O O    . HOH R .   ? 0.2335 0.1081 0.1435 -0.0043 -0.0248 0.0159  2066 HOH A O    
4123 O O    . HOH R .   ? 0.1584 0.2258 0.1578 0.0026  0.0211  0.0242  2067 HOH A O    
4124 O O    . HOH R .   ? 0.2950 0.2053 0.1233 0.0146  0.0736  0.0185  2068 HOH A O    
4125 O O    . HOH R .   ? 0.2100 0.3211 0.1311 -0.0395 -0.0008 0.0227  2069 HOH A O    
4126 O O    . HOH R .   ? 0.3590 0.2384 0.2860 -0.0418 -0.1191 0.1354  2070 HOH A O    
4127 O O    . HOH R .   ? 0.1202 0.1356 0.4069 0.0218  0.0046  0.0606  2071 HOH A O    
4128 O O    . HOH R .   ? 0.3863 0.3593 0.4186 0.1044  0.2122  0.0846  2072 HOH A O    
4129 O O    . HOH R .   ? 0.3900 0.3064 0.3642 -0.1170 -0.1252 0.2167  2073 HOH A O    
4130 O O    . HOH R .   ? 0.1859 0.2465 0.1986 0.0298  0.0392  0.0318  2074 HOH A O    
4131 O O    . HOH R .   ? 0.2683 0.2169 0.2401 0.1635  0.0324  0.0243  2075 HOH A O    
4132 O O    . HOH R .   ? 0.2488 0.3625 0.3561 0.0649  -0.0927 0.0153  2076 HOH A O    
4133 O O    . HOH R .   ? 0.1256 0.1459 0.1644 0.0247  -0.0143 -0.0237 2077 HOH A O    
4134 O O    . HOH R .   ? 0.0821 0.1039 0.0799 0.0018  -0.0216 -0.0059 2078 HOH A O    
4135 O O    . HOH R .   ? 0.3055 0.2815 0.3362 0.0808  -0.0488 0.0057  2079 HOH A O    
4136 O O    . HOH R .   ? 0.0863 0.0392 0.0720 0.0021  0.0118  -0.0013 2080 HOH A O    
4137 O O    . HOH R .   ? 0.1914 0.3364 0.3883 0.0745  0.0093  0.0812  2081 HOH A O    
4138 O O    . HOH R .   ? 0.0849 0.0767 0.2034 -0.0019 0.0320  -0.0417 2082 HOH A O    
4139 O O    . HOH R .   ? 0.3805 0.4456 0.2308 -0.1872 -0.0879 -0.0922 2083 HOH A O    
4140 O O    . HOH R .   ? 0.1839 0.1771 0.2392 -0.0040 0.0523  -0.0264 2084 HOH A O    
4141 O O    . HOH R .   ? 0.2304 0.1227 0.2119 -0.0868 0.1526  -0.0933 2085 HOH A O    
4142 O O    . HOH R .   ? 0.7169 0.5576 0.5410 0.2512  -0.3709 0.0905  2086 HOH A O    
4143 O O    . HOH R .   ? 0.1794 0.2440 0.1634 -0.0084 -0.0385 0.0394  2087 HOH A O    
4144 O O    . HOH R .   ? 0.4145 0.4831 0.3649 0.0413  -0.0152 0.2096  2088 HOH A O    
4145 O O    . HOH R .   ? 0.1061 0.0831 0.1411 -0.0005 -0.0491 -0.0051 2089 HOH A O    
4146 O O    . HOH R .   ? 0.1014 0.3666 0.1968 -0.0083 -0.0259 0.0405  2090 HOH A O    
4147 O O    . HOH R .   ? 0.1255 0.1087 0.2223 -0.0144 -0.0207 -0.0300 2091 HOH A O    
4148 O O    . HOH R .   ? 0.4220 0.1264 0.1417 -0.0080 -0.0211 0.0048  2092 HOH A O    
4149 O O    . HOH R .   ? 0.1331 0.1160 0.1262 0.0052  -0.0016 0.0327  2093 HOH A O    
4150 O O    . HOH R .   ? 0.2400 0.4603 0.6930 0.0943  -0.1665 0.1138  2094 HOH A O    
4151 O O    . HOH R .   ? 0.0714 0.0637 0.0980 -0.0054 -0.0115 -0.0167 2095 HOH A O    
4152 O O    . HOH R .   ? 0.1765 0.2029 0.1956 0.0374  -0.0569 0.0430  2096 HOH A O    
4153 O O    . HOH R .   ? 0.7617 0.2785 0.2559 0.0823  0.2143  0.0085  2097 HOH A O    
4154 O O    . HOH R .   ? 0.2021 0.1514 0.1665 0.0140  -0.0048 0.0054  2098 HOH A O    
4155 O O    . HOH R .   ? 0.2607 0.4000 0.1857 0.0842  -0.0620 -0.1117 2099 HOH A O    
4156 O O    . HOH R .   ? 0.4676 0.3123 0.1329 0.0722  -0.0038 0.0000  2100 HOH A O    
4157 O O    . HOH R .   ? 0.1107 0.0722 0.1038 0.0223  -0.0299 0.0085  2101 HOH A O    
4158 O O    . HOH R .   ? 0.3067 0.2939 0.2092 -0.0365 0.0899  -0.0356 2102 HOH A O    
4159 O O    . HOH R .   ? 0.2050 0.5691 0.2928 -0.0330 0.0291  0.1296  2103 HOH A O    
4160 O O    . HOH R .   ? 0.1175 0.1035 0.1401 -0.0350 0.0130  -0.0270 2104 HOH A O    
4161 O O    . HOH R .   ? 0.0943 0.0525 0.0909 0.0092  -0.0243 -0.0024 2105 HOH A O    
4162 O O    . HOH R .   ? 0.3607 0.4164 0.3392 -0.0652 0.1725  0.1232  2106 HOH A O    
4163 O O    . HOH R .   ? 0.4946 0.3549 0.3297 -0.0771 -0.0249 0.1129  2107 HOH A O    
4164 O O    . HOH R .   ? 0.2065 0.4788 0.1795 -0.0462 0.0370  0.0974  2108 HOH A O    
4165 O O    . HOH R .   ? 0.5832 0.3290 0.4088 -0.1498 0.1876  -0.0265 2109 HOH A O    
4166 O O    . HOH R .   ? 0.2289 0.5640 0.2990 0.0979  0.1018  -0.0217 2110 HOH A O    
4167 O O    . HOH R .   ? 0.4556 0.3610 0.1932 0.0920  -0.1881 -0.0159 2111 HOH A O    
4168 O O    . HOH R .   ? 0.1902 0.3336 0.2652 -0.0414 -0.0485 -0.1299 2112 HOH A O    
4169 O O    . HOH R .   ? 0.2150 0.1826 0.4675 -0.0439 -0.0577 0.0212  2113 HOH A O    
4170 O O    . HOH R .   ? 0.2023 0.1262 0.1625 -0.0203 -0.0492 0.0263  2114 HOH A O    
4171 O O    . HOH R .   ? 0.3200 0.1776 0.2449 -0.0354 -0.0079 -0.0810 2115 HOH A O    
4172 O O    . HOH R .   ? 0.3384 0.2391 0.2149 -0.1462 0.0144  -0.0292 2116 HOH A O    
4173 O O    . HOH R .   ? 0.3935 0.2214 0.4905 -0.0118 0.0304  0.1843  2117 HOH A O    
4174 O O    . HOH R .   ? 0.2140 0.1809 0.3145 -0.0022 -0.0051 0.1062  2118 HOH A O    
4175 O O    . HOH R .   ? 0.1969 0.3637 0.2436 -0.0519 0.0477  0.0774  2119 HOH A O    
4176 O O    . HOH R .   ? 0.6427 0.1754 0.4917 0.1201  -0.1884 -0.1103 2120 HOH A O    
4177 O O    . HOH R .   ? 0.3626 0.1482 0.2476 0.1335  0.1156  0.0881  2121 HOH A O    
4178 O O    . HOH R .   ? 0.1668 0.0987 0.1571 -0.0274 0.0049  -0.0602 2122 HOH A O    
4179 O O    . HOH R .   ? 0.1349 0.2301 0.5653 0.0410  -0.0676 -0.0389 2123 HOH A O    
4180 O O    . HOH R .   ? 0.0927 0.2418 0.1432 0.0678  -0.0046 -0.0382 2124 HOH A O    
4181 O O    . HOH R .   ? 0.1030 0.0644 0.0961 0.0000  -0.0054 0.0143  2125 HOH A O    
4182 O O    . HOH R .   ? 0.0818 0.0629 0.0862 0.0090  -0.0118 0.0158  2126 HOH A O    
4183 O O    . HOH R .   ? 0.1153 0.0878 0.1088 -0.0174 0.0086  -0.0127 2127 HOH A O    
4184 O O    . HOH R .   ? 0.3525 0.3524 0.3309 0.1227  0.0102  0.1174  2128 HOH A O    
4185 O O    . HOH R .   ? 0.3161 0.2606 0.2090 -0.0618 0.0114  0.0183  2129 HOH A O    
4186 O O    . HOH R .   ? 0.4390 0.2676 0.2793 -0.0183 -0.1209 0.0213  2130 HOH A O    
4187 O O    . HOH R .   ? 0.2303 0.5047 0.4752 -0.1654 0.1147  -0.0393 2131 HOH A O    
4188 O O    . HOH R .   ? 0.1688 0.1277 0.1973 0.0517  -0.0253 0.0249  2132 HOH A O    
4189 O O    . HOH R .   ? 0.1532 0.4096 0.1565 -0.0428 -0.0246 0.0198  2133 HOH A O    
4190 O O    . HOH R .   ? 0.3215 0.5510 0.2103 -0.1432 0.0270  -0.0836 2134 HOH A O    
4191 O O    . HOH R .   ? 0.1388 0.1615 0.1023 -0.0255 -0.0173 -0.0120 2135 HOH A O    
4192 O O    . HOH R .   ? 0.1726 0.2547 0.1543 -0.0049 -0.0555 -0.0127 2136 HOH A O    
4193 O O    . HOH R .   ? 0.5721 0.4607 0.7394 -0.2502 -0.1172 0.1036  2137 HOH A O    
4194 O O    . HOH R .   ? 0.1824 0.1104 0.1866 0.0114  -0.0815 0.0362  2138 HOH A O    
