data_1EFA
# 
_entry.id   1EFA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EFA         
NDB   PD0118       
RCSB  RCSB010522   
WWPDB D_1000010522 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EFA 
_pdbx_database_status.recvd_initial_deposition_date   2000-02-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bell, C.E.' 1 
'Lewis, M.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A closer view of the conformation of the Lac repressor bound to operator.' Nat.Struct.Biol. 7   209  214  2000 NSBIEW US 
1072-8368 2024 ? 10700279 10.1038/78907                   
1       'Crystal structure of the lactose operon repressor and its complexes with DNA and inducer' Science          271 1247 1254 
1996 SCIEAS US 0036-8075 0038 ? ?        ?                               
2       'Crystal structure of lac repressor core tetramer and its implications for DNA looping' Science          268 1721 1727 
1995 SCIEAS US 0036-8075 0038 ? ?        ?                               
3       
;The solution structure of lac repressor headpiece 62 complexed to a symmetrical lac operator sequence determined by NMR and restrained molecular dynamics
;
Structure        7   1483 1492 1999 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(00)88339-2' 
4       
;Refined structure of lac repressor headpiece (1-56) determined by relaxation matrix calculations from 2D and 3D NOE data: change of tertiary structure upon binding to the lac operator
;
J.Mol.Biol.      259 761  773  1996 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1996.0356          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, C.E.'       1  ? 
primary 'Lewis, M.'        2  ? 
1       'Lewis, M.'        3  ? 
1       'Chang, G.'        4  ? 
1       'Horton, N.C.'     5  ? 
1       'Kercher, M.A.'    6  ? 
1       'Pace, H.C.'       7  ? 
2       'Friedman, A.M.'   8  ? 
2       'Fischmann, T.O.'  9  ? 
2       'Steitz, T.A.'     10 ? 
3       'Spronk, C.A.E.M.' 11 ? 
3       'Bonvin, A.M.J.J.' 12 ? 
3       'Radha, P.K.'      13 ? 
3       'Melacini, G.'     14 ? 
3       'Boelens, R.'      15 ? 
4       'Slijper, M.'      16 ? 
4       'Bonvin, A.M.'     17 ? 
4       'Boelens, R.'      18 ? 
4       'Kaptein, R.'      19 ? 
# 
_cell.entry_id           1EFA 
_cell.length_a           251.438 
_cell.length_b           251.438 
_cell.length_c           204.791 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              54 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EFA 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     trigonal 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*AP*AP*T*TP*GP*TP*GP*AP*GP*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*T)-3')
;
6462.196  2  ? ?         ?                ? 
2 polymer     man 'LAC REPRESSOR'                                                                35756.797 3  ? ALA109THR 
'RESIDUES 1-333' ? 
3 non-polymer syn '2-nitrophenyl beta-D-fucopyranoside'                                          285.250   3  ? ?         ? ? 
4 water       nat water                                                                          18.015    62 ? ?         ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DG)(DA)(DA)(DT)(DT)(DG)(DT)(DG)(DA)(DG)(DC)(DG)(DC)(DT)(DC)(DA)(DC)(DA)(DA)(DT)
(DT)
;
GAATTGTGAGCGCTCACAATT D,E   ? 
2 'polypeptide(L)'        no no 
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPN
;
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPN
;
A,B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DA  n 
1 3   DA  n 
1 4   DT  n 
1 5   DT  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DA  n 
1 10  DG  n 
1 11  DC  n 
1 12  DG  n 
1 13  DC  n 
1 14  DT  n 
1 15  DC  n 
1 16  DA  n 
1 17  DC  n 
1 18  DA  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
2 1   MET n 
2 2   LYS n 
2 3   PRO n 
2 4   VAL n 
2 5   THR n 
2 6   LEU n 
2 7   TYR n 
2 8   ASP n 
2 9   VAL n 
2 10  ALA n 
2 11  GLU n 
2 12  TYR n 
2 13  ALA n 
2 14  GLY n 
2 15  VAL n 
2 16  SER n 
2 17  TYR n 
2 18  GLN n 
2 19  THR n 
2 20  VAL n 
2 21  SER n 
2 22  ARG n 
2 23  VAL n 
2 24  VAL n 
2 25  ASN n 
2 26  GLN n 
2 27  ALA n 
2 28  SER n 
2 29  HIS n 
2 30  VAL n 
2 31  SER n 
2 32  ALA n 
2 33  LYS n 
2 34  THR n 
2 35  ARG n 
2 36  GLU n 
2 37  LYS n 
2 38  VAL n 
2 39  GLU n 
2 40  ALA n 
2 41  ALA n 
2 42  MET n 
2 43  ALA n 
2 44  GLU n 
2 45  LEU n 
2 46  ASN n 
2 47  TYR n 
2 48  ILE n 
2 49  PRO n 
2 50  ASN n 
2 51  ARG n 
2 52  VAL n 
2 53  ALA n 
2 54  GLN n 
2 55  GLN n 
2 56  LEU n 
2 57  ALA n 
2 58  GLY n 
2 59  LYS n 
2 60  GLN n 
2 61  SER n 
2 62  LEU n 
2 63  LEU n 
2 64  ILE n 
2 65  GLY n 
2 66  VAL n 
2 67  ALA n 
2 68  THR n 
2 69  SER n 
2 70  SER n 
2 71  LEU n 
2 72  ALA n 
2 73  LEU n 
2 74  HIS n 
2 75  ALA n 
2 76  PRO n 
2 77  SER n 
2 78  GLN n 
2 79  ILE n 
2 80  VAL n 
2 81  ALA n 
2 82  ALA n 
2 83  ILE n 
2 84  LYS n 
2 85  SER n 
2 86  ARG n 
2 87  ALA n 
2 88  ASP n 
2 89  GLN n 
2 90  LEU n 
2 91  GLY n 
2 92  ALA n 
2 93  SER n 
2 94  VAL n 
2 95  VAL n 
2 96  VAL n 
2 97  SER n 
2 98  MET n 
2 99  VAL n 
2 100 GLU n 
2 101 ARG n 
2 102 SER n 
2 103 GLY n 
2 104 VAL n 
2 105 GLU n 
2 106 ALA n 
2 107 CYS n 
2 108 LYS n 
2 109 THR n 
2 110 ALA n 
2 111 VAL n 
2 112 HIS n 
2 113 ASN n 
2 114 LEU n 
2 115 LEU n 
2 116 ALA n 
2 117 GLN n 
2 118 ARG n 
2 119 VAL n 
2 120 SER n 
2 121 GLY n 
2 122 LEU n 
2 123 ILE n 
2 124 ILE n 
2 125 ASN n 
2 126 TYR n 
2 127 PRO n 
2 128 LEU n 
2 129 ASP n 
2 130 ASP n 
2 131 GLN n 
2 132 ASP n 
2 133 ALA n 
2 134 ILE n 
2 135 ALA n 
2 136 VAL n 
2 137 GLU n 
2 138 ALA n 
2 139 ALA n 
2 140 CYS n 
2 141 THR n 
2 142 ASN n 
2 143 VAL n 
2 144 PRO n 
2 145 ALA n 
2 146 LEU n 
2 147 PHE n 
2 148 LEU n 
2 149 ASP n 
2 150 VAL n 
2 151 SER n 
2 152 ASP n 
2 153 GLN n 
2 154 THR n 
2 155 PRO n 
2 156 ILE n 
2 157 ASN n 
2 158 SER n 
2 159 ILE n 
2 160 ILE n 
2 161 PHE n 
2 162 SER n 
2 163 HIS n 
2 164 GLU n 
2 165 ASP n 
2 166 GLY n 
2 167 THR n 
2 168 ARG n 
2 169 LEU n 
2 170 GLY n 
2 171 VAL n 
2 172 GLU n 
2 173 HIS n 
2 174 LEU n 
2 175 VAL n 
2 176 ALA n 
2 177 LEU n 
2 178 GLY n 
2 179 HIS n 
2 180 GLN n 
2 181 GLN n 
2 182 ILE n 
2 183 ALA n 
2 184 LEU n 
2 185 LEU n 
2 186 ALA n 
2 187 GLY n 
2 188 PRO n 
2 189 LEU n 
2 190 SER n 
2 191 SER n 
2 192 VAL n 
2 193 SER n 
2 194 ALA n 
2 195 ARG n 
2 196 LEU n 
2 197 ARG n 
2 198 LEU n 
2 199 ALA n 
2 200 GLY n 
2 201 TRP n 
2 202 HIS n 
2 203 LYS n 
2 204 TYR n 
2 205 LEU n 
2 206 THR n 
2 207 ARG n 
2 208 ASN n 
2 209 GLN n 
2 210 ILE n 
2 211 GLN n 
2 212 PRO n 
2 213 ILE n 
2 214 ALA n 
2 215 GLU n 
2 216 ARG n 
2 217 GLU n 
2 218 GLY n 
2 219 ASP n 
2 220 TRP n 
2 221 SER n 
2 222 ALA n 
2 223 MET n 
2 224 SER n 
2 225 GLY n 
2 226 PHE n 
2 227 GLN n 
2 228 GLN n 
2 229 THR n 
2 230 MET n 
2 231 GLN n 
2 232 MET n 
2 233 LEU n 
2 234 ASN n 
2 235 GLU n 
2 236 GLY n 
2 237 ILE n 
2 238 VAL n 
2 239 PRO n 
2 240 THR n 
2 241 ALA n 
2 242 MET n 
2 243 LEU n 
2 244 VAL n 
2 245 ALA n 
2 246 ASN n 
2 247 ASP n 
2 248 GLN n 
2 249 MET n 
2 250 ALA n 
2 251 LEU n 
2 252 GLY n 
2 253 ALA n 
2 254 MET n 
2 255 ARG n 
2 256 ALA n 
2 257 ILE n 
2 258 THR n 
2 259 GLU n 
2 260 SER n 
2 261 GLY n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 GLY n 
2 266 ALA n 
2 267 ASP n 
2 268 ILE n 
2 269 SER n 
2 270 VAL n 
2 271 VAL n 
2 272 GLY n 
2 273 TYR n 
2 274 ASP n 
2 275 ASP n 
2 276 THR n 
2 277 GLU n 
2 278 ASP n 
2 279 SER n 
2 280 SER n 
2 281 CYS n 
2 282 TYR n 
2 283 ILE n 
2 284 PRO n 
2 285 PRO n 
2 286 LEU n 
2 287 THR n 
2 288 THR n 
2 289 ILE n 
2 290 LYS n 
2 291 GLN n 
2 292 ASP n 
2 293 PHE n 
2 294 ARG n 
2 295 LEU n 
2 296 LEU n 
2 297 GLY n 
2 298 GLN n 
2 299 THR n 
2 300 SER n 
2 301 VAL n 
2 302 ASP n 
2 303 ARG n 
2 304 LEU n 
2 305 LEU n 
2 306 GLN n 
2 307 LEU n 
2 308 SER n 
2 309 GLN n 
2 310 GLY n 
2 311 GLN n 
2 312 ALA n 
2 313 VAL n 
2 314 LYS n 
2 315 GLY n 
2 316 ASN n 
2 317 GLN n 
2 318 LEU n 
2 319 LEU n 
2 320 PRO n 
2 321 VAL n 
2 322 SER n 
2 323 LEU n 
2 324 VAL n 
2 325 LYS n 
2 326 ARG n 
2 327 LYS n 
2 328 THR n 
2 329 THR n 
2 330 LEU n 
2 331 ALA n 
2 332 PRO n 
2 333 ASN n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP LACI_ECOLI P03023 2 1 ? ? 
2 PDB 1EFA       1EFA   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EFA A 1 ? 333 ? P03023 1 ? 333 ? 1 333 
2 1 1EFA B 1 ? 333 ? P03023 1 ? 333 ? 1 333 
3 1 1EFA C 1 ? 333 ? P03023 1 ? 333 ? 1 333 
4 2 1EFA D 1 ? 21  ? 1EFA   1 ? 21  ? 1 21  
5 2 1EFA E 1 ? 21  ? 1EFA   1 ? 21  ? 1 21  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EFA THR A 109 ? UNP P03023 ALA 109 engineered 109 1 
2 1EFA THR B 109 ? UNP P03023 ALA 109 engineered 109 2 
3 1EFA THR C 109 ? UNP P03023 ALA 109 engineered 109 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"   ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"          ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'   149.211 
NPF D-saccharide        n '2-nitrophenyl beta-D-fucopyranoside' ? 'C12 H15 N O7'    285.250 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1EFA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, PEG 400, HEPES, Glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 HEPES              ? ? ? 
1 2 1 'ammonium sulfate' ? ? ? 
1 3 1 'PEG 400'          ? ? ? 
1 4 1 Glycerol           ? ? ? 
1 5 2 'ammonium sulfate' ? ? ? 
1 6 2 'PEG 400'          ? ? ? 
1 7 2 Glycerol           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRANDEIS - B4' 
_diffrn_detector.pdbx_collection_date   1999-01-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.1000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EFA 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             17.0 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   74896 
_reflns.number_all                   75989 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.0660000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.5 
_reflns.B_iso_Wilson_estimate        43.8 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_k_max                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.68 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.4020000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6272 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EFA 
_refine.ls_number_reflns_obs                     69506 
_refine.ls_number_reflns_all                     75989 
_refine.pdbx_ls_sigma_I                          -3 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               953713.59 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    93.1 
_refine.ls_R_factor_obs                          0.2470000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2470000 
_refine.ls_R_factor_R_free                       0.2640000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3485 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               69.2 
_refine.aniso_B[1][1]                            -1.63 
_refine.aniso_B[2][2]                            -1.63 
_refine.aniso_B[3][3]                            3.26 
_refine.aniso_B[1][2]                            7.39 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.477 
_refine.solvent_model_param_bsol                 70.17 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EFA 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7022 
_refine_hist.pdbx_number_atoms_nucleic_acid   694 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             62 
_refine_hist.number_atoms_total               7838 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.10  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.82  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.48  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        0.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       1.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             9977 
_refine_ls_shell.R_factor_R_work                  0.3320000 
_refine_ls_shell.percent_reflns_obs               84.9 
_refine_ls_shell.R_factor_R_free                  0.3390000 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             510 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PA PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PA DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARA WATER.TOP   'X-RAY DIFFRACTION' 
4 PARAM.ONPF     TOP.ONPF    'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1EFA 
_struct.title                     'CRYSTAL STRUCTURE OF THE LAC REPRESSOR DIMER BOUND TO OPERATOR AND THE ANTI-INDUCER ONPF' 
_struct.pdbx_descriptor           'LAC REPRESSOR/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EFA 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'protein-dna complex, helix-turn-helix, gene regulation, molecular switch, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 5   ? TYR C 12  ? THR A 5   TYR A 12  1 ? 8  
HELX_P HELX_P2  2  SER C 16  ? ASN C 25  ? SER A 16  ASN A 25  1 ? 10 
HELX_P HELX_P3  3  ALA C 32  ? ASN C 46  ? ALA A 32  ASN A 46  1 ? 15 
HELX_P HELX_P4  4  ASN C 50  ? ALA C 57  ? ASN A 50  ALA A 57  1 ? 8  
HELX_P HELX_P5  5  LEU C 73  ? LEU C 90  ? LEU A 73  LEU A 90  1 ? 18 
HELX_P HELX_P6  6  GLY C 103 ? GLN C 117 ? GLY A 103 GLN A 117 1 ? 15 
HELX_P HELX_P7  7  ASP C 129 ? CYS C 140 ? ASP A 129 CYS A 140 1 ? 12 
HELX_P HELX_P8  8  SER C 162 ? LEU C 177 ? SER A 162 LEU A 177 1 ? 16 
HELX_P HELX_P9  9  SER C 191 ? ARG C 207 ? SER A 191 ARG A 207 1 ? 17 
HELX_P HELX_P10 10 SER C 221 ? GLU C 235 ? SER A 221 GLU A 235 1 ? 15 
HELX_P HELX_P11 11 ASN C 246 ? GLU C 259 ? ASN A 246 GLU A 259 1 ? 14 
HELX_P HELX_P12 12 THR C 276 ? TYR C 282 ? THR A 276 TYR A 282 5 ? 7  
HELX_P HELX_P13 13 ASP C 292 ? GLN C 309 ? ASP A 292 GLN A 309 1 ? 18 
HELX_P HELX_P14 14 THR D 5   ? TYR D 12  ? THR B 5   TYR B 12  1 ? 8  
HELX_P HELX_P15 15 SER D 16  ? ASN D 25  ? SER B 16  ASN B 25  1 ? 10 
HELX_P HELX_P16 16 ALA D 32  ? LEU D 45  ? ALA B 32  LEU B 45  1 ? 14 
HELX_P HELX_P17 17 ASN D 50  ? ALA D 57  ? ASN B 50  ALA B 57  1 ? 8  
HELX_P HELX_P18 18 LEU D 73  ? LEU D 90  ? LEU B 73  LEU B 90  1 ? 18 
HELX_P HELX_P19 19 GLY D 103 ? GLN D 117 ? GLY B 103 GLN B 117 1 ? 15 
HELX_P HELX_P20 20 ASP D 129 ? CYS D 140 ? ASP B 129 CYS B 140 1 ? 12 
HELX_P HELX_P21 21 SER D 162 ? LEU D 177 ? SER B 162 LEU B 177 1 ? 16 
HELX_P HELX_P22 22 SER D 191 ? ARG D 207 ? SER B 191 ARG B 207 1 ? 17 
HELX_P HELX_P23 23 SER D 221 ? GLU D 235 ? SER B 221 GLU B 235 1 ? 15 
HELX_P HELX_P24 24 ASN D 246 ? GLU D 259 ? ASN B 246 GLU B 259 1 ? 14 
HELX_P HELX_P25 25 GLU D 277 ? TYR D 282 ? GLU B 277 TYR B 282 5 ? 6  
HELX_P HELX_P26 26 ASP D 292 ? GLN D 309 ? ASP B 292 GLN B 309 1 ? 18 
HELX_P HELX_P27 27 ASN E 50  ? ALA E 57  ? ASN C 50  ALA C 57  1 ? 8  
HELX_P HELX_P28 28 LEU E 73  ? LEU E 90  ? LEU C 73  LEU C 90  1 ? 18 
HELX_P HELX_P29 29 GLY E 103 ? GLN E 117 ? GLY C 103 GLN C 117 1 ? 15 
HELX_P HELX_P30 30 ASP E 129 ? CYS E 140 ? ASP C 129 CYS C 140 1 ? 12 
HELX_P HELX_P31 31 SER E 162 ? LEU E 177 ? SER C 162 LEU C 177 1 ? 16 
HELX_P HELX_P32 32 SER E 191 ? ARG E 207 ? SER C 191 ARG C 207 1 ? 17 
HELX_P HELX_P33 33 SER E 221 ? GLU E 235 ? SER C 221 GLU C 235 1 ? 15 
HELX_P HELX_P34 34 ASN E 246 ? GLU E 259 ? ASN C 246 GLU C 259 1 ? 14 
HELX_P HELX_P35 35 GLU E 277 ? TYR E 282 ? GLU C 277 TYR C 282 5 ? 6  
HELX_P HELX_P36 36 ASP E 292 ? GLN E 309 ? ASP C 292 GLN C 309 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DC 17 N4 ? ? D DT 5  E DC 17 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? ? 
hydrog2  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 18 N1 ? ? D DT 5  E DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog3  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 18 N6 ? ? D DT 5  E DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog4  hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DA 16 N6 ? ? D DG 6  E DA 16 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ? ? ? 
hydrog5  hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 17 N3 ? ? D DG 6  E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog6  hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 17 O2 ? ? D DG 6  E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog7  hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 17 N4 ? ? D DG 6  E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog8  hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DC 15 N4 ? ? D DT 7  E DC 15 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? ? 
hydrog9  hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 16 N1 ? ? D DT 7  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog10 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 16 N6 ? ? D DT 7  E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog11 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 15 N3 ? ? D DG 8  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog12 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 15 O2 ? ? D DG 8  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog13 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 15 N4 ? ? D DG 8  E DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog14 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 14 N3 ? ? D DA 9  E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog15 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 14 O4 ? ? D DA 9  E DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog16 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 13 N3 ? ? D DG 10 E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog17 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 13 O2 ? ? D DG 10 E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog18 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 13 N4 ? ? D DG 10 E DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog19 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 12 N1 ? ? D DC 11 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog20 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 12 O6 ? ? D DC 11 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog21 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 12 N2 ? ? D DC 11 E DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog22 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 11 N3 ? ? D DG 12 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog23 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 11 O2 ? ? D DG 12 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog24 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 11 N4 ? ? D DG 12 E DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog25 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG 10 N1 ? ? D DC 13 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog26 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG 10 O6 ? ? D DC 13 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog27 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG 10 N2 ? ? D DC 13 E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog28 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 9  N1 ? ? D DT 14 E DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog29 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 9  N6 ? ? D DT 14 E DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog30 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DT 7  O4 ? ? D DC 15 E DT 7  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? ? 
hydrog31 hydrog ? ? A DC 15 N3 ? ? ? 1_555 B DG 8  N1 ? ? D DC 15 E DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog32 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG 8  O6 ? ? D DC 15 E DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog33 hydrog ? ? A DC 15 O2 ? ? ? 1_555 B DG 8  N2 ? ? D DC 15 E DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog34 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DG 6  O6 ? ? D DA 16 E DG 6  1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? ? 
hydrog35 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 7  N3 ? ? D DA 16 E DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog36 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 7  O4 ? ? D DA 16 E DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog37 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG 6  N1 ? ? D DC 17 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog38 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG 6  O6 ? ? D DC 17 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog39 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG 6  N2 ? ? D DC 17 E DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog40 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 4  O4 ? ? D DA 18 E DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? ? 
hydrog41 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 5  N3 ? ? D DA 18 E DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog42 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 5  O4 ? ? D DA 18 E DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? ? 
hydrog43 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DA 3  N6 ? ? D DA 19 E DA 3  1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? ? 
hydrog44 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 4  N3 ? ? D DA 19 E DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? ? 
hydrog45 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 3  N1 ? ? D DT 20 E DA 3  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
hydrog46 hydrog ? ? A DT 21 N3 ? ? ? 1_555 B DA 2  N1 ? ? D DT 21 E DA 2  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 283 C . ? ILE 283 A PRO 284 C ? PRO 284 A 1 -0.51 
2 ILE 283 D . ? ILE 283 B PRO 284 D ? PRO 284 B 1 -0.25 
3 ILE 283 E . ? ILE 283 C PRO 284 E ? PRO 284 C 1 -0.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 6 ? 
D ? 4 ? 
E ? 2 ? 
F ? 6 ? 
G ? 4 ? 
H ? 2 ? 
I ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
H 1 2 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 93  ? MET C 98  ? SER A 93  MET A 98  
A 2 LEU C 63  ? THR C 68  ? LEU A 63  THR A 68  
A 3 GLY C 121 ? ASN C 125 ? GLY A 121 ASN A 125 
A 4 ALA C 145 ? PHE C 147 ? ALA A 145 PHE A 147 
B 1 SER C 158 ? PHE C 161 ? SER A 158 PHE A 161 
B 2 ASN C 316 ? LEU C 319 ? ASN A 316 LEU A 319 
C 1 ALA C 214 ? GLU C 217 ? ALA A 214 GLU A 217 
C 2 ILE C 182 ? ALA C 186 ? ILE A 182 ALA A 186 
C 3 ALA C 241 ? VAL C 244 ? ALA A 241 VAL A 244 
C 4 SER C 269 ? ASP C 274 ? SER A 269 ASP A 274 
C 5 THR C 288 ? LYS C 290 ? THR A 288 LYS A 290 
C 6 SER C 322 ? VAL C 324 ? SER A 322 VAL A 324 
D 1 SER D 93  ? VAL D 99  ? SER B 93  VAL B 99  
D 2 LEU D 63  ? SER D 69  ? LEU B 63  SER B 69  
D 3 GLY D 121 ? ASN D 125 ? GLY B 121 ASN B 125 
D 4 ALA D 145 ? PHE D 147 ? ALA B 145 PHE B 147 
E 1 SER D 158 ? PHE D 161 ? SER B 158 PHE B 161 
E 2 ASN D 316 ? LEU D 319 ? ASN B 316 LEU B 319 
F 1 ALA D 214 ? GLU D 217 ? ALA B 214 GLU B 217 
F 2 ILE D 182 ? ALA D 186 ? ILE B 182 ALA B 186 
F 3 ALA D 241 ? VAL D 244 ? ALA B 241 VAL B 244 
F 4 SER D 269 ? ASP D 274 ? SER B 269 ASP B 274 
F 5 THR D 287 ? LYS D 290 ? THR B 287 LYS B 290 
F 6 SER D 322 ? VAL D 324 ? SER B 322 VAL B 324 
G 1 SER E 93  ? VAL E 99  ? SER C 93  VAL C 99  
G 2 LEU E 63  ? SER E 69  ? LEU C 63  SER C 69  
G 3 GLY E 121 ? ASN E 125 ? GLY C 121 ASN C 125 
G 4 ALA E 145 ? PHE E 147 ? ALA C 145 PHE C 147 
H 1 SER E 158 ? PHE E 161 ? SER C 158 PHE C 161 
H 2 ASN E 316 ? LEU E 319 ? ASN C 316 LEU C 319 
I 1 ALA E 214 ? GLU E 217 ? ALA C 214 GLU C 217 
I 2 ILE E 182 ? ALA E 186 ? ILE C 182 ALA C 186 
I 3 ALA E 241 ? VAL E 244 ? ALA C 241 VAL C 244 
I 4 SER E 269 ? ASP E 274 ? SER C 269 ASP C 274 
I 5 THR E 287 ? LYS E 290 ? THR C 287 LYS C 290 
I 6 SER E 322 ? VAL E 324 ? SER C 322 VAL C 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER C 93  ? O SER A 93  N ILE C 64  ? N ILE A 64  
A 2 3 N GLY C 65  ? N GLY A 65  O GLY C 121 ? O GLY A 121 
A 3 4 N ILE C 124 ? N ILE A 124 O LEU C 146 ? O LEU A 146 
B 1 2 O SER C 158 ? O SER A 158 N GLN C 317 ? N GLN A 317 
C 1 2 N ALA C 214 ? N ALA A 214 O ILE C 182 ? O ILE A 182 
C 2 3 N ALA C 183 ? N ALA A 183 O ALA C 241 ? O ALA A 241 
C 3 4 N MET C 242 ? N MET A 242 O SER C 269 ? O SER A 269 
C 4 5 N ASP C 274 ? N ASP A 274 O ILE C 289 ? O ILE A 289 
C 5 6 N LYS C 290 ? N LYS A 290 O SER C 322 ? O SER A 322 
D 1 2 O SER D 93  ? O SER B 93  N ILE D 64  ? N ILE B 64  
D 2 3 N GLY D 65  ? N GLY B 65  O GLY D 121 ? O GLY B 121 
D 3 4 N ILE D 124 ? N ILE B 124 O LEU D 146 ? O LEU B 146 
E 1 2 N ILE D 160 ? N ILE B 160 O GLN D 317 ? O GLN B 317 
F 1 2 N ALA D 214 ? N ALA B 214 O ILE D 182 ? O ILE B 182 
F 2 3 N ALA D 183 ? N ALA B 183 O ALA D 241 ? O ALA B 241 
F 3 4 N MET D 242 ? N MET B 242 O SER D 269 ? O SER B 269 
F 4 5 N GLY D 272 ? N GLY B 272 O THR D 287 ? O THR B 287 
F 5 6 N LYS D 290 ? N LYS B 290 O SER D 322 ? O SER B 322 
G 1 2 O SER E 93  ? O SER C 93  N ILE E 64  ? N ILE C 64  
G 2 3 N GLY E 65  ? N GLY C 65  O GLY E 121 ? O GLY C 121 
G 3 4 N ILE E 124 ? N ILE C 124 O LEU E 146 ? O LEU C 146 
H 1 2 O SER E 158 ? O SER C 158 N GLN E 317 ? N GLN C 317 
I 1 2 N ALA E 214 ? N ALA C 214 O ILE E 182 ? O ILE C 182 
I 2 3 N ALA E 183 ? N ALA C 183 O ALA E 241 ? O ALA C 241 
I 3 4 N MET E 242 ? N MET C 242 O SER E 269 ? O SER C 269 
I 4 5 N GLY E 272 ? N GLY C 272 O THR E 287 ? O THR C 287 
I 5 6 N LYS E 290 ? N LYS C 290 O SER E 322 ? O SER C 322 
# 
_database_PDB_matrix.entry_id          1EFA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EFA 
_atom_sites.fract_transf_matrix[1][1]   0.003977 
_atom_sites.fract_transf_matrix[1][2]   0.002296 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004592 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004883 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 5   ? -6.441  91.288  -22.163 1.00 136.32 ? 5   DT  D "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 5   ? -6.339  92.635  -21.685 1.00 136.72 ? 5   DT  D "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 5   ? -6.921  93.640  -22.653 1.00 136.94 ? 5   DT  D "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 5   ? -8.358  93.467  -22.728 1.00 137.09 ? 5   DT  D "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 5   ? -6.744  95.103  -22.275 1.00 137.05 ? 5   DT  D "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 5   ? -5.471  95.564  -22.727 1.00 137.20 ? 5   DT  D "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 5   ? -7.875  95.788  -23.040 1.00 137.01 ? 5   DT  D "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 5   ? -8.958  94.703  -23.067 1.00 137.18 ? 5   DT  D "C1'" 1 