4195 O O    . HOH R .   ? 0.1064 0.0579 0.0832 0.0158  -0.0192 -0.0023 2139 HOH A O    
4196 O O    . HOH R .   ? 0.1506 0.1952 0.2452 0.0271  0.0139  0.0555  2140 HOH A O    
4197 O O    . HOH R .   ? 0.0830 0.0437 0.0770 0.0045  -0.0244 -0.0004 2141 HOH A O    
4198 O O    . HOH R .   ? 0.4231 0.6758 0.5187 -0.0553 0.2918  -0.2689 2142 HOH A O    
4199 O O    . HOH R .   ? 0.1801 0.1050 0.3057 0.0486  0.0012  -0.0556 2143 HOH A O    
4200 O O    . HOH R .   ? 0.4077 0.5083 0.4325 0.1195  0.1115  0.1689  2144 HOH A O    
4201 O O    . HOH R .   ? 0.3725 0.3359 0.5166 0.1246  0.1460  -0.0452 2145 HOH A O    
4202 O O    . HOH R .   ? 0.2160 0.3217 0.2478 -0.0451 0.0413  -0.0544 2146 HOH A O    
4203 O O    . HOH R .   ? 0.3123 0.1825 0.1875 -0.0674 0.1190  -0.0426 2147 HOH A O    
4204 O O    . HOH R .   ? 0.2896 0.3923 0.3258 0.0781  -0.0982 -0.0045 2148 HOH A O    
4205 O O    . HOH R .   ? 0.1426 0.3861 0.4087 0.0616  -0.0635 0.1656  2149 HOH A O    
4206 O O    . HOH R .   ? 0.1550 0.1237 0.1514 -0.0601 -0.0573 0.0267  2150 HOH A O    
4207 O O    . HOH R .   ? 0.8434 0.6444 0.5214 0.2224  0.2443  -0.2490 2151 HOH A O    
4208 O O    . HOH R .   ? 0.4527 0.4718 0.5810 -0.1484 0.1454  -0.0267 2152 HOH A O    
4209 O O    . HOH R .   ? 0.1176 0.1243 0.2118 -0.0344 0.0087  0.0338  2153 HOH A O    
4210 O O    . HOH R .   ? 0.3054 0.3131 0.1828 0.0832  0.0623  0.0189  2154 HOH A O    
4211 O O    . HOH R .   ? 0.4480 0.4670 0.4995 0.0022  0.0198  0.0094  2155 HOH A O    
4212 O O    . HOH R .   ? 0.2347 0.2258 0.2878 -0.0839 0.1376  -0.1147 2156 HOH A O    
4213 O O    . HOH R .   ? 0.1722 0.1764 0.2329 -0.0358 0.0886  0.0114  2157 HOH A O    
4214 O O    . HOH R .   ? 0.4788 0.3003 0.3170 -0.2396 0.2086  -0.1626 2158 HOH A O    
4215 O O    . HOH R .   ? 0.0987 0.1219 0.1394 0.0208  -0.0332 0.0147  2159 HOH A O    
4216 O O    . HOH R .   ? 0.3175 0.3778 0.2653 0.1058  0.0353  -0.1881 2160 HOH A O    
4217 O O    . HOH R .   ? 0.1044 0.1076 0.1275 0.0101  0.0047  0.0053  2161 HOH A O    
4218 O O    . HOH R .   ? 0.1123 0.1733 0.1144 -0.0627 0.0046  0.0004  2162 HOH A O    
4219 O O    . HOH R .   ? 0.3492 0.7623 0.2508 -0.0095 -0.0969 -0.1341 2163 HOH A O    
4220 O O    . HOH R .   ? 0.0997 0.1088 0.0951 -0.0102 -0.0258 0.0166  2164 HOH A O    
4221 O O    . HOH R .   ? 0.2534 0.3623 0.2083 -0.0908 -0.1129 0.0437  2165 HOH A O    
4222 O O    . HOH R .   ? 0.1559 0.2714 0.1710 -0.0031 0.0221  0.0390  2166 HOH A O    
4223 O O    . HOH R .   ? 0.1996 0.4578 0.2420 0.0314  -0.0633 -0.2376 2167 HOH A O    
4224 O O    . HOH R .   ? 0.2405 0.4022 0.4832 0.0672  0.0185  -0.1017 2168 HOH A O    
4225 O O    . HOH R .   ? 0.3359 0.3383 0.3952 -0.0499 -0.1417 -0.1259 2169 HOH A O    
4226 O O    . HOH R .   ? 0.0896 0.0850 0.2402 -0.0194 -0.0514 0.0677  2170 HOH A O    
4227 O O    . HOH R .   ? 0.2002 0.1658 0.3677 0.0462  -0.1515 -0.0203 2171 HOH A O    
4228 O O    . HOH R .   ? 0.1909 0.1244 0.1363 0.0178  -0.0606 -0.0128 2172 HOH A O    
4229 O O    . HOH R .   ? 0.2769 0.2009 0.2697 -0.1228 -0.0712 0.0321  2173 HOH A O    
4230 O O    . HOH R .   ? 0.2845 0.1700 0.2621 -0.0577 -0.0686 0.0614  2174 HOH A O    
4231 O O    . HOH R .   ? 0.1415 0.0638 0.1566 0.0039  -0.0518 0.0139  2175 HOH A O    
4232 O O    . HOH R .   ? 0.3649 0.3175 0.4122 0.0403  -0.1255 0.2189  2176 HOH A O    
4233 O O    . HOH R .   ? 0.2341 0.3183 0.1652 -0.0924 -0.0782 0.0292  2177 HOH A O    
4234 O O    . HOH S .   ? 0.0994 0.2845 0.3894 -0.0150 0.0388  -0.0789 2001 HOH B O    
4235 O O    . HOH S .   ? 0.1953 0.2754 0.3583 -0.0838 -0.1298 0.0452  2002 HOH B O    
4236 O O    . HOH S .   ? 0.1455 0.5432 0.6304 0.0395  0.0830  -0.2269 2003 HOH B O    
4237 O O    . HOH S .   ? 0.4772 0.4340 0.1646 0.1087  0.0028  -0.0782 2004 HOH B O    
4238 O O    . HOH S .   ? 0.5516 0.5811 0.4283 -0.3774 -0.2592 0.1953  2005 HOH B O    
4239 O O    . HOH S .   ? 0.1446 0.1993 0.1848 -0.0399 -0.0644 -0.0908 2006 HOH B O    
4240 O O    . HOH S .   ? 0.3501 0.3079 0.3019 0.0256  0.0213  0.0022  2007 HOH B O    
4241 O O    . HOH S .   ? 0.0985 0.2695 0.1311 -0.0362 -0.0325 -0.0136 2008 HOH B O    
4242 O O    . HOH S .   ? 0.3982 0.3599 0.2401 -0.1905 0.0410  0.0387  2009 HOH B O    
4243 O O    . HOH S .   ? 0.2628 0.2004 0.1622 0.0369  0.0624  -0.0312 2010 HOH B O    
4244 O O    . HOH S .   ? 0.0925 0.2481 0.2373 -0.0435 -0.0136 -0.0159 2011 HOH B O    
4245 O O    . HOH S .   ? 0.2237 0.1262 0.6927 -0.0253 0.0925  -0.0879 2012 HOH B O    
4246 O O    . HOH S .   ? 0.6661 0.6986 0.1933 -0.0910 0.1025  -0.0209 2013 HOH B O    
4247 O O    . HOH S .   ? 0.4346 0.2701 0.2726 0.0850  -0.1769 -0.1017 2014 HOH B O    
4248 O O    . HOH S .   ? 0.0726 0.2918 0.2348 -0.0025 -0.0218 -0.1479 2015 HOH B O    
4249 O O    . HOH S .   ? 0.1245 0.4271 0.5318 0.0254  -0.0632 -0.3390 2016 HOH B O    
4250 O O    . HOH S .   ? 0.3856 0.4797 0.3900 -0.1305 0.1519  0.0654  2017 HOH B O    
4251 O O    . HOH S .   ? 0.1150 0.2045 0.1440 0.0410  0.0274  0.0131  2018 HOH B O    
4252 O O    . HOH S .   ? 0.3202 0.4454 0.3357 0.2586  0.1083  0.1459  2019 HOH B O    
4253 O O    . HOH S .   ? 0.3110 0.3340 0.3611 0.0215  0.0377  -0.0295 2020 HOH B O    
4254 O O    . HOH S .   ? 0.2445 0.2964 0.5473 0.1829  0.0357  0.1062  2021 HOH B O    
4255 O O    . HOH S .   ? 0.1038 0.1060 0.6191 0.0070  -0.0685 -0.1091 2022 HOH B O    
4256 O O    . HOH S .   ? 0.1156 0.4060 0.2703 0.0001  0.0374  0.1688  2023 HOH B O    
4257 O O    . HOH S .   ? 0.2287 0.3418 0.2199 -0.0801 0.0295  0.0731  2024 HOH B O    
4258 O O    . HOH S .   ? 0.3052 0.2892 0.1384 0.1542  -0.0033 -0.0276 2025 HOH B O    
4259 O O    . HOH S .   ? 0.2100 0.1821 0.2025 -0.0034 0.0009  0.0320  2026 HOH B O    
4260 O O    . HOH S .   ? 0.1454 0.2310 0.2096 0.0478  0.0331  0.0530  2027 HOH B O    
4261 O O    . HOH S .   ? 0.1570 0.6878 0.3338 -0.0661 0.0316  -0.2794 2028 HOH B O    
4262 O O    . HOH S .   ? 0.5747 0.7884 0.2790 0.1308  0.0880  -0.2088 2029 HOH B O    
4263 O O    . HOH S .   ? 0.1977 0.1578 0.1340 -0.0002 -0.0364 -0.0178 2030 HOH B O    
4264 O O    . HOH S .   ? 0.2999 0.2896 0.2875 -0.0052 0.0064  -0.0068 2031 HOH B O    
4265 O O    . HOH S .   ? 0.2554 0.4354 0.2099 -0.0990 -0.0072 0.0244  2032 HOH B O    
4266 O O    . HOH S .   ? 0.1668 0.1490 0.1408 0.0357  -0.0191 -0.0032 2033 HOH B O    
4267 O O    . HOH S .   ? 0.0988 0.2817 0.0921 0.0513  -0.0295 -0.0680 2034 HOH B O    
4268 O O    . HOH S .   ? 0.1763 0.1483 0.1489 0.0217  0.0275  0.0324  2035 HOH B O    
4269 O O    . HOH S .   ? 0.3001 0.2210 0.4615 -0.0164 0.1820  0.0395  2036 HOH B O    
4270 O O    . HOH S .   ? 0.1357 0.1760 0.1485 0.0186  0.0131  -0.0246 2037 HOH B O    
4271 O O    . HOH S .   ? 0.2723 0.2574 0.3146 -0.0812 -0.1940 0.0749  2038 HOH B O    
4272 O O    . HOH S .   ? 0.6531 0.7008 0.2372 0.2419  0.0093  -0.1698 2039 HOH B O    
4273 O O    . HOH S .   ? 0.4650 0.6380 0.2057 -0.0247 0.0588  0.0657  2040 HOH B O    
4274 O O    . HOH S .   ? 1.0094 0.9176 0.4804 0.0403  0.1791  -0.3573 2041 HOH B O    
4275 O O    . HOH S .   ? 0.2022 0.3025 0.3594 0.0036  -0.1025 -0.0676 2042 HOH B O    
4276 O O    . HOH S .   ? 0.1002 0.0675 0.1305 0.0110  0.0095  0.0396  2043 HOH B O    
4277 O O    . HOH S .   ? 0.2002 0.4070 0.2846 0.1246  0.0731  0.2048  2044 HOH B O    
4278 O O    . HOH S .   ? 0.1729 0.1577 0.4086 -0.0400 0.0923  -0.1031 2045 HOH B O    
4279 O O    . HOH S .   ? 0.1843 0.4652 0.0779 -0.1940 0.0138  -0.0879 2046 HOH B O    
4280 O O    . HOH S .   ? 0.1459 0.1524 0.1387 0.0614  0.0321  0.0100  2047 HOH B O    
4281 O O    . HOH S .   ? 0.1777 0.0969 0.1028 -0.0272 -0.0417 0.0223  2048 HOH B O    
4282 O O    . HOH S .   ? 0.1248 0.1641 0.1918 -0.0190 0.0280  0.0113  2049 HOH B O    
4283 O O    . HOH S .   ? 0.0688 0.0747 0.0656 -0.0127 -0.0095 -0.0258 2050 HOH B O    
4284 O O    . HOH S .   ? 0.2702 0.5230 0.2923 -0.2714 -0.0778 0.1923  2051 HOH B O    
4285 O O    . HOH S .   ? 0.3341 0.4215 0.3160 0.0190  0.0958  -0.1216 2052 HOH B O    
4286 O O    . HOH S .   ? 0.1776 0.5968 0.3808 -0.1008 -0.0360 0.3118  2053 HOH B O    
4287 O O    . HOH S .   ? 0.2144 0.2801 0.2629 -0.0261 0.0623  0.0146  2054 HOH B O    
4288 O O    . HOH S .   ? 0.2757 0.3207 0.2015 -0.0922 0.0055  0.1078  2055 HOH B O    
4289 O O    . HOH S .   ? 0.1115 0.4007 0.1695 0.0745  0.0068  0.1458  2056 HOH B O    
4290 O O    . HOH S .   ? 0.1138 0.1287 0.0907 0.0554  -0.0510 -0.0288 2057 HOH B O    
4291 O O    . HOH S .   ? 0.2363 0.1679 0.1326 -0.0897 -0.0640 0.0197  2058 HOH B O    
4292 O O    . HOH S .   ? 0.0987 0.0944 0.1063 -0.0129 0.0000  -0.0106 2059 HOH B O    
4293 O O    . HOH S .   ? 0.0671 0.0393 0.1086 0.0028  -0.0171 0.0079  2060 HOH B O    
4294 O O    . HOH S .   ? 0.3041 0.4399 0.4340 -0.1277 -0.0556 -0.1638 2061 HOH B O    
4295 O O    . HOH S .   ? 0.3088 0.2948 0.4347 0.0384  -0.0733 -0.1067 2062 HOH B O    
4296 O O    . HOH S .   ? 0.3518 0.3296 0.3667 -0.0158 0.0045  0.0162  2063 HOH B O    
4297 O O    . HOH S .   ? 0.5434 0.2973 0.2740 -0.0515 0.0454  0.0485  2064 HOH B O    
4298 O O    . HOH S .   ? 0.2352 0.1641 0.2134 -0.0506 -0.0990 0.0302  2065 HOH B O    
4299 O O    . HOH S .   ? 0.1505 0.1861 0.1401 0.0132  -0.0626 0.0051  2066 HOH B O    
4300 O O    . HOH S .   ? 0.1285 0.1056 0.5215 0.0051  -0.0761 0.0043  2067 HOH B O    
4301 O O    . HOH S .   ? 0.1601 0.1260 0.2473 -0.0210 0.0463  0.0415  2068 HOH B O    
4302 O O    . HOH S .   ? 0.3307 0.5492 0.3146 0.2450  0.1252  0.2545  2069 HOH B O    
4303 O O    . HOH S .   ? 0.3409 0.1781 0.1456 -0.1463 0.0069  -0.0276 2070 HOH B O    
4304 O O    . HOH S .   ? 0.1966 0.2833 0.5580 0.0280  -0.0704 -0.0232 2071 HOH B O    
4305 O O    . HOH S .   ? 0.2685 0.5045 0.2332 -0.0498 -0.1063 -0.0818 2072 HOH B O    
4306 O O    . HOH S .   ? 0.1455 0.3275 0.1664 -0.1081 0.0194  -0.0431 2073 HOH B O    
4307 O O    . HOH S .   ? 0.2226 0.4224 0.1905 0.0444  0.0646  0.1258  2074 HOH B O    
4308 O O    . HOH S .   ? 0.3242 0.3440 0.2772 0.1603  0.0309  0.0899  2075 HOH B O    
4309 O O    . HOH S .   ? 0.3308 0.3920 0.5233 0.0242  0.1697  0.0827  2076 HOH B O    
4310 O O    . HOH S .   ? 0.2350 0.1171 0.1515 -0.0178 0.0102  0.0755  2077 HOH B O    
4311 O O    . HOH S .   ? 0.2169 0.2906 0.1877 -0.0309 -0.0147 0.0490  2078 HOH B O    
4312 O O    . HOH S .   ? 0.2874 0.4930 0.5008 -0.0016 0.0897  -0.2005 2079 HOH B O    
4313 O O    . HOH S .   ? 0.2621 0.3681 0.3472 -0.0526 -0.0301 0.2279  2080 HOH B O    
4314 O O    . HOH S .   ? 0.4828 0.7698 0.4614 0.1078  0.2451  -0.1208 2081 HOH B O    
4315 O O    . HOH S .   ? 0.1131 0.1908 0.1654 0.0072  0.0005  -0.0189 2082 HOH B O    
4316 O O    . HOH S .   ? 0.4163 0.4583 0.3815 0.1720  0.0649  -0.1198 2083 HOH B O    
4317 O O    . HOH S .   ? 0.1208 0.3002 0.3432 0.0021  0.0126  0.0982  2084 HOH B O    
4318 O O    . HOH S .   ? 0.1794 0.3621 0.2652 -0.0536 -0.0788 0.0387  2085 HOH B O    
4319 O O    . HOH S .   ? 0.1099 0.1846 0.1634 -0.0076 -0.0389 -0.0303 2086 HOH B O    
4320 O O    . HOH S .   ? 0.5471 0.3506 0.3728 -0.1235 0.1595  0.0107  2087 HOH B O    
4321 O O    . HOH S .   ? 0.3393 0.1897 0.2002 0.0700  0.0760  0.0182  2088 HOH B O    
4322 O O    . HOH S .   ? 0.1946 0.4312 0.2544 0.1281  0.1106  0.1712  2089 HOH B O    
4323 O O    . HOH S .   ? 0.3141 0.3497 0.4941 -0.1528 -0.0889 -0.2101 2090 HOH B O    
4324 O O    . HOH S .   ? 0.1366 0.0887 0.1225 -0.0015 -0.0419 0.0029  2091 HOH B O    
4325 O O    . HOH S .   ? 0.1620 0.3041 0.2621 0.0725  -0.0135 0.1573  2092 HOH B O    
4326 O O    . HOH S .   ? 0.1440 0.1008 0.1144 0.0105  -0.0106 0.0088  2093 HOH B O    
4327 O O    . HOH S .   ? 0.1263 0.1137 0.1168 0.0026  -0.0102 -0.0257 2094 HOH B O    
4328 O O    . HOH S .   ? 0.0967 0.0652 0.0935 0.0020  -0.0237 -0.0021 2095 HOH B O    
4329 O O    . HOH S .   ? 0.0923 0.1435 0.1799 0.0101  -0.0101 -0.0322 2096 HOH B O    
4330 O O    . HOH S .   ? 0.4085 0.1189 0.1402 0.0399  0.0666  0.0160  2097 HOH B O    
4331 O O    . HOH S .   ? 0.1013 0.1319 0.1337 0.0053  0.0097  0.0547  2098 HOH B O    
4332 O O    . HOH S .   ? 0.0759 0.0547 0.0710 -0.0112 -0.0073 -0.0163 2099 HOH B O    
4333 O O    . HOH S .   ? 0.2468 0.2336 0.2092 -0.0907 0.0901  -0.0351 2100 HOH B O    
4334 O O    . HOH S .   ? 0.1839 0.2016 0.2044 0.0289  -0.0309 0.0465  2101 HOH B O    
4335 O O    . HOH S .   ? 0.1546 0.3829 0.1987 0.0879  -0.0918 -0.2090 2102 HOH B O    
4336 O O    . HOH S .   ? 0.4596 0.3202 0.1212 -0.0503 -0.0477 0.0428  2103 HOH B O    
4337 O O    . HOH S .   ? 0.1309 0.2502 0.2377 -0.0083 -0.0050 -0.1445 2104 HOH B O    
4338 O O    . HOH S .   ? 0.3189 0.3373 0.1952 0.0230  0.0577  -0.1001 2105 HOH B O    
4339 O O    . HOH S .   ? 0.1010 0.0723 0.1099 -0.0213 0.0049  -0.0129 2106 HOH B O    
4340 O O    . HOH S .   ? 0.0840 0.0429 0.0762 0.0070  -0.0190 -0.0057 2107 HOH B O    
4341 O O    . HOH S .   ? 0.3390 0.4775 0.4284 0.1119  0.1806  0.2537  2108 HOH B O    