ATOM   9    N N1    . DT  A 1 5   ? -10.134 94.928  -22.194 1.00 137.43 ? 5   DT  D N1    1 
ATOM   10   C C2    . DT  A 1 5   ? -10.820 96.118  -22.323 1.00 137.57 ? 5   DT  D C2    1 
ATOM   11   O O2    . DT  A 1 5   ? -10.484 97.005  -23.094 1.00 137.62 ? 5   DT  D O2    1 
ATOM   12   N N3    . DT  A 1 5   ? -11.923 96.235  -21.510 1.00 137.53 ? 5   DT  D N3    1 
ATOM   13   C C4    . DT  A 1 5   ? -12.400 95.306  -20.603 1.00 137.44 ? 5   DT  D C4    1 
ATOM   14   O O4    . DT  A 1 5   ? -13.416 95.553  -19.950 1.00 137.54 ? 5   DT  D O4    1 
ATOM   15   C C5    . DT  A 1 5   ? -11.628 94.084  -20.511 1.00 137.42 ? 5   DT  D C5    1 
ATOM   16   C C7    . DT  A 1 5   ? -12.066 93.019  -19.555 1.00 137.19 ? 5   DT  D C7    1 
ATOM   17   C C6    . DT  A 1 5   ? -10.544 93.961  -21.296 1.00 137.42 ? 5   DT  D C6    1 
ATOM   18   P P     . DG  A 1 6   ? -4.758  96.798  -21.981 1.00 137.50 ? 6   DG  D P     1 
ATOM   19   O OP1   . DG  A 1 6   ? -3.345  96.432  -21.701 1.00 137.33 ? 6   DG  D OP1   1 
ATOM   20   O OP2   . DG  A 1 6   ? -5.652  97.196  -20.860 1.00 137.60 ? 6   DG  D OP2   1 
ATOM   21   O "O5'" . DG  A 1 6   ? -4.766  97.975  -23.058 1.00 137.02 ? 6   DG  D "O5'" 1 
ATOM   22   C "C5'" . DG  A 1 6   ? -4.948  99.332  -22.655 1.00 136.34 ? 6   DG  D "C5'" 1 
ATOM   23   C "C4'" . DG  A 1 6   ? -6.265  99.854  -23.176 1.00 136.08 ? 6   DG  D "C4'" 1 
ATOM   24   O "O4'" . DG  A 1 6   ? -7.314  98.915  -22.849 1.00 135.86 ? 6   DG  D "O4'" 1 
ATOM   25   C "C3'" . DG  A 1 6   ? -6.729  101.183 -22.596 1.00 136.10 ? 6   DG  D "C3'" 1 
ATOM   26   O "O3'" . DG  A 1 6   ? -6.186  102.239 -23.387 1.00 136.57 ? 6   DG  D "O3'" 1 
ATOM   27   C "C2'" . DG  A 1 6   ? -8.247  101.117 -22.756 1.00 135.84 ? 6   DG  D "C2'" 1 
ATOM   28   C "C1'" . DG  A 1 6   ? -8.526  99.613  -22.670 1.00 135.84 ? 6   DG  D "C1'" 1 
ATOM   29   N N9    . DG  A 1 6   ? -9.163  99.133  -21.447 1.00 135.87 ? 6   DG  D N9    1 
ATOM   30   C C8    . DG  A 1 6   ? -8.791  98.045  -20.693 1.00 135.82 ? 6   DG  D C8    1 
ATOM   31   N N7    . DG  A 1 6   ? -9.601  97.812  -19.694 1.00 135.81 ? 6   DG  D N7    1 
ATOM   32   C C5    . DG  A 1 6   ? -10.553 98.817  -19.782 1.00 135.85 ? 6   DG  D C5    1 
ATOM   33   C C6    . DG  A 1 6   ? -11.694 99.082  -18.972 1.00 135.81 ? 6   DG  D C6    1 
ATOM   34   O O6    . DG  A 1 6   ? -12.109 98.448  -17.986 1.00 135.82 ? 6   DG  D O6    1 
ATOM   35   N N1    . DG  A 1 6   ? -12.381 100.209 -19.413 1.00 135.74 ? 6   DG  D N1    1 
ATOM   36   C C2    . DG  A 1 6   ? -12.026 100.981 -20.497 1.00 135.82 ? 6   DG  D C2    1 
ATOM   37   N N2    . DG  A 1 6   ? -12.818 102.032 -20.769 1.00 135.73 ? 6   DG  D N2    1 
ATOM   38   N N3    . DG  A 1 6   ? -10.973 100.740 -21.261 1.00 135.82 ? 6   DG  D N3    1 
ATOM   39   C C4    . DG  A 1 6   ? -10.287 99.653  -20.850 1.00 135.88 ? 6   DG  D C4    1 
ATOM   40   P P     . DT  A 1 7   ? -5.666  103.589 -22.682 1.00 137.06 ? 7   DT  D P     1 
ATOM   41   O OP1   . DT  A 1 7   ? -4.970  104.406 -23.711 1.00 136.87 ? 7   DT  D OP1   1 
ATOM   42   O OP2   . DT  A 1 7   ? -4.939  103.192 -21.450 1.00 137.08 ? 7   DT  D OP2   1 
ATOM   43   O "O5'" . DT  A 1 7   ? -7.003  104.349 -22.260 1.00 136.75 ? 7   DT  D "O5'" 1 
ATOM   44   C "C5'" . DT  A 1 7   ? -7.878  104.882 -23.249 1.00 136.39 ? 7   DT  D "C5'" 1 
ATOM   45   C "C4'" . DT  A 1 7   ? -9.184  105.312 -22.626 1.00 136.25 ? 7   DT  D "C4'" 1 
ATOM   46   O "O4'" . DT  A 1 7   ? -9.809  104.177 -21.981 1.00 136.39 ? 7   DT  D "O4'" 1 
ATOM   47   C "C3'" . DT  A 1 7   ? -9.113  106.364 -21.529 1.00 136.11 ? 7   DT  D "C3'" 1 
ATOM   48   O "O3'" . DT  A 1 7   ? -9.092  107.662 -22.125 1.00 135.64 ? 7   DT  D "O3'" 1 
ATOM   49   C "C2'" . DT  A 1 7   ? -10.426 106.146 -20.775 1.00 136.35 ? 7   DT  D "C2'" 1 
ATOM   50   C "C1'" . DT  A 1 7   ? -10.674 104.644 -20.965 1.00 136.67 ? 7   DT  D "C1'" 1 
ATOM   51   N N1    . DT  A 1 7   ? -10.518 103.799 -19.757 1.00 137.05 ? 7   DT  D N1    1 
ATOM   52   C C2    . DT  A 1 7   ? -11.553 103.804 -18.841 1.00 137.19 ? 7   DT  D C2    1 
ATOM   53   O O2    . DT  A 1 7   ? -12.556 104.492 -18.969 1.00 137.26 ? 7   DT  D O2    1 
ATOM   54   N N3    . DT  A 1 7   ? -11.371 102.967 -17.765 1.00 137.19 ? 7   DT  D N3    1 
ATOM   55   C C4    . DT  A 1 7   ? -10.288 102.144 -17.515 1.00 137.20 ? 7   DT  D C4    1 
ATOM   56   O O4    . DT  A 1 7   ? -10.279 101.433 -16.507 1.00 137.16 ? 7   DT  D O4    1 
ATOM   57   C C5    . DT  A 1 7   ? -9.230  102.201 -18.509 1.00 137.14 ? 7   DT  D C5    1 
ATOM   58   C C7    . DT  A 1 7   ? -8.012  101.351 -18.323 1.00 137.04 ? 7   DT  D C7    1 
ATOM   59   C C6    . DT  A 1 7   ? -9.395  103.018 -19.563 1.00 137.07 ? 7   DT  D C6    1 
ATOM   60   P P     . DG  A 1 8   ? -8.729  108.955 -21.235 1.00 135.27 ? 8   DG  D P     1 
ATOM   61   O OP1   . DG  A 1 8   ? -8.691  110.131 -22.140 1.00 135.25 ? 8   DG  D OP1   1 
ATOM   62   O OP2   . DG  A 1 8   ? -7.528  108.613 -20.430 1.00 135.09 ? 8   DG  D OP2   1 
ATOM   63   O "O5'" . DG  A 1 8   ? -9.979  109.133 -20.255 1.00 134.54 ? 8   DG  D "O5'" 1 
ATOM   64   C "C5'" . DG  A 1 8   ? -11.243 109.585 -20.748 1.00 133.33 ? 8   DG  D "C5'" 1 
ATOM   65   C "C4'" . DG  A 1 8   ? -12.339 109.321 -19.734 1.00 132.66 ? 8   DG  D "C4'" 1 
ATOM   66   O "O4'" . DG  A 1 8   ? -12.315 107.918 -19.369 1.00 132.58 ? 8   DG  D "O4'" 1 
ATOM   67   C "C3'" . DG  A 1 8   ? -12.252 110.056 -18.400 1.00 132.19 ? 8   DG  D "C3'" 1 
ATOM   68   O "O3'" . DG  A 1 8   ? -12.885 111.330 -18.504 1.00 131.32 ? 8   DG  D "O3'" 1 
ATOM   69   C "C2'" . DG  A 1 8   ? -13.066 109.158 -17.470 1.00 132.28 ? 8   DG  D "C2'" 1 
ATOM   70   C "C1'" . DG  A 1 8   ? -12.807 107.766 -18.050 1.00 132.52 ? 8   DG  D "C1'" 1 
ATOM   71   N N9    . DG  A 1 8   ? -11.876 106.939 -17.282 1.00 132.61 ? 8   DG  D N9    1 
ATOM   72   C C8    . DG  A 1 8   ? -10.546 106.700 -17.543 1.00 132.55 ? 8   DG  D C8    1 
ATOM   73   N N7    . DG  A 1 8   ? -9.999  105.867 -16.697 1.00 132.36 ? 8   DG  D N7    1 
ATOM   74   C C5    . DG  A 1 8   ? -11.024 105.548 -15.817 1.00 132.34 ? 8   DG  D C5    1 
ATOM   75   C C6    . DG  A 1 8   ? -11.038 104.684 -14.690 1.00 132.15 ? 8   DG  D C6    1 
ATOM   76   O O6    . DG  A 1 8   ? -10.114 103.997 -14.232 1.00 132.00 ? 8   DG  D O6    1 
ATOM   77   N N1    . DG  A 1 8   ? -12.288 104.662 -14.078 1.00 132.08 ? 8   DG  D N1    1 
ATOM   78   C C2    . DG  A 1 8   ? -13.388 105.372 -14.496 1.00 132.08 ? 8   DG  D C2    1 
ATOM   79   N N2    . DG  A 1 8   ? -14.510 105.222 -13.771 1.00 132.04 ? 8   DG  D N2    1 
ATOM   80   N N3    . DG  A 1 8   ? -13.391 106.171 -15.547 1.00 132.29 ? 8   DG  D N3    1 
ATOM   81   C C4    . DG  A 1 8   ? -12.187 106.212 -16.156 1.00 132.48 ? 8   DG  D C4    1 
ATOM   82   P P     . DA  A 1 9   ? -12.757 112.391 -17.300 1.00 130.75 ? 9   DA  D P     1 
ATOM   83   O OP1   . DA  A 1 9   ? -13.711 113.499 -17.565 1.00 130.72 ? 9   DA  D OP1   1 
ATOM   84   O OP2   . DA  A 1 9   ? -11.314 112.694 -17.119 1.00 130.73 ? 9   DA  D OP2   1 
ATOM   85   O "O5'" . DA  A 1 9   ? -13.272 111.603 -16.011 1.00 130.04 ? 9   DA  D "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 9   ? -14.666 111.415 -15.781 1.00 128.79 ? 9   DA  D "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 9   ? -14.898 110.683 -14.475 1.00 127.92 ? 9   DA  D "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 9   ? -14.219 109.404 -14.509 1.00 128.13 ? 9   DA  D "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 9   ? -14.377 111.332 -13.201 1.00 127.10 ? 9   DA  D "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 9   ? -15.325 112.274 -12.705 1.00 125.47 ? 9   DA  D "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 9   ? -14.287 110.148 -12.242 1.00 127.61 ? 9   DA  D "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 9   ? -13.968 108.982 -13.181 1.00 128.15 ? 9   DA  D "C1'" 1 
ATOM   93   N N9    . DA  A 1 9   ? -12.602 108.463 -13.075 1.00 128.39 ? 9   DA  D N9    1 
ATOM   94   C C8    . DA  A 1 9   ? -11.451 108.868 -13.712 1.00 128.38 ? 9   DA  D C8    1 
ATOM   95   N N7    . DA  A 1 9   ? -10.394 108.154 -13.395 1.00 128.32 ? 9   DA  D N7    1 
ATOM   96   C C5    . DA  A 1 9   ? -10.879 107.221 -12.486 1.00 128.48 ? 9   DA  D C5    1 
ATOM   97   C C6    . DA  A 1 9   ? -10.263 106.164 -11.775 1.00 128.50 ? 9   DA  D C6    1 
ATOM   98   N N6    . DA  A 1 9   ? -8.967  105.848 -11.872 1.00 128.39 ? 9   DA  D N6    1 
ATOM   99   N N1    . DA  A 1 9   ? -11.040 105.429 -10.948 1.00 128.54 ? 9   DA  D N1    1 
ATOM   100  C C2    . DA  A 1 9   ? -12.342 105.732 -10.849 1.00 128.43 ? 9   DA  D C2    1 
ATOM   101  N N3    . DA  A 1 9   ? -13.033 106.689 -11.462 1.00 128.42 ? 9   DA  D N3    1 
ATOM   102  C C4    . DA  A 1 9   ? -12.236 107.406 -12.275 1.00 128.48 ? 9   DA  D C4    1 
ATOM   103  P P     . DG  A 1 10  ? -14.918 113.270 -11.507 1.00 124.33 ? 10  DG  D P     1 
ATOM   104  O OP1   . DG  A 1 10  ? -16.046 114.214 -11.284 1.00 124.33 ? 10  DG  D OP1   1 
ATOM   105  O OP2   . DG  A 1 10  ? -13.564 113.801 -11.806 1.00 124.18 ? 10  DG  D OP2   1 
ATOM   106  O "O5'" . DG  A 1 10  ? -14.807 112.333 -10.221 1.00 123.33 ? 10  DG  D "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 10  ? -15.936 111.597 -9.747  1.00 121.20 ? 10  DG  D "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 10  ? -15.490 110.489 -8.813  1.00 119.57 ? 10  DG  D "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 10  ? -14.478 109.695 -9.477  1.00 119.37 ? 10  DG  D "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 10  ? -14.831 110.913 -7.506  1.00 118.30 ? 10  DG  D "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 10  ? -15.841 111.088 -6.521  1.00 116.34 ? 10  DG  D "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 10  ? -13.976 109.703 -7.138  1.00 118.47 ? 10  DG  D "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 10  ? -13.643 109.103 -8.506  1.00 118.62 ? 10  DG  D "C1'" 1 
ATOM   114  N N9    . DG  A 1 10  ? -12.250 109.203 -8.932  1.00 118.11 ? 10  DG  D N9    1 
ATOM   115  C C8    . DG  A 1 10  ? -11.625 110.222 -9.614  1.00 117.73 ? 10  DG  D C8    1 
ATOM   116  N N7    . DG  A 1 10  ? -10.368 109.968 -9.867  1.00 117.49 ? 10  DG  D N7    1 
ATOM   117  C C5    . DG  A 1 10  ? -10.153 108.713 -9.311  1.00 117.61 ? 10  DG  D C5    1 
ATOM   118  C C6    . DG  A 1 10  ? -8.985  107.900 -9.266  1.00 117.45 ? 10  DG  D C6    1 
ATOM   119  O O6    . DG  A 1 10  ? -7.860  108.133 -9.730  1.00 117.51 ? 10  DG  D O6    1 
ATOM   120  N N1    . DG  A 1 10  ? -9.223  106.702 -8.599  1.00 117.23 ? 10  DG  D N1    1 
ATOM   121  C C2    . DG  A 1 10  ? -10.424 106.329 -8.048  1.00 117.20 ? 10  DG  D C2    1 
ATOM   122  N N2    . DG  A 1 10  ? -10.466 105.140 -7.445  1.00 117.26 ? 10  DG  D N2    1 
ATOM   123  N N3    . DG  A 1 10  ? -11.509 107.068 -8.085  1.00 117.54 ? 10  DG  D N3    1 
ATOM   124  C C4    . DG  A 1 10  ? -11.305 108.236 -8.725  1.00 117.86 ? 10  DG  D C4    1 
ATOM   125  P P     . DC  A 1 11  ? -15.445 111.602 -5.055  1.00 114.91 ? 11  DC  D P     1 
ATOM   126  O OP1   . DC  A 1 11  ? -16.687 112.000 -4.345  1.00 114.84 ? 11  DC  D OP1   1 
ATOM   127  O OP2   . DC  A 1 11  ? -14.338 112.581 -5.217  1.00 114.66 ? 11  DC  D OP2   1 
ATOM   128  O "O5'" . DC  A 1 11  ? -14.855 110.318 -4.327  1.00 113.97 ? 11  DC  D "O5'" 1 
ATOM   129  C "C5'" . DC  A 1 11  ? -15.707 109.299 -3.810  1.00 111.69 ? 11  DC  D "C5'" 1 
ATOM   130  C "C4'" . DC  A 1 11  ? -14.880 108.273 -3.073  1.00 110.12 ? 11  DC  D "C4'" 1 
ATOM   131  O "O4'" . DC  A 1 11  ? -13.885 107.762 -3.990  1.00 109.88 ? 11  DC  D "O4'" 1 
ATOM   132  C "C3'" . DC  A 1 11  ? -14.090 108.812 -1.888  1.00 109.14 ? 11  DC  D "C3'" 1 
ATOM   133  O "O3'" . DC  A 1 11  ? -14.875 108.644 -0.711  1.00 107.96 ? 11  DC  D "O3'" 1 
ATOM   134  C "C2'" . DC  A 1 11  ? -12.882 107.880 -1.830  1.00 109.22 ? 11  DC  D "C2'" 1 
ATOM   135  C "C1'" . DC  A 1 11  ? -12.680 107.501 -3.299  1.00 109.15 ? 11  DC  D "C1'" 1 
ATOM   136  N N1    . DC  A 1 11  ? -11.590 108.206 -3.991  1.00 108.55 ? 11  DC  D N1    1 
ATOM   137  C C2    . DC  A 1 11  ? -10.549 107.449 -4.528  1.00 108.30 ? 11  DC  D C2    1 
ATOM   138  O O2    . DC  A 1 11  ? -10.562 106.218 -4.371  1.00 107.94 ? 11  DC  D O2    1 
ATOM   139  N N3    . DC  A 1 11  ? -9.557  108.071 -5.202  1.00 108.07 ? 11  DC  D N3    1 
ATOM   140  C C4    . DC  A 1 11  ? -9.572  109.395 -5.338  1.00 107.88 ? 11  DC  D C4    1 
ATOM   141  N N4    . DC  A 1 11  ? -8.571  109.957 -6.019  1.00 107.63 ? 11  DC  D N4    1 
ATOM   142  C C5    . DC  A 1 11  ? -10.612 110.198 -4.786  1.00 107.91 ? 11  DC  D C5    1 
ATOM   143  C C6    . DC  A 1 11  ? -11.593 109.567 -4.124  1.00 108.14 ? 11  DC  D C6    1 
ATOM   144  P P     . DG  A 1 12  ? -15.600 109.907 -0.040  1.00 107.07 ? 12  DG  D P     1 
ATOM   145  O OP1   . DG  A 1 12  ? -16.649 109.404 0.884   1.00 106.66 ? 12  DG  D OP1   1 
ATOM   146  O OP2   . DG  A 1 12  ? -15.966 110.835 -1.136  1.00 107.44 ? 12  DG  D OP2   1 
ATOM   147  O "O5'" . DG  A 1 12  ? -14.470 110.600 0.832   1.00 106.55 ? 12  DG  D "O5'" 1 
ATOM   148  C "C5'" . DG  A 1 12  ? -13.944 109.950 1.976   1.00 105.73 ? 12  DG  D "C5'" 1 
ATOM   149  C "C4'" . DG  A 1 12  ? -12.583 110.498 2.286   1.00 105.25 ? 12  DG  D "C4'" 1 
ATOM   150  O "O4'" . DG  A 1 12  ? -11.775 110.402 1.097   1.00 105.21 ? 12  DG  D "O4'" 1 
ATOM   151  C "C3'" . DG  A 1 12  ? -12.533 111.973 2.649   1.00 104.88 ? 12  DG  D "C3'" 1 
ATOM   152  O "O3'" . DG  A 1 12  ? -12.708 112.059 4.060   1.00 104.48 ? 12  DG  D "O3'" 1 
ATOM   153  C "C2'" . DG  A 1 12  ? -11.122 112.400 2.237   1.00 105.01 ? 12  DG  D "C2'" 1 
ATOM   154  C "C1'" . DG  A 1 12  ? -10.758 111.372 1.164   1.00 105.28 ? 12  DG  D "C1'" 1 
ATOM   155  N N9    . DG  A 1 12  ? -10.434 111.831 -0.184  1.00 105.28 ? 12  DG  D N9    1 
ATOM   156  C C8    . DG  A 1 12  ? -11.265 112.363 -1.141  1.00 105.22 ? 12  DG  D C8    1 
ATOM   157  N N7    . DG  A 1 12  ? -10.652 112.601 -2.271  1.00 105.19 ? 12  DG  D N7    1 
ATOM   158  C C5    . DG  A 1 12  ? -9.337  112.218 -2.035  1.00 105.28 ? 12  DG  D C5    1 
ATOM   159  C C6    . DG  A 1 12  ? -8.198  112.232 -2.886  1.00 105.30 ? 12  DG  D C6    1 
ATOM   160  O O6    . DG  A 1 12  ? -8.115  112.594 -4.067  1.00 105.35 ? 12  DG  D O6    1 
ATOM   161  N N1    . DG  A 1 12  ? -7.067  111.755 -2.229  1.00 105.45 ? 12  DG  D N1    1 
ATOM   162  C C2    . DG  A 1 12  ? -7.033  111.315 -0.925  1.00 105.40 ? 12  DG  D C2    1 
ATOM   163  N N2    . DG  A 1 12  ? -5.849  110.887 -0.458  1.00 105.36 ? 12  DG  D N2    1 
ATOM   164  N N3    . DG  A 1 12  ? -8.081  111.297 -0.133  1.00 105.21 ? 12  DG  D N3    1 
ATOM   165  C C4    . DG  A 1 12  ? -9.190  111.757 -0.746  1.00 105.24 ? 12  DG  D C4    1 
ATOM   166  P P     . DC  A 1 13  ? -12.033 113.263 4.879   1.00 104.49 ? 13  DC  D P     1 
ATOM   167  O OP1   . DC  A 1 13  ? -12.522 113.225 6.278   1.00 104.73 ? 13  DC  D OP1   1 
ATOM   168  O OP2   . DC  A 1 13  ? -12.199 114.495 4.073   1.00 104.84 ? 13  DC  D OP2   1 
ATOM   169  O "O5'" . DC  A 1 13  ? -10.484 112.914 4.895   1.00 105.04 ? 13  DC  D "O5'" 1 
ATOM   170  C "C5'" . DC  A 1 13  ? -9.513  113.940 5.058   1.00 105.84 ? 13  DC  D "C5'" 1 
ATOM   171  C "C4'" . DC  A 1 13  ? -8.257  113.592 4.297   1.00 106.36 ? 13  DC  D "C4'" 1 
ATOM   172  O "O4'" . DC  A 1 13  ? -8.579  113.350 2.911   1.00 106.22 ? 13  DC  D "O4'" 1 
ATOM   173  C "C3'" . DC  A 1 13  ? -7.190  114.675 4.253   1.00 106.80 ? 13  DC  D "C3'" 1 
ATOM   174  O "O3'" . DC  A 1 13  ? -6.377  114.545 5.415   1.00 108.05 ? 13  DC  D "O3'" 1 
ATOM   175  C "C2'" . DC  A 1 13  ? -6.398  114.324 2.996   1.00 106.48 ? 13  DC  D "C2'" 1 
ATOM   176  C "C1'" . DC  A 1 13  ? -7.442  113.617 2.125   1.00 106.32 ? 13  DC  D "C1'" 1 
ATOM   177  N N1    . DC  A 1 13  ? -7.849  114.309 0.894   1.00 106.50 ? 13  DC  D N1    1 
ATOM   178  C C2    . DC  A 1 13  ? -6.897  114.475 -0.103  1.00 106.65 ? 13  DC  D C2    1 
ATOM   179  O O2    . DC  A 1 13  ? -5.745  114.086 0.113   1.00 106.73 ? 13  DC  D O2    1 
ATOM   180  N N3    . DC  A 1 13  ? -7.248  115.048 -1.274  1.00 106.61 ? 13  DC  D N3    1 
ATOM   181  C C4    . DC  A 1 13  ? -8.499  115.457 -1.469  1.00 106.55 ? 13  DC  D C4    1 
ATOM   182  N N4    . DC  A 1 13  ? -8.794  115.996 -2.652  1.00 106.46 ? 13  DC  D N4    1 
ATOM   183  C C5    . DC  A 1 13  ? -9.495  115.322 -0.453  1.00 106.47 ? 13  DC  D C5    1 
ATOM   184  C C6    . DC  A 1 13  ? -9.129  114.752 0.705   1.00 106.55 ? 13  DC  D C6    1 
ATOM   185  P P     . DT  A 1 14  ? -5.631  115.831 6.018   1.00 109.16 ? 14  DT  D P     1 
ATOM   186  O OP1   . DT  A 1 14  ? -5.361  115.571 7.457   1.00 109.05 ? 14  DT  D OP1   1 
ATOM   187  O OP2   . DT  A 1 14  ? -6.416  117.024 5.620   1.00 108.91 ? 14  DT  D OP2   1 
ATOM   188  O "O5'" . DT  A 1 14  ? -4.237  115.871 5.249   1.00 110.99 ? 14  DT  D "O5'" 1 
ATOM   189  C "C5'" . DT  A 1 14  ? -3.272  114.837 5.433   1.00 114.08 ? 14  DT  D "C5'" 1 
ATOM   190  C "C4'" . DT  A 1 14  ? -2.266  114.857 4.307   1.00 116.13 ? 14  DT  D "C4'" 1 
ATOM   191  O "O4'" . DT  A 1 14  ? -2.984  114.762 3.060   1.00 116.53 ? 14  DT  D "O4'" 1 
ATOM   192  C "C3'" . DT  A 1 14  ? -1.433  116.123 4.185   1.00 117.53 ? 14  DT  D "C3'" 1 
ATOM   193  O "O3'" . DT  A 1 14  ? -0.255  115.955 4.971   1.00 119.69 ? 14  DT  D "O3'" 1 
ATOM   194  C "C2'" . DT  A 1 14  ? -1.095  116.178 2.696   1.00 117.41 ? 14  DT  D "C2'" 1 
ATOM   195  C "C1'" . DT  A 1 14  ? -2.298  115.479 2.057   1.00 117.03 ? 14  DT  D "C1'" 1 
ATOM   196  N N1    . DT  A 1 14  ? -3.276  116.327 1.347   1.00 117.07 ? 14  DT  D N1    1 
ATOM   197  C C2    . DT  A 1 14  ? -3.106  116.507 -0.009  1.00 117.09 ? 14  DT  D C2    1 
ATOM   198  O O2    . DT  A 1 14  ? -2.159  116.048 -0.630  1.00 117.29 ? 14  DT  D O2    1 
ATOM   199  N N3    . DT  A 1 14  ? -4.094  117.239 -0.617  1.00 116.90 ? 14  DT  D N3    1 
ATOM   200  C C4    . DT  A 1 14  ? -5.206  117.801 -0.021  1.00 116.76 ? 14  DT  D C4    1 
ATOM   201  O O4    . DT  A 1 14  ? -6.019  118.414 -0.708  1.00 116.81 ? 14  DT  D O4    1 
ATOM   202  C C5    . DT  A 1 14  ? -5.308  117.596 1.409   1.00 116.72 ? 14  DT  D C5    1 
ATOM   203  C C7    . DT  A 1 14  ? -6.474  118.174 2.146   1.00 116.56 ? 14  DT  D C7    1 
ATOM   204  C C6    . DT  A 1 14  ? -4.345  116.888 2.014   1.00 116.90 ? 14  DT  D C6    1 
ATOM   205  P P     . DC  A 1 15  ? 0.886   117.086 4.958   1.00 121.40 ? 15  DC  D P     1 
ATOM   206  O OP1   . DC  A 1 15  ? 1.702   116.953 6.191   1.00 121.39 ? 15  DC  D OP1   1 
ATOM   207  O OP2   . DC  A 1 15  ? 0.228   118.384 4.648   1.00 121.41 ? 15  DC  D OP2   1 
ATOM   208  O "O5'" . DC  A 1 15  ? 1.799   116.695 3.717   1.00 122.43 ? 15  DC  D "O5'" 1 
ATOM   209  C "C5'" . DC  A 1 15  ? 2.508   117.696 2.999   1.00 124.59 ? 15  DC  D "C5'" 1 
ATOM   210  C "C4'" . DC  A 1 15  ? 2.381   117.451 1.518   1.00 126.11 ? 15  DC  D "C4'" 1 
ATOM   211  O "O4'" . DC  A 1 15  ? 0.983   117.352 1.165   1.00 126.31 ? 15  DC  D "O4'" 1 
ATOM   212  C "C3'" . DC  A 1 15  ? 2.925   118.553 0.627   1.00 127.14 ? 15  DC  D "C3'" 1 
ATOM   213  O "O3'" . DC  A 1 15  ? 4.313   118.322 0.427   1.00 128.70 ? 15  DC  D "O3'" 1 
ATOM   214  C "C2'" . DC  A 1 15  ? 2.140   118.356 -0.668  1.00 126.98 ? 15  DC  D "C2'" 1 
ATOM   215  C "C1'" . DC  A 1 15  ? 0.803   117.806 -0.160  1.00 126.61 ? 15  DC  D "C1'" 1 
ATOM   216  N N1    . DC  A 1 15  ? -0.334  118.739 -0.188  1.00 126.58 ? 15  DC  D N1    1 
ATOM   217  C C2    . DC  A 1 15  ? -0.853  119.121 -1.425  1.00 126.54 ? 15  DC  D C2    1 
ATOM   218  O O2    . DC  A 1 15  ? -0.306  118.708 -2.459  1.00 126.59 ? 15  DC  D O2    1 
ATOM   219  N N3    . DC  A 1 15  ? -1.931  119.929 -1.468  1.00 126.52 ? 15  DC  D N3    1 
ATOM   220  C C4    . DC  A 1 15  ? -2.489  120.362 -0.341  1.00 126.71 ? 15  DC  D C4    1 
ATOM   221  N N4    . DC  A 1 15  ? -3.564  121.146 -0.446  1.00 126.98 ? 15  DC  D N4    1 
ATOM   222  C C5    . DC  A 1 15  ? -1.970  120.006 0.940   1.00 126.66 ? 15  DC  D C5    1 
ATOM   223  C C6    . DC  A 1 15  ? -0.898  119.203 0.969   1.00 126.55 ? 15  DC  D C6    1 
ATOM   224  P P     . DA  A 1 16  ? 5.357   119.520 0.633   1.00 129.87 ? 16  DA  D P     1 
ATOM   225  O OP1   . DA  A 1 16  ? 6.725   118.942 0.589   1.00 129.77 ? 16  DA  D OP1   1 
ATOM   226  O OP2   . DA  A 1 16  ? 4.925   120.297 1.823   1.00 129.85 ? 16  DA  D OP2   1 
ATOM   227  O "O5'" . DA  A 1 16  ? 5.148   120.420 -0.661  1.00 131.02 ? 16  DA  D "O5'" 1 
ATOM   228  C "C5'" . DA  A 1 16  ? 5.442   119.904 -1.953  1.00 133.00 ? 16  DA  D "C5'" 1 
ATOM   229  C "C4'" . DA  A 1 16  ? 4.766   120.736 -3.015  1.00 134.41 ? 16  DA  D "C4'" 1 
ATOM   230  O "O4'" . DA  A 1 16  ? 3.329   120.639 -2.861  1.00 134.87 ? 16  DA  D "O4'" 1 
ATOM   231  C "C3'" . DA  A 1 16  ? 5.043   122.230 -2.969  1.00 135.14 ? 16  DA  D "C3'" 1 
ATOM   232  O "O3'" . DA  A 1 16  ? 6.261   122.516 -3.653  1.00 136.02 ? 16  DA  D "O3'" 1 
ATOM   233  C "C2'" . DA  A 1 16  ? 3.841   122.812 -3.707  1.00 135.25 ? 16  DA  D "C2'" 1 
ATOM   234  C "C1'" . DA  A 1 16  ? 2.727   121.826 -3.344  1.00 135.21 ? 16  DA  D "C1'" 1 
ATOM   235  N N9    . DA  A 1 16  ? 1.756   122.309 -2.357  1.00 135.40 ? 16  DA  D N9    1 
ATOM   236  C C8    . DA  A 1 16  ? 1.827   122.305 -0.984  1.00 135.34 ? 16  DA  D C8    1 
ATOM   237  N N7    . DA  A 1 16  ? 0.754   122.787 -0.398  1.00 135.26 ? 16  DA  D N7    1 
ATOM   238  C C5    . DA  A 1 16  ? -0.074  123.140 -1.456  1.00 135.35 ? 16  DA  D C5    1 
ATOM   239  C C6    . DA  A 1 16  ? -1.366  123.705 -1.510  1.00 135.34 ? 16  DA  D C6    1 
ATOM   240  N N6    . DA  A 1 16  ? -2.091  124.023 -0.433  1.00 135.32 ? 16  DA  D N6    1 
ATOM   241  N N1    . DA  A 1 16  ? -1.897  123.933 -2.731  1.00 135.33 ? 16  DA  D N1    1 
ATOM   242  C C2    . DA  A 1 16  ? -1.184  123.611 -3.814  1.00 135.31 ? 16  DA  D C2    1 
ATOM   243  N N3    . DA  A 1 16  ? 0.028   123.072 -3.894  1.00 135.43 ? 16  DA  D N3    1 
ATOM   244  C C4    . DA  A 1 16  ? 0.535   122.859 -2.667  1.00 135.42 ? 16  DA  D C4    1 
ATOM   245  P P     . DC  A 1 17  ? 6.695   124.042 -3.905  1.00 136.78 ? 17  DC  D P     1 
ATOM   246  O OP1   . DC  A 1 17  ? 8.043   124.038 -4.523  1.00 136.85 ? 17  DC  D OP1   1 
ATOM   247  O OP2   . DC  A 1 17  ? 6.463   124.797 -2.645  1.00 136.87 ? 17  DC  D OP2   1 
ATOM   248  O "O5'" . DC  A 1 17  ? 5.656   124.553 -4.998  1.00 137.44 ? 17  DC  D "O5'" 1 
ATOM   249  C "C5'" . DC  A 1 17  ? 5.264   125.921 -5.066  1.00 138.48 ? 17  DC  D "C5'" 1 
ATOM   250  C "C4'" . DC  A 1 17  ? 3.826   126.017 -5.517  1.00 139.08 ? 17  DC  D "C4'" 1 
ATOM   251  O "O4'" . DC  A 1 17  ? 2.976   125.395 -4.525  1.00 139.34 ? 17  DC  D "O4'" 1 
ATOM   252  C "C3'" . DC  A 1 17  ? 3.251   127.415 -5.664  1.00 139.40 ? 17  DC  D "C3'" 1 
ATOM   253  O "O3'" . DC  A 1 17  ? 3.571   127.917 -6.956  1.00 139.78 ? 17  DC  D "O3'" 1 
ATOM   254  C "C2'" . DC  A 1 17  ? 1.750   127.167 -5.549  1.00 139.48 ? 17  DC  D "C2'" 1 
ATOM   255  C "C1'" . DC  A 1 17  ? 1.689   125.975 -4.589  1.00 139.50 ? 17  DC  D "C1'" 1 
ATOM   256  N N1    . DC  A 1 17  ? 1.228   126.286 -3.225  1.00 139.66 ? 17  DC  D N1    1 
ATOM   257  C C2    . DC  A 1 17  ? -0.106  126.663 -3.052  1.00 139.88 ? 17  DC  D C2    1 
ATOM   258  O O2    . DC  A 1 17  ? -0.836  126.759 -4.055  1.00 140.12 ? 17  DC  D O2    1 
ATOM   259  N N3    . DC  A 1 17  ? -0.568  126.915 -1.804  1.00 139.78 ? 17  DC  D N3    1 
ATOM   260  C C4    . DC  A 1 17  ? 0.246   126.804 -0.755  1.00 139.54 ? 17  DC  D C4    1 
ATOM   261  N N4    . DC  A 1 17  ? -0.266  127.051 0.457   1.00 139.27 ? 17  DC  D N4    1 
ATOM   262  C C5    . DC  A 1 17  ? 1.619   126.435 -0.902  1.00 139.50 ? 17  DC  D C5    1 
ATOM   263  C C6    . DC  A 1 17  ? 2.064   126.189 -2.146  1.00 139.50 ? 17  DC  D C6    1 
ATOM   264  P P     . DA  A 1 18  ? 3.623   129.502 -7.206  1.00 140.05 ? 18  DA  D P     1 
ATOM   265  O OP1   . DA  A 1 18  ? 4.164   129.736 -8.568  1.00 140.16 ? 18  DA  D OP1   1 
ATOM   266  O OP2   . DA  A 1 18  ? 4.295   130.117 -6.031  1.00 140.11 ? 18  DA  D OP2   1 
ATOM   267  O "O5'" . DA  A 1 18  ? 2.096   129.953 -7.188  1.00 140.13 ? 18  DA  D "O5'" 1 
ATOM   268  C "C5'" . DA  A 1 18  ? 1.162   129.415 -8.118  1.00 140.16 ? 18  DA  D "C5'" 1 
ATOM   269  C "C4'" . DA  A 1 18  ? -0.245  129.634 -7.617  1.00 140.22 ? 18  DA  D "C4'" 1 
ATOM   270  O "O4'" . DA  A 1 18  ? -0.376  129.004 -6.321  1.00 140.30 ? 18  DA  D "O4'" 1 
ATOM   271  C "C3'" . DA  A 1 18  ? -0.648  131.083 -7.385  1.00 140.20 ? 18  DA  D "C3'" 1 
ATOM   272  O "O3'" . DA  A 1 18  ? -1.197  131.599 -8.593  1.00 140.12 ? 18  DA  D "O3'" 1 
ATOM   273  C "C2'" . DA  A 1 18  ? -1.732  130.970 -6.318  1.00 140.26 ? 18  DA  D "C2'" 1 
ATOM   274  C "C1'" . DA  A 1 18  ? -1.291  129.735 -5.532  1.00 140.30 ? 18  DA  D "C1'" 1 
ATOM   275  N N9    . DA  A 1 18  ? -0.680  130.007 -4.233  1.00 140.26 ? 18  DA  D N9    1 
ATOM   276  C C8    . DA  A 1 18  ? 0.646   129.983 -3.879  1.00 140.32 ? 18  DA  D C8    1 
ATOM   277  N N7    . DA  A 1 18  ? 0.858   130.214 -2.605  1.00 140.36 ? 18  DA  D N7    1 
ATOM   278  C C5    . DA  A 1 18  ? -0.415  130.419 -2.089  1.00 140.38 ? 18  DA  D C5    1 
ATOM   279  C C6    . DA  A 1 18  ? -0.882  130.702 -0.790  1.00 140.45 ? 18  DA  D C6    1 
ATOM   280  N N6    . DA  A 1 18  ? -0.091  130.827 0.282   1.00 140.51 ? 18  DA  D N6    1 
ATOM   281  N N1    . DA  A 1 18  ? -2.213  130.849 -0.625  1.00 140.42 ? 18  DA  D N1    1 
ATOM   282  C C2    . DA  A 1 18  ? -3.012  130.714 -1.688  1.00 140.39 ? 18  DA  D C2    1 
ATOM   283  N N3    . DA  A 1 18  ? -2.697  130.447 -2.950  1.00 140.35 ? 18  DA  D N3    1 
ATOM   284  C C4    . DA  A 1 18  ? -1.368  130.308 -3.085  1.00 140.30 ? 18  DA  D C4    1 
ATOM   285  P P     . DA  A 1 19  ? -1.656  133.137 -8.678  1.00 140.03 ? 19  DA  D P     1 
ATOM   286  O OP1   . DA  A 1 19  ? -2.272  133.340 -10.016 1.00 140.02 ? 19  DA  D OP1   1 
ATOM   287  O OP2   . DA  A 1 19  ? -0.497  133.973 -8.265  1.00 139.92 ? 19  DA  D OP2   1 
ATOM   288  O "O5'" . DA  A 1 19  ? -2.803  133.285 -7.580  1.00 139.55 ? 19  DA  D "O5'" 1 
ATOM   289  C "C5'" . DA  A 1 19  ? -4.065  132.637 -7.736  1.00 138.60 ? 19  DA  D "C5'" 1 
ATOM   290  C "C4'" . DA  A 1 19  ? -4.880  132.776 -6.470  1.00 138.10 ? 19  DA  D "C4'" 1 
ATOM   291  O "O4'" . DA  A 1 19  ? -4.086  132.309 -5.353  1.00 137.99 ? 19  DA  D "O4'" 1 
ATOM   292  C "C3'" . DA  A 1 19  ? -5.300  134.190 -6.092  1.00 137.77 ? 19  DA  D "C3'" 1 
ATOM   293  O "O3'" . DA  A 1 19  ? -6.558  134.455 -6.718  1.00 137.50 ? 19  DA  D "O3'" 1 
ATOM   294  C "C2'" . DA  A 1 19  ? -5.450  134.107 -4.573  1.00 137.73 ? 19  DA  D "C2'" 1 
ATOM   295  C "C1'" . DA  A 1 19  ? -4.409  133.049 -4.194  1.00 137.74 ? 19  DA  D "C1'" 1 
ATOM   296  N N9    . DA  A 1 19  ? -3.164  133.550 -3.607  1.00 137.54 ? 19  DA  D N9    1 
ATOM   297  C C8    . DA  A 1 19  ? -2.007  133.906 -4.255  1.00 137.38 ? 19  DA  D C8    1 
ATOM   298  N N7    . DA  A 1 19  ? -1.040  134.270 -3.447  1.00 137.36 ? 19  DA  D N7    1 
ATOM   299  C C5    . DA  A 1 19  ? -1.601  134.156 -2.181  1.00 137.33 ? 19  DA  D C5    1 
ATOM   300  C C6    . DA  A 1 19  ? -1.086  134.393 -0.889  1.00 137.27 ? 19  DA  D C6    1 
ATOM   301  N N6    . DA  A 1 19  ? 0.158   134.812 -0.653  1.00 137.32 ? 19  DA  D N6    1 
ATOM   302  N N1    . DA  A 1 19  ? -1.907  134.179 0.163   1.00 137.11 ? 19  DA  D N1    1 
ATOM   303  C C2    . DA  A 1 19  ? -3.155  133.760 -0.074  1.00 137.12 ? 19  DA  D C2    1 
ATOM   304  N N3    . DA  A 1 19  ? -3.753  133.505 -1.239  1.00 137.33 ? 19  DA  D N3    1 
ATOM   305  C C4    . DA  A 1 19  ? -2.911  133.725 -2.265  1.00 137.39 ? 19  DA  D C4    1 
ATOM   306  P P     . DT  A 1 20  ? -7.225  135.916 -6.613  1.00 137.29 ? 20  DT  D P     1 
ATOM   307  O OP1   . DT  A 1 20  ? -8.701  135.754 -6.524  1.00 137.02 ? 20  DT  D OP1   1 
ATOM   308  O OP2   . DT  A 1 20  ? -6.643  136.757 -7.688  1.00 137.36 ? 20  DT  D OP2   1 
ATOM   309  O "O5'" . DT  A 1 20  ? -6.707  136.476 -5.218  1.00 136.90 ? 20  DT  D "O5'" 1 
ATOM   310  C "C5'" . DT  A 1 20  ? -7.475  137.405 -4.472  1.00 136.34 ? 20  DT  D "C5'" 1 
ATOM   311  C "C4'" . DT  A 1 20  ? -7.861  136.795 -3.154  1.00 136.09 ? 20  DT  D "C4'" 1 
ATOM   312  O "O4'" . DT  A 1 20  ? -6.738  136.051 -2.631  1.00 136.02 ? 20  DT  D "O4'" 1 
ATOM   313  C "C3'" . DT  A 1 20  ? -8.242  137.786 -2.070  1.00 136.08 ? 20  DT  D "C3'" 1 
ATOM   314  O "O3'" . DT  A 1 20  ? -9.637  138.058 -2.162  1.00 136.00 ? 20  DT  D "O3'" 1 
ATOM   315  C "C2'" . DT  A 1 20  ? -7.893  137.033 -0.788  1.00 136.00 ? 20  DT  D "C2'" 1 
ATOM   316  C "C1'" . DT  A 1 20  ? -6.691  136.189 -1.227  1.00 136.04 ? 20  DT  D "C1'" 1 
ATOM   317  N N1    . DT  A 1 20  ? -5.359  136.714 -0.869  1.00 136.14 ? 20  DT  D N1    1 
ATOM   318  C C2    . DT  A 1 20  ? -5.019  136.805 0.464   1.00 136.20 ? 20  DT  D C2    1 
ATOM   319  O O2    . DT  A 1 20  ? -5.782  136.509 1.372   1.00 136.18 ? 20  DT  D O2    1 
ATOM   320  N N3    . DT  A 1 20  ? -3.740  137.258 0.695   1.00 136.28 ? 20  DT  D N3    1 
ATOM   321  C C4    . DT  A 1 20  ? -2.796  137.623 -0.251  1.00 136.32 ? 20  DT  D C4    1 
ATOM   322  O O4    . DT  A 1 20  ? -1.683  138.004 0.109   1.00 136.46 ? 20  DT  D O4    1 
ATOM   323  C C5    . DT  A 1 20  ? -3.227  137.515 -1.628  1.00 136.18 ? 20  DT  D C5    1 
ATOM   324  C C7    . DT  A 1 20  ? -2.275  137.890 -2.720  1.00 135.94 ? 20  DT  D C7    1 
ATOM   325  C C6    . DT  A 1 20  ? -4.472  137.078 -1.863  1.00 136.08 ? 20  DT  D C6    1 
ATOM   326  P P     . DT  A 1 21  ? -10.177 139.553 -1.936  1.00 135.84 ? 21  DT  D P     1 
ATOM   327  O OP1   . DT  A 1 21  ? -11.627 139.570 -2.260  1.00 135.72 ? 21  DT  D OP1   1 
ATOM   328  O OP2   . DT  A 1 21  ? -9.251  140.460 -2.664  1.00 135.89 ? 21  DT  D OP2   1 
ATOM   329  O "O5'" . DT  A 1 21  ? -9.999  139.791 -0.367  1.00 135.68 ? 21  DT  D "O5'" 1 
ATOM   330  C "C5'" . DT  A 1 21  ? -9.583  141.057 0.146   1.00 135.26 ? 21  DT  D "C5'" 1 
ATOM   331  C "C4'" . DT  A 1 21  ? -8.796  140.874 1.426   1.00 135.02 ? 21  DT  D "C4'" 1 
ATOM   332  O "O4'" . DT  A 1 21  ? -7.705  139.943 1.199   1.00 134.93 ? 21  DT  D "O4'" 1 
ATOM   333  C "C3'" . DT  A 1 21  ? -8.121  142.131 1.949   1.00 134.96 ? 21  DT  D "C3'" 1 
ATOM   334  O "O3'" . DT  A 1 21  ? -9.042  142.937 2.688   1.00 135.04 ? 21  DT  D "O3'" 1 
ATOM   335  C "C2'" . DT  A 1 21  ? -6.972  141.567 2.777   1.00 134.87 ? 21  DT  D "C2'" 1 
ATOM   336  C "C1'" . DT  A 1 21  ? -6.570  140.339 1.954   1.00 134.62 ? 21  DT  D "C1'" 1 
ATOM   337  N N1    . DT  A 1 21  ? -5.456  140.583 1.013   1.00 134.13 ? 21  DT  D N1    1 
ATOM   338  C C2    . DT  A 1 21  ? -4.163  140.566 1.494   1.00 133.73 ? 21  DT  D C2    1 
ATOM   339  O O2    . DT  A 1 21  ? -3.886  140.372 2.668   1.00 133.41 ? 21  DT  D O2    1 
ATOM   340  N N3    . DT  A 1 21  ? -3.197  140.785 0.541   1.00 133.50 ? 21  DT  D N3    1 
ATOM   341  C C4    . DT  A 1 21  ? -3.391  141.012 -0.810  1.00 133.56 ? 21  DT  D C4    1 
ATOM   342  O O4    . DT  A 1 21  ? -2.423  141.187 -1.546  1.00 133.49 ? 21  DT  D O4    1 
ATOM   343  C C5    . DT  A 1 21  ? -4.772  141.022 -1.242  1.00 133.62 ? 21  DT  D C5    1 
ATOM   344  C C7    . DT  A 1 21  ? -5.083  141.262 -2.686  1.00 133.54 ? 21  DT  D C7    1 
ATOM   345  C C6    . DT  A 1 21  ? -5.720  140.812 -0.322  1.00 133.82 ? 21  DT  D C6    1 
ATOM   346  P P     . DA  B 1 2   ? 8.161   140.069 5.715   1.00 124.98 ? 2   DA  E P     1 
ATOM   347  O OP1   . DA  B 1 2   ? 8.952   141.039 4.915   1.00 124.69 ? 2   DA  E OP1   1 
ATOM   348  O OP2   . DA  B 1 2   ? 8.478   139.867 7.153   1.00 124.82 ? 2   DA  E OP2   1 
ATOM   349  O "O5'" . DA  B 1 2   ? 6.616   140.445 5.595   1.00 125.18 ? 2   DA  E "O5'" 1 
ATOM   350  C "C5'" . DA  B 1 2   ? 5.986   141.259 6.580   1.00 125.39 ? 2   DA  E "C5'" 1 
ATOM   351  C "C4'" . DA  B 1 2   ? 4.609   140.726 6.904   1.00 125.57 ? 2   DA  E "C4'" 1 
ATOM   352  O "O4'" . DA  B 1 2   ? 3.709   140.946 5.794   1.00 125.30 ? 2   DA  E "O4'" 1 
ATOM   353  C "C3'" . DA  B 1 2   ? 4.505   139.238 7.196   1.00 125.90 ? 2   DA  E "C3'" 1 
ATOM   354  O "O3'" . DA  B 1 2   ? 4.878   139.013 8.562   1.00 126.75 ? 2   DA  E "O3'" 1 
ATOM   355  C "C2'" . DA  B 1 2   ? 3.040   138.927 6.889   1.00 125.44 ? 2   DA  E "C2'" 1 
ATOM   356  C "C1'" . DA  B 1 2   ? 2.696   139.959 5.808   1.00 125.03 ? 2   DA  E "C1'" 1 
ATOM   357  N N9    . DA  B 1 2   ? 2.538   139.437 4.452   1.00 124.61 ? 2   DA  E N9    1 
ATOM   358  C C8    . DA  B 1 2   ? 3.386   138.642 3.722   1.00 124.34 ? 2   DA  E C8    1 
ATOM   359  N N7    . DA  B 1 2   ? 2.959   138.388 2.508   1.00 124.12 ? 2   DA  E N7    1 
ATOM   360  C C5    . DA  B 1 2   ? 1.744   139.055 2.438   1.00 124.11 ? 2   DA  E C5    1 
ATOM   361  C C6    . DA  B 1 2   ? 0.790   139.184 1.408   1.00 124.08 ? 2   DA  E C6    1 
ATOM   362  N N6    . DA  B 1 2   ? 0.920   138.623 0.203   1.00 123.97 ? 2   DA  E N6    1 
ATOM   363  N N1    . DA  B 1 2   ? -0.312  139.921 1.665   1.00 124.09 ? 2   DA  E N1    1 
ATOM   364  C C2    . DA  B 1 2   ? -0.444  140.482 2.875   1.00 124.14 ? 2   DA  E C2    1 
ATOM   365  N N3    . DA  B 1 2   ? 0.381   140.431 3.920   1.00 124.15 ? 2   DA  E N3    1 
ATOM   366  C C4    . DA  B 1 2   ? 1.467   139.695 3.631   1.00 124.28 ? 2   DA  E C4    1 
ATOM   367  P P     . DA  B 1 3   ? 3.765   138.582 9.647   1.00 127.44 ? 3   DA  E P     1 
ATOM   368  O OP1   . DA  B 1 3   ? 2.661   139.577 9.585   1.00 127.25 ? 3   DA  E OP1   1 
ATOM   369  O OP2   . DA  B 1 3   ? 4.448   138.327 10.941  1.00 127.16 ? 3   DA  E OP2   1 
ATOM   370  O "O5'" . DA  B 1 3   ? 3.221   137.186 9.112   1.00 127.72 ? 3   DA  E "O5'" 1 
ATOM   371  C "C5'" . DA  B 1 3   ? 2.173   136.493 9.787   1.00 128.36 ? 3   DA  E "C5'" 1 
ATOM   372  C "C4'" . DA  B 1 3   ? 0.836   137.133 9.475   1.00 128.58 ? 3   DA  E "C4'" 1 
ATOM   373  O "O4'" . DA  B 1 3   ? 0.872   137.753 8.169   1.00 128.52 ? 3   DA  E "O4'" 1 
ATOM   374  C "C3'" . DA  B 1 3   ? -0.359  136.194 9.479   1.00 128.62 ? 3   DA  E "C3'" 1 
ATOM   375  O "O3'" . DA  B 1 3   ? -0.886  136.153 10.805  1.00 128.78 ? 3   DA  E "O3'" 1 
ATOM   376  C "C2'" . DA  B 1 3   ? -1.318  136.849 8.480   1.00 128.35 ? 3   DA  E "C2'" 1 
ATOM   377  C "C1'" . DA  B 1 3   ? -0.361  137.553 7.510   1.00 128.24 ? 3   DA  E "C1'" 1 
ATOM   378  N N9    . DA  B 1 3   ? -0.062  136.871 6.252   1.00 127.99 ? 3   DA  E N9    1 
ATOM   379  C C8    . DA  B 1 3   ? 1.028   136.080 5.986   1.00 127.99 ? 3   DA  E C8    1 
ATOM   380  N N7    . DA  B 1 3   ? 1.079   135.639 4.754   1.00 127.93 ? 3   DA  E N7    1 
ATOM   381  C C5    . DA  B 1 3   ? -0.065  136.164 4.168   1.00 127.77 ? 3   DA  E C5    1 
ATOM   382  C C6    . DA  B 1 3   ? -0.590  136.061 2.865   1.00 127.54 ? 3   DA  E C6    1 
ATOM   383  N N6    . DA  B 1 3   ? -0.010  135.370 1.883   1.00 127.26 ? 3   DA  E N6    1 
ATOM   384  N N1    . DA  B 1 3   ? -1.749  136.704 2.607   1.00 127.45 ? 3   DA  E N1    1 
ATOM   385  C C2    . DA  B 1 3   ? -2.333  137.398 3.594   1.00 127.59 ? 3   DA  E C2    1 
ATOM   386  N N3    . DA  B 1 3   ? -1.939  137.566 4.856   1.00 127.72 ? 3   DA  E N3    1 
ATOM   387  C C4    . DA  B 1 3   ? -0.784  136.916 5.079   1.00 127.84 ? 3   DA  E C4    1 
ATOM   388  P P     . DT  B 1 4   ? -1.906  134.986 11.230  1.00 128.82 ? 4   DT  E P     1 
ATOM   389  O OP1   . DT  B 1 4   ? -2.341  135.217 12.634  1.00 128.46 ? 4   DT  E OP1   1 
ATOM   390  O OP2   . DT  B 1 4   ? -1.296  133.683 10.853  1.00 128.76 ? 4   DT  E OP2   1 
ATOM   391  O "O5'" . DT  B 1 4   ? -3.153  135.240 10.280  1.00 128.69 ? 4   DT  E "O5'" 1 
ATOM   392  C "C5'" . DT  B 1 4   ? -3.867  134.159 9.707   1.00 128.82 ? 4   DT  E "C5'" 1 
ATOM   393  C "C4'" . DT  B 1 4   ? -4.526  134.605 8.432   1.00 128.92 ? 4   DT  E "C4'" 1 
ATOM   394  O "O4'" . DT  B 1 4   ? -3.514  135.038 7.491   1.00 128.78 ? 4   DT  E "O4'" 1 
ATOM   395  C "C3'" . DT  B 1 4   ? -5.313  133.541 7.688   1.00 129.19 ? 4   DT  E "C3'" 1 
ATOM   396  O "O3'" . DT  B 1 4   ? -6.624  133.468 8.244   1.00 129.66 ? 4   DT  E "O3'" 1 
ATOM   397  C "C2'" . DT  B 1 4   ? -5.322  134.075 6.255   1.00 128.94 ? 4   DT  E "C2'" 1 
ATOM   398  C "C1'" . DT  B 1 4   ? -3.969  134.795 6.170   1.00 128.68 ? 4   DT  E "C1'" 1 
ATOM   399  N N1    . DT  B 1 4   ? -2.913  134.077 5.426   1.00 128.31 ? 4   DT  E N1    1 
ATOM   400  C C2    . DT  B 1 4   ? -3.062  133.912 4.062   1.00 128.11 ? 4   DT  E C2    1 
ATOM   401  O O2    . DT  B 1 4   ? -4.041  134.308 3.444   1.00 127.91 ? 4   DT  E O2    1 
ATOM   402  N N3    . DT  B 1 4   ? -2.021  133.264 3.444   1.00 127.96 ? 4   DT  E N3    1 
ATOM   403  C C4    . DT  B 1 4   ? -0.871  132.774 4.035   1.00 127.84 ? 4   DT  E C4    1 
ATOM   404  O O4    . DT  B 1 4   ? -0.018  132.218 3.348   1.00 127.65 ? 4   DT  E O4    1 
ATOM   405  C C5    . DT  B 1 4   ? -0.781  132.976 5.469   1.00 127.84 ? 4   DT  E C5    1 
ATOM   406  C C7    . DT  B 1 4   ? 0.431   132.488 6.196   1.00 127.63 ? 4   DT  E C7    1 
ATOM   407  C C6    . DT  B 1 4   ? -1.795  133.603 6.081   1.00 128.08 ? 4   DT  E C6    1 
ATOM   408  P P     . DT  B 1 5   ? -7.557  132.197 7.920   1.00 130.04 ? 5   DT  E P     1 
ATOM   409  O OP1   . DT  B 1 5   ? -8.666  132.115 8.893   1.00 129.92 ? 5   DT  E OP1   1 
ATOM   410  O OP2   . DT  B 1 5   ? -6.676  131.010 7.708   1.00 130.05 ? 5   DT  E OP2   1 
ATOM   411  O "O5'" . DT  B 1 5   ? -8.205  132.577 6.525   1.00 130.15 ? 5   DT  E "O5'" 1 
ATOM   412  C "C5'" . DT  B 1 5   ? -8.731  131.577 5.677   1.00 130.52 ? 5   DT  E "C5'" 1 
ATOM   413  C "C4'" . DT  B 1 5   ? -8.511  131.980 4.251   1.00 130.98 ? 5   DT  E "C4'" 1 
ATOM   414  O "O4'" . DT  B 1 5   ? -7.128  132.352 4.070   1.00 131.07 ? 5   DT  E "O4'" 1 
ATOM   415  C "C3'" . DT  B 1 5   ? -8.792  130.926 3.199   1.00 131.23 ? 5   DT  E "C3'" 1 
ATOM   416  O "O3'" . DT  B 1 5   ? -10.174 131.007 2.867   1.00 131.53 ? 5   DT  E "O3'" 1 
ATOM   417  C "C2'" . DT  B 1 5   ? -7.916  131.375 2.031   1.00 131.35 ? 5   DT  E "C2'" 1 
ATOM   418  C "C1'" . DT  B 1 5   ? -6.748  132.072 2.743   1.00 131.37 ? 5   DT  E "C1'" 1 
ATOM   419  N N1    . DT  B 1 5   ? -5.449  131.367 2.770   1.00 131.47 ? 5   DT  E N1    1 
ATOM   420  C C2    . DT  B 1 5   ? -4.826  131.140 1.567   1.00 131.49 ? 5   DT  E C2    1 
ATOM   421  O O2    . DT  B 1 5   ? -5.325  131.441 0.494   1.00 131.78 ? 5   DT  E O2    1 
ATOM   422  N N3    . DT  B 1 5   ? -3.594  130.545 1.663   1.00 131.28 ? 5   DT  E N3    1 
ATOM   423  C C4    . DT  B 1 5   ? -2.936  130.161 2.814   1.00 131.08 ? 5   DT  E C4    1 
ATOM   424  O O4    . DT  B 1 5   ? -1.818  129.655 2.735   1.00 130.99 ? 5   DT  E O4    1 
ATOM   425  C C5    . DT  B 1 5   ? -3.657  130.408 4.045   1.00 131.05 ? 5   DT  E C5    1 
ATOM   426  C C7    . DT  B 1 5   ? -3.031  130.021 5.347   1.00 130.85 ? 5   DT  E C7    1 
ATOM   427  C C6    . DT  B 1 5   ? -4.866  130.985 3.962   1.00 131.28 ? 5   DT  E C6    1 
ATOM   428  P P     . DG  B 1 6   ? -10.890 129.779 2.132   1.00 131.86 ? 6   DG  E P     1 
ATOM   429  O OP1   . DG  B 1 6   ? -12.144 129.457 2.864   1.00 132.02 ? 6   DG  E OP1   1 
ATOM   430  O OP2   . DG  B 1 6   ? -9.864  128.732 1.938   1.00 132.00 ? 6   DG  E OP2   1 
ATOM   431  O "O5'" . DG  B 1 6   ? -11.270 130.372 0.705   1.00 132.28 ? 6   DG  E "O5'" 1 
ATOM   432  C "C5'" . DG  B 1 6   ? -11.185 129.568 -0.465  1.00 132.79 ? 6   DG  E "C5'" 1 
ATOM   433  C "C4'" . DG  B 1 6   ? -10.050 130.048 -1.327  1.00 133.15 ? 6   DG  E "C4'" 1 
ATOM   434  O "O4'" . DG  B 1 6   ? -8.868  130.171 -0.509  1.00 133.25 ? 6   DG  E "O4'" 1 
ATOM   435  C "C3'" . DG  B 1 6   ? -9.651  129.126 -2.467  1.00 133.50 ? 6   DG  E "C3'" 1 
ATOM   436  O "O3'" . DG  B 1 6   ? -10.426 129.455 -3.615  1.00 133.87 ? 6   DG  E "O3'" 1 
ATOM   437  C "C2'" . DG  B 1 6   ? -8.184  129.486 -2.696  1.00 133.63 ? 6   DG  E "C2'" 1 
ATOM   438  C "C1'" . DG  B 1 6   ? -7.727  129.924 -1.301  1.00 133.63 ? 6   DG  E "C1'" 1 
ATOM   439  N N9    . DG  B 1 6   ? -6.843  129.011 -0.580  1.00 133.83 ? 6   DG  E N9    1 
ATOM   440  C C8    . DG  B 1 6   ? -6.950  128.625 0.735   1.00 133.83 ? 6   DG  E C8    1 
ATOM   441  N N7    . DG  B 1 6   ? -5.963  127.867 1.129   1.00 133.86 ? 6   DG  E N7    1 
ATOM   442  C C5    . DG  B 1 6   ? -5.167  127.724 0.001   1.00 133.92 ? 6   DG  E C5    1 
ATOM   443  C C6    . DG  B 1 6   ? -3.948  127.014 -0.184  1.00 133.95 ? 6   DG  E C6    1 
ATOM   444  O O6    . DG  B 1 6   ? -3.302  126.353 0.645   1.00 134.04 ? 6   DG  E O6    1 
ATOM   445  N N1    . DG  B 1 6   ? -3.484  127.131 -1.490  1.00 133.86 ? 6   DG  E N1    1 
ATOM   446  C C2    . DG  B 1 6   ? -4.102  127.843 -2.490  1.00 133.88 ? 6   DG  E C2    1 
ATOM   447  N N2    . DG  B 1 6   ? -3.494  127.839 -3.686  1.00 133.94 ? 6   DG  E N2    1 
ATOM   448  N N3    . DG  B 1 6   ? -5.232  128.513 -2.329  1.00 133.90 ? 6   DG  E N3    1 
ATOM   449  C C4    . DG  B 1 6   ? -5.705  128.411 -1.069  1.00 133.90 ? 6   DG  E C4    1 
ATOM   450  P P     . DT  B 1 7   ? -10.981 128.289 -4.566  1.00 134.17 ? 7   DT  E P     1 
ATOM   451  O OP1   . DT  B 1 7   ? -11.916 128.892 -5.549  1.00 134.26 ? 7   DT  E OP1   1 
ATOM   452  O OP2   . DT  B 1 7   ? -11.453 127.201 -3.675  1.00 134.49 ? 7   DT  E OP2   1 
ATOM   453  O "O5'" . DT  B 1 7   ? -9.695  127.774 -5.355  1.00 134.26 ? 7   DT  E "O5'" 1 
ATOM   454  C "C5'" . DT  B 1 7   ? -9.063  128.597 -6.329  1.00 134.24 ? 7   DT  E "C5'" 1 
ATOM   455  C "C4'" . DT  B 1 7   ? -7.738  128.001 -6.745  1.00 134.23 ? 7   DT  E "C4'" 1 
ATOM   456  O "O4'" . DT  B 1 7   ? -6.886  127.855 -5.586  1.00 134.54 ? 7   DT  E "O4'" 1 
ATOM   457  C "C3'" . DT  B 1 7   ? -7.772  126.608 -7.351  1.00 133.96 ? 7   DT  E "C3'" 1 
ATOM   458  O "O3'" . DT  B 1 7   ? -8.025  126.724 -8.746  1.00 133.46 ? 7   DT  E "O3'" 1 
ATOM   459  C "C2'" . DT  B 1 7   ? -6.347  126.106 -7.121  1.00 134.27 ? 7   DT  E "C2'" 1 
ATOM   460  C "C1'" . DT  B 1 7   ? -5.939  126.836 -5.838  1.00 134.69 ? 7   DT  E "C1'" 1 
ATOM   461  N N1    . DT  B 1 7   ? -5.790  125.997 -4.632  1.00 135.08 ? 7   DT  E N1    1 
ATOM   462  C C2    . DT  B 1 7   ? -4.624  125.275 -4.511  1.00 135.24 ? 7   DT  E C2    1 
ATOM   463  O O2    . DT  B 1 7   ? -3.752  125.272 -5.368  1.00 135.26 ? 7   DT  E O2    1 
ATOM   464  N N3    . DT  B 1 7   ? -4.513  124.558 -3.345  1.00 135.29 ? 7   DT  E N3    1 
ATOM   465  C C4    . DT  B 1 7   ? -5.428  124.490 -2.311  1.00 135.21 ? 7   DT  E C4    1 
ATOM   466  O O4    . DT  B 1 7   ? -5.174  123.815 -1.312  1.00 135.09 ? 7   DT  E O4    1 
ATOM   467  C C5    . DT  B 1 7   ? -6.640  125.255 -2.513  1.00 135.20 ? 7   DT  E C5    1 
ATOM   468  C C7    . DT  B 1 7   ? -7.695  125.235 -1.453  1.00 135.12 ? 7   DT  E C7    1 
ATOM   469  C C6    . DT  B 1 7   ? -6.761  125.956 -3.651  1.00 135.17 ? 7   DT  E C6    1 
ATOM   470  P P     . DG  B 1 8   ? -8.371  125.416 -9.609  1.00 133.12 ? 8   DG  E P     1 
ATOM   471  O OP1   . DG  B 1 8   ? -8.701  125.852 -10.989 1.00 133.14 ? 8   DG  E OP1   1 
ATOM   472  O OP2   . DG  B 1 8   ? -9.364  124.638 -8.827  1.00 133.26 ? 8   DG  E OP2   1 
ATOM   473  O "O5'" . DG  B 1 8   ? -7.004  124.593 -9.662  1.00 132.86 ? 8   DG  E "O5'" 1 
ATOM   474  C "C5'" . DG  B 1 8   ? -5.913  125.032 -10.471 1.00 132.00 ? 8   DG  E "C5'" 1 
ATOM   475  C "C4'" . DG  B 1 8   ? -4.637  124.317 -10.078 1.00 131.46 ? 8   DG  E "C4'" 1 
ATOM   476  O "O4'" . DG  B 1 8   ? -4.445  124.455 -8.648  1.00 131.46 ? 8   DG  E "O4'" 1 
ATOM   477  C "C3'" . DG  B 1 8   ? -4.574  122.812 -10.318 1.00 131.01 ? 8   DG  E "C3'" 1 
ATOM   478  O "O3'" . DG  B 1 8   ? -4.118  122.549 -11.644 1.00 130.33 ? 8   DG  E "O3'" 1 
ATOM   479  C "C2'" . DG  B 1 8   ? -3.516  122.361 -9.315  1.00 131.23 ? 8   DG  E "C2'" 1 
ATOM   480  C "C1'" . DG  B 1 8   ? -3.717  123.345 -8.162  1.00 131.42 ? 8   DG  E "C1'" 1 
ATOM   481  N N9    . DG  B 1 8   ? -4.403  122.794 -6.995  1.00 131.47 ? 8   DG  E N9    1 
ATOM   482  C C8    . DG  B 1 8   ? -5.720  122.957 -6.631  1.00 131.40 ? 8   DG  E C8    1 
ATOM   483  N N7    . DG  B 1 8   ? -6.014  122.373 -5.500  1.00 131.23 ? 8   DG  E N7    1 
ATOM   484  C C5    . DG  B 1 8   ? -4.825  121.779 -5.100  1.00 131.25 ? 8   DG  E C5    1 
ATOM   485  C C6    . DG  B 1 8   ? -4.515  121.009 -3.946  1.00 131.18 ? 8   DG  E C6    1 
ATOM   486  O O6    . DG  B 1 8   ? -5.257  120.690 -3.007  1.00 131.12 ? 8   DG  E O6    1 
ATOM   487  N N1    . DG  B 1 8   ? -3.186  120.601 -3.944  1.00 131.18 ? 8   DG  E N1    1 
ATOM   488  C C2    . DG  B 1 8   ? -2.266  120.895 -4.921  1.00 131.13 ? 8   DG  E C2    1 
ATOM   489  N N2    . DG  B 1 8   ? -1.028  120.409 -4.745  1.00 131.04 ? 8   DG  E N2    1 
ATOM   490  N N3    . DG  B 1 8   ? -2.538  121.613 -5.995  1.00 131.25 ? 8   DG  E N3    1 
ATOM   491  C C4    . DG  B 1 8   ? -3.825  122.020 -6.020  1.00 131.37 ? 8   DG  E C4    1 
ATOM   492  P P     . DA  B 1 9   ? -4.164  121.048 -12.229 1.00 129.96 ? 9   DA  E P     1 
ATOM   493  O OP1   . DA  B 1 9   ? -3.409  121.030 -13.509 1.00 129.88 ? 9   DA  E OP1   1 
ATOM   494  O OP2   . DA  B 1 9   ? -5.577  120.592 -12.207 1.00 129.98 ? 9   DA  E OP2   1 
ATOM   495  O "O5'" . DA  B 1 9   ? -3.350  120.175 -11.172 1.00 129.40 ? 9   DA  E "O5'" 1 
ATOM   496  C "C5'" . DA  B 1 9   ? -1.925  120.194 -11.153 1.00 128.35 ? 9   DA  E "C5'" 1 
ATOM   497  C "C4'" . DA  B 1 9   ? -1.393  119.266 -10.081 1.00 127.61 ? 9   DA  E "C4'" 1 
ATOM   498  O "O4'" . DA  B 1 9   ? -1.921  119.659 -8.790  1.00 127.79 ? 9   DA  E "O4'" 1 
ATOM   499  C "C3'" . DA  B 1 9   ? -1.764  117.792 -10.185 1.00 126.80 ? 9   DA  E "C3'" 1 
ATOM   500  O "O3'" . DA  B 1 9   ? -0.857  117.121 -11.056 1.00 125.25 ? 9   DA  E "O3'" 1 
ATOM   501  C "C2'" . DA  B 1 9   ? -1.560  117.299 -8.755  1.00 127.28 ? 9   DA  E "C2'" 1 
ATOM   502  C "C1'" . DA  B 1 9   ? -1.898  118.540 -7.924  1.00 127.81 ? 9   DA  E "C1'" 1 
ATOM   503  N N9    . DA  B 1 9   ? -3.159  118.463 -7.183  1.00 128.14 ? 9   DA  E N9    1 
ATOM   504  C C8    . DA  B 1 9   ? -4.435  118.795 -7.572  1.00 128.09 ? 9   DA  E C8    1 
ATOM   505  N N7    . DA  B 1 9   ? -5.336  118.622 -6.631  1.00 128.10 ? 9   DA  E N7    1 
ATOM   506  C C5    . DA  B 1 9   ? -4.605  118.137 -5.553  1.00 128.24 ? 9   DA  E C5    1 
ATOM   507  C C6    . DA  B 1 9   ? -4.969  117.759 -4.241  1.00 128.30 ? 9   DA  E C6    1 
ATOM   508  N N6    . DA  B 1 9   ? -6.216  117.809 -3.762  1.00 128.05 ? 9   DA  E N6    1 
ATOM   509  N N1    . DA  B 1 9   ? -3.988  117.321 -3.422  1.00 128.46 ? 9   DA  E N1    1 
ATOM   510  C C2    . DA  B 1 9   ? -2.735  117.271 -3.888  1.00 128.47 ? 9   DA  E C2    1 
ATOM   511  N N3    . DA  B 1 9   ? -2.270  117.599 -5.089  1.00 128.45 ? 9   DA  E N3    1 
ATOM   512  C C4    . DA  B 1 9   ? -3.266  118.029 -5.883  1.00 128.28 ? 9   DA  E C4    1 
ATOM   513  P P     . DG  B 1 10  ? -1.172  115.618 -11.541 1.00 124.07 ? 10  DG  E P     1 
ATOM   514  O OP1   . DG  B 1 10  ? -0.143  115.225 -12.538 1.00 124.09 ? 10  DG  E OP1   1 
ATOM   515  O OP2   . DG  B 1 10  ? -2.611  115.551 -11.905 1.00 123.96 ? 10  DG  E OP2   1 
ATOM   516  O "O5'" . DG  B 1 10  ? -0.957  114.724 -10.239 1.00 123.14 ? 10  DG  E "O5'" 1 
ATOM   517  C "C5'" . DG  B 1 10  ? 0.307   114.683 -9.581  1.00 120.91 ? 10  DG  E "C5'" 1 
ATOM   518  C "C4'" . DG  B 1 10  ? 0.149   114.133 -8.182  1.00 119.25 ? 10  DG  E "C4'" 1 
ATOM   519  O "O4'" . DG  B 1 10  ? -0.859  114.906 -7.489  1.00 119.17 ? 10  DG  E "O4'" 1 
ATOM   520  C "C3'" . DG  B 1 10  ? -0.345  112.698 -8.063  1.00 118.01 ? 10  DG  E "C3'" 1 
ATOM   521  O "O3'" . DG  B 1 10  ? 0.775   111.822 -8.101  1.00 116.09 ? 10  DG  E "O3'" 1 
ATOM   522  C "C2'" . DG  B 1 10  ? -0.970  112.664 -6.672  1.00 118.45 ? 10  DG  E "C2'" 1 
ATOM   523  C "C1'" . DG  B 1 10  ? -1.445  114.107 -6.488  1.00 118.77 ? 10  DG  E "C1'" 1 
ATOM   524  N N9    . DG  B 1 10  ? -2.892  114.305 -6.485  1.00 118.59 ? 10  DG  E N9    1 
ATOM   525  C C8    . DG  B 1 10  ? -3.737  114.519 -7.549  1.00 118.47 ? 10  DG  E C8    1 
ATOM   526  N N7    . DG  B 1 10  ? -4.983  114.685 -7.184  1.00 118.31 ? 10  DG  E N7    1 
ATOM   527  C C5    . DG  B 1 10  ? -4.953  114.567 -5.799  1.00 118.23 ? 10  DG  E C5    1 
ATOM   528  C C6    . DG  B 1 10  ? -5.998  114.656 -4.831  1.00 118.08 ? 10  DG  E C6    1 
ATOM   529  O O6    . DG  B 1 10  ? -7.206  114.872 -5.006  1.00 117.64 ? 10  DG  E O6    1 
ATOM   530  N N1    . DG  B 1 10  ? -5.510  114.469 -3.540  1.00 118.14 ? 10  DG  E N1    1 
ATOM   531  C C2    . DG  B 1 10  ? -4.193  114.230 -3.217  1.00 118.12 ? 10  DG  E C2    1 
ATOM   532  N N2    . DG  B 1 10  ? -3.905  114.073 -1.921  1.00 118.13 ? 10  DG  E N2    1 
ATOM   533  N N3    . DG  B 1 10  ? -3.224  114.151 -4.100  1.00 118.27 ? 10  DG  E N3    1 
ATOM   534  C C4    . DG  B 1 10  ? -3.669  114.326 -5.360  1.00 118.41 ? 10  DG  E C4    1 
ATOM   535  P P     . DC  B 1 11  ? 0.551   110.235 -8.023  1.00 114.63 ? 11  DC  E P     1 
ATOM   536  O OP1   . DC  B 1 11  ? 1.830   109.578 -8.391  1.00 114.76 ? 11  DC  E OP1   1 
ATOM   537  O OP2   . DC  B 1 11  ? -0.685  109.919 -8.784  1.00 114.38 ? 11  DC  E OP2   1 
ATOM   538  O "O5'" . DC  B 1 11  ? 0.264   109.947 -6.482  1.00 113.52 ? 11  DC  E "O5'" 1 
ATOM   539  C "C5'" . DC  B 1 11  ? 1.316   109.930 -5.515  1.00 111.38 ? 11  DC  E "C5'" 1 
ATOM   540  C "C4'" . DC  B 1 11  ? 0.770   109.497 -4.172  1.00 110.05 ? 11  DC  E "C4'" 1 
ATOM   541  O "O4'" . DC  B 1 11  ? -0.299  110.405 -3.809  1.00 109.84 ? 11  DC  E "O4'" 1 
ATOM   542  C "C3'" . DC  B 1 11  ? 0.145   108.106 -4.141  1.00 109.18 ? 11  DC  E "C3'" 1 
ATOM   543  O "O3'" . DC  B 1 11  ? 1.137   107.159 -3.751  1.00 107.30 ? 11  DC  E "O3'" 1 
ATOM   544  C "C2'" . DC  B 1 11  ? -0.910  108.227 -3.041  1.00 109.26 ? 11  DC  E "C2'" 1 
ATOM   545  C "C1'" . DC  B 1 11  ? -1.323  109.699 -3.137  1.00 109.49 ? 11  DC  E "C1'" 1 
ATOM   546  N N1    . DC  B 1 11  ? -2.591  109.952 -3.837  1.00 109.37 ? 11  DC  E N1    1 
ATOM   547  C C2    . DC  B 1 11  ? -3.612  110.589 -3.137  1.00 109.34 ? 11  DC  E C2    1 
ATOM   548  O O2    . DC  B 1 11  ? -3.423  110.887 -1.947  1.00 108.98 ? 11  DC  E O2    1 
ATOM   549  N N3    . DC  B 1 11  ? -4.775  110.869 -3.769  1.00 109.42 ? 11  DC  E N3    1 
ATOM   550  C C4    . DC  B 1 11  ? -4.941  110.527 -5.046  1.00 109.43 ? 11  DC  E C4    1 
ATOM   551  N N4    . DC  B 1 11  ? -6.106  110.840 -5.624  1.00 109.46 ? 11  DC  E N4    1 
ATOM   552  C C5    . DC  B 1 11  ? -3.922  109.855 -5.784  1.00 109.22 ? 11  DC  E C5    1 
ATOM   553  C C6    . DC  B 1 11  ? -2.772  109.589 -5.145  1.00 109.24 ? 11  DC  E C6    1 
ATOM   554  P P     . DG  B 1 12  ? 1.792   106.183 -4.842  1.00 105.95 ? 12  DG  E P     1 
ATOM   555  O OP1   . DG  B 1 12  ? 3.018   105.606 -4.246  1.00 105.85 ? 12  DG  E OP1   1 
ATOM   556  O OP2   . DG  B 1 12  ? 1.874   106.917 -6.127  1.00 106.31 ? 12  DG  E OP2   1 
ATOM   557  O "O5'" . DG  B 1 12  ? 0.734   105.015 -5.013  1.00 105.43 ? 12  DG  E "O5'" 1 
ATOM   558  C "C5'" . DG  B 1 12  ? 0.499   104.105 -3.959  1.00 105.10 ? 12  DG  E "C5'" 1 
ATOM   559  C "C4'" . DG  B 1 12  ? -0.841  103.467 -4.141  1.00 105.13 ? 12  DG  E "C4'" 1 
ATOM   560  O "O4'" . DG  B 1 12  ? -1.817  104.516 -4.291  1.00 105.38 ? 12  DG  E "O4'" 1 
ATOM   561  C "C3'" . DG  B 1 12  ? -1.003  102.630 -5.399  1.00 105.17 ? 12  DG  E "C3'" 1 
ATOM   562  O "O3'" . DG  B 1 12  ? -0.604  101.305 -5.071  1.00 105.47 ? 12  DG  E "O3'" 1 
ATOM   563  C "C2'" . DG  B 1 12  ? -2.506  102.696 -5.683  1.00 105.34 ? 12  DG  E "C2'" 1 
ATOM   564  C "C1'" . DG  B 1 12  ? -2.920  104.004 -5.002  1.00 105.63 ? 12  DG  E "C1'" 1 
ATOM   565  N N9    . DG  B 1 12  ? -3.520  105.063 -5.809  1.00 105.68 ? 12  DG  E N9    1 
ATOM   566  C C8    . DG  B 1 12  ? -2.931  105.867 -6.756  1.00 105.75 ? 12  DG  E C8    1 
ATOM   567  N N7    . DG  B 1 12  ? -3.750  106.761 -7.244  1.00 105.54 ? 12  DG  E N7    1 
ATOM   568  C C5    . DG  B 1 12  ? -4.950  106.520 -6.588  1.00 105.58 ? 12  DG  E C5    1 
ATOM   569  C C6    . DG  B 1 12  ? -6.204  107.173 -6.686  1.00 105.76 ? 12  DG  E C6    1 
ATOM   570  O O6    . DG  B 1 12  ? -6.521  108.138 -7.391  1.00 106.18 ? 12  DG  E O6    1 
ATOM   571  N N1    . DG  B 1 12  ? -7.147  106.595 -5.839  1.00 105.77 ? 12  DG  E N1    1 
ATOM   572  C C2    . DG  B 1 12  ? -6.914  105.535 -5.000  1.00 105.52 ? 12  DG  E C2    1 