4342 O O    . HOH S .   ? 0.1528 0.3600 0.1241 -0.0500 0.0168  0.0348  2109 HOH B O    
4343 O O    . HOH S .   ? 0.2682 0.5284 0.2004 -0.0342 0.0500  0.1249  2110 HOH B O    
4344 O O    . HOH S .   ? 0.3337 0.5857 0.1951 -0.0481 -0.0096 -0.1255 2111 HOH B O    
4345 O O    . HOH S .   ? 0.1814 0.4580 0.1918 0.0104  0.0560  -0.0777 2112 HOH B O    
4346 O O    . HOH S .   ? 0.1811 0.7509 0.4713 0.1512  0.1459  0.4479  2113 HOH B O    
4347 O O    . HOH S .   ? 0.5609 0.3381 0.5075 0.1373  -0.3190 -0.0435 2114 HOH B O    
4348 O O    . HOH S .   ? 0.7421 0.4715 0.1523 -0.2458 -0.0927 0.0684  2115 HOH B O    
4349 O O    . HOH S .   ? 0.2902 0.1476 0.4135 -0.0319 -0.1185 -0.0177 2116 HOH B O    
4350 O O    . HOH S .   ? 0.2306 0.3302 0.3677 0.0495  -0.1347 0.0143  2117 HOH B O    
4351 O O    . HOH S .   ? 0.3995 0.2861 0.1666 -0.2239 -0.1484 0.0807  2118 HOH B O    
4352 O O    . HOH S .   ? 0.1928 0.5117 0.1602 -0.0862 0.0317  0.0273  2119 HOH B O    
4353 O O    . HOH S .   ? 0.4629 0.2992 0.4272 0.2657  0.1176  0.1533  2120 HOH B O    
4354 O O    . HOH S .   ? 0.1423 0.2573 0.4257 -0.0614 -0.0151 0.0443  2121 HOH B O    
4355 O O    . HOH S .   ? 0.3773 0.1229 0.5010 0.0494  -0.1562 -0.0825 2122 HOH B O    
4356 O O    . HOH S .   ? 0.2335 0.1822 0.3342 -0.0232 -0.1155 -0.0035 2123 HOH B O    
4357 O O    . HOH S .   ? 0.1466 0.1611 0.1297 -0.0659 0.0103  -0.0634 2124 HOH B O    
4358 O O    . HOH S .   ? 0.0768 0.0587 0.0913 0.0246  -0.0058 0.0207  2125 HOH B O    
4359 O O    . HOH S .   ? 0.2139 0.3106 0.2669 0.1007  -0.0956 -0.1105 2126 HOH B O    
4360 O O    . HOH S .   ? 0.0816 0.1056 0.1463 -0.0408 0.0078  -0.0290 2127 HOH B O    
4361 O O    . HOH S .   ? 0.0742 0.0522 0.0585 0.0088  0.0031  0.0107  2128 HOH B O    
4362 O O    . HOH S .   ? 0.1032 0.1025 0.0927 -0.0142 -0.0064 -0.0360 2129 HOH B O    
4363 O O    . HOH S .   ? 0.4605 0.3464 0.4219 0.1032  -0.0752 -0.0059 2130 HOH B O    
4364 O O    . HOH S .   ? 0.6651 0.1959 0.1415 -0.1020 0.1749  -0.0393 2131 HOH B O    
4365 O O    . HOH S .   ? 0.1171 0.2377 0.2204 0.0077  -0.0208 -0.0530 2132 HOH B O    
4366 O O    . HOH S .   ? 0.1206 0.3914 0.2495 0.0004  -0.0385 -0.2393 2133 HOH B O    
4367 O O    . HOH S .   ? 0.1238 0.1104 0.1902 -0.0179 -0.0651 0.0452  2134 HOH B O    
4368 O O    . HOH S .   ? 0.3091 0.1789 0.2160 -0.0616 0.0251  0.0037  2135 HOH B O    
4369 O O    . HOH S .   ? 0.3879 0.2185 0.2785 -0.0423 0.0913  0.0111  2136 HOH B O    
4370 O O    . HOH S .   ? 0.1340 0.2569 0.2138 0.0510  -0.0329 0.0737  2137 HOH B O    
4371 O O    . HOH S .   ? 0.2421 0.2736 0.1692 0.1161  -0.0677 -0.0321 2138 HOH B O    
4372 O O    . HOH S .   ? 0.2319 0.3765 0.4513 0.0871  -0.0771 0.0954  2139 HOH B O    
4373 O O    . HOH S .   ? 0.3128 0.4579 0.3980 0.0226  -0.2530 0.0088  2140 HOH B O    
4374 O O    . HOH S .   ? 0.4151 0.1410 0.4977 -0.0324 -0.2558 0.0127  2141 HOH B O    
4375 O O    . HOH S .   ? 0.6024 0.3071 0.5258 -0.1668 0.2272  -0.2334 2142 HOH B O    
4376 O O    . HOH S .   ? 0.2335 0.1973 0.1989 -0.0221 -0.0373 0.0269  2143 HOH B O    
4377 O O    . HOH S .   ? 0.2647 0.5645 0.5293 0.0188  0.1310  0.2824  2144 HOH B O    
4378 O O    . HOH S .   ? 0.2460 0.1981 0.3364 -0.0417 -0.0241 0.0036  2145 HOH B O    
4379 O O    . HOH S .   ? 0.3852 0.4995 0.3531 0.0469  0.1006  0.2408  2146 HOH B O    
4380 O O    . HOH S .   ? 0.1895 0.1852 0.2269 -0.0179 -0.0594 0.0564  2147 HOH B O    
4381 O O    . HOH S .   ? 0.1164 0.0637 0.1079 0.0109  -0.0172 0.0034  2148 HOH B O    
4382 O O    . HOH S .   ? 0.1321 0.9177 0.4791 -0.0620 0.0654  -0.0313 2149 HOH B O    
4383 O O    . HOH S .   ? 0.1115 0.1228 0.1978 0.0105  0.0208  0.0567  2150 HOH B O    
4384 O O    . HOH S .   ? 0.0829 0.0435 0.0696 0.0042  -0.0294 -0.0046 2151 HOH B O    
4385 O O    . HOH S .   ? 0.2907 0.6585 0.3477 0.1181  0.1208  0.3100  2152 HOH B O    
4386 O O    . HOH S .   ? 0.1077 0.5701 0.3348 0.0256  0.0988  0.1863  2153 HOH B O    
4387 O O    . HOH S .   ? 0.1862 0.3569 0.4274 -0.1475 0.1177  0.0477  2154 HOH B O    
4388 O O    . HOH S .   ? 0.2704 0.3251 0.4221 0.0984  0.1559  0.0519  2155 HOH B O    
4389 O O    . HOH S .   ? 0.1190 0.2258 0.1914 0.0134  -0.0143 0.0734  2156 HOH B O    
4390 O O    . HOH S .   ? 0.1493 0.1497 0.2474 -0.0100 0.0827  -0.0723 2157 HOH B O    
4391 O O    . HOH S .   ? 0.4166 0.6441 0.2110 -0.0116 0.1002  -0.1461 2158 HOH B O    
4392 O O    . HOH S .   ? 0.3035 0.4599 0.4927 0.1507  0.0838  -0.1844 2159 HOH B O    
4393 O O    . HOH S .   ? 0.3173 0.2022 0.1895 -0.0983 0.0664  0.0079  2160 HOH B O    
4394 O O    . HOH S .   ? 0.2851 0.2851 0.2851 0.0000  0.0000  0.0000  2161 HOH B O    
4395 O O    . HOH S .   ? 0.1954 0.4397 0.2237 -0.0404 -0.0393 -0.0019 2162 HOH B O    
4396 O O    . HOH S .   ? 0.1657 0.1709 0.1712 -0.0550 0.0075  -0.0527 2163 HOH B O    
4397 O O    . HOH S .   ? 0.2775 0.2083 0.3011 0.0280  -0.1088 0.0466  2164 HOH B O    
4398 O O    . HOH S .   ? 0.2911 0.2954 0.3415 -0.0944 -0.0219 0.0035  2165 HOH B O    
4399 O O    . HOH S .   ? 0.3689 0.2473 0.5743 -0.0652 0.0833  -0.2017 2166 HOH B O    
4400 O O    . HOH S .   ? 0.5942 0.1866 0.2794 0.1017  -0.2420 -0.0618 2167 HOH B O    
4401 O O    . HOH S .   ? 0.1101 0.2109 0.4138 -0.0092 -0.0158 -0.0730 2168 HOH B O    
4402 O O    . HOH S .   ? 0.1260 0.1745 0.3997 -0.0194 0.0121  -0.1016 2169 HOH B O    
4403 O O    . HOH S .   ? 0.1963 0.1756 0.2824 -0.0270 0.0462  0.0433  2170 HOH B O    
4404 O O    . HOH S .   ? 0.0970 0.1508 0.1710 -0.0270 0.0067  -0.0336 2171 HOH B O    
4405 O O    . HOH S .   ? 0.3622 0.2487 0.6726 -0.0358 -0.2095 -0.1911 2172 HOH B O    
4406 O O    . HOH S .   ? 0.4172 0.3810 0.3369 0.2562  0.0153  0.0902  2173 HOH B O    
4407 O O    . HOH S .   ? 0.1474 0.1218 0.1960 0.0038  -0.0674 0.0027  2174 HOH B O    
4408 O O    . HOH S .   ? 0.0597 0.0806 0.0871 -0.0075 -0.0133 -0.0094 2175 HOH B O    
4409 O O    . HOH S .   ? 0.1256 0.1711 0.1702 -0.0743 -0.0188 -0.0030 2176 HOH B O    
4410 O O    . HOH S .   ? 0.0856 0.1082 0.0934 -0.0081 -0.0212 0.0264  2177 HOH B O    
4411 O O    . HOH S .   ? 0.1241 0.2890 0.1235 -0.0517 0.0259  -0.0132 2178 HOH B O    
4412 O O    . HOH S .   ? 0.1287 0.1207 0.1019 0.0147  -0.0338 -0.0164 2179 HOH B O    
4413 O O    . HOH S .   ? 0.3105 0.5443 0.4237 0.0419  0.1100  -0.2924 2180 HOH B O    
4414 O O    . HOH S .   ? 0.1711 0.2330 0.1349 0.0001  -0.0100 -0.0823 2181 HOH B O    