ATOM   573  N N2    . DG  B 1 12  ? -7.949  105.112 -4.254  1.00 105.25 ? 12  DG  E N2    1 
ATOM   574  N N3    . DG  B 1 12  ? -5.752  104.927 -4.897  1.00 105.47 ? 12  DG  E N3    1 
ATOM   575  C C4    . DG  B 1 12  ? -4.824  105.467 -5.713  1.00 105.51 ? 12  DG  E C4    1 
ATOM   576  P P     . DC  B 1 13  ? -1.263  100.055 -5.834  1.00 105.56 ? 13  DC  E P     1 
ATOM   577  O OP1   . DC  B 1 13  ? -0.536  98.823  -5.448  1.00 105.94 ? 13  DC  E OP1   1 
ATOM   578  O OP2   . DC  B 1 13  ? -1.367  100.435 -7.256  1.00 105.94 ? 13  DC  E OP2   1 
ATOM   579  O "O5'" . DC  B 1 13  ? -2.735  99.951  -5.246  1.00 105.65 ? 13  DC  E "O5'" 1 
ATOM   580  C "C5'" . DC  B 1 13  ? -3.768  99.324  -5.991  1.00 106.29 ? 13  DC  E "C5'" 1 
ATOM   581  C "C4'" . DC  B 1 13  ? -5.082  99.992  -5.695  1.00 107.03 ? 13  DC  E "C4'" 1 
ATOM   582  O "O4'" . DC  B 1 13  ? -4.963  101.403 -5.968  1.00 106.73 ? 13  DC  E "O4'" 1 
ATOM   583  C "C3'" . DC  B 1 13  ? -6.268  99.543  -6.529  1.00 107.68 ? 13  DC  E "C3'" 1 
ATOM   584  O "O3'" . DC  B 1 13  ? -6.854  98.419  -5.886  1.00 109.46 ? 13  DC  E "O3'" 1 
ATOM   585  C "C2'" . DC  B 1 13  ? -7.207  100.746 -6.459  1.00 107.21 ? 13  DC  E "C2'" 1 
ATOM   586  C "C1'" . DC  B 1 13  ? -6.238  101.918 -6.265  1.00 106.70 ? 13  DC  E "C1'" 1 
ATOM   587  N N1    . DC  B 1 13  ? -6.124  102.886 -7.367  1.00 106.40 ? 13  DC  E N1    1 
ATOM   588  C C2    . DC  B 1 13  ? -7.235  103.667 -7.671  1.00 106.21 ? 13  DC  E C2    1 
ATOM   589  O O2    . DC  B 1 13  ? -8.284  103.475 -7.045  1.00 106.25 ? 13  DC  E O2    1 
ATOM   590  N N3    . DC  B 1 13  ? -7.142  104.609 -8.633  1.00 106.02 ? 13  DC  E N3    1 
ATOM   591  C C4    . DC  B 1 13  ? -5.996  104.782 -9.286  1.00 106.05 ? 13  DC  E C4    1 
ATOM   592  N N4    . DC  B 1 13  ? -5.952  105.741 -10.217 1.00 105.96 ? 13  DC  E N4    1 
ATOM   593  C C5    . DC  B 1 13  ? -4.847  103.984 -9.014  1.00 106.01 ? 13  DC  E C5    1 
ATOM   594  C C6    . DC  B 1 13  ? -4.957  103.050 -8.057  1.00 106.09 ? 13  DC  E C6    1 
ATOM   595  P P     . DT  B 1 14  ? -7.639  97.325  -6.753  1.00 111.02 ? 14  DT  E P     1 
ATOM   596  O OP1   . DT  B 1 14  ? -7.656  96.040  -6.008  1.00 110.88 ? 14  DT  E OP1   1 
ATOM   597  O OP2   . DT  B 1 14  ? -7.055  97.380  -8.119  1.00 110.96 ? 14  DT  E OP2   1 
ATOM   598  O "O5'" . DT  B 1 14  ? -9.132  97.872  -6.811  1.00 112.71 ? 14  DT  E "O5'" 1 
ATOM   599  C "C5'" . DT  B 1 14  ? -9.936  97.927  -5.636  1.00 115.35 ? 14  DT  E "C5'" 1 
ATOM   600  C "C4'" . DT  B 1 14  ? -11.118 98.840  -5.861  1.00 117.32 ? 14  DT  E "C4'" 1 
ATOM   601  O "O4'" . DT  B 1 14  ? -10.623 100.130 -6.280  1.00 117.57 ? 14  DT  E "O4'" 1 
ATOM   602  C "C3'" . DT  B 1 14  ? -12.083 98.414  -6.957  1.00 118.69 ? 14  DT  E "C3'" 1 
ATOM   603  O "O3'" . DT  B 1 14  ? -13.076 97.578  -6.365  1.00 121.32 ? 14  DT  E "O3'" 1 
ATOM   604  C "C2'" . DT  B 1 14  ? -12.679 99.737  -7.432  1.00 118.29 ? 14  DT  E "C2'" 1 
ATOM   605  C "C1'" . DT  B 1 14  ? -11.537 100.724 -7.176  1.00 117.84 ? 14  DT  E "C1'" 1 
ATOM   606  N N1    . DT  B 1 14  ? -10.784 101.211 -8.350  1.00 117.59 ? 14  DT  E N1    1 
ATOM   607  C C2    . DT  B 1 14  ? -11.188 102.399 -8.920  1.00 117.39 ? 14  DT  E C2    1 
ATOM   608  O O2    . DT  B 1 14  ? -12.169 103.020 -8.543  1.00 117.43 ? 14  DT  E O2    1 
ATOM   609  N N3    . DT  B 1 14  ? -10.394 102.840 -9.949  1.00 117.17 ? 14  DT  E N3    1 
ATOM   610  C C4    . DT  B 1 14  ? -9.266  102.227 -10.457 1.00 117.16 ? 14  DT  E C4    1 
ATOM   611  O O4    . DT  B 1 14  ? -8.640  102.765 -11.371 1.00 117.07 ? 14  DT  E O4    1 
ATOM   612  C C5    . DT  B 1 14  ? -8.916  100.964 -9.831  1.00 117.17 ? 14  DT  E C5    1 
ATOM   613  C C7    . DT  B 1 14  ? -7.715  100.217 -10.320 1.00 116.98 ? 14  DT  E C7    1 
ATOM   614  C C6    . DT  B 1 14  ? -9.689  100.522 -8.830  1.00 117.22 ? 14  DT  E C6    1 
ATOM   615  P P     . DC  B 1 15  ? -14.331 97.074  -7.239  1.00 123.29 ? 15  DC  E P     1 
ATOM   616  O OP1   . DC  B 1 15  ? -14.905 95.864  -6.591  1.00 123.02 ? 15  DC  E OP1   1 
ATOM   617  O OP2   . DC  B 1 15  ? -13.891 97.012  -8.660  1.00 123.11 ? 15  DC  E OP2   1 
ATOM   618  O "O5'" . DC  B 1 15  ? -15.390 98.254  -7.097  1.00 124.22 ? 15  DC  E "O5'" 1 
ATOM   619  C "C5'" . DC  B 1 15  ? -16.330 98.509  -8.130  1.00 126.13 ? 15  DC  E "C5'" 1 
ATOM   620  C "C4'" . DC  B 1 15  ? -16.415 99.989  -8.392  1.00 127.54 ? 15  DC  E "C4'" 1 
ATOM   621  O "O4'" . DC  B 1 15  ? -15.091 100.514 -8.647  1.00 127.56 ? 15  DC  E "O4'" 1 
ATOM   622  C "C3'" . DC  B 1 15  ? -17.223 100.378 -9.615  1.00 128.68 ? 15  DC  E "C3'" 1 
ATOM   623  O "O3'" . DC  B 1 15  ? -18.591 100.472 -9.236  1.00 130.63 ? 15  DC  E "O3'" 1 
ATOM   624  C "C2'" . DC  B 1 15  ? -16.647 101.745 -9.980  1.00 128.27 ? 15  DC  E "C2'" 1 
ATOM   625  C "C1'" . DC  B 1 15  ? -15.187 101.616 -9.528  1.00 127.64 ? 15  DC  E "C1'" 1 
ATOM   626  N N1    . DC  B 1 15  ? -14.181 101.460 -10.595 1.00 127.15 ? 15  DC  E N1    1 
ATOM   627  C C2    . DC  B 1 15  ? -13.923 102.547 -11.436 1.00 126.85 ? 15  DC  E C2    1 
ATOM   628  O O2    . DC  B 1 15  ? -14.586 103.589 -11.297 1.00 126.84 ? 15  DC  E O2    1 
ATOM   629  N N3    . DC  B 1 15  ? -12.962 102.438 -12.379 1.00 126.53 ? 15  DC  E N3    1 
ATOM   630  C C4    . DC  B 1 15  ? -12.277 101.305 -12.506 1.00 126.43 ? 15  DC  E C4    1 
ATOM   631  N N4    . DC  B 1 15  ? -11.328 101.261 -13.449 1.00 126.36 ? 15  DC  E N4    1 
ATOM   632  C C5    . DC  B 1 15  ? -12.531 100.171 -11.680 1.00 126.54 ? 15  DC  E C5    1 
ATOM   633  C C6    . DC  B 1 15  ? -13.487 100.292 -10.747 1.00 126.86 ? 15  DC  E C6    1 
ATOM   634  P P     . DA  B 1 16  ? -19.713 99.729  -10.110 1.00 132.29 ? 16  DA  E P     1 
ATOM   635  O OP1   . DA  B 1 16  ? -20.990 99.800  -9.352  1.00 132.04 ? 16  DA  E OP1   1 
ATOM   636  O OP2   . DA  B 1 16  ? -19.169 98.406  -10.517 1.00 132.10 ? 16  DA  E OP2   1 
ATOM   637  O "O5'" . DA  B 1 16  ? -19.841 100.641 -11.410 1.00 133.16 ? 16  DA  E "O5'" 1 
ATOM   638  C "C5'" . DA  B 1 16  ? -20.303 101.983 -11.306 1.00 134.82 ? 16  DA  E "C5'" 1 
ATOM   639  C "C4'" . DA  B 1 16  ? -19.914 102.768 -12.533 1.00 136.00 ? 16  DA  E "C4'" 1 
ATOM   640  O "O4'" . DA  B 1 16  ? -18.470 102.841 -12.626 1.00 136.18 ? 16  DA  E "O4'" 1 
ATOM   641  C "C3'" . DA  B 1 16  ? -20.340 102.184 -13.870 1.00 136.81 ? 16  DA  E "C3'" 1 
ATOM   642  O "O3'" . DA  B 1 16  ? -21.690 102.558 -14.152 1.00 137.96 ? 16  DA  E "O3'" 1 
ATOM   643  C "C2'" . DA  B 1 16  ? -19.362 102.842 -14.840 1.00 136.68 ? 16  DA  E "C2'" 1 
ATOM   644  C "C1'" . DA  B 1 16  ? -18.099 102.983 -13.984 1.00 136.35 ? 16  DA  E "C1'" 1 
ATOM   645  N N9    . DA  B 1 16  ? -17.040 102.022 -14.290 1.00 136.25 ? 16  DA  E N9    1 
ATOM   646  C C8    . DA  B 1 16  ? -16.882 100.729 -13.851 1.00 136.03 ? 16  DA  E C8    1 
ATOM   647  N N7    . DA  B 1 16  ? -15.789 100.151 -14.296 1.00 136.02 ? 16  DA  E N7    1 
ATOM   648  C C5    . DA  B 1 16  ? -15.192 101.127 -15.086 1.00 136.03 ? 16  DA  E C5    1 
ATOM   649  C C6    . DA  B 1 16  ? -13.997 101.149 -15.844 1.00 135.93 ? 16  DA  E C6    1 
ATOM   650  N N6    . DA  B 1 16  ? -13.139 100.126 -15.930 1.00 135.89 ? 16  DA  E N6    1 
ATOM   651  N N1    . DA  B 1 16  ? -13.707 102.282 -16.519 1.00 135.84 ? 16  DA  E N1    1 
ATOM   652  C C2    . DA  B 1 16  ? -14.551 103.315 -16.435 1.00 135.96 ? 16  DA  E C2    1 
ATOM   653  N N3    . DA  B 1 16  ? -15.691 103.420 -15.758 1.00 135.97 ? 16  DA  E N3    1 
ATOM   654  C C4    . DA  B 1 16  ? -15.958 102.279 -15.098 1.00 136.10 ? 16  DA  E C4    1 
ATOM   655  P P     . DC  B 1 17  ? -22.331 102.230 -15.592 1.00 138.82 ? 17  DC  E P     1 
ATOM   656  O OP1   . DC  B 1 17  ? -23.761 102.638 -15.557 1.00 138.63 ? 17  DC  E OP1   1 
ATOM   657  O OP2   . DC  B 1 17  ? -21.972 100.832 -15.947 1.00 138.71 ? 17  DC  E OP2   1 
ATOM   658  O "O5'" . DC  B 1 17  ? -21.559 103.208 -16.584 1.00 139.10 ? 17  DC  E "O5'" 1 
ATOM   659  C "C5'" . DC  B 1 17  ? -21.333 102.856 -17.944 1.00 140.07 ? 17  DC  E "C5'" 1 
ATOM   660  C "C4'" . DC  B 1 17  ? -20.020 103.435 -18.408 1.00 140.82 ? 17  DC  E "C4'" 1 
ATOM   661  O "O4'" . DC  B 1 17  ? -18.943 102.833 -17.651 1.00 141.04 ? 17  DC  E "O4'" 1 
ATOM   662  C "C3'" . DC  B 1 17  ? -19.637 103.170 -19.855 1.00 141.30 ? 17  DC  E "C3'" 1 
ATOM   663  O "O3'" . DC  B 1 17  ? -20.238 104.156 -20.685 1.00 141.90 ? 17  DC  E "O3'" 1 
ATOM   664  C "C2'" . DC  B 1 17  ? -18.122 103.347 -19.831 1.00 141.19 ? 17  DC  E "C2'" 1 
ATOM   665  C "C1'" . DC  B 1 17  ? -17.761 102.855 -18.427 1.00 141.10 ? 17  DC  E "C1'" 1 
ATOM   666  N N1    . DC  B 1 17  ? -17.121 101.529 -18.374 1.00 141.15 ? 17  DC  E N1    1 
ATOM   667  C C2    . DC  B 1 17  ? -15.839 101.395 -18.915 1.00 141.12 ? 17  DC  E C2    1 
ATOM   668  O O2    . DC  B 1 17  ? -15.310 102.388 -19.451 1.00 141.06 ? 17  DC  E O2    1 
ATOM   669  N N3    . DC  B 1 17  ? -15.206 100.199 -18.840 1.00 141.00 ? 17  DC  E N3    1 
ATOM   670  C C4    . DC  B 1 17  ? -15.810 99.161  -18.260 1.00 140.89 ? 17  DC  E C4    1 
ATOM   671  N N4    . DC  B 1 17  ? -15.134 98.006  -18.199 1.00 140.60 ? 17  DC  E N4    1 
ATOM   672  C C5    . DC  B 1 17  ? -17.127 99.260  -17.714 1.00 140.84 ? 17  DC  E C5    1 
ATOM   673  C C6    . DC  B 1 17  ? -17.742 100.453 -17.797 1.00 140.97 ? 17  DC  E C6    1 
ATOM   674  P P     . DA  B 1 18  ? -20.517 103.835 -22.233 1.00 142.34 ? 18  DA  E P     1 
ATOM   675  O OP1   . DA  B 1 18  ? -21.310 104.959 -22.798 1.00 142.24 ? 18  DA  E OP1   1 
ATOM   676  O OP2   . DA  B 1 18  ? -21.048 102.446 -22.300 1.00 142.01 ? 18  DA  E OP2   1 
ATOM   677  O "O5'" . DA  B 1 18  ? -19.072 103.851 -22.907 1.00 142.29 ? 18  DA  E "O5'" 1 
ATOM   678  C "C5'" . DA  B 1 18  ? -18.261 105.025 -22.885 1.00 142.21 ? 18  DA  E "C5'" 1 
ATOM   679  C "C4'" . DA  B 1 18  ? -16.825 104.661 -23.174 1.00 142.28 ? 18  DA  E "C4'" 1 
ATOM   680  O "O4'" . DA  B 1 18  ? -16.382 103.703 -22.182 1.00 142.43 ? 18  DA  E "O4'" 1 
ATOM   681  C "C3'" . DA  B 1 18  ? -16.587 103.959 -24.503 1.00 142.28 ? 18  DA  E "C3'" 1 
ATOM   682  O "O3'" . DA  B 1 18  ? -16.430 104.931 -25.540 1.00 142.17 ? 18  DA  E "O3'" 1 
ATOM   683  C "C2'" . DA  B 1 18  ? -15.304 103.176 -24.246 1.00 142.29 ? 18  DA  E "C2'" 1 
ATOM   684  C "C1'" . DA  B 1 18  ? -15.440 102.822 -22.763 1.00 142.37 ? 18  DA  E "C1'" 1 
ATOM   685  N N9    . DA  B 1 18  ? -15.846 101.444 -22.477 1.00 142.31 ? 18  DA  E N9    1 
ATOM   686  C C8    . DA  B 1 18  ? -17.069 100.967 -22.065 1.00 142.23 ? 18  DA  E C8    1 
ATOM   687  N N7    . DA  B 1 18  ? -17.079 99.675  -21.832 1.00 142.25 ? 18  DA  E N7    1 
ATOM   688  C C5    . DA  B 1 18  ? -15.781 99.272  -22.125 1.00 142.33 ? 18  DA  E C5    1 
ATOM   689  C C6    . DA  B 1 18  ? -15.134 98.017  -22.077 1.00 142.32 ? 18  DA  E C6    1 
ATOM   690  N N6    . DA  B 1 18  ? -15.724 96.883  -21.685 1.00 142.33 ? 18  DA  E N6    1 
ATOM   691  N N1    . DA  B 1 18  ? -13.836 97.968  -22.445 1.00 142.25 ? 18  DA  E N1    1 
ATOM   692  C C2    . DA  B 1 18  ? -13.232 99.097  -22.825 1.00 142.25 ? 18  DA  E C2    1 
ATOM   693  N N3    . DA  B 1 18  ? -13.724 100.330 -22.905 1.00 142.32 ? 18  DA  E N3    1 
ATOM   694  C C4    . DA  B 1 18  ? -15.017 100.350 -22.537 1.00 142.34 ? 18  DA  E C4    1 
ATOM   695  N N     . LYS C 2 2   ? 9.626   105.388 -2.970  1.00 105.50 ? 2   LYS A N     1 
ATOM   696  C CA    . LYS C 2 2   ? 8.189   105.146 -3.283  1.00 105.73 ? 2   LYS A CA    1 
ATOM   697  C C     . LYS C 2 2   ? 7.988   103.719 -3.783  1.00 105.99 ? 2   LYS A C     1 
ATOM   698  O O     . LYS C 2 2   ? 8.319   103.402 -4.923  1.00 106.22 ? 2   LYS A O     1 
ATOM   699  N N     . PRO C 2 3   ? 7.446   102.838 -2.929  1.00 106.03 ? 3   PRO A N     1 
ATOM   700  C CA    . PRO C 2 3   ? 7.183   101.430 -3.245  1.00 106.19 ? 3   PRO A CA    1 
ATOM   701  C C     . PRO C 2 3   ? 6.592   101.207 -4.633  1.00 106.39 ? 3   PRO A C     1 
ATOM   702  O O     . PRO C 2 3   ? 5.980   102.105 -5.203  1.00 106.44 ? 3   PRO A O     1 
ATOM   703  C CB    . PRO C 2 3   ? 6.233   101.010 -2.135  1.00 106.14 ? 3   PRO A CB    1 
ATOM   704  C CG    . PRO C 2 3   ? 6.789   101.757 -0.964  1.00 106.29 ? 3   PRO A CG    1 
ATOM   705  C CD    . PRO C 2 3   ? 7.054   103.139 -1.539  1.00 106.15 ? 3   PRO A CD    1 
ATOM   706  N N     . VAL C 2 4   ? 6.773   100.004 -5.170  1.00 106.91 ? 4   VAL A N     1 
ATOM   707  C CA    . VAL C 2 4   ? 6.263   99.685  -6.500  1.00 107.49 ? 4   VAL A CA    1 
ATOM   708  C C     . VAL C 2 4   ? 4.761   99.901  -6.593  1.00 107.91 ? 4   VAL A C     1 
ATOM   709  O O     . VAL C 2 4   ? 3.994   99.398  -5.774  1.00 107.90 ? 4   VAL A O     1 
ATOM   710  C CB    . VAL C 2 4   ? 6.582   98.226  -6.913  1.00 107.40 ? 4   VAL A CB    1 
ATOM   711  C CG1   . VAL C 2 4   ? 8.088   98.014  -6.937  1.00 107.25 ? 4   VAL A CG1   1 
ATOM   712  C CG2   . VAL C 2 4   ? 5.907   97.245  -5.963  1.00 107.53 ? 4   VAL A CG2   1 
ATOM   713  N N     . THR C 2 5   ? 4.354   100.656 -7.607  1.00 108.53 ? 5   THR A N     1 
ATOM   714  C CA    . THR C 2 5   ? 2.950   100.970 -7.834  1.00 109.11 ? 5   THR A CA    1 
ATOM   715  C C     . THR C 2 5   ? 2.310   99.956  -8.779  1.00 109.59 ? 5   THR A C     1 
ATOM   716  O O     . THR C 2 5   ? 2.993   99.093  -9.328  1.00 109.63 ? 5   THR A O     1 
ATOM   717  C CB    . THR C 2 5   ? 2.810   102.370 -8.455  1.00 109.02 ? 5   THR A CB    1 
ATOM   718  O OG1   . THR C 2 5   ? 3.617   103.298 -7.721  1.00 108.80 ? 5   THR A OG1   1 
ATOM   719  C CG2   . THR C 2 5   ? 1.363   102.829 -8.418  1.00 109.16 ? 5   THR A CG2   1 
ATOM   720  N N     . LEU C 2 6   ? 0.996   100.058 -8.952  1.00 110.34 ? 6   LEU A N     1 
ATOM   721  C CA    . LEU C 2 6   ? 0.262   99.172  -9.853  1.00 111.26 ? 6   LEU A CA    1 
ATOM   722  C C     . LEU C 2 6   ? 0.641   99.632  -11.253 1.00 112.21 ? 6   LEU A C     1 
ATOM   723  O O     . LEU C 2 6   ? 0.526   98.884  -12.227 1.00 112.24 ? 6   LEU A O     1 
ATOM   724  C CB    . LEU C 2 6   ? -1.246  99.335  -9.648  1.00 110.81 ? 6   LEU A CB    1 
ATOM   725  C CG    . LEU C 2 6   ? -2.210  98.263  -10.155 1.00 110.50 ? 6   LEU A CG    1 
ATOM   726  C CD1   . LEU C 2 6   ? -1.830  96.919  -9.574  1.00 110.50 ? 6   LEU A CD1   1 
ATOM   727  C CD2   . LEU C 2 6   ? -3.629  98.622  -9.749  1.00 110.34 ? 6   LEU A CD2   1 
ATOM   728  N N     . TYR C 2 7   ? 1.094   100.881 -11.326 1.00 113.31 ? 7   TYR A N     1 
ATOM   729  C CA    . TYR C 2 7   ? 1.523   101.500 -12.572 1.00 114.51 ? 7   TYR A CA    1 
ATOM   730  C C     . TYR C 2 7   ? 2.839   100.883 -13.038 1.00 115.36 ? 7   TYR A C     1 
ATOM   731  O O     . TYR C 2 7   ? 3.013   100.593 -14.223 1.00 115.65 ? 7   TYR A O     1 
ATOM   732  C CB    . TYR C 2 7   ? 1.712   103.009 -12.372 1.00 114.61 ? 7   TYR A CB    1 
ATOM   733  C CG    . TYR C 2 7   ? 0.433   103.798 -12.156 1.00 114.84 ? 7   TYR A CG    1 
ATOM   734  C CD1   . TYR C 2 7   ? 0.477   105.171 -11.902 1.00 114.89 ? 7   TYR A CD1   1 
ATOM   735  C CD2   . TYR C 2 7   ? -0.819  103.181 -12.217 1.00 114.91 ? 7   TYR A CD2   1 
ATOM   736  C CE1   . TYR C 2 7   ? -0.690  105.910 -11.716 1.00 114.95 ? 7   TYR A CE1   1 
ATOM   737  C CE2   . TYR C 2 7   ? -1.995  103.912 -12.032 1.00 114.94 ? 7   TYR A CE2   1 
ATOM   738  C CZ    . TYR C 2 7   ? -1.922  105.276 -11.782 1.00 115.03 ? 7   TYR A CZ    1 
ATOM   739  O OH    . TYR C 2 7   ? -3.078  106.001 -11.587 1.00 114.68 ? 7   TYR A OH    1 
ATOM   740  N N     . ASP C 2 8   ? 3.761   100.686 -12.097 1.00 116.18 ? 8   ASP A N     1 
ATOM   741  C CA    . ASP C 2 8   ? 5.071   100.107 -12.396 1.00 116.92 ? 8   ASP A CA    1 
ATOM   742  C C     . ASP C 2 8   ? 4.965   98.729  -13.037 1.00 117.54 ? 8   ASP A C     1 
ATOM   743  O O     . ASP C 2 8   ? 5.779   98.367  -13.885 1.00 117.48 ? 8   ASP A O     1 
ATOM   744  C CB    . ASP C 2 8   ? 5.902   100.011 -11.120 1.00 116.80 ? 8   ASP A CB    1 
ATOM   745  C CG    . ASP C 2 8   ? 6.111   101.357 -10.468 1.00 116.87 ? 8   ASP A CG    1 
ATOM   746  O OD1   . ASP C 2 8   ? 6.786   101.408 -9.421  1.00 117.17 ? 8   ASP A OD1   1 
ATOM   747  O OD2   . ASP C 2 8   ? 5.600   102.364 -11.001 1.00 116.72 ? 8   ASP A OD2   1 
ATOM   748  N N     . VAL C 2 9   ? 3.964   97.961  -12.623 1.00 118.41 ? 9   VAL A N     1 
ATOM   749  C CA    . VAL C 2 9   ? 3.750   96.630  -13.172 1.00 119.44 ? 9   VAL A CA    1 
ATOM   750  C C     . VAL C 2 9   ? 3.115   96.751  -14.554 1.00 120.24 ? 9   VAL A C     1 
ATOM   751  O O     . VAL C 2 9   ? 3.298   95.884  -15.408 1.00 120.34 ? 9   VAL A O     1 
ATOM   752  C CB    . VAL C 2 9   ? 2.818   95.790  -12.268 1.00 119.48 ? 9   VAL A CB    1 
ATOM   753  C CG1   . VAL C 2 9   ? 2.535   94.439  -12.913 1.00 119.39 ? 9   VAL A CG1   1 
ATOM   754  C CG2   . VAL C 2 9   ? 3.458   95.597  -10.902 1.00 119.61 ? 9   VAL A CG2   1 
ATOM   755  N N     . ALA C 2 10  ? 2.376   97.836  -14.766 1.00 121.17 ? 10  ALA A N     1 
ATOM   756  C CA    . ALA C 2 10  ? 1.701   98.082  -16.039 1.00 122.01 ? 10  ALA A CA    1 
ATOM   757  C C     . ALA C 2 10  ? 2.657   98.060  -17.232 1.00 122.59 ? 10  ALA A C     1 
ATOM   758  O O     . ALA C 2 10  ? 2.382   97.410  -18.243 1.00 122.84 ? 10  ALA A O     1 
ATOM   759  C CB    . ALA C 2 10  ? 0.961   99.421  -15.991 1.00 121.97 ? 10  ALA A CB    1 
ATOM   760  N N     . GLU C 2 11  ? 3.775   98.771  -17.113 1.00 123.09 ? 11  GLU A N     1 
ATOM   761  C CA    . GLU C 2 11  ? 4.763   98.837  -18.187 1.00 123.59 ? 11  GLU A CA    1 
ATOM   762  C C     . GLU C 2 11  ? 5.718   97.649  -18.172 1.00 123.82 ? 11  GLU A C     1 
ATOM   763  O O     . GLU C 2 11  ? 6.177   97.195  -19.222 1.00 123.96 ? 11  GLU A O     1 
ATOM   764  C CB    . GLU C 2 11  ? 5.569   100.127 -18.067 1.00 123.74 ? 11  GLU A CB    1 
ATOM   765  C CG    . GLU C 2 11  ? 6.250   100.281 -16.724 1.00 124.14 ? 11  GLU A CG    1 
ATOM   766  C CD    . GLU C 2 11  ? 7.021   101.573 -16.615 1.00 124.45 ? 11  GLU A CD    1 
ATOM   767  O OE1   . GLU C 2 11  ? 6.414   102.644 -16.828 1.00 124.47 ? 11  GLU A OE1   1 
ATOM   768  O OE2   . GLU C 2 11  ? 8.233   101.518 -16.315 1.00 124.76 ? 11  GLU A OE2   1 
ATOM   769  N N     . TYR C 2 12  ? 6.019   97.152  -16.976 1.00 124.03 ? 12  TYR A N     1 
ATOM   770  C CA    . TYR C 2 12  ? 6.924   96.019  -16.818 1.00 124.18 ? 12  TYR A CA    1 
ATOM   771  C C     . TYR C 2 12  ? 6.179   94.728  -17.152 1.00 124.27 ? 12  TYR A C     1 
ATOM   772  O O     . TYR C 2 12  ? 6.617   93.632  -16.795 1.00 124.29 ? 12  TYR A O     1 
ATOM   773  C CB    . TYR C 2 12  ? 7.448   95.975  -15.380 1.00 124.37 ? 12  TYR A CB    1 
ATOM   774  C CG    . TYR C 2 12  ? 8.849   95.420  -15.229 1.00 124.53 ? 12  TYR A CG    1 
ATOM   775  C CD1   . TYR C 2 12  ? 9.098   94.047  -15.319 1.00 124.58 ? 12  TYR A CD1   1 
ATOM   776  C CD2   . TYR C 2 12  ? 9.929   96.272  -14.991 1.00 124.51 ? 12  TYR A CD2   1 
ATOM   777  C CE1   . TYR C 2 12  ? 10.393  93.539  -15.173 1.00 124.58 ? 12  TYR A CE1   1 
ATOM   778  C CE2   . TYR C 2 12  ? 11.222  95.777  -14.844 1.00 124.53 ? 12  TYR A CE2   1 
ATOM   779  C CZ    . TYR C 2 12  ? 11.448  94.412  -14.936 1.00 124.57 ? 12  TYR A CZ    1 
ATOM   780  O OH    . TYR C 2 12  ? 12.729  93.926  -14.794 1.00 124.54 ? 12  TYR A OH    1 
ATOM   781  N N     . ALA C 2 13  ? 5.045   94.876  -17.837 1.00 124.30 ? 13  ALA A N     1 
ATOM   782  C CA    . ALA C 2 13  ? 4.212   93.747  -18.247 1.00 124.31 ? 13  ALA A CA    1 
ATOM   783  C C     . ALA C 2 13  ? 3.482   94.079  -19.548 1.00 124.40 ? 13  ALA A C     1 
ATOM   784  O O     . ALA C 2 13  ? 2.829   93.221  -20.143 1.00 124.39 ? 13  ALA A O     1 
ATOM   785  C CB    . ALA C 2 13  ? 3.203   93.409  -17.152 1.00 124.27 ? 13  ALA A CB    1 
ATOM   786  N N     . GLY C 2 14  ? 3.591   95.333  -19.977 1.00 124.56 ? 14  GLY A N     1 
ATOM   787  C CA    . GLY C 2 14  ? 2.954   95.763  -21.210 1.00 124.76 ? 14  GLY A CA    1 
ATOM   788  C C     . GLY C 2 14  ? 1.446   95.943  -21.146 1.00 124.94 ? 14  GLY A C     1 
ATOM   789  O O     . GLY C 2 14  ? 0.780   95.985  -22.184 1.00 124.97 ? 14  GLY A O     1 
ATOM   790  N N     . VAL C 2 15  ? 0.899   96.051  -19.940 1.00 125.05 ? 15  VAL A N     1 
ATOM   791  C CA    . VAL C 2 15  ? -0.542  96.231  -19.784 1.00 125.17 ? 15  VAL A CA    1 
ATOM   792  C C     . VAL C 2 15  ? -0.869  97.556  -19.103 1.00 125.18 ? 15  VAL A C     1 
ATOM   793  O O     . VAL C 2 15  ? 0.001   98.416  -18.933 1.00 125.05 ? 15  VAL A O     1 
ATOM   794  C CB    . VAL C 2 15  ? -1.176  95.079  -18.961 1.00 125.31 ? 15  VAL A CB    1 
ATOM   795  C CG1   . VAL C 2 15  ? -0.933  93.746  -19.654 1.00 125.21 ? 15  VAL A CG1   1 
ATOM   796  C CG2   . VAL C 2 15  ? -0.600  95.062  -17.552 1.00 125.47 ? 15  VAL A CG2   1 
ATOM   797  N N     . SER C 2 16  ? -2.134  97.711  -18.721 1.00 125.27 ? 16  SER A N     1 
ATOM   798  C CA    . SER C 2 16  ? -2.602  98.922  -18.053 1.00 125.37 ? 16  SER A CA    1 
ATOM   799  C C     . SER C 2 16  ? -2.735  98.682  -16.555 1.00 125.30 ? 16  SER A C     1 
ATOM   800  O O     . SER C 2 16  ? -2.566  97.557  -16.076 1.00 125.35 ? 16  SER A O     1 
ATOM   801  C CB    . SER C 2 16  ? -3.967  99.340  -18.610 1.00 125.53 ? 16  SER A CB    1 
ATOM   802  O OG    . SER C 2 16  ? -4.971  98.401  -18.254 1.00 125.54 ? 16  SER A OG    1 
ATOM   803  N N     . TYR C 2 17  ? -3.049  99.742  -15.818 1.00 125.06 ? 17  TYR A N     1 
ATOM   804  C CA    . TYR C 2 17  ? -3.212  99.627  -14.380 1.00 124.91 ? 17  TYR A CA    1 
ATOM   805  C C     . TYR C 2 17  ? -4.415  98.744  -14.048 1.00 124.69 ? 17  TYR A C     1 
ATOM   806  O O     . TYR C 2 17  ? -4.432  98.062  -13.023 1.00 124.67 ? 17  TYR A O     1 
ATOM   807  C CB    . TYR C 2 17  ? -3.371  101.020 -13.752 1.00 125.19 ? 17  TYR A CB    1 
ATOM   808  C CG    . TYR C 2 17  ? -4.505  101.866 -14.305 1.00 125.52 ? 17  TYR A CG    1 
ATOM   809  C CD1   . TYR C 2 17  ? -5.836  101.454 -14.192 1.00 125.57 ? 17  TYR A CD1   1 
ATOM   810  C CD2   . TYR C 2 17  ? -4.250  103.103 -14.902 1.00 125.57 ? 17  TYR A CD2   1 
ATOM   811  C CE1   . TYR C 2 17  ? -6.884  102.251 -14.656 1.00 125.61 ? 17  TYR A CE1   1 
ATOM   812  C CE2   . TYR C 2 17  ? -5.293  103.911 -15.370 1.00 125.59 ? 17  TYR A CE2   1 
ATOM   813  C CZ    . TYR C 2 17  ? -6.607  103.478 -15.241 1.00 125.60 ? 17  TYR A CZ    1 
ATOM   814  O OH    . TYR C 2 17  ? -7.643  104.271 -15.684 1.00 125.54 ? 17  TYR A OH    1 
ATOM   815  N N     . GLN C 2 18  ? -5.410  98.746  -14.929 1.00 124.41 ? 18  GLN A N     1 
ATOM   816  C CA    . GLN C 2 18  ? -6.616  97.955  -14.721 1.00 124.22 ? 18  GLN A CA    1 
ATOM   817  C C     . GLN C 2 18  ? -6.366  96.469  -14.959 1.00 124.09 ? 18  GLN A C     1 
ATOM   818  O O     . GLN C 2 18  ? -6.882  95.621  -14.230 1.00 124.03 ? 18  GLN A O     1 
ATOM   819  C CB    . GLN C 2 18  ? -7.733  98.447  -15.643 1.00 124.20 ? 18  GLN A CB    1 
ATOM   820  C CG    . GLN C 2 18  ? -9.069  97.762  -15.415 1.00 124.10 ? 18  GLN A CG    1 
ATOM   821  C CD    . GLN C 2 18  ? -9.627  98.016  -14.028 1.00 124.06 ? 18  GLN A CD    1 
ATOM   822  O OE1   . GLN C 2 18  ? -9.033  97.628  -13.024 1.00 123.88 ? 18  GLN A OE1   1 
ATOM   823  N NE2   . GLN C 2 18  ? -10.778 98.673  -13.967 1.00 124.20 ? 18  GLN A NE2   1 
ATOM   824  N N     . THR C 2 19  ? -5.578  96.158  -15.984 1.00 124.07 ? 19  THR A N     1 
ATOM   825  C CA    . THR C 2 19  ? -5.251  94.772  -16.307 1.00 124.13 ? 19  THR A CA    1 
ATOM   826  C C     . THR C 2 19  ? -4.676  94.117  -15.053 1.00 124.15 ? 19  THR A C     1 
ATOM   827  O O     . THR C 2 19  ? -5.130  93.053  -14.618 1.00 123.97 ? 19  THR A O     1 
ATOM   828  C CB    . THR C 2 19  ? -4.192  94.692  -17.440 1.00 124.16 ? 19  THR A CB    1 
ATOM   829  O OG1   . THR C 2 19  ? -4.680  95.360  -18.610 1.00 124.08 ? 19  THR A OG1   1 
ATOM   830  C CG2   . THR C 2 19  ? -3.892  93.243  -17.791 1.00 123.99 ? 19  THR A CG2   1 
ATOM   831  N N     . VAL C 2 20  ? -3.674  94.778  -14.480 1.00 124.19 ? 20  VAL A N     1 
ATOM   832  C CA    . VAL C 2 20  ? -3.009  94.302  -13.274 1.00 124.17 ? 20  VAL A CA    1 
ATOM   833  C C     . VAL C 2 20  ? -4.040  94.166  -12.157 1.00 124.19 ? 20  VAL A C     1 
ATOM   834  O O     . VAL C 2 20  ? -4.073  93.163  -11.443 1.00 124.12 ? 20  VAL A O     1 
ATOM   835  C CB    . VAL C 2 20  ? -1.904  95.292  -12.822 1.00 124.15 ? 20  VAL A CB    1 
ATOM   836  C CG1   . VAL C 2 20  ? -1.003  94.632  -11.792 1.00 124.21 ? 20  VAL A CG1   1 
ATOM   837  C CG2   . VAL C 2 20  ? -1.094  95.763  -14.023 1.00 124.13 ? 20  VAL A CG2   1 
ATOM   838  N N     . SER C 2 21  ? -4.882  95.186  -12.017 1.00 124.24 ? 21  SER A N     1 
ATOM   839  C CA    . SER C 2 21  ? -5.921  95.196  -10.996 1.00 124.35 ? 21  SER A CA    1 
ATOM   840  C C     . SER C 2 21  ? -6.728  93.904  -11.051 1.00 124.40 ? 21  SER A C     1 
ATOM   841  O O     . SER C 2 21  ? -6.912  93.234  -10.034 1.00 124.25 ? 21  SER A O     1 
ATOM   842  C CB    . SER C 2 21  ? -6.848  96.397  -11.205 1.00 124.50 ? 21  SER A CB    1 
ATOM   843  O OG    . SER C 2 21  ? -7.915  96.397  -10.273 1.00 124.50 ? 21  SER A OG    1 
ATOM   844  N N     . ARG C 2 22  ? -7.206  93.561  -12.244 1.00 124.67 ? 22  ARG A N     1 
ATOM   845  C CA    . ARG C 2 22  ? -7.986  92.343  -12.424 1.00 124.94 ? 22  ARG A CA    1 
ATOM   846  C C     . ARG C 2 22  ? -7.197  91.169  -11.867 1.00 124.96 ? 22  ARG A C     1 
ATOM   847  O O     . ARG C 2 22  ? -7.681  90.421  -11.018 1.00 124.73 ? 22  ARG A O     1 
ATOM   848  C CB    . ARG C 2 22  ? -8.273  92.087  -13.908 1.00 125.12 ? 22  ARG A CB    1 
ATOM   849  C CG    . ARG C 2 22  ? -9.114  93.148  -14.592 1.00 125.51 ? 22  ARG A CG    1 
ATOM   850  C CD    . ARG C 2 22  ? -9.558  92.684  -15.978 1.00 125.80 ? 22  ARG A CD    1 
ATOM   851  N NE    . ARG C 2 22  ? -10.274 93.729  -16.708 1.00 126.08 ? 22  ARG A NE    1 
ATOM   852  C CZ    . ARG C 2 22  ? -9.705  94.834  -17.187 1.00 126.25 ? 22  ARG A CZ    1 
ATOM   853  N NH1   . ARG C 2 22  ? -8.404  95.042  -17.019 1.00 126.09 ? 22  ARG A NH1   1 
ATOM   854  N NH2   . ARG C 2 22  ? -10.439 95.735  -17.829 1.00 126.30 ? 22  ARG A NH2   1 
ATOM   855  N N     . VAL C 2 23  ? -5.971  91.026  -12.359 1.00 125.13 ? 23  VAL A N     1 
ATOM   856  C CA    . VAL C 2 23  ? -5.081  89.953  -11.939 1.00 125.32 ? 23  VAL A CA    1 
ATOM   857  C C     . VAL C 2 23  ? -4.965  89.887  -10.415 1.00 125.36 ? 23  VAL A C     1 
ATOM   858  O O     . VAL C 2 23  ? -5.147  88.825  -9.818  1.00 125.40 ? 23  VAL A O     1 
ATOM   859  C CB    . VAL C 2 23  ? -3.666  90.145  -12.545 1.00 125.45 ? 23  VAL A CB    1 
ATOM   860  C CG1   . VAL C 2 23  ? -2.804  88.922  -12.261 1.00 125.44 ? 23  VAL A CG1   1 
ATOM   861  C CG2   . VAL C 2 23  ? -3.769  90.394  -14.046 1.00 125.29 ? 23  VAL A CG2   1 
ATOM   862  N N     . VAL C 2 24  ? -4.670  91.024  -9.790  1.00 125.33 ? 24  VAL A N     1 
ATOM   863  C CA    . VAL C 2 24  ? -4.524  91.079  -8.338  1.00 125.32 ? 24  VAL A CA    1 
ATOM   864  C C     . VAL C 2 24  ? -5.810  90.677  -7.617  1.00 125.52 ? 24  VAL A C     1 
ATOM   865  O O     . VAL C 2 24  ? -5.768  89.982  -6.603  1.00 125.59 ? 24  VAL A O     1 
ATOM   866  C CB    . VAL C 2 24  ? -4.106  92.494  -7.869  1.00 125.14 ? 24  VAL A CB    1 
ATOM   867  C CG1   . VAL C 2 24  ? -4.022  92.540  -6.353  1.00 124.91 ? 24  VAL A CG1   1 
ATOM   868  C CG2   . VAL C 2 24  ? -2.763  92.865  -8.474  1.00 125.05 ? 24  VAL A CG2   1 
ATOM   869  N N     . ASN C 2 25  ? -6.950  91.106  -8.148  1.00 125.73 ? 25  ASN A N     1 
ATOM   870  C CA    . ASN C 2 25  ? -8.240  90.792  -7.545  1.00 126.00 ? 25  ASN A CA    1 
ATOM   871  C C     . ASN C 2 25  ? -8.801  89.458  -8.021  1.00 126.45 ? 25  ASN A C     1 
ATOM   872  O O     . ASN C 2 25  ? -9.954  89.131  -7.737  1.00 126.49 ? 25  ASN A O     1 
ATOM   873  C CB    . ASN C 2 25  ? -9.240  91.903  -7.863  1.00 125.78 ? 25  ASN A CB    1 
ATOM   874  C CG    . ASN C 2 25  ? -8.911  93.200  -7.159  1.00 125.69 ? 25  ASN A CG    1 
ATOM   875  O OD1   . ASN C 2 25  ? -9.415  93.476  -6.070  1.00 125.78 ? 25  ASN A OD1   1 
ATOM   876  N ND2   . ASN C 2 25  ? -8.049  94.001  -7.772  1.00 125.48 ? 25  ASN A ND2   1 
ATOM   877  N N     . GLN C 2 26  ? -7.990  88.687  -8.738  1.00 127.00 ? 26  GLN A N     1 
ATOM   878  C CA    . GLN C 2 26  ? -8.437  87.398  -9.259  1.00 127.69 ? 26  GLN A CA    1 
ATOM   879  C C     . GLN C 2 26  ? -9.722  87.626  -10.051 1.00 128.25 ? 26  GLN A C     1 
ATOM   880  O O     . GLN C 2 26  ? -10.648 86.815  -10.007 1.00 128.16 ? 26  GLN A O     1 
ATOM   881  N N     . ALA C 2 27  ? -9.763  88.741  -10.773 1.00 128.82 ? 27  ALA A N     1 
ATOM   882  C CA    . ALA C 2 27  ? -10.926 89.120  -11.569 1.00 129.52 ? 27  ALA A CA    1 
ATOM   883  C C     . ALA C 2 27  ? -11.347 88.102  -12.628 1.00 130.15 ? 27  ALA A C     1 
ATOM   884  O O     . ALA C 2 27  ? -10.673 87.093  -12.854 1.00 130.25 ? 27  ALA A O     1 
ATOM   885  N N     . SER C 2 28  ? -12.479 88.383  -13.270 1.00 130.60 ? 28  SER A N     1 
ATOM   886  C CA    . SER C 2 28  ? -13.021 87.528  -14.318 1.00 130.88 ? 28  SER A CA    1 
ATOM   887  C C     . SER C 2 28  ? -12.845 88.226  -15.662 1.00 131.19 ? 28  SER A C     1 
ATOM   888  O O     . SER C 2 28  ? -13.200 89.394  -15.817 1.00 131.18 ? 28  SER A O     1 
ATOM   889  N N     . HIS C 2 29  ? -12.287 87.506  -16.628 1.00 131.50 ? 29  HIS A N     1 
ATOM   890  C CA    . HIS C 2 29  ? -12.061 88.068  -17.952 1.00 131.88 ? 29  HIS A CA    1 
ATOM   891  C C     . HIS C 2 29  ? -10.630 88.577  -18.102 1.00 132.19 ? 29  HIS A C     1 
ATOM   892  O O     . HIS C 2 29  ? -10.399 89.777  -18.256 1.00 132.14 ? 29  HIS A O     1 
ATOM   893  N N     . VAL C 2 30  ? -9.676  87.653  -18.046 1.00 132.53 ? 30  VAL A N     1 
ATOM   894  C CA    . VAL C 2 30  ? -8.264  87.984  -18.195 1.00 133.02 ? 30  VAL A CA    1 
ATOM   895  C C     . VAL C 2 30  ? -7.765  87.408  -19.519 1.00 133.36 ? 30  VAL A C     1 
ATOM   896  O O     . VAL C 2 30  ? -8.370  86.488  -20.069 1.00 133.50 ? 30  VAL A O     1 
ATOM   897  N N     . SER C 2 31  ? -6.664  87.949  -20.031 1.00 133.60 ? 31  SER A N     1 
ATOM   898  C CA    . SER C 2 31  ? -6.100  87.478  -21.291 1.00 133.86 ? 31  SER A CA    1 
ATOM   899  C C     . SER C 2 31  ? -5.474  86.088  -21.157 1.00 134.03 ? 31  SER A C     1 
ATOM   900  O O     . SER C 2 31  ? -4.512  85.770  -21.856 1.00 134.09 ? 31  SER A O     1 
ATOM   901  N N     . ALA C 2 32  ? -6.026  85.268  -20.262 1.00 134.04 ? 32  ALA A N     1 
ATOM   902  C CA    . ALA C 2 32  ? -5.529  83.912  -20.035 1.00 133.97 ? 32  ALA A CA    1 
ATOM   903  C C     . ALA C 2 32  ? -4.028  83.925  -19.770 1.00 134.00 ? 32  ALA A C     1 
ATOM   904  O O     . ALA C 2 32  ? -3.591  83.991  -18.622 1.00 133.95 ? 32  ALA A O     1 
ATOM   905  N N     . LYS C 2 33  ? -3.244  83.856  -20.843 1.00 134.07 ? 33  LYS A N     1 
ATOM   906  C CA    . LYS C 2 33  ? -1.790  83.878  -20.737 1.00 133.93 ? 33  LYS A CA    1 
ATOM   907  C C     . LYS C 2 33  ? -1.350  85.258  -20.259 1.00 133.89 ? 33  LYS A C     1 
ATOM   908  O O     . LYS C 2 33  ? -0.258  85.417  -19.712 1.00 133.93 ? 33  LYS A O     1 
ATOM   909  N N     . THR C 2 34  ? -2.213  86.251  -20.471 1.00 133.69 ? 34  THR A N     1 
ATOM   910  C CA    . THR C 2 34  ? -1.933  87.622  -20.059 1.00 133.37 ? 34  THR A CA    1 
ATOM   911  C C     . THR C 2 34  ? -1.659  87.670  -18.558 1.00 133.24 ? 34  THR A C     1 
ATOM   912  O O     . THR C 2 34  ? -0.675  88.266  -18.115 1.00 133.27 ? 34  THR A O     1 
ATOM   913  N N     . ARG C 2 35  ? -2.534  87.036  -17.781 1.00 132.99 ? 35  ARG A N     1 
ATOM   914  C CA    . ARG C 2 35  ? -2.385  86.997  -16.329 1.00 132.58 ? 35  ARG A CA    1 
ATOM   915  C C     . ARG C 2 35  ? -1.069  86.325  -15.943 1.00 132.31 ? 35  ARG A C     1 
ATOM   916  O O     . ARG C 2 35  ? -0.415  86.725  -14.980 1.00 132.31 ? 35  ARG A O     1 
ATOM   917  N N     . GLU C 2 36  ? -0.689  85.299  -16.699 1.00 132.02 ? 36  GLU A N     1 
ATOM   918  C CA    . GLU C 2 36  ? 0.551   84.579  -16.439 1.00 131.55 ? 36  GLU A CA    1 
ATOM   919  C C     . GLU C 2 36  ? 1.735   85.538  -16.527 1.00 131.33 ? 36  GLU A C     1 
ATOM   920  O O     . GLU C 2 36  ? 2.663   85.470  -15.720 1.00 131.24 ? 36  GLU A O     1 
ATOM   921  N N     . LYS C 2 37  ? 1.691   86.434  -17.510 1.00 131.05 ? 37  LYS A N     1 
ATOM   922  C CA    . LYS C 2 37  ? 2.753   87.415  -17.715 1.00 130.61 ? 37  LYS A CA    1 
ATOM   923  C C     . LYS C 2 37  ? 2.742   88.480  -16.624 1.00 130.40 ? 37  LYS A C     1 
ATOM   924  O O     . LYS C 2 37  ? 3.783   88.809  -16.056 1.00 130.41 ? 37  LYS A O     1 
ATOM   925  N N     . VAL C 2 38  ? 1.560   89.017  -16.337 1.00 130.13 ? 38  VAL A N     1 
ATOM   926  C CA    . VAL C 2 38  ? 1.406   90.045  -15.311 1.00 129.84 ? 38  VAL A CA    1 
ATOM   927  C C     . VAL C 2 38  ? 1.926   89.572  -13.956 1.00 129.38 ? 38  VAL A C     1 
ATOM   928  O O     . VAL C 2 38  ? 2.741   90.248  -13.326 1.00 129.22 ? 38  VAL A O     1 
ATOM   929  C CB    . VAL C 2 38  ? -0.080  90.463  -15.157 1.00 130.10 ? 38  VAL A CB    1 
ATOM   930  C CG1   . VAL C 2 38  ? -0.239  91.430  -13.988 1.00 130.13 ? 38  VAL A CG1   1 
ATOM   931  C CG2   . VAL C 2 38  ? -0.573  91.109  -16.445 1.00 130.26 ? 38  VAL A CG2   1 
ATOM   932  N N     . GLU C 2 39  ? 1.450   88.414  -13.508 1.00 128.84 ? 39  GLU A N     1 
ATOM   933  C CA    . GLU C 2 39  ? 1.876   87.865  -12.226 1.00 128.26 ? 39  GLU A CA    1 
ATOM   934  C C     . GLU C 2 39  ? 3.395   87.759  -12.151 1.00 127.69 ? 39  GLU A C     1 
ATOM   935  O O     . GLU C 2 39  ? 3.997   88.062  -11.120 1.00 127.71 ? 39  GLU A O     1 
ATOM   936  C CB    . GLU C 2 39  ? 1.250   86.489  -12.000 1.00 128.46 ? 39  GLU A CB    1 
ATOM   937  C CG    . GLU C 2 39  ? -0.255  86.522  -11.824 1.00 128.81 ? 39  GLU A CG    1 
ATOM   938  C CD    . GLU C 2 39  ? -0.827  85.162  -11.487 1.00 129.07 ? 39  GLU A CD    1 
ATOM   939  O OE1   . GLU C 2 39  ? -0.667  84.230  -12.305 1.00 129.28 ? 39  GLU A OE1   1 
ATOM   940  O OE2   . GLU C 2 39  ? -1.435  85.024  -10.403 1.00 129.24 ? 39  GLU A OE2   1 
ATOM   941  N N     . ALA C 2 40  ? 4.013   87.327  -13.245 1.00 126.88 ? 40  ALA A N     1 
ATOM   942  C CA    . ALA C 2 40  ? 5.462   87.198  -13.283 1.00 126.09 ? 40  ALA A CA    1 
ATOM   943  C C     . ALA C 2 40  ? 6.100   88.581  -13.141 1.00 125.61 ? 40  ALA A C     1 
ATOM   944  O O     . ALA C 2 40  ? 7.151   88.733  -12.515 1.00 125.41 ? 40  ALA A O     1 
ATOM   945  C CB    . ALA C 2 40  ? 5.894   86.547  -14.593 1.00 125.96 ? 40  ALA A CB    1 
ATOM   946  N N     . ALA C 2 41  ? 5.445   89.588  -13.716 1.00 124.99 ? 41  ALA A N     1 
ATOM   947  C CA    . ALA C 2 41  ? 5.933   90.965  -13.673 1.00 124.18 ? 41  ALA A CA    1 
ATOM   948  C C     . ALA C 2 41  ? 5.930   91.536  -12.252 1.00 123.49 ? 41  ALA A C     1 
ATOM   949  O O     . ALA C 2 41  ? 6.886   92.197  -11.837 1.00 123.41 ? 41  ALA A O     1 
ATOM   950  C CB    . ALA C 2 41  ? 5.086   91.842  -14.595 1.00 124.27 ? 41  ALA A CB    1 
ATOM   951  N N     . MET C 2 42  ? 4.849   91.284  -11.518 1.00 122.54 ? 42  MET A N     1 
ATOM   952  C CA    . MET C 2 42  ? 4.716   91.761  -10.144 1.00 121.39 ? 42  MET A CA    1 
ATOM   953  C C     . MET C 2 42  ? 5.591   90.927  -9.211  1.00 120.68 ? 42  MET A C     1 
ATOM   954  O O     . MET C 2 42  ? 6.070   91.413  -8.184  1.00 120.51 ? 42  MET A O     1 
ATOM   955  C CB    . MET C 2 42  ? 3.253   91.677  -9.694  1.00 121.22 ? 42  MET A CB    1 
ATOM   956  C CG    . MET C 2 42  ? 2.595   90.331  -9.963  1.00 120.97 ? 42  MET A CG    1 
ATOM   957  S SD    . MET C 2 42  ? 0.952   90.150  -9.234  1.00 120.65 ? 42  MET A SD    1 
ATOM   958  C CE    . MET C 2 42  ? 0.050   91.424  -10.098 1.00 120.97 ? 42  MET A CE    1 
ATOM   959  N N     . ALA C 2 43  ? 5.795   89.667  -9.582  1.00 119.77 ? 43  ALA A N     1 
ATOM   960  C CA    . ALA C 2 43  ? 6.611   88.758  -8.792  1.00 118.87 ? 43  ALA A CA    1 
ATOM   961  C C     . ALA C 2 43  ? 8.059   89.225  -8.773  1.00 118.24 ? 43  ALA A C     1 
ATOM   962  O O     . ALA C 2 43  ? 8.700   89.236  -7.726  1.00 118.18 ? 43  ALA A O     1 
ATOM   963  C CB    . ALA C 2 43  ? 6.527   87.353  -9.364  1.00 118.82 ? 43  ALA A CB    1 
ATOM   964  N N     . GLU C 2 44  ? 8.563   89.618  -9.937  1.00 117.64 ? 44  GLU A N     1 
ATOM   965  C CA    . GLU C 2 44  ? 9.944   90.076  -10.065 1.00 117.15 ? 44  GLU A CA    1 
ATOM   966  C C     . GLU C 2 44  ? 10.188  91.448  -9.442  1.00 116.36 ? 44  GLU A C     1 
ATOM   967  O O     . GLU C 2 44  ? 11.331  91.816  -9.162  1.00 116.17 ? 44  GLU A O     1 
ATOM   968  C CB    . GLU C 2 44  ? 10.352  90.098  -11.542 1.00 117.68 ? 44  GLU A CB    1 
ATOM   969  C CG    . GLU C 2 44  ? 10.225  88.743  -12.228 1.00 118.18 ? 44  GLU A CG    1 
ATOM   970  C CD    . GLU C 2 44  ? 10.984  87.646  -11.496 1.00 118.59 ? 44  GLU A CD    1 
ATOM   971  O OE1   . GLU C 2 44  ? 12.232  87.723  -11.432 1.00 118.54 ? 44  GLU A OE1   1 
ATOM   972  O OE2   . GLU C 2 44  ? 10.329  86.712  -10.979 1.00 118.82 ? 44  GLU A OE2   1 
ATOM   973  N N     . LEU C 2 45  ? 9.115   92.201  -9.230  1.00 115.46 ? 45  LEU A N     1 
ATOM   974  C CA    . LEU C 2 45  ? 9.219   93.529  -8.633  1.00 114.37 ? 45  LEU A CA    1 
ATOM   975  C C     . LEU C 2 45  ? 8.776   93.506  -7.172  1.00 113.52 ? 45  LEU A C     1 
ATOM   976  O O     . LEU C 2 45  ? 8.854   94.522  -6.477  1.00 113.29 ? 45  LEU A O     1 
ATOM   977  C CB    . LEU C 2 45  ? 8.363   94.533  -9.413  1.00 114.40 ? 45  LEU A CB    1 
ATOM   978  C CG    . LEU C 2 45  ? 8.875   95.011  -10.774 1.00 114.29 ? 45  LEU A CG    1 
ATOM   979  C CD1   . LEU C 2 45  ? 7.777   95.781  -11.491 1.00 114.06 ? 45  LEU A CD1   1 
ATOM   980  C CD2   . LEU C 2 45  ? 10.113  95.881  -10.580 1.00 114.12 ? 45  LEU A CD2   1 
ATOM   981  N N     . ASN C 2 46  ? 8.316   92.341  -6.715  1.00 112.56 ? 46  ASN A N     1 
ATOM   982  C CA    . ASN C 2 46  ? 7.848   92.177  -5.341  1.00 111.51 ? 46  ASN A CA    1 
ATOM   983  C C     . ASN C 2 46  ? 6.746   93.195  -5.077  1.00 110.59 ? 46  ASN A C     1 
ATOM   984  O O     . ASN C 2 46  ? 6.915   94.130  -4.291  1.00 110.45 ? 46  ASN A O     1 
ATOM   985  C CB    . ASN C 2 46  ? 9.001   92.388  -4.354  1.00 111.75 ? 46  ASN A CB    1 
ATOM   986  C CG    . ASN C 2 46  ? 8.560   92.265  -2.909  1.00 111.71 ? 46  ASN A CG    1 
ATOM   987  O OD1   . ASN C 2 46  ? 8.026   91.234  -2.498  1.00 111.79 ? 46  ASN A OD1   1 
ATOM   988  N ND2   . ASN C 2 46  ? 8.783   93.319  -2.130  1.00 111.48 ? 46  ASN A ND2   1 
ATOM   989  N N     . TYR C 2 47  ? 5.617   93.002  -5.744  1.00 109.30 ? 47  TYR A N     1 
ATOM   990  C CA    . TYR C 2 47  ? 4.489   93.906  -5.613  1.00 108.16 ? 47  TYR A CA    1 
ATOM   991  C C     . TYR C 2 47  ? 3.515   93.495  -4.518  1.00 107.33 ? 47  TYR A C     1 
ATOM   992  O O     . TYR C 2 47  ? 3.085   92.344  -4.452  1.00 107.31 ? 47  TYR A O     1 
ATOM   993  C CB    . TYR C 2 47  ? 3.752   94.003  -6.955  1.00 108.23 ? 47  TYR A CB    1 
ATOM   994  C CG    . TYR C 2 47  ? 2.441   94.754  -6.894  1.00 107.95 ? 47  TYR A CG    1 
ATOM   995  C CD1   . TYR C 2 47  ? 2.407   96.121  -6.616  1.00 107.71 ? 47  TYR A CD1   1 
ATOM   996  C CD2   . TYR C 2 47  ? 1.228   94.089  -7.085  1.00 107.83 ? 47  TYR A CD2   1 
ATOM   997  C CE1   . TYR C 2 47  ? 1.197   96.803  -6.527  1.00 107.47 ? 47  TYR A CE1   1 
ATOM   998  C CE2   . TYR C 2 47  ? 0.015   94.760  -6.997  1.00 107.57 ? 47  TYR A CE2   1 
ATOM   999  C CZ    . TYR C 2 47  ? 0.004   96.113  -6.717  1.00 107.49 ? 47  TYR A CZ    1 
ATOM   1000 O OH    . TYR C 2 47  ? -1.201  96.765  -6.617  1.00 107.47 ? 47  TYR A OH    1 
ATOM   1001 N N     . ILE C 2 48  ? 3.175   94.453  -3.660  1.00 106.32 ? 48  ILE A N     1 
ATOM   1002 C CA    . ILE C 2 48  ? 2.233   94.234  -2.567  1.00 105.18 ? 48  ILE A CA    1 
ATOM   1003 C C     . ILE C 2 48  ? 1.186   95.345  -2.608  1.00 104.11 ? 48  ILE A C     1 
ATOM   1004 O O     . ILE C 2 48  ? 1.466   96.488  -2.251  1.00 103.90 ? 48  ILE A O     1 
ATOM   1005 C CB    . ILE C 2 48  ? 2.940   94.264  -1.197  1.00 105.35 ? 48  ILE A CB    1 
ATOM   1006 C CG1   . ILE C 2 48  ? 3.983   93.146  -1.127  1.00 105.24 ? 48  ILE A CG1   1 
ATOM   1007 C CG2   . ILE C 2 48  ? 1.918   94.107  -0.082  1.00 105.32 ? 48  ILE A CG2   1 
ATOM   1008 C CD1   . ILE C 2 48  ? 4.824   93.169  0.124   1.00 105.25 ? 48  ILE A CD1   1 
ATOM   1009 N N     . PRO C 2 49  ? -0.037  95.015  -3.052  1.00 103.24 ? 49  PRO A N     1 
ATOM   1010 C CA    . PRO C 2 49  ? -1.154  95.961  -3.160  1.00 102.52 ? 49  PRO A CA    1 
ATOM   1011 C C     . PRO C 2 49  ? -1.359  96.834  -1.923  1.00 101.81 ? 49  PRO A C     1 
ATOM   1012 O O     . PRO C 2 49  ? -1.612  96.329  -0.834  1.00 101.92 ? 49  PRO A O     1 
ATOM   1013 C CB    . PRO C 2 49  ? -2.348  95.050  -3.423  1.00 102.62 ? 49  PRO A CB    1 
ATOM   1014 C CG    . PRO C 2 49  ? -1.738  93.932  -4.203  1.00 102.95 ? 49  PRO A CG    1 
ATOM   1015 C CD    . PRO C 2 49  ? -0.463  93.659  -3.439  1.00 103.00 ? 49  PRO A CD    1 
ATOM   1016 N N     . ASN C 2 50  ? -1.258  98.147  -2.105  1.00 100.87 ? 50  ASN A N     1 
ATOM   1017 C CA    . ASN C 2 50  ? -1.437  99.096  -1.009  1.00 99.85  ? 50  ASN A CA    1 
ATOM   1018 C C     . ASN C 2 50  ? -2.889  99.084  -0.521  1.00 99.57  ? 50  ASN A C     1 
ATOM   1019 O O     . ASN C 2 50  ? -3.716  99.852  -1.002  1.00 99.59  ? 50  ASN A O     1 
ATOM   1020 C CB    . ASN C 2 50  ? -1.056  100.504 -1.479  1.00 98.91  ? 50  ASN A CB    1 
ATOM   1021 C CG    . ASN C 2 50  ? -1.138  101.529 -0.374  1.00 97.92  ? 50  ASN A CG    1 
ATOM   1022 O OD1   . ASN C 2 50  ? -2.137  101.612 0.333   1.00 97.56  ? 50  ASN A OD1   1 
ATOM   1023 N ND2   . ASN C 2 50  ? -0.087  102.323 -0.225  1.00 97.40  ? 50  ASN A ND2   1 
ATOM   1024 N N     . ARG C 2 51  ? -3.189  98.211  0.436   1.00 99.31  ? 51  ARG A N     1 
ATOM   1025 C CA    . ARG C 2 51  ? -4.536  98.093  0.983   1.00 99.13  ? 51  ARG A CA    1 
ATOM   1026 C C     . ARG C 2 51  ? -5.164  99.431  1.349   1.00 98.68  ? 51  ARG A C     1 
ATOM   1027 O O     . ARG C 2 51  ? -6.379  99.588  1.272   1.00 98.62  ? 51  ARG A O     1 
ATOM   1028 C CB    . ARG C 2 51  ? -4.535  97.194  2.220   1.00 99.66  ? 51  ARG A CB    1 
ATOM   1029 C CG    . ARG C 2 51  ? -4.615  95.701  1.944   1.00 100.43 ? 51  ARG A CG    1 
ATOM   1030 C CD    . ARG C 2 51  ? -4.575  94.930  3.259   1.00 101.40 ? 51  ARG A CD    1 
ATOM   1031 N NE    . ARG C 2 51  ? -4.951  93.523  3.127   1.00 102.33 ? 51  ARG A NE    1 
ATOM   1032 C CZ    . ARG C 2 51  ? -4.297  92.628  2.390   1.00 102.94 ? 51  ARG A CZ    1 
ATOM   1033 N NH1   . ARG C 2 51  ? -3.220  92.982  1.703   1.00 103.00 ? 51  ARG A NH1   1 
ATOM   1034 N NH2   . ARG C 2 51  ? -4.719  91.369  2.348   1.00 103.25 ? 51  ARG A NH2   1 
ATOM   1035 N N     . VAL C 2 52  ? -4.346  100.392 1.759   1.00 98.16  ? 52  VAL A N     1 
ATOM   1036 C CA    . VAL C 2 52  ? -4.871  101.700 2.128   1.00 98.04  ? 52  VAL A CA    1 
ATOM   1037 C C     . VAL C 2 52  ? -5.598  102.311 0.934   1.00 98.24  ? 52  VAL A C     1 
ATOM   1038 O O     . VAL C 2 52  ? -6.698  102.847 1.067   1.00 98.24  ? 52  VAL A O     1 
ATOM   1039 C CB    . VAL C 2 52  ? -3.747  102.654 2.568   1.00 97.84  ? 52  VAL A CB    1 
ATOM   1040 C CG1   . VAL C 2 52  ? -4.340  103.955 3.076   1.00 97.41  ? 52  VAL A CG1   1 
ATOM   1041 C CG2   . VAL C 2 52  ? -2.901  101.996 3.640   1.00 97.73  ? 52  VAL A CG2   1 
ATOM   1042 N N     . ALA C 2 53  ? -4.974  102.216 -0.235  1.00 98.43  ? 53  ALA A N     1 
ATOM   1043 C CA    . ALA C 2 53  ? -5.547  102.746 -1.463  1.00 98.51  ? 53  ALA A CA    1 
ATOM   1044 C C     . ALA C 2 53  ? -6.740  101.914 -1.925  1.00 98.73  ? 53  ALA A C     1 
ATOM   1045 O O     . ALA C 2 53  ? -7.735  102.457 -2.399  1.00 98.98  ? 53  ALA A O     1 
ATOM   1046 C CB    . ALA C 2 53  ? -4.494  102.779 -2.542  1.00 98.24  ? 53  ALA A CB    1 
ATOM   1047 N N     . GLN C 2 54  ? -6.638  100.596 -1.788  1.00 98.98  ? 54  GLN A N     1 
ATOM   1048 C CA    . GLN C 2 54  ? -7.716  99.697  -2.189  1.00 99.20  ? 54  GLN A CA    1 
ATOM   1049 C C     . GLN C 2 54  ? -9.011  99.997  -1.446  1.00 99.27  ? 54  GLN A C     1 
ATOM   1050 O O     . GLN C 2 54  ? -10.087 100.001 -2.035  1.00 99.31  ? 54  GLN A O     1 
ATOM   1051 C CB    . GLN C 2 54  ? -7.319  98.241  -1.942  1.00 99.27  ? 54  GLN A CB    1 
ATOM   1052 C CG    . GLN C 2 54  ? -6.213  97.736  -2.851  1.00 99.95  ? 54  GLN A CG    1 
ATOM   1053 C CD    . GLN C 2 54  ? -5.914  96.258  -2.648  1.00 100.32 ? 54  GLN A CD    1 
ATOM   1054 O OE1   . GLN C 2 54  ? -5.362  95.857  -1.624  1.00 100.50 ? 54  GLN A OE1   1 
ATOM   1055 N NE2   . GLN C 2 54  ? -6.285  95.440  -3.626  1.00 100.31 ? 54  GLN A NE2   1 
ATOM   1056 N N     . GLN C 2 55  ? -8.905  100.244 -0.147  1.00 99.47  ? 55  GLN A N     1 
ATOM   1057 C CA    . GLN C 2 55  ? -10.075 100.541 0.661   1.00 99.60  ? 55  GLN A CA    1 
ATOM   1058 C C     . GLN C 2 55  ? -10.705 101.866 0.241   1.00 99.41  ? 55  GLN A C     1 
ATOM   1059 O O     . GLN C 2 55  ? -11.912 101.940 0.016   1.00 99.47  ? 55  GLN A O     1 
ATOM   1060 C CB    . GLN C 2 55  ? -9.694  100.573 2.149   1.00 100.17 ? 55  GLN A CB    1 
ATOM   1061 C CG    . GLN C 2 55  ? -10.811 101.053 3.076   1.00 101.02 ? 55  GLN A CG    1 
ATOM   1062 C CD    . GLN C 2 55  ? -10.546 100.745 4.545   1.00 101.30 ? 55  GLN A CD    1 
ATOM   1063 O OE1   . GLN C 2 55  ? -9.426  100.897 5.035   1.00 101.42 ? 55  GLN A OE1   1 
ATOM   1064 N NE2   . GLN C 2 55  ? -11.586 100.322 5.255   1.00 101.21 ? 55  GLN A NE2   1 
ATOM   1065 N N     . LEU C 2 56  ? -9.884  102.906 0.123   1.00 99.04  ? 56  LEU A N     1 
ATOM   1066 C CA    . LEU C 2 56  ? -10.373 104.223 -0.270  1.00 98.77  ? 56  LEU A CA    1 
ATOM   1067 C C     . LEU C 2 56  ? -11.053 104.160 -1.633  1.00 99.00  ? 56  LEU A C     1 
ATOM   1068 O O     . LEU C 2 56  ? -12.115 104.745 -1.834  1.00 98.95  ? 56  LEU A O     1 
ATOM   1069 C CB    . LEU C 2 56  ? -9.218  105.222 -0.327  1.00 98.23  ? 56  LEU A CB    1 
ATOM   1070 C CG    . LEU C 2 56  ? -9.615  106.690 -0.481  1.00 97.87  ? 56  LEU A CG    1 
ATOM   1071 C CD1   . LEU C 2 56  ? -10.325 107.138 0.776   1.00 97.86  ? 56  LEU A CD1   1 
ATOM   1072 C CD2   . LEU C 2 56  ? -8.389  107.554 -0.715  1.00 97.96  ? 56  LEU A CD2   1 
ATOM   1073 N N     . ALA C 2 57  ? -10.431 103.438 -2.561  1.00 99.18  ? 57  ALA A N     1 
ATOM   1074 C CA    . ALA C 2 57  ? -10.950 103.289 -3.915  1.00 99.22  ? 57  ALA A CA    1 
ATOM   1075 C C     . ALA C 2 57  ? -12.314 102.615 -3.953  1.00 99.37  ? 57  ALA A C     1 
ATOM   1076 O O     . ALA C 2 57  ? -12.959 102.574 -4.998  1.00 99.34  ? 57  ALA A O     1 
ATOM   1077 C CB    . ALA C 2 57  ? -9.964  102.512 -4.762  1.00 99.31  ? 57  ALA A CB    1 
ATOM   1078 N N     . GLY C 2 58  ? -12.749 102.073 -2.822  1.00 99.61  ? 58  GLY A N     1 
ATOM   1079 C CA    . GLY C 2 58  ? -14.054 101.441 -2.777  1.00 99.94  ? 58  GLY A CA    1 
ATOM   1080 C C     . GLY C 2 58  ? -14.087 99.931  -2.655  1.00 100.33 ? 58  GLY A C     1 
ATOM   1081 O O     . GLY C 2 58  ? -15.172 99.345  -2.589  1.00 100.39 ? 58  GLY A O     1 
ATOM   1082 N N     . LYS C 2 59  ? -12.917 99.293  -2.627  1.00 100.60 ? 59  LYS A N     1 
ATOM   1083 C CA    . LYS C 2 59  ? -12.848 97.833  -2.504  1.00 100.45 ? 59  LYS A CA    1 
ATOM   1084 C C     . LYS C 2 59  ? -13.629 97.367  -1.276  1.00 99.95  ? 59  LYS A C     1 
ATOM   1085 O O     . LYS C 2 59  ? -13.241 97.635  -0.134  1.00 99.85  ? 59  LYS A O     1 
ATOM   1086 C CB    . LYS C 2 59  ? -11.386 97.369  -2.410  1.00 100.76 ? 59  LYS A CB    1 
ATOM   1087 C CG    . LYS C 2 59  ? -11.209 95.873  -2.176  1.00 101.04 ? 59  LYS A CG    1 
ATOM   1088 C CD    . LYS C 2 59  ? -9.796  95.432  -2.535  1.00 101.67 ? 59  LYS A CD    1 
ATOM   1089 C CE    . LYS C 2 59  ? -9.461  94.059  -1.955  1.00 102.06 ? 59  LYS A CE    1 
ATOM   1090 N NZ    . LYS C 2 59  ? -9.259  94.097  -0.468  1.00 102.23 ? 59  LYS A NZ    1 
ATOM   1091 N N     . GLN C 2 60  ? -14.734 96.669  -1.525  1.00 99.19  ? 60  GLN A N     1 
ATOM   1092 C CA    . GLN C 2 60  ? -15.586 96.179  -0.452  1.00 98.40  ? 60  GLN A CA    1 
ATOM   1093 C C     . GLN C 2 60  ? -14.902 95.083  0.362   1.00 97.06  ? 60  GLN A C     1 
ATOM   1094 O O     . GLN C 2 60  ? -14.957 93.900  0.016   1.00 96.96  ? 60  GLN A O     1 
ATOM   1095 C CB    . GLN C 2 60  ? -16.911 95.661  -1.023  1.00 99.31  ? 60  GLN A CB    1 
ATOM   1096 C CG    . GLN C 2 60  ? -18.025 95.560  0.011   1.00 100.39 ? 60  GLN A CG    1 
ATOM   1097 C CD    . GLN C 2 60  ? -18.403 96.915  0.589   1.00 101.00 ? 60  GLN A CD    1 
ATOM   1098 O OE1   . GLN C 2 60  ? -17.559 97.627  1.141   1.00 101.35 ? 60  GLN A OE1   1 
ATOM   1099 N NE2   . GLN C 2 60  ? -19.678 97.278  0.465   1.00 100.93 ? 60  GLN A NE2   1 
ATOM   1100 N N     . SER C 2 61  ? -14.249 95.495  1.444   1.00 95.23  ? 61  SER A N     1 
ATOM   1101 C CA    . SER C 2 61  ? -13.555 94.570  2.328   1.00 92.76  ? 61  SER A CA    1 
ATOM   1102 C C     . SER C 2 61  ? -14.163 94.693  3.707   1.00 90.59  ? 61  SER A C     1 
ATOM   1103 O O     . SER C 2 61  ? -14.021 95.715  4.376   1.00 90.48  ? 61  SER A O     1 
ATOM   1104 C CB    . SER C 2 61  ? -12.066 94.904  2.398   1.00 93.13  ? 61  SER A CB    1 
ATOM   1105 O OG    . SER C 2 61  ? -11.476 94.814  1.113   1.00 93.82  ? 61  SER A OG    1 
ATOM   1106 N N     . LEU C 2 62  ? -14.864 93.652  4.115   1.00 87.75  ? 62  LEU A N     1 
ATOM   1107 C CA    . LEU C 2 62  ? -15.489 93.631  5.420   1.00 84.86  ? 62  LEU A CA    1 
ATOM   1108 C C     . LEU C 2 62  ? -14.430 93.743  6.521   1.00 82.46  ? 62  LEU A C     1 
ATOM   1109 O O     . LEU C 2 62  ? -13.765 92.768  6.876   1.00 82.29  ? 62  LEU A O     1 
ATOM   1110 C CB    . LEU C 2 62  ? -16.319 92.351  5.557   1.00 85.52  ? 62  LEU A CB    1 
ATOM   1111 C CG    . LEU C 2 62  ? -15.713 90.968  5.267   1.00 85.96  ? 62  LEU A CG    1 
ATOM   1112 C CD1   . LEU C 2 62  ? -16.867 90.010  4.957   1.00 86.05  ? 62  LEU A CD1   1 
ATOM   1113 C CD2   . LEU C 2 62  ? -14.747 90.989  4.079   1.00 85.87  ? 62  LEU A CD2   1 
ATOM   1114 N N     . LEU C 2 63  ? -14.282 94.955  7.049   1.00 79.34  ? 63  LEU A N     1 
ATOM   1115 C CA    . LEU C 2 63  ? -13.313 95.246  8.096   1.00 76.09  ? 63  LEU A CA    1 
ATOM   1116 C C     . LEU C 2 63  ? -13.979 95.421  9.472   1.00 74.15  ? 63  LEU A C     1 
ATOM   1117 O O     . LEU C 2 63  ? -14.618 96.440  9.754   1.00 73.96  ? 63  LEU A O     1 
ATOM   1118 C CB    . LEU C 2 63  ? -12.524 96.499  7.708   1.00 75.61  ? 63  LEU A CB    1 
ATOM   1119 C CG    . LEU C 2 63  ? -11.311 96.972  8.513   1.00 75.42  ? 63  LEU A CG    1 
ATOM   1120 C CD1   . LEU C 2 63  ? -11.685 98.225  9.266   1.00 75.15  ? 63  LEU A CD1   1 
ATOM   1121 C CD2   . LEU C 2 63  ? -10.805 95.877  9.453   1.00 75.57  ? 63  LEU A CD2   1 
ATOM   1122 N N     . ILE C 2 64  ? -13.810 94.407  10.319  1.00 71.34  ? 64  ILE A N     1 
ATOM   1123 C CA    . ILE C 2 64  ? -14.367 94.373  11.669  1.00 68.22  ? 64  ILE A CA    1 
ATOM   1124 C C     . ILE C 2 64  ? -13.513 95.105  12.708  1.00 66.38  ? 64  ILE A C     1 
ATOM   1125 O O     . ILE C 2 64  ? -12.315 94.870  12.813  1.00 66.62  ? 64  ILE A O     1 
ATOM   1126 C CB    . ILE C 2 64  ? -14.529 92.920  12.131  1.00 67.51  ? 64  ILE A CB    1 
ATOM   1127 C CG1   . ILE C 2 64  ? -15.483 92.189  11.191  1.00 66.63  ? 64  ILE A CG1   1 
ATOM   1128 C CG2   . ILE C 2 64  ? -15.002 92.882  13.572  1.00 67.49  ? 64  ILE A CG2   1 
ATOM   1129 C CD1   . ILE C 2 64  ? -15.543 90.704  11.434  1.00 66.29  ? 64  ILE A CD1   1 
ATOM   1130 N N     . GLY C 2 65  ? -14.137 95.992  13.473  1.00 64.30  ? 65  GLY A N     1 
ATOM   1131 C CA    . GLY C 2 65  ? -13.417 96.721  14.505  1.00 61.70  ? 65  GLY A CA    1 
ATOM   1132 C C     . GLY C 2 65  ? -13.707 96.052  15.833  1.00 59.96  ? 65  GLY A C     1 
ATOM   1133 O O     . GLY C 2 65  ? -14.785 95.481  16.017  1.00 60.17  ? 65  GLY A O     1 
ATOM   1134 N N     . VAL C 2 66  ? -12.755 96.090  16.759  1.00 58.09  ? 66  VAL A N     1 
ATOM   1135 C CA    . VAL C 2 66  ? -12.967 95.468  18.058  1.00 56.03  ? 66  VAL A CA    1 
ATOM   1136 C C     . VAL C 2 66  ? -12.434 96.302  19.207  1.00 55.01  ? 66  VAL A C     1 
ATOM   1137 O O     . VAL C 2 66  ? -11.245 96.600  19.259  1.00 54.73  ? 66  VAL A O     1 
ATOM   1138 C CB    . VAL C 2 66  ? -12.316 94.083  18.142  1.00 55.61  ? 66  VAL A CB    1 
ATOM   1139 C CG1   . VAL C 2 66  ? -12.495 93.521  19.543  1.00 55.78  ? 66  VAL A CG1   1 