4415 O O    . HOH S .   ? 0.1636 0.1713 0.1544 -0.0438 0.0001  0.0049  2182 HOH B O    
4416 O O    . HOH S .   ? 0.1266 0.2774 0.1418 0.0026  0.0278  -0.0597 2183 HOH B O    
4417 O O    . HOH S .   ? 0.2072 0.1397 0.2511 -0.0350 -0.0973 -0.0132 2184 HOH B O    
4418 O O    . HOH S .   ? 0.1072 0.0643 0.1305 0.0018  -0.0233 0.0194  2185 HOH B O    
4419 O O    . HOH S .   ? 0.2721 0.4308 0.5640 -0.0648 -0.0678 0.0460  2186 HOH B O    
4420 O O    . HOH S .   ? 0.1759 0.1637 0.1082 0.0532  -0.0296 -0.0167 2187 HOH B O    
4421 O O    . HOH S .   ? 0.4591 0.3367 0.4549 -0.0759 -0.0677 0.0632  2188 HOH B O    
4422 O O    . HOH S .   ? 0.8240 0.8240 0.8240 0.0000  0.0000  0.0000  2189 HOH B O    
4423 O O    . HOH S .   ? 0.0921 0.0904 0.0981 -0.0002 0.0008  0.0021  2190 HOH B O    
4424 O O    . HOH S .   ? 0.1646 0.1459 0.1948 -0.0040 -0.0566 -0.0276 2191 HOH B O    
4425 O O    . HOH S .   ? 0.1054 0.0898 0.1031 -0.0042 -0.0183 0.0342  2192 HOH B O    
4426 O O    . HOH S .   ? 0.1673 0.1565 0.1665 0.0032  -0.0037 0.0055  2193 HOH B O    
4427 O O    . HOH S .   ? 0.5051 0.6417 0.3754 -0.1345 0.2301  0.1591  2194 HOH B O    
4428 O O    . HOH S .   ? 0.3815 0.3721 0.2305 -0.0149 -0.0146 -0.0863 2195 HOH B O    
4429 O O    . HOH S .   ? 0.2132 0.1296 0.1540 0.0207  0.0114  0.0224  2196 HOH B O    
4430 O O    . HOH S .   ? 0.1744 0.1365 0.1411 -0.0301 -0.0196 0.0001  2197 HOH B O    
4431 O O    . HOH S .   ? 0.1707 0.2052 0.3559 -0.0242 -0.1180 0.0357  2198 HOH B O    
4432 O O    . HOH S .   ? 0.1155 0.4256 0.2002 0.0113  -0.0195 -0.0293 2199 HOH B O    
4433 O O    . HOH S .   ? 0.2553 0.8218 0.2112 0.1814  -0.0352 -0.1593 2200 HOH B O    
4434 O O    . HOH S .   ? 0.1487 0.2652 0.1143 0.0584  -0.0348 -0.0217 2201 HOH B O    
4435 O O    . HOH S .   ? 0.6674 0.2606 0.3370 0.1440  0.2219  0.0557  2202 HOH B O    
4436 O O    . HOH S .   ? 0.2052 0.4453 0.6919 0.1947  -0.0186 -0.1452 2203 HOH B O    
4437 O O    . HOH S .   ? 0.1223 0.1528 0.1279 -0.0140 -0.0126 -0.0073 2204 HOH B O    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  MET 30  30  30  MET MET A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  CYS 40  40  40  CYS CYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  IAS 67  67  67  IAS IAS A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  CYS 72  72  72  CYS CYS A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
B 1 1   LYS 1   1   1   LYS LYS B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   ALA 6   6   6   ALA ALA B . n 
B 1 7   LYS 7   7   7   LYS LYS B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  ARG 10  10  10  ARG ARG B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  HIS 12  12  12  HIS HIS B . n 
B 1 13  MET 13  13  13  MET MET B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  SER 15  15  15  SER SER B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  SER 21  21  21  SER SER B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  TYR 25  25  25  TYR TYR B . n 
B 1 26  CYS 26  26  26  CYS CYS B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  MET 29  29  29  MET MET B . n 
B 1 30  MET 30  30  30  MET MET B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  ASN 34  34  34  ASN ASN B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  LYS 37  37  37  LYS LYS B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  CYS 40  40  40  CYS CYS B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  HIS 48  48  48  HIS HIS B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  CYS 58  58  58  CYS CYS B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  ASN 62  62  62  ASN ASN B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  CYS 65  65  65  CYS CYS B . n 
B 1 66  LYS 66  66  66  LYS LYS B . n 
B 1 67  IAS 67  67  67  IAS IAS B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ASN 71  71  71  ASN ASN B . n 
B 1 72  CYS 72  72  72  CYS CYS B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  SER 80  80  80  SER SER B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  TYR 92  92  92  TYR TYR B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  ASN 94  94  94  ASN ASN B . n 
B 1 95  CYS 95  95  95  CYS CYS B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 THR 100 100 100 THR THR B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 ASN 103 103 103 ASN ASN B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 HIS 105 105 105 HIS HIS B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 GLY 112 112 112 GLY GLY B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 PRO 117 117 117 PRO PRO B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 HIS 119 119 119 HIS HIS B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   125  125  SO4 SO4 A . 
D 3 ACT 1   600  600  ACT ACT A . 
E 4 IPA 1   800  800  IPA IPA A . 
F 4 IPA 1   801  801  IPA IPA A . 
G 4 IPA 1   802  802  IPA IPA A . 
H 4 IPA 1   803  803  IPA IPA A . 
I 2 SO4 1   125  125  SO4 SO4 B . 
J 2 SO4 1   126  126  SO4 SO4 B . 
K 3 ACT 1   600  600  ACT ACT B . 
L 3 ACT 1   601  601  ACT ACT B . 
M 3 ACT 1   602  602  ACT ACT B . 
N 4 IPA 1   800  800  IPA IPA B . 
O 4 IPA 1   801  801  IPA IPA B . 
P 4 IPA 1   804  804  IPA IPA B . 
Q 4 IPA 1   805  805  IPA IPA B . 
R 5 HOH 1   2001 2001 HOH HOH A . 
R 5 HOH 2   2002 2002 HOH HOH A . 
R 5 HOH 3   2003 2003 HOH HOH A . 
R 5 HOH 4   2004 2004 HOH HOH A . 
R 5 HOH 5   2005 2005 HOH HOH A . 
R 5 HOH 6   2006 2006 HOH HOH A . 
R 5 HOH 7   2007 2007 HOH HOH A . 
R 5 HOH 8   2008 2008 HOH HOH A . 
R 5 HOH 9   2009 2009 HOH HOH A . 
R 5 HOH 10  2010 2010 HOH HOH A . 
R 5 HOH 11  2011 2011 HOH HOH A . 
R 5 HOH 12  2012 2012 HOH HOH A . 
R 5 HOH 13  2013 2013 HOH HOH A . 
R 5 HOH 14  2014 2014 HOH HOH A . 
R 5 HOH 15  2015 2015 HOH HOH A . 
R 5 HOH 16  2016 2016 HOH HOH A . 
R 5 HOH 17  2017 2017 HOH HOH A . 
R 5 HOH 18  2018 2018 HOH HOH A . 
R 5 HOH 19  2019 2019 HOH HOH A . 
R 5 HOH 20  2020 2020 HOH HOH A . 
R 5 HOH 21  2021 2021 HOH HOH A . 
R 5 HOH 22  2022 2022 HOH HOH A . 
R 5 HOH 23  2023 2023 HOH HOH A . 
R 5 HOH 24  2024 2024 HOH HOH A . 
R 5 HOH 25  2025 2025 HOH HOH A . 
R 5 HOH 26  2026 2026 HOH HOH A . 
R 5 HOH 27  2027 2027 HOH HOH A . 
R 5 HOH 28  2028 2028 HOH HOH A . 
R 5 HOH 29  2029 2029 HOH HOH A . 
R 5 HOH 30  2030 2030 HOH HOH A . 
R 5 HOH 31  2031 2031 HOH HOH A . 
R 5 HOH 32  2032 2032 HOH HOH A . 
R 5 HOH 33  2033 2033 HOH HOH A . 
R 5 HOH 34  2034 2034 HOH HOH A . 