ATOM   1140 C CG2   . VAL C 2 66  ? -12.943 93.153  17.137  1.00 55.41  ? 66  VAL A CG2   1 
ATOM   1141 N N     . ALA C 2 67  ? -13.329 96.696  20.109  1.00 54.03  ? 67  ALA A N     1 
ATOM   1142 C CA    . ALA C 2 67  ? -12.951 97.465  21.295  1.00 53.57  ? 67  ALA A CA    1 
ATOM   1143 C C     . ALA C 2 67  ? -12.968 96.409  22.397  1.00 53.07  ? 67  ALA A C     1 
ATOM   1144 O O     . ALA C 2 67  ? -13.999 95.763  22.632  1.00 52.97  ? 67  ALA A O     1 
ATOM   1145 C CB    . ALA C 2 67  ? -13.972 98.559  21.577  1.00 53.71  ? 67  ALA A CB    1 
ATOM   1146 N N     . THR C 2 68  ? -11.838 96.226  23.069  1.00 51.72  ? 68  THR A N     1 
ATOM   1147 C CA    . THR C 2 68  ? -11.763 95.178  24.068  1.00 50.87  ? 68  THR A CA    1 
ATOM   1148 C C     . THR C 2 68  ? -11.046 95.567  25.350  1.00 50.39  ? 68  THR A C     1 
ATOM   1149 O O     . THR C 2 68  ? -10.310 96.564  25.405  1.00 49.60  ? 68  THR A O     1 
ATOM   1150 C CB    . THR C 2 68  ? -11.044 93.950  23.446  1.00 51.10  ? 68  THR A CB    1 
ATOM   1151 O OG1   . THR C 2 68  ? -10.916 92.897  24.407  1.00 51.08  ? 68  THR A OG1   1 
ATOM   1152 C CG2   . THR C 2 68  ? -9.660  94.349  22.997  1.00 51.47  ? 68  THR A CG2   1 
ATOM   1153 N N     . SER C 2 69  ? -11.283 94.769  26.387  1.00 49.95  ? 69  SER A N     1 
ATOM   1154 C CA    . SER C 2 69  ? -10.621 94.958  27.668  1.00 50.27  ? 69  SER A CA    1 
ATOM   1155 C C     . SER C 2 69  ? -9.188  94.501  27.406  1.00 49.90  ? 69  SER A C     1 
ATOM   1156 O O     . SER C 2 69  ? -8.926  93.860  26.382  1.00 49.04  ? 69  SER A O     1 
ATOM   1157 C CB    . SER C 2 69  ? -11.232 94.051  28.732  1.00 50.61  ? 69  SER A CB    1 
ATOM   1158 O OG    . SER C 2 69  ? -12.610 94.308  28.902  1.00 52.25  ? 69  SER A OG    1 
ATOM   1159 N N     . SER C 2 70  ? -8.275  94.812  28.325  1.00 49.38  ? 70  SER A N     1 
ATOM   1160 C CA    . SER C 2 70  ? -6.875  94.419  28.175  1.00 48.61  ? 70  SER A CA    1 
ATOM   1161 C C     . SER C 2 70  ? -6.707  92.957  27.771  1.00 47.35  ? 70  SER A C     1 
ATOM   1162 O O     . SER C 2 70  ? -7.334  92.059  28.340  1.00 46.23  ? 70  SER A O     1 
ATOM   1163 C CB    . SER C 2 70  ? -6.109  94.653  29.469  1.00 48.74  ? 70  SER A CB    1 
ATOM   1164 O OG    . SER C 2 70  ? -4.757  94.281  29.301  1.00 49.97  ? 70  SER A OG    1 
ATOM   1165 N N     . LEU C 2 71  ? -5.852  92.732  26.781  1.00 46.54  ? 71  LEU A N     1 
ATOM   1166 C CA    . LEU C 2 71  ? -5.589  91.386  26.298  1.00 46.02  ? 71  LEU A CA    1 
ATOM   1167 C C     . LEU C 2 71  ? -4.752  90.637  27.322  1.00 44.95  ? 71  LEU A C     1 
ATOM   1168 O O     . LEU C 2 71  ? -4.514  89.450  27.187  1.00 44.75  ? 71  LEU A O     1 
ATOM   1169 C CB    . LEU C 2 71  ? -4.878  91.453  24.955  1.00 46.09  ? 71  LEU A CB    1 
ATOM   1170 C CG    . LEU C 2 71  ? -5.790  92.124  23.926  1.00 46.65  ? 71  LEU A CG    1 
ATOM   1171 C CD1   . LEU C 2 71  ? -5.020  92.451  22.653  1.00 46.59  ? 71  LEU A CD1   1 
ATOM   1172 C CD2   . LEU C 2 71  ? -6.962  91.188  23.639  1.00 46.31  ? 71  LEU A CD2   1 
ATOM   1173 N N     . ALA C 2 72  ? -4.317  91.340  28.357  1.00 44.18  ? 72  ALA A N     1 
ATOM   1174 C CA    . ALA C 2 72  ? -3.544  90.705  29.404  1.00 44.27  ? 72  ALA A CA    1 
ATOM   1175 C C     . ALA C 2 72  ? -4.480  89.837  30.239  1.00 44.49  ? 72  ALA A C     1 
ATOM   1176 O O     . ALA C 2 72  ? -4.030  89.064  31.081  1.00 45.10  ? 72  ALA A O     1 
ATOM   1177 C CB    . ALA C 2 72  ? -2.878  91.750  30.284  1.00 42.91  ? 72  ALA A CB    1 
ATOM   1178 N N     . LEU C 2 73  ? -5.785  89.961  30.014  1.00 43.95  ? 73  LEU A N     1 
ATOM   1179 C CA    . LEU C 2 73  ? -6.748  89.170  30.766  1.00 43.60  ? 73  LEU A CA    1 
ATOM   1180 C C     . LEU C 2 73  ? -7.109  87.924  29.982  1.00 42.93  ? 73  LEU A C     1 
ATOM   1181 O O     . LEU C 2 73  ? -7.234  87.968  28.755  1.00 42.61  ? 73  LEU A O     1 
ATOM   1182 C CB    . LEU C 2 73  ? -8.000  89.998  31.040  1.00 45.27  ? 73  LEU A CB    1 
ATOM   1183 C CG    . LEU C 2 73  ? -7.717  91.240  31.890  1.00 46.46  ? 73  LEU A CG    1 
ATOM   1184 C CD1   . LEU C 2 73  ? -8.854  92.269  31.693  1.00 46.66  ? 73  LEU A CD1   1 
ATOM   1185 C CD2   . LEU C 2 73  ? -7.553  90.836  33.349  1.00 45.31  ? 73  LEU A CD2   1 
ATOM   1186 N N     . HIS C 2 74  ? -7.312  86.820  30.690  1.00 42.30  ? 74  HIS A N     1 
ATOM   1187 C CA    . HIS C 2 74  ? -7.609  85.564  30.034  1.00 42.42  ? 74  HIS A CA    1 
ATOM   1188 C C     . HIS C 2 74  ? -8.710  85.547  28.986  1.00 42.93  ? 74  HIS A C     1 
ATOM   1189 O O     . HIS C 2 74  ? -8.430  85.400  27.798  1.00 44.11  ? 74  HIS A O     1 
ATOM   1190 C CB    . HIS C 2 74  ? -7.906  84.473  31.056  1.00 43.28  ? 74  HIS A CB    1 
ATOM   1191 C CG    . HIS C 2 74  ? -7.986  83.110  30.445  1.00 45.31  ? 74  HIS A CG    1 
ATOM   1192 N ND1   . HIS C 2 74  ? -6.882  82.461  29.934  1.00 45.23  ? 74  HIS A ND1   1 
ATOM   1193 C CD2   . HIS C 2 74  ? -9.047  82.306  30.189  1.00 46.17  ? 74  HIS A CD2   1 
ATOM   1194 C CE1   . HIS C 2 74  ? -7.259  81.316  29.390  1.00 45.96  ? 74  HIS A CE1   1 
ATOM   1195 N NE2   . HIS C 2 74  ? -8.568  81.197  29.529  1.00 46.42  ? 74  HIS A NE2   1 
ATOM   1196 N N     . ALA C 2 75  ? -9.965  85.676  29.409  1.00 43.56  ? 75  ALA A N     1 
ATOM   1197 C CA    . ALA C 2 75  ? -11.085 85.619  28.462  1.00 42.91  ? 75  ALA A CA    1 
ATOM   1198 C C     . ALA C 2 75  ? -10.962 86.561  27.263  1.00 42.20  ? 75  ALA A C     1 
ATOM   1199 O O     . ALA C 2 75  ? -11.171 86.159  26.119  1.00 41.91  ? 75  ALA A O     1 
ATOM   1200 C CB    . ALA C 2 75  ? -12.393 85.859  29.188  1.00 42.12  ? 75  ALA A CB    1 
ATOM   1201 N N     . PRO C 2 76  ? -10.626 87.828  27.506  1.00 42.08  ? 76  PRO A N     1 
ATOM   1202 C CA    . PRO C 2 76  ? -10.497 88.754  26.376  1.00 43.12  ? 76  PRO A CA    1 
ATOM   1203 C C     . PRO C 2 76  ? -9.501  88.231  25.338  1.00 44.32  ? 76  PRO A C     1 
ATOM   1204 O O     . PRO C 2 76  ? -9.795  88.223  24.132  1.00 45.19  ? 76  PRO A O     1 
ATOM   1205 C CB    . PRO C 2 76  ? -10.011 90.050  27.030  1.00 41.95  ? 76  PRO A CB    1 
ATOM   1206 C CG    . PRO C 2 76  ? -10.576 89.969  28.405  1.00 41.86  ? 76  PRO A CG    1 
ATOM   1207 C CD    . PRO C 2 76  ? -10.415 88.513  28.791  1.00 41.62  ? 76  PRO A CD    1 
ATOM   1208 N N     . SER C 2 77  ? -8.327  87.791  25.798  1.00 44.39  ? 77  SER A N     1 
ATOM   1209 C CA    . SER C 2 77  ? -7.324  87.293  24.860  1.00 44.97  ? 77  SER A CA    1 
ATOM   1210 C C     . SER C 2 77  ? -7.878  86.092  24.111  1.00 44.70  ? 77  SER A C     1 
ATOM   1211 O O     . SER C 2 77  ? -7.717  85.987  22.896  1.00 45.68  ? 77  SER A O     1 
ATOM   1212 C CB    . SER C 2 77  ? -6.026  86.913  25.579  1.00 44.89  ? 77  SER A CB    1 
ATOM   1213 O OG    . SER C 2 77  ? -6.181  85.717  26.331  1.00 46.60  ? 77  SER A OG    1 
ATOM   1214 N N     . GLN C 2 78  ? -8.547  85.194  24.818  1.00 44.00  ? 78  GLN A N     1 
ATOM   1215 C CA    . GLN C 2 78  ? -9.103  84.023  24.154  1.00 44.72  ? 78  GLN A CA    1 
ATOM   1216 C C     . GLN C 2 78  ? -10.123 84.441  23.097  1.00 45.11  ? 78  GLN A C     1 
ATOM   1217 O O     . GLN C 2 78  ? -10.176 83.870  22.000  1.00 45.74  ? 78  GLN A O     1 
ATOM   1218 C CB    . GLN C 2 78  ? -9.789  83.107  25.169  1.00 44.86  ? 78  GLN A CB    1 
ATOM   1219 C CG    . GLN C 2 78  ? -8.881  82.647  26.292  1.00 46.18  ? 78  GLN A CG    1 
ATOM   1220 C CD    . GLN C 2 78  ? -7.701  81.855  25.773  1.00 46.63  ? 78  GLN A CD    1 
ATOM   1221 O OE1   . GLN C 2 78  ? -7.872  80.802  25.159  1.00 47.04  ? 78  GLN A OE1   1 
ATOM   1222 N NE2   . GLN C 2 78  ? -6.497  82.360  26.013  1.00 46.64  ? 78  GLN A NE2   1 
ATOM   1223 N N     . ILE C 2 79  ? -10.922 85.451  23.429  1.00 44.67  ? 79  ILE A N     1 
ATOM   1224 C CA    . ILE C 2 79  ? -11.973 85.916  22.536  1.00 44.14  ? 79  ILE A CA    1 
ATOM   1225 C C     . ILE C 2 79  ? -11.426 86.609  21.301  1.00 44.00  ? 79  ILE A C     1 
ATOM   1226 O O     . ILE C 2 79  ? -11.829 86.293  20.181  1.00 43.79  ? 79  ILE A O     1 
ATOM   1227 C CB    . ILE C 2 79  ? -12.976 86.838  23.314  1.00 44.38  ? 79  ILE A CB    1 
ATOM   1228 C CG1   . ILE C 2 79  ? -13.813 85.973  24.272  1.00 43.61  ? 79  ILE A CG1   1 
ATOM   1229 C CG2   . ILE C 2 79  ? -13.897 87.593  22.344  1.00 43.23  ? 79  ILE A CG2   1 
ATOM   1230 C CD1   . ILE C 2 79  ? -14.405 86.745  25.431  1.00 42.52  ? 79  ILE A CD1   1 
ATOM   1231 N N     . VAL C 2 80  ? -10.523 87.559  21.485  1.00 44.07  ? 80  VAL A N     1 
ATOM   1232 C CA    . VAL C 2 80  ? -9.949  88.220  20.327  1.00 45.25  ? 80  VAL A CA    1 
ATOM   1233 C C     . VAL C 2 80  ? -9.332  87.157  19.406  1.00 46.25  ? 80  VAL A C     1 
ATOM   1234 O O     . VAL C 2 80  ? -9.494  87.208  18.183  1.00 46.54  ? 80  VAL A O     1 
ATOM   1235 C CB    . VAL C 2 80  ? -8.868  89.212  20.738  1.00 45.63  ? 80  VAL A CB    1 
ATOM   1236 C CG1   . VAL C 2 80  ? -7.952  89.483  19.571  1.00 46.14  ? 80  VAL A CG1   1 
ATOM   1237 C CG2   . VAL C 2 80  ? -9.513  90.509  21.187  1.00 45.73  ? 80  VAL A CG2   1 
ATOM   1238 N N     . ALA C 2 81  ? -8.651  86.179  20.004  1.00 46.92  ? 81  ALA A N     1 
ATOM   1239 C CA    . ALA C 2 81  ? -8.017  85.109  19.240  1.00 47.17  ? 81  ALA A CA    1 
ATOM   1240 C C     . ALA C 2 81  ? -9.032  84.394  18.365  1.00 47.39  ? 81  ALA A C     1 
ATOM   1241 O O     . ALA C 2 81  ? -8.821  84.245  17.164  1.00 48.18  ? 81  ALA A O     1 
ATOM   1242 C CB    . ALA C 2 81  ? -7.343  84.121  20.176  1.00 46.46  ? 81  ALA A CB    1 
ATOM   1243 N N     . ALA C 2 82  ? -10.136 83.951  18.958  1.00 47.67  ? 82  ALA A N     1 
ATOM   1244 C CA    . ALA C 2 82  ? -11.158 83.264  18.175  1.00 47.84  ? 82  ALA A CA    1 
ATOM   1245 C C     . ALA C 2 82  ? -11.792 84.213  17.138  1.00 48.53  ? 82  ALA A C     1 
ATOM   1246 O O     . ALA C 2 82  ? -12.255 83.765  16.086  1.00 48.11  ? 82  ALA A O     1 
ATOM   1247 C CB    . ALA C 2 82  ? -12.216 82.687  19.089  1.00 46.64  ? 82  ALA A CB    1 
ATOM   1248 N N     . ILE C 2 83  ? -11.792 85.517  17.428  1.00 49.19  ? 83  ILE A N     1 
ATOM   1249 C CA    . ILE C 2 83  ? -12.358 86.492  16.500  1.00 50.36  ? 83  ILE A CA    1 
ATOM   1250 C C     . ILE C 2 83  ? -11.461 86.599  15.270  1.00 51.62  ? 83  ILE A C     1 
ATOM   1251 O O     . ILE C 2 83  ? -11.917 86.378  14.145  1.00 51.67  ? 83  ILE A O     1 
ATOM   1252 C CB    . ILE C 2 83  ? -12.511 87.898  17.150  1.00 49.89  ? 83  ILE A CB    1 
ATOM   1253 C CG1   . ILE C 2 83  ? -13.632 87.869  18.200  1.00 50.38  ? 83  ILE A CG1   1 
ATOM   1254 C CG2   . ILE C 2 83  ? -12.838 88.943  16.079  1.00 48.90  ? 83  ILE A CG2   1 
ATOM   1255 C CD1   . ILE C 2 83  ? -13.885 89.204  18.875  1.00 48.77  ? 83  ILE A CD1   1 
ATOM   1256 N N     . LYS C 2 84  ? -10.189 86.936  15.485  1.00 52.81  ? 84  LYS A N     1 
ATOM   1257 C CA    . LYS C 2 84  ? -9.239  87.048  14.376  1.00 53.79  ? 84  LYS A CA    1 
ATOM   1258 C C     . LYS C 2 84  ? -9.196  85.740  13.587  1.00 54.38  ? 84  LYS A C     1 
ATOM   1259 O O     . LYS C 2 84  ? -9.180  85.746  12.354  1.00 54.02  ? 84  LYS A O     1 
ATOM   1260 C CB    . LYS C 2 84  ? -7.847  87.390  14.891  1.00 53.18  ? 84  LYS A CB    1 
ATOM   1261 C CG    . LYS C 2 84  ? -7.806  88.722  15.603  1.00 54.67  ? 84  LYS A CG    1 
ATOM   1262 C CD    . LYS C 2 84  ? -6.392  89.170  15.877  1.00 55.45  ? 84  LYS A CD    1 
ATOM   1263 C CE    . LYS C 2 84  ? -5.867  90.034  14.745  1.00 57.10  ? 84  LYS A CE    1 
ATOM   1264 N NZ    . LYS C 2 84  ? -6.277  91.473  14.877  1.00 57.37  ? 84  LYS A NZ    1 
ATOM   1265 N N     . SER C 2 85  ? -9.204  84.620  14.299  1.00 55.11  ? 85  SER A N     1 
ATOM   1266 C CA    . SER C 2 85  ? -9.185  83.331  13.641  1.00 56.26  ? 85  SER A CA    1 
ATOM   1267 C C     . SER C 2 85  ? -10.371 83.190  12.699  1.00 58.24  ? 85  SER A C     1 
ATOM   1268 O O     . SER C 2 85  ? -10.196 82.974  11.502  1.00 59.61  ? 85  SER A O     1 
ATOM   1269 C CB    . SER C 2 85  ? -9.223  82.214  14.669  1.00 56.26  ? 85  SER A CB    1 
ATOM   1270 O OG    . SER C 2 85  ? -9.471  80.969  14.046  1.00 56.03  ? 85  SER A OG    1 
ATOM   1271 N N     . ARG C 2 86  ? -11.583 83.327  13.226  1.00 59.95  ? 86  ARG A N     1 
ATOM   1272 C CA    . ARG C 2 86  ? -12.777 83.188  12.397  1.00 61.12  ? 86  ARG A CA    1 
ATOM   1273 C C     . ARG C 2 86  ? -12.860 84.229  11.278  1.00 62.01  ? 86  ARG A C     1 
ATOM   1274 O O     . ARG C 2 86  ? -13.344 83.928  10.187  1.00 62.37  ? 86  ARG A O     1 
ATOM   1275 C CB    . ARG C 2 86  ? -14.032 83.224  13.286  1.00 61.39  ? 86  ARG A CB    1 
ATOM   1276 C CG    . ARG C 2 86  ? -15.331 83.630  12.593  1.00 61.83  ? 86  ARG A CG    1 
ATOM   1277 C CD    . ARG C 2 86  ? -15.686 82.765  11.402  1.00 61.92  ? 86  ARG A CD    1 
ATOM   1278 N NE    . ARG C 2 86  ? -16.249 81.478  11.781  1.00 62.36  ? 86  ARG A NE    1 
ATOM   1279 C CZ    . ARG C 2 86  ? -17.027 80.760  10.976  1.00 62.95  ? 86  ARG A CZ    1 
ATOM   1280 N NH1   . ARG C 2 86  ? -17.324 81.219  9.766   1.00 63.08  ? 86  ARG A NH1   1 
ATOM   1281 N NH2   . ARG C 2 86  ? -17.502 79.587  11.368  1.00 63.41  ? 86  ARG A NH2   1 
ATOM   1282 N N     . ALA C 2 87  ? -12.381 85.441  11.534  1.00 63.00  ? 87  ALA A N     1 
ATOM   1283 C CA    . ALA C 2 87  ? -12.417 86.485  10.515  1.00 64.63  ? 87  ALA A CA    1 
ATOM   1284 C C     . ALA C 2 87  ? -11.457 86.162  9.362   1.00 66.27  ? 87  ALA A C     1 
ATOM   1285 O O     . ALA C 2 87  ? -11.759 86.439  8.192   1.00 66.20  ? 87  ALA A O     1 
ATOM   1286 C CB    . ALA C 2 87  ? -12.066 87.830  11.130  1.00 64.08  ? 87  ALA A CB    1 
ATOM   1287 N N     . ASP C 2 88  ? -10.298 85.592  9.692   1.00 67.92  ? 88  ASP A N     1 
ATOM   1288 C CA    . ASP C 2 88  ? -9.325  85.222  8.668   1.00 69.56  ? 88  ASP A CA    1 
ATOM   1289 C C     . ASP C 2 88  ? -9.959  84.136  7.808   1.00 69.80  ? 88  ASP A C     1 
ATOM   1290 O O     . ASP C 2 88  ? -9.816  84.120  6.583   1.00 70.06  ? 88  ASP A O     1 
ATOM   1291 C CB    . ASP C 2 88  ? -8.030  84.683  9.295   1.00 71.03  ? 88  ASP A CB    1 
ATOM   1292 C CG    . ASP C 2 88  ? -7.224  85.766  10.002  1.00 73.27  ? 88  ASP A CG    1 
ATOM   1293 O OD1   . ASP C 2 88  ? -7.229  86.920  9.504   1.00 74.56  ? 88  ASP A OD1   1 
ATOM   1294 O OD2   . ASP C 2 88  ? -6.575  85.469  11.040  1.00 73.65  ? 88  ASP A OD2   1 
ATOM   1295 N N     . GLN C 2 89  ? -10.677 83.240  8.469   1.00 69.37  ? 89  GLN A N     1 
ATOM   1296 C CA    . GLN C 2 89  ? -11.332 82.142  7.796   1.00 69.63  ? 89  GLN A CA    1 
ATOM   1297 C C     . GLN C 2 89  ? -12.466 82.594  6.879   1.00 69.70  ? 89  GLN A C     1 
ATOM   1298 O O     . GLN C 2 89  ? -12.904 81.836  6.019   1.00 70.01  ? 89  GLN A O     1 
ATOM   1299 C CB    . GLN C 2 89  ? -11.859 81.165  8.840   1.00 70.02  ? 89  GLN A CB    1 
ATOM   1300 C CG    . GLN C 2 89  ? -12.518 79.942  8.271   1.00 71.06  ? 89  GLN A CG    1 
ATOM   1301 C CD    . GLN C 2 89  ? -12.948 78.984  9.356   1.00 72.57  ? 89  GLN A CD    1 
ATOM   1302 O OE1   . GLN C 2 89  ? -13.436 77.886  9.074   1.00 73.51  ? 89  GLN A OE1   1 
ATOM   1303 N NE2   . GLN C 2 89  ? -12.770 79.392  10.614  1.00 73.15  ? 89  GLN A NE2   1 
ATOM   1304 N N     . LEU C 2 90  ? -12.947 83.821  7.062   1.00 69.48  ? 90  LEU A N     1 
ATOM   1305 C CA    . LEU C 2 90  ? -14.039 84.336  6.235   1.00 69.16  ? 90  LEU A CA    1 
ATOM   1306 C C     . LEU C 2 90  ? -13.520 85.414  5.305   1.00 68.84  ? 90  LEU A C     1 
ATOM   1307 O O     . LEU C 2 90  ? -14.293 86.107  4.642   1.00 69.10  ? 90  LEU A O     1 
ATOM   1308 C CB    . LEU C 2 90  ? -15.163 84.918  7.106   1.00 69.07  ? 90  LEU A CB    1 
ATOM   1309 C CG    . LEU C 2 90  ? -15.944 83.959  8.011   1.00 69.30  ? 90  LEU A CG    1 
ATOM   1310 C CD1   . LEU C 2 90  ? -16.983 84.744  8.805   1.00 69.26  ? 90  LEU A CD1   1 
ATOM   1311 C CD2   . LEU C 2 90  ? -16.615 82.881  7.171   1.00 68.82  ? 90  LEU A CD2   1 
ATOM   1312 N N     . GLY C 2 91  ? -12.205 85.559  5.262   1.00 68.18  ? 91  GLY A N     1 
ATOM   1313 C CA    . GLY C 2 91  ? -11.624 86.568  4.403   1.00 67.61  ? 91  GLY A CA    1 
ATOM   1314 C C     . GLY C 2 91  ? -11.947 87.959  4.903   1.00 67.51  ? 91  GLY A C     1 
ATOM   1315 O O     . GLY C 2 91  ? -11.941 88.921  4.135   1.00 67.50  ? 91  GLY A O     1 
ATOM   1316 N N     . ALA C 2 92  ? -12.235 88.069  6.198   1.00 67.24  ? 92  ALA A N     1 
ATOM   1317 C CA    . ALA C 2 92  ? -12.549 89.362  6.795   1.00 66.74  ? 92  ALA A CA    1 
ATOM   1318 C C     . ALA C 2 92  ? -11.336 89.879  7.551   1.00 66.30  ? 92  ALA A C     1 
ATOM   1319 O O     . ALA C 2 92  ? -10.581 89.105  8.132   1.00 66.35  ? 92  ALA A O     1 
ATOM   1320 C CB    . ALA C 2 92  ? -13.732 89.231  7.737   1.00 66.77  ? 92  ALA A CB    1 
ATOM   1321 N N     . SER C 2 93  ? -11.157 91.191  7.542   1.00 65.80  ? 93  SER A N     1 
ATOM   1322 C CA    . SER C 2 93  ? -10.034 91.815  8.222   1.00 65.64  ? 93  SER A CA    1 
ATOM   1323 C C     . SER C 2 93  ? -10.457 92.268  9.632   1.00 65.32  ? 93  SER A C     1 
ATOM   1324 O O     . SER C 2 93  ? -11.637 92.509  9.885   1.00 65.82  ? 93  SER A O     1 
ATOM   1325 C CB    . SER C 2 93  ? -9.557  93.004  7.388   1.00 65.70  ? 93  SER A CB    1 
ATOM   1326 O OG    . SER C 2 93  ? -8.380  93.570  7.924   1.00 67.06  ? 93  SER A OG    1 
ATOM   1327 N N     . VAL C 2 94  ? -9.501  92.391  10.549  1.00 64.39  ? 94  VAL A N     1 
ATOM   1328 C CA    . VAL C 2 94  ? -9.824  92.792  11.912  1.00 63.28  ? 94  VAL A CA    1 
ATOM   1329 C C     . VAL C 2 94  ? -8.822  93.741  12.556  1.00 63.16  ? 94  VAL A C     1 
ATOM   1330 O O     . VAL C 2 94  ? -7.643  93.432  12.673  1.00 63.62  ? 94  VAL A O     1 
ATOM   1331 C CB    . VAL C 2 94  ? -9.942  91.561  12.836  1.00 63.07  ? 94  VAL A CB    1 
ATOM   1332 C CG1   . VAL C 2 94  ? -10.159 92.013  14.268  1.00 62.83  ? 94  VAL A CG1   1 
ATOM   1333 C CG2   . VAL C 2 94  ? -11.081 90.667  12.381  1.00 62.74  ? 94  VAL A CG2   1 
ATOM   1334 N N     . VAL C 2 95  ? -9.298  94.899  12.979  1.00 62.91  ? 95  VAL A N     1 
ATOM   1335 C CA    . VAL C 2 95  ? -8.445  95.859  13.656  1.00 63.04  ? 95  VAL A CA    1 
ATOM   1336 C C     . VAL C 2 95  ? -9.006  95.918  15.078  1.00 63.28  ? 95  VAL A C     1 
ATOM   1337 O O     . VAL C 2 95  ? -10.224 95.879  15.252  1.00 63.21  ? 95  VAL A O     1 
ATOM   1338 C CB    . VAL C 2 95  ? -8.524  97.241  12.979  1.00 63.13  ? 95  VAL A CB    1 
ATOM   1339 C CG1   . VAL C 2 95  ? -9.961  97.566  12.639  1.00 62.95  ? 95  VAL A CG1   1 
ATOM   1340 C CG2   . VAL C 2 95  ? -7.945  98.306  13.902  1.00 63.21  ? 95  VAL A CG2   1 
ATOM   1341 N N     . VAL C 2 96  ? -8.146  95.984  16.094  1.00 63.22  ? 96  VAL A N     1 
ATOM   1342 C CA    . VAL C 2 96  ? -8.650  96.013  17.464  1.00 63.70  ? 96  VAL A CA    1 
ATOM   1343 C C     . VAL C 2 96  ? -8.091  97.138  18.304  1.00 64.56  ? 96  VAL A C     1 
ATOM   1344 O O     . VAL C 2 96  ? -6.896  97.403  18.294  1.00 64.81  ? 96  VAL A O     1 
ATOM   1345 C CB    . VAL C 2 96  ? -8.403  94.664  18.217  1.00 63.07  ? 96  VAL A CB    1 
ATOM   1346 C CG1   . VAL C 2 96  ? -8.166  93.544  17.229  1.00 62.50  ? 96  VAL A CG1   1 
ATOM   1347 C CG2   . VAL C 2 96  ? -7.258  94.793  19.190  1.00 63.00  ? 96  VAL A CG2   1 
ATOM   1348 N N     . SER C 2 97  ? -8.975  97.802  19.036  1.00 65.68  ? 97  SER A N     1 
ATOM   1349 C CA    . SER C 2 97  ? -8.574  98.899  19.894  1.00 66.87  ? 97  SER A CA    1 
ATOM   1350 C C     . SER C 2 97  ? -8.693  98.410  21.331  1.00 68.04  ? 97  SER A C     1 
ATOM   1351 O O     . SER C 2 97  ? -9.773  98.049  21.800  1.00 68.20  ? 97  SER A O     1 
ATOM   1352 C CB    . SER C 2 97  ? -9.474  100.109 19.657  1.00 66.38  ? 97  SER A CB    1 
ATOM   1353 O OG    . SER C 2 97  ? -8.925  101.265 20.257  1.00 66.65  ? 97  SER A OG    1 
ATOM   1354 N N     . MET C 2 98  ? -7.568  98.387  22.028  1.00 69.42  ? 98  MET A N     1 
ATOM   1355 C CA    . MET C 2 98  ? -7.548  97.908  23.395  1.00 70.65  ? 98  MET A CA    1 
ATOM   1356 C C     . MET C 2 98  ? -7.815  99.060  24.353  1.00 71.90  ? 98  MET A C     1 
ATOM   1357 O O     . MET C 2 98  ? -7.191  100.111 24.262  1.00 71.89  ? 98  MET A O     1 
ATOM   1358 C CB    . MET C 2 98  ? -6.189  97.253  23.680  1.00 70.03  ? 98  MET A CB    1 
ATOM   1359 C CG    . MET C 2 98  ? -6.178  96.351  24.900  1.00 70.16  ? 98  MET A CG    1 
ATOM   1360 S SD    . MET C 2 98  ? -4.624  95.467  25.179  1.00 68.82  ? 98  MET A SD    1 
ATOM   1361 C CE    . MET C 2 98  ? -3.726  96.655  26.221  1.00 68.18  ? 98  MET A CE    1 
ATOM   1362 N N     . VAL C 2 99  ? -8.766  98.867  25.257  1.00 73.91  ? 99  VAL A N     1 
ATOM   1363 C CA    . VAL C 2 99  ? -9.101  99.895  26.237  1.00 75.87  ? 99  VAL A CA    1 
ATOM   1364 C C     . VAL C 2 99  ? -8.502  99.506  27.588  1.00 77.59  ? 99  VAL A C     1 
ATOM   1365 O O     . VAL C 2 99  ? -8.821  98.452  28.134  1.00 77.87  ? 99  VAL A O     1 
ATOM   1366 C CB    . VAL C 2 99  ? -10.627 100.037 26.405  1.00 75.48  ? 99  VAL A CB    1 
ATOM   1367 C CG1   . VAL C 2 99  ? -10.934 101.180 27.345  1.00 75.36  ? 99  VAL A CG1   1 
ATOM   1368 C CG2   . VAL C 2 99  ? -11.283 100.257 25.064  1.00 74.95  ? 99  VAL A CG2   1 
ATOM   1369 N N     . GLU C 2 100 ? -7.629  100.347 28.125  1.00 79.68  ? 100 GLU A N     1 
ATOM   1370 C CA    . GLU C 2 100 ? -7.014  100.049 29.412  1.00 82.20  ? 100 GLU A CA    1 
ATOM   1371 C C     . GLU C 2 100 ? -7.604  100.910 30.515  1.00 83.36  ? 100 GLU A C     1 
ATOM   1372 O O     . GLU C 2 100 ? -7.927  100.415 31.599  1.00 83.41  ? 100 GLU A O     1 
ATOM   1373 C CB    . GLU C 2 100 ? -5.505  100.267 29.348  1.00 83.05  ? 100 GLU A CB    1 
ATOM   1374 C CG    . GLU C 2 100 ? -4.763  99.212  28.563  1.00 84.17  ? 100 GLU A CG    1 
ATOM   1375 C CD    . GLU C 2 100 ? -3.300  99.553  28.405  1.00 85.13  ? 100 GLU A CD    1 
ATOM   1376 O OE1   . GLU C 2 100 ? -3.007  100.638 27.847  1.00 85.28  ? 100 GLU A OE1   1 
ATOM   1377 O OE2   . GLU C 2 100 ? -2.448  98.743  28.838  1.00 85.75  ? 100 GLU A OE2   1 
ATOM   1378 N N     . ARG C 2 101 ? -7.733  102.203 30.246  1.00 84.66  ? 101 ARG A N     1 
ATOM   1379 C CA    . ARG C 2 101 ? -8.304  103.103 31.232  1.00 85.78  ? 101 ARG A CA    1 
ATOM   1380 C C     . ARG C 2 101 ? -9.725  102.632 31.522  1.00 85.77  ? 101 ARG A C     1 
ATOM   1381 O O     . ARG C 2 101 ? -10.437 102.183 30.623  1.00 85.92  ? 101 ARG A O     1 
ATOM   1382 C CB    . ARG C 2 101 ? -8.318  104.538 30.697  1.00 86.86  ? 101 ARG A CB    1 
ATOM   1383 C CG    . ARG C 2 101 ? -6.929  105.091 30.396  1.00 88.92  ? 101 ARG A CG    1 
ATOM   1384 C CD    . ARG C 2 101 ? -6.997  106.436 29.681  1.00 90.54  ? 101 ARG A CD    1 
ATOM   1385 N NE    . ARG C 2 101 ? -7.805  106.351 28.466  1.00 92.37  ? 101 ARG A NE    1 
ATOM   1386 C CZ    . ARG C 2 101 ? -7.933  107.330 27.574  1.00 93.14  ? 101 ARG A CZ    1 
ATOM   1387 N NH1   . ARG C 2 101 ? -7.297  108.482 27.757  1.00 93.81  ? 101 ARG A NH1   1 
ATOM   1388 N NH2   . ARG C 2 101 ? -8.702  107.156 26.502  1.00 93.27  ? 101 ARG A NH2   1 
ATOM   1389 N N     . SER C 2 102 ? -10.127 102.704 32.783  1.00 85.70  ? 102 SER A N     1 
ATOM   1390 C CA    . SER C 2 102 ? -11.468 102.293 33.159  1.00 85.45  ? 102 SER A CA    1 
ATOM   1391 C C     . SER C 2 102 ? -12.405 103.463 32.904  1.00 85.06  ? 102 SER A C     1 
ATOM   1392 O O     . SER C 2 102 ? -12.085 104.606 33.234  1.00 85.20  ? 102 SER A O     1 
ATOM   1393 C CB    . SER C 2 102 ? -11.512 101.910 34.637  1.00 85.73  ? 102 SER A CB    1 
ATOM   1394 O OG    . SER C 2 102 ? -12.841 101.633 35.040  1.00 86.24  ? 102 SER A OG    1 
ATOM   1395 N N     . GLY C 2 103 ? -13.558 103.188 32.309  1.00 84.38  ? 103 GLY A N     1 
ATOM   1396 C CA    . GLY C 2 103 ? -14.493 104.261 32.043  1.00 83.59  ? 103 GLY A CA    1 
ATOM   1397 C C     . GLY C 2 103 ? -15.113 104.209 30.663  1.00 83.11  ? 103 GLY A C     1 
ATOM   1398 O O     . GLY C 2 103 ? -14.577 103.579 29.746  1.00 83.20  ? 103 GLY A O     1 
ATOM   1399 N N     . VAL C 2 104 ? -16.247 104.890 30.526  1.00 82.29  ? 104 VAL A N     1 
ATOM   1400 C CA    . VAL C 2 104 ? -16.990 104.949 29.275  1.00 81.44  ? 104 VAL A CA    1 
ATOM   1401 C C     . VAL C 2 104 ? -16.317 105.867 28.269  1.00 80.89  ? 104 VAL A C     1 
ATOM   1402 O O     . VAL C 2 104 ? -16.444 105.675 27.062  1.00 80.96  ? 104 VAL A O     1 
ATOM   1403 C CB    . VAL C 2 104 ? -18.416 105.453 29.514  1.00 81.62  ? 104 VAL A CB    1 
ATOM   1404 C CG1   . VAL C 2 104 ? -19.271 105.251 28.263  1.00 81.18  ? 104 VAL A CG1   1 
ATOM   1405 C CG2   . VAL C 2 104 ? -19.006 104.737 30.717  1.00 81.76  ? 104 VAL A CG2   1 
ATOM   1406 N N     . GLU C 2 105 ? -15.617 106.879 28.765  1.00 80.03  ? 105 GLU A N     1 
ATOM   1407 C CA    . GLU C 2 105 ? -14.924 107.799 27.879  1.00 79.44  ? 105 GLU A CA    1 
ATOM   1408 C C     . GLU C 2 105 ? -13.835 107.032 27.144  1.00 78.32  ? 105 GLU A C     1 
ATOM   1409 O O     . GLU C 2 105 ? -13.659 107.190 25.934  1.00 78.16  ? 105 GLU A O     1 
ATOM   1410 C CB    . GLU C 2 105 ? -14.322 108.956 28.680  1.00 80.41  ? 105 GLU A CB    1 
ATOM   1411 C CG    . GLU C 2 105 ? -15.371 109.931 29.166  1.00 81.95  ? 105 GLU A CG    1 
ATOM   1412 C CD    . GLU C 2 105 ? -16.175 110.511 28.012  1.00 83.19  ? 105 GLU A CD    1 
ATOM   1413 O OE1   . GLU C 2 105 ? -15.653 111.414 27.318  1.00 83.89  ? 105 GLU A OE1   1 
ATOM   1414 O OE2   . GLU C 2 105 ? -17.320 110.052 27.783  1.00 83.84  ? 105 GLU A OE2   1 
ATOM   1415 N N     . ALA C 2 106 ? -13.118 106.193 27.887  1.00 76.88  ? 106 ALA A N     1 
ATOM   1416 C CA    . ALA C 2 106 ? -12.049 105.379 27.325  1.00 75.41  ? 106 ALA A CA    1 
ATOM   1417 C C     . ALA C 2 106 ? -12.613 104.488 26.224  1.00 74.51  ? 106 ALA A C     1 
ATOM   1418 O O     . ALA C 2 106 ? -12.034 104.382 25.142  1.00 74.45  ? 106 ALA A O     1 
ATOM   1419 C CB    . ALA C 2 106 ? -11.415 104.524 28.416  1.00 75.05  ? 106 ALA A CB    1 
ATOM   1420 N N     . CYS C 2 107 ? -13.750 103.855 26.500  1.00 73.31  ? 107 CYS A N     1 
ATOM   1421 C CA    . CYS C 2 107 ? -14.371 102.979 25.520  1.00 72.27  ? 107 CYS A CA    1 
ATOM   1422 C C     . CYS C 2 107 ? -14.879 103.774 24.329  1.00 72.11  ? 107 CYS A C     1 
ATOM   1423 O O     . CYS C 2 107 ? -14.899 103.283 23.201  1.00 71.73  ? 107 CYS A O     1 
ATOM   1424 C CB    . CYS C 2 107 ? -15.524 102.203 26.140  1.00 71.80  ? 107 CYS A CB    1 
ATOM   1425 S SG    . CYS C 2 107 ? -16.204 100.983 25.006  1.00 71.27  ? 107 CYS A SG    1 
ATOM   1426 N N     . LYS C 2 108 ? -15.303 105.004 24.581  1.00 72.05  ? 108 LYS A N     1 
ATOM   1427 C CA    . LYS C 2 108 ? -15.786 105.846 23.500  1.00 71.99  ? 108 LYS A CA    1 
ATOM   1428 C C     . LYS C 2 108 ? -14.595 106.245 22.640  1.00 71.62  ? 108 LYS A C     1 
ATOM   1429 O O     . LYS C 2 108 ? -14.686 106.231 21.413  1.00 71.35  ? 108 LYS A O     1 
ATOM   1430 C CB    . LYS C 2 108 ? -16.499 107.085 24.052  1.00 72.76  ? 108 LYS A CB    1 
ATOM   1431 C CG    . LYS C 2 108 ? -17.895 106.798 24.611  1.00 73.35  ? 108 LYS A CG    1 
ATOM   1432 C CD    . LYS C 2 108 ? -18.597 108.083 25.010  1.00 74.35  ? 108 LYS A CD    1 
ATOM   1433 C CE    . LYS C 2 108 ? -20.026 107.828 25.458  1.00 75.28  ? 108 LYS A CE    1 
ATOM   1434 N NZ    . LYS C 2 108 ? -20.753 109.109 25.728  1.00 75.98  ? 108 LYS A NZ    1 
ATOM   1435 N N     . THR C 2 109 ? -13.479 106.585 23.286  1.00 71.20  ? 109 THR A N     1 
ATOM   1436 C CA    . THR C 2 109 ? -12.259 106.953 22.572  1.00 70.86  ? 109 THR A CA    1 
ATOM   1437 C C     . THR C 2 109 ? -11.903 105.803 21.633  1.00 71.20  ? 109 THR A C     1 
ATOM   1438 O O     . THR C 2 109 ? -11.580 106.011 20.465  1.00 70.92  ? 109 THR A O     1 
ATOM   1439 C CB    . THR C 2 109 ? -11.078 107.146 23.531  1.00 70.84  ? 109 THR A CB    1 
ATOM   1440 O OG1   . THR C 2 109 ? -11.347 108.238 24.416  1.00 71.32  ? 109 THR A OG1   1 
ATOM   1441 C CG2   . THR C 2 109 ? -9.811  107.431 22.757  1.00 70.56  ? 109 THR A CG2   1 
ATOM   1442 N N     . ALA C 2 110 ? -11.964 104.587 22.166  1.00 71.39  ? 110 ALA A N     1 
ATOM   1443 C CA    . ALA C 2 110 ? -11.668 103.389 21.397  1.00 71.75  ? 110 ALA A CA    1 
ATOM   1444 C C     . ALA C 2 110 ? -12.610 103.247 20.205  1.00 72.51  ? 110 ALA A C     1 
ATOM   1445 O O     . ALA C 2 110 ? -12.180 102.917 19.104  1.00 72.99  ? 110 ALA A O     1 
ATOM   1446 C CB    . ALA C 2 110 ? -11.776 102.164 22.287  1.00 71.23  ? 110 ALA A CB    1 
ATOM   1447 N N     . VAL C 2 111 ? -13.899 103.486 20.419  1.00 73.30  ? 111 VAL A N     1 
ATOM   1448 C CA    . VAL C 2 111 ? -14.858 103.369 19.331  1.00 74.08  ? 111 VAL A CA    1 
ATOM   1449 C C     . VAL C 2 111 ? -14.612 104.457 18.293  1.00 74.80  ? 111 VAL A C     1 
ATOM   1450 O O     . VAL C 2 111 ? -14.811 104.243 17.095  1.00 74.82  ? 111 VAL A O     1 
ATOM   1451 C CB    . VAL C 2 111 ? -16.309 103.460 19.851  1.00 73.72  ? 111 VAL A CB    1 
ATOM   1452 C CG1   . VAL C 2 111 ? -17.282 103.535 18.686  1.00 73.63  ? 111 VAL A CG1   1 
ATOM   1453 C CG2   . VAL C 2 111 ? -16.624 102.236 20.697  1.00 73.59  ? 111 VAL A CG2   1 
ATOM   1454 N N     . HIS C 2 112 ? -14.165 105.617 18.760  1.00 75.69  ? 112 HIS A N     1 
ATOM   1455 C CA    . HIS C 2 112 ? -13.884 106.742 17.875  1.00 76.64  ? 112 HIS A CA    1 
ATOM   1456 C C     . HIS C 2 112 ? -12.835 106.343 16.838  1.00 76.60  ? 112 HIS A C     1 
ATOM   1457 O O     . HIS C 2 112 ? -13.054 106.486 15.632  1.00 76.53  ? 112 HIS A O     1 
ATOM   1458 C CB    . HIS C 2 112 ? -13.382 107.937 18.694  1.00 78.40  ? 112 HIS A CB    1 
ATOM   1459 C CG    . HIS C 2 112 ? -13.189 109.190 17.893  1.00 80.81  ? 112 HIS A CG    1 
ATOM   1460 N ND1   . HIS C 2 112 ? -12.685 110.353 18.444  1.00 81.77  ? 112 HIS A ND1   1 
ATOM   1461 C CD2   . HIS C 2 112 ? -13.439 109.470 16.590  1.00 81.69  ? 112 HIS A CD2   1 
ATOM   1462 C CE1   . HIS C 2 112 ? -12.634 111.292 17.511  1.00 82.02  ? 112 HIS A CE1   1 
ATOM   1463 N NE2   . HIS C 2 112 ? -13.085 110.783 16.382  1.00 82.08  ? 112 HIS A NE2   1 
ATOM   1464 N N     . ASN C 2 113 ? -11.699 105.835 17.315  1.00 76.43  ? 113 ASN A N     1 
ATOM   1465 C CA    . ASN C 2 113 ? -10.611 105.411 16.436  1.00 75.98  ? 113 ASN A CA    1 
ATOM   1466 C C     . ASN C 2 113 ? -11.044 104.306 15.490  1.00 75.75  ? 113 ASN A C     1 
ATOM   1467 O O     . ASN C 2 113 ? -10.721 104.332 14.310  1.00 76.31  ? 113 ASN A O     1 
ATOM   1468 C CB    . ASN C 2 113 ? -9.414  104.911 17.241  1.00 76.19  ? 113 ASN A CB    1 
ATOM   1469 C CG    . ASN C 2 113 ? -8.875  105.951 18.188  1.00 76.74  ? 113 ASN A CG    1 
ATOM   1470 O OD1   . ASN C 2 113 ? -8.823  107.142 17.862  1.00 77.54  ? 113 ASN A OD1   1 
ATOM   1471 N ND2   . ASN C 2 113 ? -8.452  105.508 19.370  1.00 76.91  ? 113 ASN A ND2   1 
ATOM   1472 N N     . LEU C 2 114 ? -11.760 103.320 16.010  1.00 75.30  ? 114 LEU A N     1 
ATOM   1473 C CA    . LEU C 2 114 ? -12.219 102.226 15.175  1.00 74.98  ? 114 LEU A CA    1 
ATOM   1474 C C     . LEU C 2 114 ? -13.081 102.790 14.049  1.00 75.10  ? 114 LEU A C     1 
ATOM   1475 O O     . LEU C 2 114 ? -13.052 102.304 12.913  1.00 74.99  ? 114 LEU A O     1 
ATOM   1476 C CB    . LEU C 2 114 ? -13.014 101.232 16.020  1.00 74.95  ? 114 LEU A CB    1 
ATOM   1477 C CG    . LEU C 2 114 ? -12.345 99.901  16.372  1.00 75.09  ? 114 LEU A CG    1 
ATOM   1478 C CD1   . LEU C 2 114 ? -10.918 100.123 16.820  1.00 74.89  ? 114 LEU A CD1   1 
ATOM   1479 C CD2   . LEU C 2 114 ? -13.149 99.217  17.460  1.00 75.15  ? 114 LEU A CD2   1 
ATOM   1480 N N     . LEU C 2 115 ? -13.843 103.829 14.371  1.00 74.95  ? 115 LEU A N     1 
ATOM   1481 C CA    . LEU C 2 115 ? -14.714 104.458 13.391  1.00 74.97  ? 115 LEU A CA    1 
ATOM   1482 C C     . LEU C 2 115 ? -13.860 105.187 12.361  1.00 74.90  ? 115 LEU A C     1 
ATOM   1483 O O     . LEU C 2 115 ? -14.134 105.137 11.165  1.00 74.84  ? 115 LEU A O     1 
ATOM   1484 C CB    . LEU C 2 115 ? -15.674 105.428 14.093  1.00 75.02  ? 115 LEU A CB    1 
ATOM   1485 C CG    . LEU C 2 115 ? -17.153 105.031 14.253  1.00 75.11  ? 115 LEU A CG    1 
ATOM   1486 C CD1   . LEU C 2 115 ? -17.315 103.534 14.460  1.00 75.42  ? 115 LEU A CD1   1 
ATOM   1487 C CD2   . LEU C 2 115 ? -17.739 105.797 15.423  1.00 75.25  ? 115 LEU A CD2   1 
ATOM   1488 N N     . ALA C 2 116 ? -12.811 105.850 12.833  1.00 74.81  ? 116 ALA A N     1 
ATOM   1489 C CA    . ALA C 2 116 ? -11.910 106.584 11.951  1.00 74.70  ? 116 ALA A CA    1 
ATOM   1490 C C     . ALA C 2 116 ? -11.320 105.663 10.886  1.00 74.75  ? 116 ALA A C     1 
ATOM   1491 O O     . ALA C 2 116 ? -11.050 106.090 9.764   1.00 75.48  ? 116 ALA A O     1 
ATOM   1492 C CB    . ALA C 2 116 ? -10.787 107.219 12.760  1.00 74.32  ? 116 ALA A CB    1 
ATOM   1493 N N     . GLN C 2 117 ? -11.112 104.401 11.238  1.00 74.28  ? 117 GLN A N     1 
ATOM   1494 C CA    . GLN C 2 117 ? -10.555 103.445 10.294  1.00 73.61  ? 117 GLN A CA    1 
ATOM   1495 C C     . GLN C 2 117 ? -11.654 102.898 9.402   1.00 72.94  ? 117 GLN A C     1 
ATOM   1496 O O     . GLN C 2 117 ? -11.462 101.922 8.681   1.00 73.29  ? 117 GLN A O     1 
ATOM   1497 C CB    . GLN C 2 117 ? -9.867  102.307 11.040  1.00 74.06  ? 117 GLN A CB    1 
ATOM   1498 C CG    . GLN C 2 117 ? -8.735  102.772 11.938  1.00 75.29  ? 117 GLN A CG    1 
ATOM   1499 C CD    . GLN C 2 117 ? -8.071  101.622 12.673  1.00 76.32  ? 117 GLN A CD    1 
ATOM   1500 O OE1   . GLN C 2 117 ? -7.500  100.717 12.051  1.00 77.13  ? 117 GLN A OE1   1 
ATOM   1501 N NE2   . GLN C 2 117 ? -8.144  101.647 14.004  1.00 76.02  ? 117 GLN A NE2   1 
ATOM   1502 N N     . ARG C 2 118 ? -12.814 103.537 9.464   1.00 71.98  ? 118 ARG A N     1 
ATOM   1503 C CA    . ARG C 2 118 ? -13.956 103.146 8.655   1.00 71.07  ? 118 ARG A CA    1 
ATOM   1504 C C     . ARG C 2 118 ? -14.253 101.649 8.653   1.00 69.95  ? 118 ARG A C     1 
ATOM   1505 O O     . ARG C 2 118 ? -14.310 101.013 7.599   1.00 69.59  ? 118 ARG A O     1 
ATOM   1506 C CB    . ARG C 2 118 ? -13.760 103.656 7.225   1.00 71.62  ? 118 ARG A CB    1 
ATOM   1507 C CG    . ARG C 2 118 ? -13.748 105.183 7.121   1.00 72.51  ? 118 ARG A CG    1 
ATOM   1508 C CD    . ARG C 2 118 ? -15.128 105.764 7.431   1.00 73.41  ? 118 ARG A CD    1 
ATOM   1509 N NE    . ARG C 2 118 ? -15.152 107.228 7.436   1.00 73.91  ? 118 ARG A NE    1 
ATOM   1510 C CZ    . ARG C 2 118 ? -14.547 107.993 8.343   1.00 74.18  ? 118 ARG A CZ    1 
ATOM   1511 N NH1   . ARG C 2 118 ? -13.859 107.442 9.330   1.00 74.44  ? 118 ARG A NH1   1 
ATOM   1512 N NH2   . ARG C 2 118 ? -14.638 109.314 8.273   1.00 74.22  ? 118 ARG A NH2   1 
ATOM   1513 N N     . VAL C 2 119 ? -14.447 101.096 9.844   1.00 68.89  ? 119 VAL A N     1 
ATOM   1514 C CA    . VAL C 2 119 ? -14.770 99.686  9.990   1.00 68.00  ? 119 VAL A CA    1 
ATOM   1515 C C     . VAL C 2 119 ? -16.218 99.499  9.542   1.00 67.08  ? 119 VAL A C     1 
ATOM   1516 O O     . VAL C 2 119 ? -17.008 100.436 9.595   1.00 66.88  ? 119 VAL A O     1 
ATOM   1517 C CB    . VAL C 2 119 ? -14.633 99.243  11.463  1.00 68.23  ? 119 VAL A CB    1 
ATOM   1518 C CG1   . VAL C 2 119 ? -13.204 99.420  11.926  1.00 67.62  ? 119 VAL A CG1   1 
ATOM   1519 C CG2   . VAL C 2 119 ? -15.556 100.073 12.342  1.00 68.22  ? 119 VAL A CG2   1 
ATOM   1520 N N     . SER C 2 120 ? -16.569 98.301  9.099   1.00 66.26  ? 120 SER A N     1 
ATOM   1521 C CA    . SER C 2 120 ? -17.932 98.058  8.657   1.00 65.91  ? 120 SER A CA    1 
ATOM   1522 C C     . SER C 2 120 ? -18.804 97.544  9.800   1.00 65.92  ? 120 SER A C     1 
ATOM   1523 O O     . SER C 2 120 ? -19.989 97.265  9.612   1.00 66.42  ? 120 SER A O     1 
ATOM   1524 C CB    . SER C 2 120 ? -17.945 97.058  7.494   1.00 65.79  ? 120 SER A CB    1 
ATOM   1525 O OG    . SER C 2 120 ? -17.455 95.789  7.881   1.00 65.43  ? 120 SER A OG    1 
ATOM   1526 N N     . GLY C 2 121 ? -18.213 97.431  10.987  1.00 65.46  ? 121 GLY A N     1 
ATOM   1527 C CA    . GLY C 2 121 ? -18.945 96.944  12.149  1.00 64.80  ? 121 GLY A CA    1 
ATOM   1528 C C     . GLY C 2 121 ? -18.069 96.896  13.393  1.00 64.20  ? 121 GLY A C     1 
ATOM   1529 O O     . GLY C 2 121 ? -16.843 96.829  13.286  1.00 64.54  ? 121 GLY A O     1 
ATOM   1530 N N     . LEU C 2 122 ? -18.681 96.938  14.574  1.00 62.83  ? 122 LEU A N     1 
ATOM   1531 C CA    . LEU C 2 122 ? -17.911 96.898  15.810  1.00 61.04  ? 122 LEU A CA    1 
ATOM   1532 C C     . LEU C 2 122 ? -18.319 95.770  16.723  1.00 60.28  ? 122 LEU A C     1 
ATOM   1533 O O     . LEU C 2 122 ? -19.483 95.378  16.756  1.00 60.21  ? 122 LEU A O     1 
ATOM   1534 C CB    . LEU C 2 122 ? -18.060 98.196  16.599  1.00 61.19  ? 122 LEU A CB    1 
ATOM   1535 C CG    . LEU C 2 122 ? -17.467 99.494  16.056  1.00 61.57  ? 122 LEU A CG    1 
ATOM   1536 C CD1   . LEU C 2 122 ? -17.305 100.490 17.193  1.00 61.22  ? 122 LEU A CD1   1 
ATOM   1537 C CD2   . LEU C 2 122 ? -16.117 99.217  15.450  1.00 62.24  ? 122 LEU A CD2   1 
ATOM   1538 N N     . ILE C 2 123 ? -17.338 95.236  17.445  1.00 59.09  ? 123 ILE A N     1 
ATOM   1539 C CA    . ILE C 2 123 ? -17.580 94.198  18.440  1.00 57.63  ? 123 ILE A CA    1 
ATOM   1540 C C     . ILE C 2 123 ? -17.001 94.816  19.693  1.00 57.26  ? 123 ILE A C     1 
ATOM   1541 O O     . ILE C 2 123 ? -15.799 95.078  19.768  1.00 57.28  ? 123 ILE A O     1 
ATOM   1542 C CB    . ILE C 2 123 ? -16.851 92.884  18.140  1.00 56.90  ? 123 ILE A CB    1 
ATOM   1543 C CG1   . ILE C 2 123 ? -17.521 92.175  16.963  1.00 56.52  ? 123 ILE A CG1   1 
ATOM   1544 C CG2   . ILE C 2 123 ? -16.898 91.980  19.366  1.00 55.36  ? 123 ILE A CG2   1 
ATOM   1545 C CD1   . ILE C 2 123 ? -16.901 90.821  16.634  1.00 56.62  ? 123 ILE A CD1   1 
ATOM   1546 N N     . ILE C 2 124 ? -17.867 95.091  20.660  1.00 56.88  ? 124 ILE A N     1 
ATOM   1547 C CA    . ILE C 2 124 ? -17.438 95.716  21.903  1.00 56.53  ? 124 ILE A CA    1 
ATOM   1548 C C     . ILE C 2 124 ? -17.371 94.674  23.011  1.00 56.88  ? 124 ILE A C     1 
ATOM   1549 O O     . ILE C 2 124 ? -18.404 94.188  23.485  1.00 57.40  ? 124 ILE A O     1 
ATOM   1550 C CB    . ILE C 2 124 ? -18.422 96.834  22.341  1.00 55.63  ? 124 ILE A CB    1 
ATOM   1551 C CG1   . ILE C 2 124 ? -18.787 97.715  21.147  1.00 55.12  ? 124 ILE A CG1   1 
ATOM   1552 C CG2   . ILE C 2 124 ? -17.784 97.700  23.432  1.00 55.14  ? 124 ILE A CG2   1 
ATOM   1553 C CD1   . ILE C 2 124 ? -17.709 98.696  20.760  1.00 55.11  ? 124 ILE A CD1   1 
ATOM   1554 N N     . ASN C 2 125 ? -16.154 94.305  23.398  1.00 56.86  ? 125 ASN A N     1 
ATOM   1555 C CA    . ASN C 2 125 ? -15.967 93.351  24.476  1.00 57.29  ? 125 ASN A CA    1 
ATOM   1556 C C     . ASN C 2 125 ? -15.375 94.168  25.610  1.00 57.37  ? 125 ASN A C     1 
ATOM   1557 O O     . ASN C 2 125 ? -14.173 94.101  25.893  1.00 57.97  ? 125 ASN A O     1 
ATOM   1558 C CB    . ASN C 2 125 ? -14.998 92.247  24.075  1.00 57.89  ? 125 ASN A CB    1 
ATOM   1559 C CG    . ASN C 2 125 ? -14.756 91.257  25.198  1.00 59.11  ? 125 ASN A CG    1 
ATOM   1560 O OD1   . ASN C 2 125 ? -13.881 90.402  25.104  1.00 61.03  ? 125 ASN A OD1   1 
ATOM   1561 N ND2   . ASN C 2 125 ? -15.537 91.366  26.268  1.00 59.92  ? 125 ASN A ND2   1 
ATOM   1562 N N     . TYR C 2 126 ? -16.236 94.955  26.240  1.00 57.07  ? 126 TYR A N     1 
ATOM   1563 C CA    . TYR C 2 126 ? -15.837 95.828  27.327  1.00 56.67  ? 126 TYR A CA    1 
ATOM   1564 C C     . TYR C 2 126 ? -17.057 96.016  28.228  1.00 56.22  ? 126 TYR A C     1 
ATOM   1565 O O     . TYR C 2 126 ? -18.156 96.276  27.744  1.00 56.22  ? 126 TYR A O     1 
ATOM   1566 C CB    . TYR C 2 126 ? -15.366 97.153  26.737  1.00 56.68  ? 126 TYR A CB    1 
ATOM   1567 C CG    . TYR C 2 126 ? -14.822 98.116  27.743  1.00 57.71  ? 126 TYR A CG    1 
ATOM   1568 C CD1   . TYR C 2 126 ? -15.669 98.964  28.451  1.00 58.13  ? 126 TYR A CD1   1 
ATOM   1569 C CD2   . TYR C 2 126 ? -13.453 98.186  27.992  1.00 57.85  ? 126 TYR A CD2   1 
ATOM   1570 C CE1   . TYR C 2 126 ? -15.165 99.868  29.389  1.00 59.27  ? 126 TYR A CE1   1 
ATOM   1571 C CE2   . TYR C 2 126 ? -12.935 99.082  28.929  1.00 58.66  ? 126 TYR A CE2   1 
ATOM   1572 C CZ    . TYR C 2 126 ? -13.796 99.922  29.626  1.00 59.42  ? 126 TYR A CZ    1 
ATOM   1573 O OH    . TYR C 2 126 ? -13.299 100.806 30.564  1.00 60.26  ? 126 TYR A OH    1 
ATOM   1574 N N     . PRO C 2 127 ? -16.876 95.882  29.555  1.00 55.78  ? 127 PRO A N     1 
ATOM   1575 C CA    . PRO C 2 127 ? -17.955 96.027  30.545  1.00 54.82  ? 127 PRO A CA    1 
ATOM   1576 C C     . PRO C 2 127 ? -18.671 97.375  30.450  1.00 54.28  ? 127 PRO A C     1 
ATOM   1577 O O     . PRO C 2 127 ? -18.098 98.431  30.733  1.00 53.99  ? 127 PRO A O     1 
ATOM   1578 C CB    . PRO C 2 127 ? -17.223 95.848  31.869  1.00 54.97  ? 127 PRO A CB    1 
ATOM   1579 C CG    . PRO C 2 127 ? -15.874 96.466  31.573  1.00 54.78  ? 127 PRO A CG    1 
ATOM   1580 C CD    . PRO C 2 127 ? -15.558 95.878  30.217  1.00 55.28  ? 127 PRO A CD    1 
ATOM   1581 N N     . LEU C 2 128 ? -19.940 97.332  30.073  1.00 54.19  ? 128 LEU A N     1 
ATOM   1582 C CA    . LEU C 2 128 ? -20.719 98.555  29.910  1.00 53.86  ? 128 LEU A CA    1 
ATOM   1583 C C     . LEU C 2 128 ? -22.089 98.501  30.581  1.00 53.99  ? 128 LEU A C     1 
ATOM   1584 O O     . LEU C 2 128 ? -22.859 97.561  30.357  1.00 54.04  ? 128 LEU A O     1 
ATOM   1585 C CB    . LEU C 2 128 ? -20.904 98.810  28.412  1.00 53.06  ? 128 LEU A CB    1 
ATOM   1586 C CG    . LEU C 2 128 ? -20.203 99.955  27.679  1.00 52.61  ? 128 LEU A CG    1 
ATOM   1587 C CD1   . LEU C 2 128 ? -18.944 100.385 28.367  1.00 52.21  ? 128 LEU A CD1   1 
ATOM   1588 C CD2   . LEU C 2 128 ? -19.931 99.494  26.259  1.00 52.52  ? 128 LEU A CD2   1 
ATOM   1589 N N     . ASP C 2 129 ? -22.396 99.492  31.411  1.00 54.37  ? 129 ASP A N     1 
ATOM   1590 C CA    . ASP C 2 129 ? -23.719 99.552  32.038  1.00 55.00  ? 129 ASP A CA    1 
ATOM   1591 C C     . ASP C 2 129 ? -24.698 99.891  30.903  1.00 54.53  ? 129 ASP A C     1 
ATOM   1592 O O     . ASP C 2 129 ? -24.286 100.413 29.867  1.00 54.44  ? 129 ASP A O     1 
ATOM   1593 C CB    . ASP C 2 129 ? -23.765 100.636 33.126  1.00 55.55  ? 129 ASP A CB    1 
ATOM   1594 C CG    . ASP C 2 129 ? -23.164 100.169 34.455  1.00 57.39  ? 129 ASP A CG    1 
ATOM   1595 O OD1   . ASP C 2 129 ? -23.161 100.974 35.423  1.00 57.66  ? 129 ASP A OD1   1 
ATOM   1596 O OD2   . ASP C 2 129 ? -22.699 99.000  34.538  1.00 58.26  ? 129 ASP A OD2   1 
ATOM   1597 N N     . ASP C 2 130 ? -25.981 99.600  31.095  1.00 54.78  ? 130 ASP A N     1 
ATOM   1598 C CA    . ASP C 2 130 ? -26.999 99.843  30.065  1.00 55.15  ? 130 ASP A CA    1 
ATOM   1599 C C     . ASP C 2 130 ? -26.980 101.167 29.300  1.00 54.82  ? 130 ASP A C     1 
ATOM   1600 O O     . ASP C 2 130 ? -26.938 101.182 28.070  1.00 53.56  ? 130 ASP A O     1 
ATOM   1601 C CB    . ASP C 2 130 ? -28.392 99.640  30.653  1.00 55.73  ? 130 ASP A CB    1 
ATOM   1602 C CG    . ASP C 2 130 ? -28.677 98.194  30.963  1.00 57.23  ? 130 ASP A CG    1 
ATOM   1603 O OD1   . ASP C 2 130 ? -29.834 97.853  31.297  1.00 58.19  ? 130 ASP A OD1   1 
ATOM   1604 O OD2   . ASP C 2 130 ? -27.729 97.384  30.872  1.00 58.65  ? 130 ASP A OD2   1 
ATOM   1605 N N     . GLN C 2 131 ? -27.014 102.286 30.007  1.00 55.27  ? 131 GLN A N     1 
ATOM   1606 C CA    . GLN C 2 131 ? -27.035 103.553 29.297  1.00 56.49  ? 131 GLN A CA    1 
ATOM   1607 C C     . GLN C 2 131 ? -25.731 103.832 28.576  1.00 56.38  ? 131 GLN A C     1 
ATOM   1608 O O     . GLN C 2 131 ? -25.733 104.386 27.478  1.00 56.78  ? 131 GLN A O     1 
ATOM   1609 C CB    . GLN C 2 131 ? -27.445 104.682 30.254  1.00 56.99  ? 131 GLN A CB    1 
ATOM   1610 C CG    . GLN C 2 131 ? -28.891 104.457 30.741  1.00 59.39  ? 131 GLN A CG    1 
ATOM   1611 C CD    . GLN C 2 131 ? -29.434 105.548 31.650  1.00 60.80  ? 131 GLN A CD    1 
ATOM   1612 O OE1   . GLN C 2 131 ? -29.626 106.696 31.225  1.00 61.40  ? 131 GLN A OE1   1 
ATOM   1613 N NE2   . GLN C 2 131 ? -29.693 105.192 32.911  1.00 60.98  ? 131 GLN A NE2   1 
ATOM   1614 N N     . ASP C 2 132 ? -24.618 103.423 29.174  1.00 56.69  ? 132 ASP A N     1 
ATOM   1615 C CA    . ASP C 2 132 ? -23.310 103.612 28.551  1.00 56.25  ? 132 ASP A CA    1 
ATOM   1616 C C     . ASP C 2 132 ? -23.268 102.777 27.263  1.00 55.62  ? 132 ASP A C     1 
ATOM   1617 O O     . ASP C 2 132 ? -22.823 103.242 26.212  1.00 55.37  ? 132 ASP A O     1 
ATOM   1618 C CB    . ASP C 2 132 ? -22.214 103.184 29.530  1.00 56.69  ? 132 ASP A CB    1 
ATOM   1619 C CG    . ASP C 2 132 ? -22.037 104.179 30.675  1.00 58.11  ? 132 ASP A CG    1 
ATOM   1620 O OD1   . ASP C 2 132 ? -21.597 103.768 31.775  1.00 58.84  ? 132 ASP A OD1   1 
ATOM   1621 O OD2   . ASP C 2 132 ? -22.323 105.384 30.473  1.00 58.65  ? 132 ASP A OD2   1 
ATOM   1622 N N     . ALA C 2 133 ? -23.758 101.548 27.343  1.00 54.82  ? 133 ALA A N     1 
ATOM   1623 C CA    . ALA C 2 133 ? -23.779 100.691 26.178  1.00 55.03  ? 133 ALA A CA    1 
ATOM   1624 C C     . ALA C 2 133 ? -24.618 101.349 25.081  1.00 55.94  ? 133 ALA A C     1 
ATOM   1625 O O     . ALA C 2 133 ? -24.202 101.407 23.918  1.00 56.09  ? 133 ALA A O     1 
ATOM   1626 C CB    . ALA C 2 133 ? -24.346 99.337  26.542  1.00 54.02  ? 133 ALA A CB    1 
ATOM   1627 N N     . ILE C 2 134 ? -25.796 101.856 25.458  1.00 56.68  ? 134 ILE A N     1 
ATOM   1628 C CA    . ILE C 2 134 ? -26.695 102.522 24.511  1.00 56.54  ? 134 ILE A CA    1 
ATOM   1629 C C     . ILE C 2 134 ? -26.011 103.755 23.909  1.00 56.72  ? 134 ILE A C     1 
ATOM   1630 O O     . ILE C 2 134 ? -26.160 104.047 22.719  1.00 56.16  ? 134 ILE A O     1 
ATOM   1631 C CB    . ILE C 2 134 ? -28.028 102.929 25.204  1.00 56.60  ? 134 ILE A CB    1 
ATOM   1632 C CG1   . ILE C 2 134 ? -28.832 101.667 25.548  1.00 56.72  ? 134 ILE A CG1   1 
ATOM   1633 C CG2   . ILE C 2 134 ? -28.844 103.837 24.298  1.00 55.72  ? 134 ILE A CG2   1 
ATOM   1634 C CD1   . ILE C 2 134 ? -30.113 101.923 26.316  1.00 56.13  ? 134 ILE A CD1   1 
ATOM   1635 N N     . ALA C 2 135 ? -25.248 104.466 24.732  1.00 57.17  ? 135 ALA A N     1 
ATOM   1636 C CA    . ALA C 2 135 ? -24.527 105.645 24.271  1.00 58.62  ? 135 ALA A CA    1 
ATOM   1637 C C     . ALA C 2 135 ? -23.507 105.227 23.218  1.00 60.22  ? 135 ALA A C     1 
ATOM   1638 O O     . ALA C 2 135 ? -23.461 105.793 22.127  1.00 60.43  ? 135 ALA A O     1 
ATOM   1639 C CB    . ALA C 2 135 ? -23.824 106.320 25.436  1.00 57.75  ? 135 ALA A CB    1 
ATOM   1640 N N     . VAL C 2 136 ? -22.683 104.236 23.554  1.00 61.93  ? 136 VAL A N     1 
ATOM   1641 C CA    . VAL C 2 136 ? -21.671 103.738 22.628  1.00 63.53  ? 136 VAL A CA    1 
ATOM   1642 C C     . VAL C 2 136 ? -22.355 103.308 21.333  1.00 64.62  ? 136 VAL A C     1 
ATOM   1643 O O     . VAL C 2 136 ? -21.985 103.740 20.239  1.00 64.41  ? 136 VAL A O     1 
ATOM   1644 C CB    . VAL C 2 136 ? -20.901 102.533 23.238  1.00 63.72  ? 136 VAL A CB    1 
ATOM   1645 C CG1   . VAL C 2 136 ? -20.086 101.822 22.161  1.00 62.92  ? 136 VAL A CG1   1 
ATOM   1646 C CG2   . VAL C 2 136 ? -19.982 103.022 24.361  1.00 62.91  ? 136 VAL A CG2   1 
ATOM   1647 N N     . GLU C 2 137 ? -23.357 102.453 21.473  1.00 65.98  ? 137 GLU A N     1 
ATOM   1648 C CA    . GLU C 2 137 ? -24.119 101.975 20.334  1.00 67.95  ? 137 GLU A CA    1 
ATOM   1649 C C     . GLU C 2 137 ? -24.548 103.151 19.452  1.00 68.77  ? 137 GLU A C     1 
ATOM   1650 O O     . GLU C 2 137 ? -24.531 103.065 18.226  1.00 68.88  ? 137 GLU A O     1 
ATOM   1651 C CB    . GLU C 2 137 ? -25.343 101.222 20.844  1.00 69.11  ? 137 GLU A CB    1 
ATOM   1652 C CG    . GLU C 2 137 ? -26.563 101.340 19.961  1.00 71.39  ? 137 GLU A CG    1 
ATOM   1653 C CD    . GLU C 2 137 ? -26.414 100.570 18.682  1.00 72.68  ? 137 GLU A CD    1 
ATOM   1654 O OE1   . GLU C 2 137 ? -26.330 99.316  18.751  1.00 73.96  ? 137 GLU A OE1   1 
ATOM   1655 O OE2   . GLU C 2 137 ? -26.376 101.220 17.613  1.00 73.30  ? 137 GLU A OE2   1 
ATOM   1656 N N     . ALA C 2 138 ? -24.928 104.255 20.083  1.00 69.86  ? 138 ALA A N     1 
ATOM   1657 C CA    . ALA C 2 138 ? -25.365 105.429 19.344  1.00 71.02  ? 138 ALA A CA    1 
ATOM   1658 C C     . ALA C 2 138 ? -24.208 106.081 18.597  1.00 72.12  ? 138 ALA A C     1 
ATOM   1659 O O     . ALA C 2 138 ? -24.372 106.529 17.463  1.00 72.55  ? 138 ALA A O     1 
ATOM   1660 C CB    . ALA C 2 138 ? -26.008 106.436 20.291  1.00 70.21  ? 138 ALA A CB    1 
ATOM   1661 N N     . ALA C 2 139 ? -23.037 106.127 19.226  1.00 73.36  ? 139 ALA A N     1 
ATOM   1662 C CA    . ALA C 2 139 ? -21.862 106.750 18.614  1.00 74.63  ? 139 ALA A CA    1 
ATOM   1663 C C     . ALA C 2 139 ? -21.401 106.029 17.341  1.00 75.75  ? 139 ALA A C     1 
ATOM   1664 O O     . ALA C 2 139 ? -20.749 106.622 16.476  1.00 75.76  ? 139 ALA A O     1 
ATOM   1665 C CB    . ALA C 2 139 ? -20.720 106.808 19.626  1.00 74.12  ? 139 ALA A CB    1 
ATOM   1666 N N     . CYS C 2 140 ? -21.745 104.749 17.232  1.00 76.78  ? 140 CYS A N     1 
ATOM   1667 C CA    . CYS C 2 140 ? -21.369 103.954 16.071  1.00 77.90  ? 140 CYS A CA    1 
ATOM   1668 C C     . CYS C 2 140 ? -22.123 104.417 14.840  1.00 78.31  ? 140 CYS A C     1 
ATOM   1669 O O     . CYS C 2 140 ? -23.013 103.722 14.336  1.00 78.58  ? 140 CYS A O     1 
ATOM   1670 C CB    . CYS C 2 140 ? -21.653 102.477 16.334  1.00 78.36  ? 140 CYS A CB    1 
ATOM   1671 S SG    . CYS C 2 140 ? -20.666 101.808 17.687  1.00 80.40  ? 140 CYS A SG    1 
ATOM   1672 N N     . THR C 2 141 ? -21.738 105.593 14.358  1.00 78.70  ? 141 THR A N     1 
ATOM   1673 C CA    . THR C 2 141 ? -22.349 106.224 13.194  1.00 79.27  ? 141 THR A CA    1 
ATOM   1674 C C     . THR C 2 141 ? -22.663 105.282 12.025  1.00 78.90  ? 141 THR A C     1 
ATOM   1675 O O     . THR C 2 141 ? -21.774 104.943 11.243  1.00 78.97  ? 141 THR A O     1 
ATOM   1676 C CB    . THR C 2 141 ? -21.451 107.360 12.657  1.00 79.76  ? 141 THR A CB    1 
ATOM   1677 O OG1   . THR C 2 141 ? -20.927 108.125 13.754  1.00 80.33  ? 141 THR A OG1   1 
ATOM   1678 C CG2   . THR C 2 141 ? -22.255 108.279 11.745  1.00 79.77  ? 141 THR A CG2   1 
ATOM   1679 N N     . ASN C 2 142 ? -23.926 104.860 11.922  1.00 78.20  ? 142 ASN A N     1 
ATOM   1680 C CA    . ASN C 2 142 ? -24.388 103.999 10.830  1.00 77.09  ? 142 ASN A CA    1 
ATOM   1681 C C     . ASN C 2 142 ? -23.926 102.536 10.831  1.00 75.37  ? 142 ASN A C     1 
ATOM   1682 O O     . ASN C 2 142 ? -24.566 101.681 10.207  1.00 75.53  ? 142 ASN A O     1 
ATOM   1683 C CB    . ASN C 2 142 ? -24.013 104.646 9.485   1.00 78.89  ? 142 ASN A CB    1 
ATOM   1684 C CG    . ASN C 2 142 ? -24.808 104.076 8.310   1.00 80.64  ? 142 ASN A CG    1 
ATOM   1685 O OD1   . ASN C 2 142 ? -24.680 102.894 7.969   1.00 81.62  ? 142 ASN A OD1   1 
ATOM   1686 N ND2   . ASN C 2 142 ? -25.637 104.919 7.687   1.00 81.10  ? 142 ASN A ND2   1 
ATOM   1687 N N     . VAL C 2 143 ? -22.831 102.238 11.524  1.00 72.73  ? 143 VAL A N     1 
ATOM   1688 C CA    . VAL C 2 143 ? -22.318 100.866 11.558  1.00 69.71  ? 143 VAL A CA    1 
ATOM   1689 C C     . VAL C 2 143 ? -22.859 100.043 12.714  1.00 67.21  ? 143 VAL A C     1 
ATOM   1690 O O     . VAL C 2 143 ? -22.991 100.544 13.831  1.00 67.28  ? 143 VAL A O     1 
ATOM   1691 C CB    . VAL C 2 143 ? -20.778 100.845 11.632  1.00 70.18  ? 143 VAL A CB    1 
ATOM   1692 C CG1   . VAL C 2 143 ? -20.191 101.360 10.327  1.00 69.83  ? 143 VAL A CG1   1 
ATOM   1693 C CG2   . VAL C 2 143 ? -20.302 101.711 12.793  1.00 70.13  ? 143 VAL A CG2   1 
ATOM   1694 N N     . PRO C 2 144 ? -23.175 98.757  12.458  1.00 64.86  ? 144 PRO A N     1 
ATOM   1695 C CA    . PRO C 2 144 ? -23.705 97.851  13.483  1.00 62.91  ? 144 PRO A CA    1 
ATOM   1696 C C     . PRO C 2 144 ? -22.705 97.566  14.613  1.00 61.73  ? 144 PRO A C     1 
ATOM   1697 O O     . PRO C 2 144 ? -21.486 97.542  14.399  1.00 61.79  ? 144 PRO A O     1 
ATOM   1698 C CB    . PRO C 2 144 ? -24.072 96.596  12.682  1.00 62.47  ? 144 PRO A CB    1 
ATOM   1699 C CG    . PRO C 2 144 ? -23.101 96.613  11.555  1.00 62.91  ? 144 PRO A CG    1 
ATOM   1700 C CD    . PRO C 2 144 ? -23.061 98.070  11.159  1.00 63.70  ? 144 PRO A CD    1 
ATOM   1701 N N     . ALA C 2 145 ? -23.230 97.371  15.820  1.00 59.77  ? 145 ALA A N     1 
ATOM   1702 C CA    . ALA C 2 145 ? -22.402 97.084  16.981  1.00 57.15  ? 145 ALA A CA    1 
ATOM   1703 C C     . ALA C 2 145 ? -22.940 95.848  17.688  1.00 55.79  ? 145 ALA A C     1 
ATOM   1704 O O     . ALA C 2 145 ? -24.153 95.659  17.787  1.00 56.13  ? 145 ALA A O     1 
ATOM   1705 C CB    . ALA C 2 145 ? -22.397 98.274  17.924  1.00 57.06  ? 145 ALA A CB    1 
ATOM   1706 N N     . LEU C 2 146 ? -22.032 94.996  18.160  1.00 53.94  ? 146 LEU A N     1 