R 5 HOH 35  2035 2035 HOH HOH A . 
R 5 HOH 36  2036 2036 HOH HOH A . 
R 5 HOH 37  2037 2037 HOH HOH A . 
R 5 HOH 38  2038 2038 HOH HOH A . 
R 5 HOH 39  2039 2039 HOH HOH A . 
R 5 HOH 40  2040 2040 HOH HOH A . 
R 5 HOH 41  2041 2041 HOH HOH A . 
R 5 HOH 42  2042 2042 HOH HOH A . 
R 5 HOH 43  2043 2043 HOH HOH A . 
R 5 HOH 44  2044 2044 HOH HOH A . 
R 5 HOH 45  2045 2045 HOH HOH A . 
R 5 HOH 46  2046 2046 HOH HOH A . 
R 5 HOH 47  2047 2047 HOH HOH A . 
R 5 HOH 48  2048 2048 HOH HOH A . 
R 5 HOH 49  2049 2049 HOH HOH A . 
R 5 HOH 50  2050 2050 HOH HOH A . 
R 5 HOH 51  2051 2051 HOH HOH A . 
R 5 HOH 52  2052 2052 HOH HOH A . 
R 5 HOH 53  2053 2053 HOH HOH A . 
R 5 HOH 54  2054 2054 HOH HOH A . 
R 5 HOH 55  2055 2055 HOH HOH A . 
R 5 HOH 56  2056 2056 HOH HOH A . 
R 5 HOH 57  2057 2057 HOH HOH A . 
R 5 HOH 58  2058 2058 HOH HOH A . 
R 5 HOH 59  2059 2059 HOH HOH A . 
R 5 HOH 60  2060 2060 HOH HOH A . 
R 5 HOH 61  2061 2061 HOH HOH A . 
R 5 HOH 62  2062 2062 HOH HOH A . 
R 5 HOH 63  2063 2063 HOH HOH A . 
R 5 HOH 64  2064 2064 HOH HOH A . 
R 5 HOH 65  2065 2065 HOH HOH A . 
R 5 HOH 66  2066 2066 HOH HOH A . 
R 5 HOH 67  2067 2067 HOH HOH A . 
R 5 HOH 68  2068 2068 HOH HOH A . 
R 5 HOH 69  2069 2069 HOH HOH A . 
R 5 HOH 70  2070 2070 HOH HOH A . 
R 5 HOH 71  2071 2071 HOH HOH A . 
R 5 HOH 72  2072 2072 HOH HOH A . 
R 5 HOH 73  2073 2073 HOH HOH A . 
R 5 HOH 74  2074 2074 HOH HOH A . 
R 5 HOH 75  2075 2075 HOH HOH A . 
R 5 HOH 76  2076 2076 HOH HOH A . 
R 5 HOH 77  2077 2077 HOH HOH A . 
R 5 HOH 78  2078 2078 HOH HOH A . 
R 5 HOH 79  2079 2079 HOH HOH A . 
R 5 HOH 80  2080 2080 HOH HOH A . 
R 5 HOH 81  2081 2081 HOH HOH A . 
R 5 HOH 82  2082 2082 HOH HOH A . 
R 5 HOH 83  2083 2083 HOH HOH A . 
R 5 HOH 84  2084 2084 HOH HOH A . 
R 5 HOH 85  2085 2085 HOH HOH A . 
R 5 HOH 86  2086 2086 HOH HOH A . 
R 5 HOH 87  2087 2087 HOH HOH A . 
R 5 HOH 88  2088 2088 HOH HOH A . 
R 5 HOH 89  2089 2089 HOH HOH A . 
R 5 HOH 90  2090 2090 HOH HOH A . 
R 5 HOH 91  2091 2091 HOH HOH A . 
R 5 HOH 92  2092 2092 HOH HOH A . 
R 5 HOH 93  2093 2093 HOH HOH A . 
R 5 HOH 94  2094 2094 HOH HOH A . 
R 5 HOH 95  2095 2095 HOH HOH A . 
R 5 HOH 96  2096 2096 HOH HOH A . 
R 5 HOH 97  2097 2097 HOH HOH A . 
R 5 HOH 98  2098 2098 HOH HOH A . 
R 5 HOH 99  2099 2099 HOH HOH A . 
R 5 HOH 100 2100 2100 HOH HOH A . 
R 5 HOH 101 2101 2101 HOH HOH A . 
R 5 HOH 102 2102 2102 HOH HOH A . 
R 5 HOH 103 2103 2103 HOH HOH A . 
R 5 HOH 104 2104 2104 HOH HOH A . 
R 5 HOH 105 2105 2105 HOH HOH A . 
R 5 HOH 106 2106 2106 HOH HOH A . 
R 5 HOH 107 2107 2107 HOH HOH A . 
R 5 HOH 108 2108 2108 HOH HOH A . 
R 5 HOH 109 2109 2109 HOH HOH A . 
R 5 HOH 110 2110 2110 HOH HOH A . 
R 5 HOH 111 2111 2111 HOH HOH A . 
R 5 HOH 112 2112 2112 HOH HOH A . 
R 5 HOH 113 2113 2113 HOH HOH A . 
R 5 HOH 114 2114 2114 HOH HOH A . 
R 5 HOH 115 2115 2115 HOH HOH A . 
R 5 HOH 116 2116 2116 HOH HOH A . 
R 5 HOH 117 2117 2117 HOH HOH A . 
R 5 HOH 118 2118 2118 HOH HOH A . 
R 5 HOH 119 2119 2119 HOH HOH A . 
R 5 HOH 120 2120 2120 HOH HOH A . 
R 5 HOH 121 2121 2121 HOH HOH A . 
R 5 HOH 122 2122 2122 HOH HOH A . 
R 5 HOH 123 2123 2123 HOH HOH A . 
R 5 HOH 124 2124 2124 HOH HOH A . 
R 5 HOH 125 2125 2125 HOH HOH A . 
R 5 HOH 126 2126 2126 HOH HOH A . 
R 5 HOH 127 2127 2127 HOH HOH A . 
R 5 HOH 128 2128 2128 HOH HOH A . 
R 5 HOH 129 2129 2129 HOH HOH A . 
R 5 HOH 130 2130 2130 HOH HOH A . 
R 5 HOH 131 2131 2131 HOH HOH A . 
R 5 HOH 132 2132 2132 HOH HOH A . 
R 5 HOH 133 2133 2133 HOH HOH A . 
R 5 HOH 134 2134 2134 HOH HOH A . 
R 5 HOH 135 2135 2135 HOH HOH A . 
R 5 HOH 136 2136 2136 HOH HOH A . 
R 5 HOH 137 2137 2137 HOH HOH A . 
R 5 HOH 138 2138 2138 HOH HOH A . 
R 5 HOH 139 2139 2139 HOH HOH A . 
R 5 HOH 140 2140 2140 HOH HOH A . 
R 5 HOH 141 2141 2141 HOH HOH A . 
R 5 HOH 142 2142 2142 HOH HOH A . 
R 5 HOH 143 2143 2143 HOH HOH A . 
R 5 HOH 144 2144 2144 HOH HOH A . 
R 5 HOH 145 2145 2145 HOH HOH A . 
R 5 HOH 146 2146 2146 HOH HOH A . 
R 5 HOH 147 2147 2147 HOH HOH A . 
R 5 HOH 148 2148 2148 HOH HOH A . 
R 5 HOH 149 2149 2149 HOH HOH A . 
R 5 HOH 150 2150 2150 HOH HOH A . 
R 5 HOH 151 2151 2151 HOH HOH A . 
R 5 HOH 152 2152 2152 HOH HOH A . 
R 5 HOH 153 2153 2153 HOH HOH A . 
R 5 HOH 154 2154 2154 HOH HOH A . 
R 5 HOH 155 2155 2155 HOH HOH A . 
R 5 HOH 156 2156 2156 HOH HOH A . 
R 5 HOH 157 2157 2157 HOH HOH A . 
R 5 HOH 158 2158 2158 HOH HOH A . 
R 5 HOH 159 2159 2159 HOH HOH A . 
R 5 HOH 160 2160 2160 HOH HOH A . 
R 5 HOH 161 2161 2161 HOH HOH A . 
R 5 HOH 162 2162 2162 HOH HOH A . 
R 5 HOH 163 2163 2163 HOH HOH A . 
R 5 HOH 164 2164 2164 HOH HOH A . 
R 5 HOH 165 2165 2165 HOH HOH A . 
R 5 HOH 166 2166 2166 HOH HOH A . 
R 5 HOH 167 2167 2167 HOH HOH A . 
R 5 HOH 168 2168 2168 HOH HOH A . 
R 5 HOH 169 2169 2169 HOH HOH A . 
R 5 HOH 170 2170 2170 HOH HOH A . 
R 5 HOH 171 2171 2171 HOH HOH A . 
R 5 HOH 172 2172 2172 HOH HOH A . 
R 5 HOH 173 2173 2173 HOH HOH A . 
R 5 HOH 174 2174 2174 HOH HOH A . 
R 5 HOH 175 2175 2175 HOH HOH A . 
R 5 HOH 176 2176 2176 HOH HOH A . 
R 5 HOH 177 2177 2177 HOH HOH A . 
S 5 HOH 1   2001 2001 HOH HOH B . 
S 5 HOH 2   2002 2002 HOH HOH B . 
S 5 HOH 3   2003 2003 HOH HOH B . 
S 5 HOH 4   2004 2004 HOH HOH B . 
S 5 HOH 5   2005 2005 HOH HOH B . 
S 5 HOH 6   2006 2006 HOH HOH B . 
S 5 HOH 7   2007 2007 HOH HOH B . 
S 5 HOH 8   2008 2008 HOH HOH B . 
S 5 HOH 9   2009 2009 HOH HOH B . 
S 5 HOH 10  2010 2010 HOH HOH B . 
S 5 HOH 11  2011 2011 HOH HOH B . 
S 5 HOH 12  2012 2012 HOH HOH B . 
S 5 HOH 13  2013 2013 HOH HOH B . 
S 5 HOH 14  2014 2014 HOH HOH B . 
S 5 HOH 15  2015 2015 HOH HOH B . 
S 5 HOH 16  2016 2016 HOH HOH B . 
S 5 HOH 17  2017 2017 HOH HOH B . 
S 5 HOH 18  2018 2018 HOH HOH B . 
S 5 HOH 19  2019 2019 HOH HOH B . 
S 5 HOH 20  2020 2020 HOH HOH B . 
S 5 HOH 21  2021 2021 HOH HOH B . 
S 5 HOH 22  2022 2022 HOH HOH B . 
S 5 HOH 23  2023 2023 HOH HOH B . 
S 5 HOH 24  2024 2024 HOH HOH B . 
S 5 HOH 25  2025 2025 HOH HOH B . 
S 5 HOH 26  2026 2026 HOH HOH B . 
S 5 HOH 27  2027 2027 HOH HOH B . 
S 5 HOH 28  2028 2028 HOH HOH B . 
S 5 HOH 29  2029 2029 HOH HOH B . 
S 5 HOH 30  2030 2030 HOH HOH B . 
S 5 HOH 31  2031 2031 HOH HOH B . 
S 5 HOH 32  2032 2032 HOH HOH B . 
S 5 HOH 33  2033 2033 HOH HOH B . 
S 5 HOH 34  2034 2034 HOH HOH B . 
S 5 HOH 35  2035 2035 HOH HOH B . 
S 5 HOH 36  2036 2036 HOH HOH B . 
S 5 HOH 37  2037 2037 HOH HOH B . 
S 5 HOH 38  2038 2038 HOH HOH B . 
S 5 HOH 39  2039 2039 HOH HOH B . 
S 5 HOH 40  2040 2040 HOH HOH B . 
S 5 HOH 41  2041 2041 HOH HOH B . 
S 5 HOH 42  2042 2042 HOH HOH B . 
S 5 HOH 43  2043 2043 HOH HOH B . 
S 5 HOH 44  2044 2044 HOH HOH B . 
S 5 HOH 45  2045 2045 HOH HOH B . 
S 5 HOH 46  2046 2046 HOH HOH B . 
S 5 HOH 47  2047 2047 HOH HOH B . 
S 5 HOH 48  2048 2048 HOH HOH B . 
S 5 HOH 49  2049 2049 HOH HOH B . 
S 5 HOH 50  2050 2050 HOH HOH B . 
S 5 HOH 51  2051 2051 HOH HOH B . 
S 5 HOH 52  2052 2052 HOH HOH B . 
S 5 HOH 53  2053 2053 HOH HOH B . 
S 5 HOH 54  2054 2054 HOH HOH B . 
S 5 HOH 55  2055 2055 HOH HOH B . 
S 5 HOH 56  2056 2056 HOH HOH B . 
S 5 HOH 57  2057 2057 HOH HOH B . 
S 5 HOH 58  2058 2058 HOH HOH B . 
S 5 HOH 59  2059 2059 HOH HOH B . 
S 5 HOH 60  2060 2060 HOH HOH B . 
S 5 HOH 61  2061 2061 HOH HOH B . 
S 5 HOH 62  2062 2062 HOH HOH B . 
S 5 HOH 63  2063 2063 HOH HOH B . 
S 5 HOH 64  2064 2064 HOH HOH B . 
S 5 HOH 65  2065 2065 HOH HOH B . 
S 5 HOH 66  2066 2066 HOH HOH B . 
S 5 HOH 67  2067 2067 HOH HOH B . 
S 5 HOH 68  2068 2068 HOH HOH B . 
S 5 HOH 69  2069 2069 HOH HOH B . 
S 5 HOH 70  2070 2070 HOH HOH B . 
S 5 HOH 71  2071 2071 HOH HOH B . 
S 5 HOH 72  2072 2072 HOH HOH B . 
S 5 HOH 73  2073 2073 HOH HOH B . 
S 5 HOH 74  2074 2074 HOH HOH B . 
S 5 HOH 75  2075 2075 HOH HOH B . 
S 5 HOH 76  2076 2076 HOH HOH B . 
S 5 HOH 77  2077 2077 HOH HOH B . 
S 5 HOH 78  2078 2078 HOH HOH B . 
S 5 HOH 79  2079 2079 HOH HOH B . 
S 5 HOH 80  2080 2080 HOH HOH B . 
S 5 HOH 81  2081 2081 HOH HOH B . 
S 5 HOH 82  2082 2082 HOH HOH B . 
S 5 HOH 83  2083 2083 HOH HOH B . 
S 5 HOH 84  2084 2084 HOH HOH B . 
S 5 HOH 85  2085 2085 HOH HOH B . 
S 5 HOH 86  2086 2086 HOH HOH B . 
S 5 HOH 87  2087 2087 HOH HOH B . 
S 5 HOH 88  2088 2088 HOH HOH B . 
S 5 HOH 89  2089 2089 HOH HOH B . 
S 5 HOH 90  2090 2090 HOH HOH B . 
S 5 HOH 91  2091 2091 HOH HOH B . 
S 5 HOH 92  2092 2092 HOH HOH B . 
S 5 HOH 93  2093 2093 HOH HOH B . 
S 5 HOH 94  2094 2094 HOH HOH B . 
S 5 HOH 95  2095 2095 HOH HOH B . 
S 5 HOH 96  2096 2096 HOH HOH B . 
S 5 HOH 97  2097 2097 HOH HOH B . 
S 5 HOH 98  2098 2098 HOH HOH B . 
S 5 HOH 99  2099 2099 HOH HOH B . 
S 5 HOH 100 2100 2100 HOH HOH B . 
S 5 HOH 101 2101 2101 HOH HOH B . 
S 5 HOH 102 2102 2102 HOH HOH B . 
S 5 HOH 103 2103 2103 HOH HOH B . 
S 5 HOH 104 2104 2104 HOH HOH B . 
S 5 HOH 105 2105 2105 HOH HOH B . 
S 5 HOH 106 2106 2106 HOH HOH B . 
S 5 HOH 107 2107 2107 HOH HOH B . 
S 5 HOH 108 2108 2108 HOH HOH B . 
S 5 HOH 109 2109 2109 HOH HOH B . 
S 5 HOH 110 2110 2110 HOH HOH B . 
S 5 HOH 111 2111 2111 HOH HOH B . 
S 5 HOH 112 2112 2112 HOH HOH B . 
S 5 HOH 113 2113 2113 HOH HOH B . 
S 5 HOH 114 2114 2114 HOH HOH B . 
S 5 HOH 115 2115 2115 HOH HOH B . 
S 5 HOH 116 2116 2116 HOH HOH B . 
S 5 HOH 117 2117 2117 HOH HOH B . 
S 5 HOH 118 2118 2118 HOH HOH B . 
S 5 HOH 119 2119 2119 HOH HOH B . 
S 5 HOH 120 2120 2120 HOH HOH B . 
S 5 HOH 121 2121 2121 HOH HOH B . 
S 5 HOH 122 2122 2122 HOH HOH B . 
S 5 HOH 123 2123 2123 HOH HOH B . 
S 5 HOH 124 2124 2124 HOH HOH B . 
S 5 HOH 125 2125 2125 HOH HOH B . 
S 5 HOH 126 2126 2126 HOH HOH B . 
S 5 HOH 127 2127 2127 HOH HOH B . 
S 5 HOH 128 2128 2128 HOH HOH B . 
S 5 HOH 129 2129 2129 HOH HOH B . 
S 5 HOH 130 2130 2130 HOH HOH B . 
S 5 HOH 131 2131 2131 HOH HOH B . 
S 5 HOH 132 2132 2132 HOH HOH B . 
S 5 HOH 133 2133 2133 HOH HOH B . 
S 5 HOH 134 2134 2134 HOH HOH B . 
S 5 HOH 135 2135 2135 HOH HOH B . 
S 5 HOH 136 2136 2136 HOH HOH B . 
S 5 HOH 137 2137 2137 HOH HOH B . 
S 5 HOH 138 2138 2138 HOH HOH B . 
S 5 HOH 139 2139 2139 HOH HOH B . 
S 5 HOH 140 2140 2140 HOH HOH B . 
S 5 HOH 141 2141 2141 HOH HOH B . 
S 5 HOH 142 2142 2142 HOH HOH B . 
S 5 HOH 143 2143 2143 HOH HOH B . 
S 5 HOH 144 2144 2144 HOH HOH B . 
S 5 HOH 145 2145 2145 HOH HOH B . 
S 5 HOH 146 2146 2146 HOH HOH B . 
S 5 HOH 147 2147 2147 HOH HOH B . 
S 5 HOH 148 2148 2148 HOH HOH B . 
S 5 HOH 149 2149 2149 HOH HOH B . 
S 5 HOH 150 2150 2150 HOH HOH B . 
S 5 HOH 151 2151 2151 HOH HOH B . 
S 5 HOH 152 2152 2152 HOH HOH B . 
S 5 HOH 153 2153 2153 HOH HOH B . 
S 5 HOH 154 2154 2154 HOH HOH B . 
S 5 HOH 155 2155 2155 HOH HOH B . 
S 5 HOH 156 2156 2156 HOH HOH B . 
S 5 HOH 157 2157 2157 HOH HOH B . 
S 5 HOH 158 2158 2158 HOH HOH B . 
S 5 HOH 159 2159 2159 HOH HOH B . 
S 5 HOH 160 2160 2160 HOH HOH B . 
S 5 HOH 161 2161 2161 HOH HOH B . 
S 5 HOH 162 2162 2162 HOH HOH B . 
S 5 HOH 163 2163 2163 HOH HOH B . 
S 5 HOH 164 2164 2164 HOH HOH B . 
S 5 HOH 165 2165 2165 HOH HOH B . 
S 5 HOH 166 2166 2166 HOH HOH B . 
S 5 HOH 167 2167 2167 HOH HOH B . 
S 5 HOH 168 2168 2168 HOH HOH B . 
S 5 HOH 169 2169 2169 HOH HOH B . 
S 5 HOH 170 2170 2170 HOH HOH B . 
S 5 HOH 171 2171 2171 HOH HOH B . 
S 5 HOH 172 2172 2172 HOH HOH B . 
S 5 HOH 173 2173 2173 HOH HOH B . 
S 5 HOH 174 2174 2174 HOH HOH B . 
S 5 HOH 175 2175 2175 HOH HOH B . 
S 5 HOH 176 2176 2176 HOH HOH B . 
S 5 HOH 177 2177 2177 HOH HOH B . 
S 5 HOH 178 2178 2178 HOH HOH B . 
S 5 HOH 179 2179 2179 HOH HOH B . 
S 5 HOH 180 2180 2180 HOH HOH B . 
S 5 HOH 181 2181 2181 HOH HOH B . 
S 5 HOH 182 2182 2182 HOH HOH B . 
S 5 HOH 183 2183 2183 HOH HOH B . 
S 5 HOH 184 2184 2184 HOH HOH B . 
S 5 HOH 185 2185 2185 HOH HOH B . 
S 5 HOH 186 2186 2186 HOH HOH B . 
S 5 HOH 187 2187 2187 HOH HOH B . 
S 5 HOH 188 2188 2188 HOH HOH B . 
S 5 HOH 189 2189 2189 HOH HOH B . 
S 5 HOH 190 2190 2190 HOH HOH B . 
S 5 HOH 191 2191 2191 HOH HOH B . 
S 5 HOH 192 2192 2192 HOH HOH B . 
S 5 HOH 193 2193 2193 HOH HOH B . 
S 5 HOH 194 2194 2194 HOH HOH B . 
S 5 HOH 195 2195 2195 HOH HOH B . 
S 5 HOH 196 2196 2196 HOH HOH B . 
S 5 HOH 197 2197 2197 HOH HOH B . 
S 5 HOH 198 2198 2198 HOH HOH B . 
S 5 HOH 199 2199 2199 HOH HOH B . 
S 5 HOH 200 2200 2200 HOH HOH B . 
S 5 HOH 201 2201 2201 HOH HOH B . 
S 5 HOH 202 2202 2202 HOH HOH B . 
S 5 HOH 203 2203 2203 HOH HOH B . 
S 5 HOH 204 2204 2204 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,R       
2 1 B,I,J,K,L,M,N,O,P,Q,S 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-03-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2019-04-24 
4 'Structure model' 1 3 2019-05-22 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'       
2  2 'Structure model' 'Derived calculations'      
3  2 'Structure model' 'Non-polymer description'   
4  2 'Structure model' 'Version format compliance' 
5  3 'Structure model' Advisory                    
6  3 'Structure model' 'Data collection'           
7  3 'Structure model' 'Derived calculations'      
8  3 'Structure model' 'Experimental preparation'  
9  3 'Structure model' Other                       
10 4 'Structure model' 'Data collection'           
11 4 'Structure model' 'Refinement description'    
12 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' chem_comp                     
2  3 'Structure model' exptl_crystal_grow            
3  3 'Structure model' pdbx_database_proc            
4  3 'Structure model' pdbx_database_status          
5  3 'Structure model' pdbx_validate_polymer_linkage 
6  3 'Structure model' struct_biol                   
7  3 'Structure model' struct_conn                   
8  4 'Structure model' refine                        
9  5 'Structure model' chem_comp                     
10 5 'Structure model' diffrn_source                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_chem_comp.type'                             
2 3 'Structure model' '_exptl_crystal_grow.method'                  
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
5 4 'Structure model' '_refine.pdbx_ls_cross_valid_method'          
6 5 'Structure model' '_chem_comp.type'                             
7 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
SHELXL-97 refinement       . ? 1 ? ? ? ? 
DENZO     'data reduction' . ? 2 ? ? ? ? 
SCALEPACK 'data scaling'   . ? 3 ? ? ? ? 
SHELXL-97 phasing          . ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             1DY5 
_pdbx_entry_details.compound_details     
;POSITION 67 IS THE DEAMIDATION SITE. AT THIS POSITION THERE
 IS A BETA-ASPARTYL RESIDUE (OR ISOASPARTYL RESIDUE) WHICH
 DIFFERS FROM A NORMAL ASPARTIC ACID BY AN EXTRA METHYLENE
 GROUP IN THE MAIN CHAIN (BETWEEN CA, C), AND A SHORTER SIDE
 CHAIN (IT LACKS THE METHYLENE GROUP).
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;POSITION 67 IS THE DEAMIDATION SITE.  AT THIS POSITION
 THERE IS A BETA-ASPARTYL RESIDUE (OR ISOASPARTYL RESIDUE)
 WHICH DIFFERS FROM A NORMAL ASPARTIC ACID BY AN EXTRA
 METHYLENE GROUP IN THE MAIN CHAIN (BETWEEN CA, C), AND A
 SHORTER SIDE CHAIN (IT LACKS THE METHYLENE GROUP).
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   HZ2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   LYS 
_pdbx_validate_close_contact.auth_seq_id_1    98 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2149 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.59 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CZ 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             39 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            A 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NH1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             39 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            A 
_pdbx_validate_rmsd_bond.bond_value                1.421 
_pdbx_validate_rmsd_bond.bond_target_value         1.326 
_pdbx_validate_rmsd_bond.bond_deviation            0.095 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 OE1 A GLU 9   ? C CD  A GLU 9   ? C OE2 A GLU 9   ? C 113.27 123.30 -10.03 1.20 N 
2  1 NE  A ARG 39  ? A CZ  A ARG 39  ? A NH1 A ARG 39  ? A 133.54 120.30 13.24  0.50 N 
3  1 NE  A ARG 39  ? A CZ  A ARG 39  ? A NH2 A ARG 39  ? A 110.84 120.30 -9.46  0.50 N 
4  1 CG1 A VAL 43  ? A CB  A VAL 43  ? A CG2 A VAL 43  ? A 100.21 110.90 -10.69 1.60 N 
5  1 CB  A ASP 83  ? B CG  A ASP 83  ? B OD1 A ASP 83  ? B 131.08 118.30 12.78  0.90 N 
6  1 NE  A ARG 85  ? ? CZ  A ARG 85  ? ? NH1 A ARG 85  ? ? 125.61 120.30 5.31   0.50 N 
7  1 NE  A ARG 85  ? ? CZ  A ARG 85  ? ? NH2 A ARG 85  ? ? 114.49 120.30 -5.81  0.50 N 
8  1 CA  A SER 90  ? ? CB  A SER 90  ? B OG  A SER 90  ? B 92.51  111.20 -18.69 2.70 N 
9  1 CB  A ASN 113 ? ? CG  A ASN 113 ? ? OD1 A ASN 113 ? ? 138.16 121.60 16.56  2.00 N 
10 1 OE1 B GLU 9   ? C CD  B GLU 9   ? C OE2 B GLU 9   ? C 111.07 123.30 -12.23 1.20 N 
11 1 CB  B ASP 38  ? ? CG  B ASP 38  ? ? OD1 B ASP 38  ? ? 111.79 118.30 -6.51  0.90 N 
12 1 NE  B ARG 39  ? ? CZ  B ARG 39  ? ? NH1 B ARG 39  ? ? 129.33 120.30 9.03   0.50 N 
13 1 NE  B ARG 39  ? ? CZ  B ARG 39  ? ? NH2 B ARG 39  ? ? 114.89 120.30 -5.41  0.50 N 
14 1 CA  B MET 79  ? ? CB  B MET 79  ? B CG  B MET 79  ? B 126.07 113.30 12.77  1.70 N 
15 1 N   B ARG 85  ? ? CA  B ARG 85  ? ? CB  B ARG 85  ? B 123.07 110.60 12.47  1.80 N 
16 1 NE  B ARG 85  ? B CZ  B ARG 85  ? B NH1 B ARG 85  ? B 123.99 120.30 3.69   0.50 N 
17 1 NE  B ARG 85  ? B CZ  B ARG 85  ? B NH2 B ARG 85  ? B 116.04 120.30 -4.26  0.50 N 
18 1 CD  B LYS 98  ? ? CE  B LYS 98  ? ? NZ  B LYS 98  ? ? 133.48 111.70 21.78  2.30 N 
19 1 CG  B HIS 105 ? ? ND1 B HIS 105 ? ? CE1 B HIS 105 ? ? 115.04 109.00 6.04   1.00 N 
20 1 OE1 B GLU 111 ? ? CD  B GLU 111 ? ? OE2 B GLU 111 ? ? 138.36 123.30 15.06  1.20 N 
21 1 CG  B GLU 111 ? ? CD  B GLU 111 ? ? OE2 B GLU 111 ? ? 105.00 118.30 -13.30 2.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 48 ? ? -103.05 66.93   
2 1 GLN A 60 ? ? -100.37 -133.35 
3 1 GLN A 69 ? ? -100.97 -132.77 
4 1 ASN A 71 ? ? -86.65  39.84   
5 1 ASN B 34 ? ? 70.57   33.72   
6 1 HIS B 48 ? ? -101.01 65.89   
7 1 GLN B 60 ? ? -101.60 -131.85 
8 1 GLN B 69 ? ? -98.77  -121.40 
9 1 ASN B 71 ? ? -89.96  39.56   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B LYS 31 ? CE ? B LYS 31 CE 
2 1 Y 1 B LYS 31 ? NZ ? B LYS 31 NZ 
3 1 Y 1 B LYS 37 ? CG ? B LYS 37 CG 
4 1 Y 1 B LYS 37 ? CD ? B LYS 37 CD 
5 1 Y 1 B LYS 37 ? CE ? B LYS 37 CE 
6 1 Y 1 B LYS 37 ? NZ ? B LYS 37 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'       SO4 
3 'ACETATE ION'       ACT 
4 'ISOPROPYL ALCOHOL' IPA 
5 water               HOH 
#