ATOM   1707 C CA    . LEU C 2 146 ? -22.402 93.774  18.862  1.00 51.64  ? 146 LEU A CA    1 
ATOM   1708 C C     . LEU C 2 146 ? -21.664 93.846  20.183  1.00 50.82  ? 146 LEU A C     1 
ATOM   1709 O O     . LEU C 2 146 ? -20.470 94.150  20.206  1.00 51.72  ? 146 LEU A O     1 
ATOM   1710 C CB    . LEU C 2 146 ? -21.956 92.556  18.066  1.00 50.70  ? 146 LEU A CB    1 
ATOM   1711 C CG    . LEU C 2 146 ? -22.397 91.206  18.616  1.00 51.05  ? 146 LEU A CG    1 
ATOM   1712 C CD1   . LEU C 2 146 ? -23.895 91.211  18.845  1.00 50.50  ? 146 LEU A CD1   1 
ATOM   1713 C CD2   . LEU C 2 146 ? -22.012 90.105  17.631  1.00 50.25  ? 146 LEU A CD2   1 
ATOM   1714 N N     . PHE C 2 147 ? -22.370 93.590  21.283  1.00 49.10  ? 147 PHE A N     1 
ATOM   1715 C CA    . PHE C 2 147 ? -21.763 93.671  22.611  1.00 47.00  ? 147 PHE A CA    1 
ATOM   1716 C C     . PHE C 2 147 ? -21.588 92.311  23.266  1.00 47.57  ? 147 PHE A C     1 
ATOM   1717 O O     . PHE C 2 147 ? -22.439 91.430  23.130  1.00 47.85  ? 147 PHE A O     1 
ATOM   1718 C CB    . PHE C 2 147 ? -22.593 94.595  23.516  1.00 44.05  ? 147 PHE A CB    1 
ATOM   1719 C CG    . PHE C 2 147 ? -22.623 96.031  23.051  1.00 40.69  ? 147 PHE A CG    1 
ATOM   1720 C CD1   . PHE C 2 147 ? -23.351 96.397  21.913  1.00 39.40  ? 147 PHE A CD1   1 
ATOM   1721 C CD2   . PHE C 2 147 ? -21.887 97.013  23.724  1.00 38.65  ? 147 PHE A CD2   1 
ATOM   1722 C CE1   . PHE C 2 147 ? -23.336 97.729  21.451  1.00 37.95  ? 147 PHE A CE1   1 
ATOM   1723 C CE2   . PHE C 2 147 ? -21.865 98.346  23.275  1.00 37.36  ? 147 PHE A CE2   1 
ATOM   1724 C CZ    . PHE C 2 147 ? -22.588 98.704  22.135  1.00 36.63  ? 147 PHE A CZ    1 
ATOM   1725 N N     . LEU C 2 148 ? -20.474 92.142  23.980  1.00 48.25  ? 148 LEU A N     1 
ATOM   1726 C CA    . LEU C 2 148 ? -20.178 90.869  24.644  1.00 48.69  ? 148 LEU A CA    1 
ATOM   1727 C C     . LEU C 2 148 ? -20.059 90.983  26.160  1.00 48.98  ? 148 LEU A C     1 
ATOM   1728 O O     . LEU C 2 148 ? -19.955 89.967  26.847  1.00 49.33  ? 148 LEU A O     1 
ATOM   1729 C CB    . LEU C 2 148 ? -18.882 90.265  24.085  1.00 48.56  ? 148 LEU A CB    1 
ATOM   1730 C CG    . LEU C 2 148 ? -18.774 90.118  22.565  1.00 48.32  ? 148 LEU A CG    1 
ATOM   1731 C CD1   . LEU C 2 148 ? -17.507 89.330  22.230  1.00 48.44  ? 148 LEU A CD1   1 
ATOM   1732 C CD2   . LEU C 2 148 ? -20.012 89.400  22.025  1.00 47.69  ? 148 LEU A CD2   1 
ATOM   1733 N N     . ASP C 2 149 ? -20.051 92.207  26.683  1.00 49.41  ? 149 ASP A N     1 
ATOM   1734 C CA    . ASP C 2 149 ? -19.968 92.391  28.129  1.00 49.68  ? 149 ASP A CA    1 
ATOM   1735 C C     . ASP C 2 149 ? -21.039 93.367  28.648  1.00 49.24  ? 149 ASP A C     1 
ATOM   1736 O O     . ASP C 2 149 ? -20.736 94.421  29.246  1.00 48.42  ? 149 ASP A O     1 
ATOM   1737 C CB    . ASP C 2 149 ? -18.575 92.868  28.541  1.00 51.69  ? 149 ASP A CB    1 
ATOM   1738 C CG    . ASP C 2 149 ? -18.312 92.676  30.038  1.00 54.47  ? 149 ASP A CG    1 
ATOM   1739 O OD1   . ASP C 2 149 ? -19.184 92.091  30.733  1.00 55.80  ? 149 ASP A OD1   1 
ATOM   1740 O OD2   . ASP C 2 149 ? -17.232 93.100  30.524  1.00 56.12  ? 149 ASP A OD2   1 
ATOM   1741 N N     . VAL C 2 150 ? -22.294 93.003  28.389  1.00 47.84  ? 150 VAL A N     1 
ATOM   1742 C CA    . VAL C 2 150 ? -23.440 93.769  28.832  1.00 47.84  ? 150 VAL A CA    1 
ATOM   1743 C C     . VAL C 2 150 ? -24.431 92.766  29.393  1.00 48.42  ? 150 VAL A C     1 
ATOM   1744 O O     . VAL C 2 150 ? -24.258 91.557  29.241  1.00 48.78  ? 150 VAL A O     1 
ATOM   1745 C CB    . VAL C 2 150 ? -24.131 94.523  27.674  1.00 47.09  ? 150 VAL A CB    1 
ATOM   1746 C CG1   . VAL C 2 150 ? -23.218 95.615  27.134  1.00 46.32  ? 150 VAL A CG1   1 
ATOM   1747 C CG2   . VAL C 2 150 ? -24.521 93.547  26.583  1.00 46.82  ? 150 VAL A CG2   1 
ATOM   1748 N N     . SER C 2 151 ? -25.465 93.268  30.051  1.00 48.73  ? 151 SER A N     1 
ATOM   1749 C CA    . SER C 2 151 ? -26.488 92.405  30.610  1.00 49.34  ? 151 SER A CA    1 
ATOM   1750 C C     . SER C 2 151 ? -27.369 91.902  29.480  1.00 49.55  ? 151 SER A C     1 
ATOM   1751 O O     . SER C 2 151 ? -27.439 92.523  28.417  1.00 49.28  ? 151 SER A O     1 
ATOM   1752 C CB    . SER C 2 151 ? -27.368 93.185  31.594  1.00 49.54  ? 151 SER A CB    1 
ATOM   1753 O OG    . SER C 2 151 ? -28.540 92.443  31.910  1.00 49.45  ? 151 SER A OG    1 
ATOM   1754 N N     . ASP C 2 152 ? -28.040 90.780  29.713  1.00 49.99  ? 152 ASP A N     1 
ATOM   1755 C CA    . ASP C 2 152 ? -28.957 90.229  28.727  1.00 51.47  ? 152 ASP A CA    1 
ATOM   1756 C C     . ASP C 2 152 ? -30.152 91.174  28.629  1.00 52.19  ? 152 ASP A C     1 
ATOM   1757 O O     . ASP C 2 152 ? -30.932 91.107  27.677  1.00 52.99  ? 152 ASP A O     1 
ATOM   1758 C CB    . ASP C 2 152 ? -29.440 88.847  29.160  1.00 52.29  ? 152 ASP A CB    1 
ATOM   1759 C CG    . ASP C 2 152 ? -29.744 88.777  30.651  1.00 55.00  ? 152 ASP A CG    1 
ATOM   1760 O OD1   . ASP C 2 152 ? -30.303 87.744  31.108  1.00 56.44  ? 152 ASP A OD1   1 
ATOM   1761 O OD2   . ASP C 2 152 ? -29.417 89.751  31.378  1.00 56.26  ? 152 ASP A OD2   1 
ATOM   1762 N N     . GLN C 2 153 ? -30.285 92.060  29.619  1.00 52.05  ? 153 GLN A N     1 
ATOM   1763 C CA    . GLN C 2 153 ? -31.383 93.023  29.669  1.00 51.18  ? 153 GLN A CA    1 
ATOM   1764 C C     . GLN C 2 153 ? -31.073 94.328  28.949  1.00 51.48  ? 153 GLN A C     1 
ATOM   1765 O O     . GLN C 2 153 ? -31.900 95.228  28.925  1.00 52.78  ? 153 GLN A O     1 
ATOM   1766 C CB    . GLN C 2 153 ? -31.724 93.363  31.121  1.00 50.96  ? 153 GLN A CB    1 
ATOM   1767 C CG    . GLN C 2 153 ? -32.258 92.224  31.965  1.00 50.35  ? 153 GLN A CG    1 
ATOM   1768 C CD    . GLN C 2 153 ? -32.176 92.550  33.444  1.00 50.47  ? 153 GLN A CD    1 
ATOM   1769 O OE1   . GLN C 2 153 ? -32.676 91.802  34.286  1.00 50.84  ? 153 GLN A OE1   1 
ATOM   1770 N NE2   . GLN C 2 153 ? -31.532 93.673  33.770  1.00 49.34  ? 153 GLN A NE2   1 
ATOM   1771 N N     . THR C 2 154 ? -29.883 94.466  28.389  1.00 51.16  ? 154 THR A N     1 
ATOM   1772 C CA    . THR C 2 154 ? -29.558 95.707  27.707  1.00 50.34  ? 154 THR A CA    1 
ATOM   1773 C C     . THR C 2 154 ? -30.237 95.707  26.338  1.00 50.71  ? 154 THR A C     1 
ATOM   1774 O O     . THR C 2 154 ? -30.243 94.700  25.631  1.00 51.09  ? 154 THR A O     1 
ATOM   1775 C CB    . THR C 2 154 ? -28.053 95.857  27.582  1.00 49.73  ? 154 THR A CB    1 
ATOM   1776 O OG1   . THR C 2 154 ? -27.464 95.560  28.854  1.00 50.24  ? 154 THR A OG1   1 
ATOM   1777 C CG2   . THR C 2 154 ? -27.681 97.278  27.179  1.00 49.12  ? 154 THR A CG2   1 
ATOM   1778 N N     . PRO C 2 155 ? -30.842 96.839  25.952  1.00 50.96  ? 155 PRO A N     1 
ATOM   1779 C CA    . PRO C 2 155 ? -31.520 96.893  24.651  1.00 50.65  ? 155 PRO A CA    1 
ATOM   1780 C C     . PRO C 2 155 ? -30.584 97.161  23.481  1.00 50.49  ? 155 PRO A C     1 
ATOM   1781 O O     . PRO C 2 155 ? -30.610 98.250  22.900  1.00 50.95  ? 155 PRO A O     1 
ATOM   1782 C CB    . PRO C 2 155 ? -32.529 98.017  24.849  1.00 50.45  ? 155 PRO A CB    1 
ATOM   1783 C CG    . PRO C 2 155 ? -31.721 99.002  25.687  1.00 50.67  ? 155 PRO A CG    1 
ATOM   1784 C CD    . PRO C 2 155 ? -31.038 98.093  26.712  1.00 50.70  ? 155 PRO A CD    1 
ATOM   1785 N N     . ILE C 2 156 ? -29.760 96.171  23.140  1.00 49.68  ? 156 ILE A N     1 
ATOM   1786 C CA    . ILE C 2 156 ? -28.816 96.279  22.023  1.00 47.82  ? 156 ILE A CA    1 
ATOM   1787 C C     . ILE C 2 156 ? -28.445 94.886  21.557  1.00 47.30  ? 156 ILE A C     1 
ATOM   1788 O O     . ILE C 2 156 ? -28.844 93.896  22.174  1.00 47.20  ? 156 ILE A O     1 
ATOM   1789 C CB    . ILE C 2 156 ? -27.520 96.968  22.431  1.00 47.96  ? 156 ILE A CB    1 
ATOM   1790 C CG1   . ILE C 2 156 ? -27.005 96.342  23.736  1.00 48.12  ? 156 ILE A CG1   1 
ATOM   1791 C CG2   . ILE C 2 156 ? -27.726 98.467  22.509  1.00 47.81  ? 156 ILE A CG2   1 
ATOM   1792 C CD1   . ILE C 2 156 ? -25.753 96.994  24.270  1.00 48.37  ? 156 ILE A CD1   1 
ATOM   1793 N N     . ASN C 2 157 ? -27.690 94.806  20.463  1.00 47.17  ? 157 ASN A N     1 
ATOM   1794 C CA    . ASN C 2 157 ? -27.253 93.511  19.946  1.00 46.62  ? 157 ASN A CA    1 
ATOM   1795 C C     . ASN C 2 157 ? -26.146 93.000  20.859  1.00 45.70  ? 157 ASN A C     1 
ATOM   1796 O O     . ASN C 2 157 ? -25.188 93.728  21.170  1.00 45.14  ? 157 ASN A O     1 
ATOM   1797 C CB    . ASN C 2 157 ? -26.738 93.660  18.527  1.00 48.00  ? 157 ASN A CB    1 
ATOM   1798 C CG    . ASN C 2 157 ? -27.800 94.159  17.598  1.00 49.32  ? 157 ASN A CG    1 
ATOM   1799 O OD1   . ASN C 2 157 ? -28.942 93.662  17.624  1.00 51.14  ? 157 ASN A OD1   1 
ATOM   1800 N ND2   . ASN C 2 157 ? -27.453 95.143  16.768  1.00 48.40  ? 157 ASN A ND2   1 
ATOM   1801 N N     . SER C 2 158 ? -26.282 91.758  21.301  1.00 44.45  ? 158 SER A N     1 
ATOM   1802 C CA    . SER C 2 158 ? -25.297 91.206  22.206  1.00 44.49  ? 158 SER A CA    1 
ATOM   1803 C C     . SER C 2 158 ? -25.258 89.688  22.185  1.00 45.05  ? 158 SER A C     1 
ATOM   1804 O O     . SER C 2 158 ? -26.217 89.018  21.763  1.00 44.81  ? 158 SER A O     1 
ATOM   1805 C CB    . SER C 2 158 ? -25.601 91.666  23.639  1.00 44.72  ? 158 SER A CB    1 
ATOM   1806 O OG    . SER C 2 158 ? -26.768 91.017  24.142  1.00 44.13  ? 158 SER A OG    1 
ATOM   1807 N N     . ILE C 2 159 ? -24.129 89.153  22.636  1.00 44.82  ? 159 ILE A N     1 
ATOM   1808 C CA    . ILE C 2 159 ? -23.970 87.713  22.738  1.00 45.40  ? 159 ILE A CA    1 
ATOM   1809 C C     . ILE C 2 159 ? -23.238 87.502  24.043  1.00 45.39  ? 159 ILE A C     1 
ATOM   1810 O O     . ILE C 2 159 ? -22.195 88.126  24.280  1.00 46.30  ? 159 ILE A O     1 
ATOM   1811 C CB    . ILE C 2 159 ? -23.111 87.104  21.616  1.00 45.31  ? 159 ILE A CB    1 
ATOM   1812 C CG1   . ILE C 2 159 ? -23.627 87.544  20.249  1.00 46.63  ? 159 ILE A CG1   1 
ATOM   1813 C CG2   . ILE C 2 159 ? -23.182 85.576  21.702  1.00 45.06  ? 159 ILE A CG2   1 
ATOM   1814 C CD1   . ILE C 2 159 ? -23.018 86.764  19.087  1.00 46.82  ? 159 ILE A CD1   1 
ATOM   1815 N N     . ILE C 2 160 ? -23.801 86.656  24.901  1.00 44.42  ? 160 ILE A N     1 
ATOM   1816 C CA    . ILE C 2 160 ? -23.176 86.359  26.173  1.00 44.20  ? 160 ILE A CA    1 
ATOM   1817 C C     . ILE C 2 160 ? -23.465 84.928  26.574  1.00 44.53  ? 160 ILE A C     1 
ATOM   1818 O O     . ILE C 2 160 ? -24.388 84.301  26.055  1.00 44.53  ? 160 ILE A O     1 
ATOM   1819 C CB    . ILE C 2 160 ? -23.678 87.281  27.289  1.00 43.55  ? 160 ILE A CB    1 
ATOM   1820 C CG1   . ILE C 2 160 ? -25.155 87.013  27.555  1.00 43.52  ? 160 ILE A CG1   1 
ATOM   1821 C CG2   . ILE C 2 160 ? -23.425 88.736  26.917  1.00 42.39  ? 160 ILE A CG2   1 
ATOM   1822 C CD1   . ILE C 2 160 ? -25.717 87.872  28.665  1.00 43.76  ? 160 ILE A CD1   1 
ATOM   1823 N N     . PHE C 2 161 ? -22.657 84.391  27.476  1.00 45.31  ? 161 PHE A N     1 
ATOM   1824 C CA    . PHE C 2 161 ? -22.911 83.036  27.912  1.00 46.60  ? 161 PHE A CA    1 
ATOM   1825 C C     . PHE C 2 161 ? -24.089 83.096  28.869  1.00 47.29  ? 161 PHE A C     1 
ATOM   1826 O O     . PHE C 2 161 ? -24.311 84.107  29.542  1.00 48.39  ? 161 PHE A O     1 
ATOM   1827 C CB    . PHE C 2 161 ? -21.672 82.438  28.593  1.00 46.85  ? 161 PHE A CB    1 
ATOM   1828 C CG    . PHE C 2 161 ? -20.600 82.016  27.622  1.00 47.19  ? 161 PHE A CG    1 
ATOM   1829 C CD1   . PHE C 2 161 ? -19.451 82.781  27.454  1.00 46.82  ? 161 PHE A CD1   1 
ATOM   1830 C CD2   . PHE C 2 161 ? -20.779 80.884  26.820  1.00 47.18  ? 161 PHE A CD2   1 
ATOM   1831 C CE1   . PHE C 2 161 ? -18.491 82.433  26.499  1.00 47.40  ? 161 PHE A CE1   1 
ATOM   1832 C CE2   . PHE C 2 161 ? -19.827 80.527  25.862  1.00 47.04  ? 161 PHE A CE2   1 
ATOM   1833 C CZ    . PHE C 2 161 ? -18.681 81.307  25.699  1.00 47.03  ? 161 PHE A CZ    1 
ATOM   1834 N N     . SER C 2 162 ? -24.862 82.026  28.916  1.00 47.79  ? 162 SER A N     1 
ATOM   1835 C CA    . SER C 2 162 ? -26.014 81.991  29.796  1.00 48.38  ? 162 SER A CA    1 
ATOM   1836 C C     . SER C 2 162 ? -25.600 81.893  31.260  1.00 48.75  ? 162 SER A C     1 
ATOM   1837 O O     . SER C 2 162 ? -25.420 80.796  31.793  1.00 48.86  ? 162 SER A O     1 
ATOM   1838 C CB    . SER C 2 162 ? -26.910 80.805  29.439  1.00 48.29  ? 162 SER A CB    1 
ATOM   1839 O OG    . SER C 2 162 ? -27.888 80.613  30.444  1.00 49.27  ? 162 SER A OG    1 
ATOM   1840 N N     . HIS C 2 163 ? -25.454 83.038  31.913  1.00 49.51  ? 163 HIS A N     1 
ATOM   1841 C CA    . HIS C 2 163 ? -25.075 83.051  33.319  1.00 51.42  ? 163 HIS A CA    1 
ATOM   1842 C C     . HIS C 2 163 ? -26.152 82.348  34.119  1.00 52.02  ? 163 HIS A C     1 
ATOM   1843 O O     . HIS C 2 163 ? -25.887 81.736  35.160  1.00 51.73  ? 163 HIS A O     1 
ATOM   1844 C CB    . HIS C 2 163 ? -24.921 84.484  33.805  1.00 52.77  ? 163 HIS A CB    1 
ATOM   1845 C CG    . HIS C 2 163 ? -26.085 85.357  33.467  1.00 55.61  ? 163 HIS A CG    1 
ATOM   1846 N ND1   . HIS C 2 163 ? -27.093 85.635  34.366  1.00 56.80  ? 163 HIS A ND1   1 
ATOM   1847 C CD2   . HIS C 2 163 ? -26.411 86.002  32.320  1.00 56.35  ? 163 HIS A CD2   1 
ATOM   1848 C CE1   . HIS C 2 163 ? -27.989 86.416  33.788  1.00 57.29  ? 163 HIS A CE1   1 
ATOM   1849 N NE2   . HIS C 2 163 ? -27.599 86.653  32.546  1.00 57.55  ? 163 HIS A NE2   1 
ATOM   1850 N N     . GLU C 2 164 ? -27.376 82.439  33.617  1.00 52.89  ? 164 GLU A N     1 
ATOM   1851 C CA    . GLU C 2 164 ? -28.511 81.810  34.273  1.00 53.87  ? 164 GLU A CA    1 
ATOM   1852 C C     . GLU C 2 164 ? -28.206 80.319  34.400  1.00 53.26  ? 164 GLU A C     1 
ATOM   1853 O O     . GLU C 2 164 ? -28.329 79.735  35.478  1.00 52.89  ? 164 GLU A O     1 
ATOM   1854 C CB    . GLU C 2 164 ? -29.775 82.007  33.426  1.00 55.93  ? 164 GLU A CB    1 
ATOM   1855 C CG    . GLU C 2 164 ? -31.061 82.092  34.228  1.00 59.05  ? 164 GLU A CG    1 
ATOM   1856 C CD    . GLU C 2 164 ? -31.262 83.461  34.872  1.00 60.91  ? 164 GLU A CD    1 
ATOM   1857 O OE1   . GLU C 2 164 ? -31.997 83.537  35.886  1.00 62.16  ? 164 GLU A OE1   1 
ATOM   1858 O OE2   . GLU C 2 164 ? -30.697 84.458  34.359  1.00 61.53  ? 164 GLU A OE2   1 
ATOM   1859 N N     . ASP C 2 165 ? -27.799 79.713  33.285  1.00 52.75  ? 165 ASP A N     1 
ATOM   1860 C CA    . ASP C 2 165 ? -27.472 78.292  33.257  1.00 52.09  ? 165 ASP A CA    1 
ATOM   1861 C C     . ASP C 2 165 ? -26.219 77.949  34.069  1.00 51.40  ? 165 ASP A C     1 
ATOM   1862 O O     . ASP C 2 165 ? -26.168 76.923  34.759  1.00 51.40  ? 165 ASP A O     1 
ATOM   1863 C CB    . ASP C 2 165 ? -27.289 77.835  31.813  1.00 52.97  ? 165 ASP A CB    1 
ATOM   1864 C CG    . ASP C 2 165 ? -28.612 77.715  31.064  1.00 54.96  ? 165 ASP A CG    1 
ATOM   1865 O OD1   . ASP C 2 165 ? -29.499 76.952  31.527  1.00 56.74  ? 165 ASP A OD1   1 
ATOM   1866 O OD2   . ASP C 2 165 ? -28.774 78.369  30.007  1.00 55.80  ? 165 ASP A OD2   1 
ATOM   1867 N N     . GLY C 2 166 ? -25.214 78.813  33.999  1.00 50.45  ? 166 GLY A N     1 
ATOM   1868 C CA    . GLY C 2 166 ? -23.981 78.553  34.720  1.00 49.61  ? 166 GLY A CA    1 
ATOM   1869 C C     . GLY C 2 166 ? -24.161 78.510  36.221  1.00 49.07  ? 166 GLY A C     1 
ATOM   1870 O O     . GLY C 2 166 ? -23.788 77.536  36.884  1.00 49.37  ? 166 GLY A O     1 
ATOM   1871 N N     . THR C 2 167 ? -24.739 79.577  36.763  1.00 48.56  ? 167 THR A N     1 
ATOM   1872 C CA    . THR C 2 167 ? -24.963 79.687  38.198  1.00 47.99  ? 167 THR A CA    1 
ATOM   1873 C C     . THR C 2 167 ? -25.938 78.628  38.709  1.00 48.38  ? 167 THR A C     1 
ATOM   1874 O O     . THR C 2 167 ? -25.800 78.130  39.830  1.00 48.38  ? 167 THR A O     1 
ATOM   1875 C CB    . THR C 2 167 ? -25.509 81.060  38.539  1.00 47.76  ? 167 THR A CB    1 
ATOM   1876 O OG1   . THR C 2 167 ? -26.640 81.324  37.699  1.00 47.17  ? 167 THR A OG1   1 
ATOM   1877 C CG2   . THR C 2 167 ? -24.439 82.135  38.312  1.00 47.06  ? 167 THR A CG2   1 
ATOM   1878 N N     . ARG C 2 168 ? -26.924 78.271  37.895  1.00 48.77  ? 168 ARG A N     1 
ATOM   1879 C CA    . ARG C 2 168 ? -27.869 77.255  38.335  1.00 49.63  ? 168 ARG A CA    1 
ATOM   1880 C C     . ARG C 2 168 ? -27.120 75.928  38.458  1.00 49.43  ? 168 ARG A C     1 
ATOM   1881 O O     . ARG C 2 168 ? -27.187 75.247  39.495  1.00 49.46  ? 168 ARG A O     1 
ATOM   1882 C CB    . ARG C 2 168 ? -29.011 77.104  37.336  1.00 50.76  ? 168 ARG A CB    1 
ATOM   1883 C CG    . ARG C 2 168 ? -30.098 76.139  37.811  1.00 52.40  ? 168 ARG A CG    1 
ATOM   1884 C CD    . ARG C 2 168 ? -30.874 75.648  36.623  1.00 54.32  ? 168 ARG A CD    1 
ATOM   1885 N NE    . ARG C 2 168 ? -29.971 74.932  35.721  1.00 58.58  ? 168 ARG A NE    1 
ATOM   1886 C CZ    . ARG C 2 168 ? -30.205 74.739  34.422  1.00 60.38  ? 168 ARG A CZ    1 
ATOM   1887 N NH1   . ARG C 2 168 ? -31.330 75.222  33.884  1.00 62.11  ? 168 ARG A NH1   1 
ATOM   1888 N NH2   . ARG C 2 168 ? -29.322 74.076  33.661  1.00 59.76  ? 168 ARG A NH2   1 
ATOM   1889 N N     . LEU C 2 169 ? -26.404 75.572  37.388  1.00 49.06  ? 169 LEU A N     1 
ATOM   1890 C CA    . LEU C 2 169 ? -25.611 74.340  37.343  1.00 47.85  ? 169 LEU A CA    1 
ATOM   1891 C C     . LEU C 2 169 ? -24.734 74.276  38.592  1.00 48.05  ? 169 LEU A C     1 
ATOM   1892 O O     . LEU C 2 169 ? -24.697 73.265  39.303  1.00 48.03  ? 169 LEU A O     1 
ATOM   1893 C CB    . LEU C 2 169 ? -24.737 74.353  36.093  1.00 47.70  ? 169 LEU A CB    1 
ATOM   1894 C CG    . LEU C 2 169 ? -24.990 73.377  34.930  1.00 47.44  ? 169 LEU A CG    1 
ATOM   1895 C CD1   . LEU C 2 169 ? -26.417 72.888  34.900  1.00 46.98  ? 169 LEU A CD1   1 
ATOM   1896 C CD2   . LEU C 2 169 ? -24.638 74.088  33.626  1.00 46.99  ? 169 LEU A CD2   1 
ATOM   1897 N N     . GLY C 2 170 ? -24.045 75.375  38.873  1.00 47.46  ? 170 GLY A N     1 
ATOM   1898 C CA    . GLY C 2 170 ? -23.195 75.397  40.044  1.00 48.16  ? 170 GLY A CA    1 
ATOM   1899 C C     . GLY C 2 170 ? -23.975 75.155  41.321  1.00 48.96  ? 170 GLY A C     1 
ATOM   1900 O O     . GLY C 2 170 ? -23.691 74.219  42.072  1.00 49.78  ? 170 GLY A O     1 
ATOM   1901 N N     . VAL C 2 171 ? -24.975 75.998  41.570  1.00 49.75  ? 171 VAL A N     1 
ATOM   1902 C CA    . VAL C 2 171 ? -25.788 75.879  42.781  1.00 49.39  ? 171 VAL A CA    1 
ATOM   1903 C C     . VAL C 2 171 ? -26.448 74.508  42.906  1.00 49.32  ? 171 VAL A C     1 
ATOM   1904 O O     . VAL C 2 171 ? -26.344 73.850  43.940  1.00 48.63  ? 171 VAL A O     1 
ATOM   1905 C CB    . VAL C 2 171 ? -26.881 76.978  42.828  1.00 49.82  ? 171 VAL A CB    1 
ATOM   1906 C CG1   . VAL C 2 171 ? -27.850 76.720  43.993  1.00 49.50  ? 171 VAL A CG1   1 
ATOM   1907 C CG2   . VAL C 2 171 ? -26.222 78.352  42.994  1.00 49.49  ? 171 VAL A CG2   1 
ATOM   1908 N N     . GLU C 2 172 ? -27.117 74.064  41.851  1.00 50.05  ? 172 GLU A N     1 
ATOM   1909 C CA    . GLU C 2 172 ? -27.790 72.779  41.924  1.00 51.30  ? 172 GLU A CA    1 
ATOM   1910 C C     . GLU C 2 172 ? -26.817 71.643  42.232  1.00 52.21  ? 172 GLU A C     1 
ATOM   1911 O O     . GLU C 2 172 ? -27.161 70.692  42.953  1.00 52.48  ? 172 GLU A O     1 
ATOM   1912 C CB    . GLU C 2 172 ? -28.570 72.524  40.637  1.00 51.80  ? 172 GLU A CB    1 
ATOM   1913 C CG    . GLU C 2 172 ? -29.786 73.447  40.534  1.00 54.04  ? 172 GLU A CG    1 
ATOM   1914 C CD    . GLU C 2 172 ? -30.682 73.171  39.330  1.00 56.17  ? 172 GLU A CD    1 
ATOM   1915 O OE1   . GLU C 2 172 ? -31.751 73.819  39.229  1.00 58.24  ? 172 GLU A OE1   1 
ATOM   1916 O OE2   . GLU C 2 172 ? -30.336 72.320  38.479  1.00 56.74  ? 172 GLU A OE2   1 
ATOM   1917 N N     . HIS C 2 173 ? -25.590 71.759  41.714  1.00 52.62  ? 173 HIS A N     1 
ATOM   1918 C CA    . HIS C 2 173 ? -24.564 70.747  41.949  1.00 51.49  ? 173 HIS A CA    1 
ATOM   1919 C C     . HIS C 2 173 ? -24.203 70.727  43.438  1.00 51.24  ? 173 HIS A C     1 
ATOM   1920 O O     . HIS C 2 173 ? -24.189 69.675  44.084  1.00 51.51  ? 173 HIS A O     1 
ATOM   1921 C CB    . HIS C 2 173 ? -23.328 71.063  41.108  1.00 51.75  ? 173 HIS A CB    1 
ATOM   1922 C CG    . HIS C 2 173 ? -22.237 70.042  41.225  1.00 51.63  ? 173 HIS A CG    1 
ATOM   1923 N ND1   . HIS C 2 173 ? -22.363 68.759  40.725  1.00 51.52  ? 173 HIS A ND1   1 
ATOM   1924 C CD2   . HIS C 2 173 ? -21.014 70.107  41.808  1.00 50.78  ? 173 HIS A CD2   1 
ATOM   1925 C CE1   . HIS C 2 173 ? -21.261 68.078  41.001  1.00 51.71  ? 173 HIS A CE1   1 
ATOM   1926 N NE2   . HIS C 2 173 ? -20.429 68.872  41.656  1.00 51.89  ? 173 HIS A NE2   1 
ATOM   1927 N N     . LEU C 2 174 ? -23.918 71.894  43.995  1.00 50.82  ? 174 LEU A N     1 
ATOM   1928 C CA    . LEU C 2 174 ? -23.574 71.937  45.410  1.00 51.57  ? 174 LEU A CA    1 
ATOM   1929 C C     . LEU C 2 174 ? -24.737 71.434  46.271  1.00 52.34  ? 174 LEU A C     1 
ATOM   1930 O O     . LEU C 2 174 ? -24.533 70.729  47.265  1.00 52.91  ? 174 LEU A O     1 
ATOM   1931 C CB    . LEU C 2 174 ? -23.189 73.363  45.822  1.00 50.39  ? 174 LEU A CB    1 
ATOM   1932 C CG    . LEU C 2 174 ? -21.841 73.846  45.274  1.00 50.44  ? 174 LEU A CG    1 
ATOM   1933 C CD1   . LEU C 2 174 ? -21.484 75.202  45.864  1.00 50.51  ? 174 LEU A CD1   1 
ATOM   1934 C CD2   . LEU C 2 174 ? -20.760 72.838  45.646  1.00 49.70  ? 174 LEU A CD2   1 
ATOM   1935 N N     . VAL C 2 175 ? -25.960 71.794  45.880  1.00 52.87  ? 175 VAL A N     1 
ATOM   1936 C CA    . VAL C 2 175 ? -27.146 71.387  46.623  1.00 52.68  ? 175 VAL A CA    1 
ATOM   1937 C C     . VAL C 2 175 ? -27.310 69.869  46.584  1.00 52.77  ? 175 VAL A C     1 
ATOM   1938 O O     . VAL C 2 175 ? -27.471 69.234  47.633  1.00 52.23  ? 175 VAL A O     1 
ATOM   1939 C CB    . VAL C 2 175 ? -28.417 72.075  46.058  1.00 52.87  ? 175 VAL A CB    1 
ATOM   1940 C CG1   . VAL C 2 175 ? -29.676 71.389  46.593  1.00 51.77  ? 175 VAL A CG1   1 
ATOM   1941 C CG2   . VAL C 2 175 ? -28.416 73.560  46.458  1.00 52.05  ? 175 VAL A CG2   1 
ATOM   1942 N N     . ALA C 2 176 ? -27.253 69.292  45.383  1.00 52.52  ? 176 ALA A N     1 
ATOM   1943 C CA    . ALA C 2 176 ? -27.396 67.843  45.239  1.00 52.40  ? 176 ALA A CA    1 
ATOM   1944 C C     . ALA C 2 176 ? -26.351 67.106  46.087  1.00 53.19  ? 176 ALA A C     1 
ATOM   1945 O O     . ALA C 2 176 ? -26.550 65.954  46.480  1.00 53.60  ? 176 ALA A O     1 
ATOM   1946 C CB    . ALA C 2 176 ? -27.269 67.448  43.778  1.00 50.72  ? 176 ALA A CB    1 
ATOM   1947 N N     . LEU C 2 177 ? -25.233 67.773  46.367  1.00 53.77  ? 177 LEU A N     1 
ATOM   1948 C CA    . LEU C 2 177 ? -24.183 67.172  47.182  1.00 54.15  ? 177 LEU A CA    1 
ATOM   1949 C C     . LEU C 2 177 ? -24.514 67.387  48.648  1.00 54.39  ? 177 LEU A C     1 
ATOM   1950 O O     . LEU C 2 177 ? -23.785 66.948  49.531  1.00 54.46  ? 177 LEU A O     1 
ATOM   1951 C CB    . LEU C 2 177 ? -22.820 67.808  46.858  1.00 54.21  ? 177 LEU A CB    1 
ATOM   1952 C CG    . LEU C 2 177 ? -21.866 67.048  45.921  1.00 54.43  ? 177 LEU A CG    1 
ATOM   1953 C CD1   . LEU C 2 177 ? -22.605 65.923  45.190  1.00 53.54  ? 177 LEU A CD1   1 
ATOM   1954 C CD2   . LEU C 2 177 ? -21.247 68.033  44.918  1.00 54.16  ? 177 LEU A CD2   1 
ATOM   1955 N N     . GLY C 2 178 ? -25.607 68.095  48.903  1.00 55.09  ? 178 GLY A N     1 
ATOM   1956 C CA    . GLY C 2 178 ? -26.020 68.343  50.272  1.00 55.60  ? 178 GLY A CA    1 
ATOM   1957 C C     . GLY C 2 178 ? -25.377 69.523  50.979  1.00 56.47  ? 178 GLY A C     1 
ATOM   1958 O O     . GLY C 2 178 ? -25.360 69.575  52.209  1.00 56.91  ? 178 GLY A O     1 
ATOM   1959 N N     . HIS C 2 179 ? -24.848 70.483  50.234  1.00 57.04  ? 179 HIS A N     1 
ATOM   1960 C CA    . HIS C 2 179 ? -24.235 71.636  50.886  1.00 58.31  ? 179 HIS A CA    1 
ATOM   1961 C C     . HIS C 2 179 ? -25.290 72.675  51.279  1.00 59.08  ? 179 HIS A C     1 
ATOM   1962 O O     . HIS C 2 179 ? -26.273 72.878  50.561  1.00 59.39  ? 179 HIS A O     1 
ATOM   1963 C CB    . HIS C 2 179 ? -23.198 72.278  49.954  1.00 58.53  ? 179 HIS A CB    1 
ATOM   1964 C CG    . HIS C 2 179 ? -21.968 71.447  49.754  1.00 58.68  ? 179 HIS A CG    1 
ATOM   1965 N ND1   . HIS C 2 179 ? -20.922 71.431  50.657  1.00 57.91  ? 179 HIS A ND1   1 
ATOM   1966 C CD2   . HIS C 2 179 ? -21.620 70.598  48.753  1.00 58.04  ? 179 HIS A CD2   1 
ATOM   1967 C CE1   . HIS C 2 179 ? -19.983 70.611  50.216  1.00 58.17  ? 179 HIS A CE1   1 
ATOM   1968 N NE2   . HIS C 2 179 ? -20.382 70.093  49.066  1.00 58.04  ? 179 HIS A NE2   1 
ATOM   1969 N N     . GLN C 2 180 ? -25.088 73.327  52.421  1.00 59.79  ? 180 GLN A N     1 
ATOM   1970 C CA    . GLN C 2 180 ? -26.024 74.349  52.869  1.00 60.80  ? 180 GLN A CA    1 
ATOM   1971 C C     . GLN C 2 180 ? -25.262 75.576  53.307  1.00 60.72  ? 180 GLN A C     1 
ATOM   1972 O O     . GLN C 2 180 ? -25.769 76.694  53.202  1.00 61.13  ? 180 GLN A O     1 
ATOM   1973 C CB    . GLN C 2 180 ? -26.879 73.829  54.017  1.00 62.57  ? 180 GLN A CB    1 
ATOM   1974 C CG    . GLN C 2 180 ? -27.701 72.612  53.631  1.00 65.13  ? 180 GLN A CG    1 
ATOM   1975 C CD    . GLN C 2 180 ? -28.612 72.165  54.752  1.00 67.12  ? 180 GLN A CD    1 
ATOM   1976 O OE1   . GLN C 2 180 ? -28.152 71.862  55.863  1.00 67.63  ? 180 GLN A OE1   1 
ATOM   1977 N NE2   . GLN C 2 180 ? -29.916 72.124  54.472  1.00 67.96  ? 180 GLN A NE2   1 
ATOM   1978 N N     . GLN C 2 181 ? -24.048 75.363  53.811  1.00 60.23  ? 181 GLN A N     1 
ATOM   1979 C CA    . GLN C 2 181 ? -23.183 76.468  54.228  1.00 59.97  ? 181 GLN A CA    1 
ATOM   1980 C C     . GLN C 2 181 ? -22.319 76.820  53.002  1.00 59.16  ? 181 GLN A C     1 
ATOM   1981 O O     . GLN C 2 181 ? -21.244 76.235  52.797  1.00 59.88  ? 181 GLN A O     1 
ATOM   1982 C CB    . GLN C 2 181 ? -22.295 76.023  55.387  1.00 61.11  ? 181 GLN A CB    1 
ATOM   1983 C CG    . GLN C 2 181 ? -23.065 75.673  56.632  1.00 63.47  ? 181 GLN A CG    1 
ATOM   1984 C CD    . GLN C 2 181 ? -23.818 76.875  57.177  1.00 65.56  ? 181 GLN A CD    1 
ATOM   1985 O OE1   . GLN C 2 181 ? -23.218 77.797  57.750  1.00 66.15  ? 181 GLN A OE1   1 
ATOM   1986 N NE2   . GLN C 2 181 ? -25.140 76.883  56.984  1.00 66.38  ? 181 GLN A NE2   1 
ATOM   1987 N N     . ILE C 2 182 ? -22.793 77.770  52.195  1.00 56.99  ? 182 ILE A N     1 
ATOM   1988 C CA    . ILE C 2 182 ? -22.115 78.173  50.966  1.00 54.31  ? 182 ILE A CA    1 
ATOM   1989 C C     . ILE C 2 182 ? -21.635 79.620  50.960  1.00 53.66  ? 182 ILE A C     1 
ATOM   1990 O O     . ILE C 2 182 ? -22.377 80.518  51.333  1.00 54.48  ? 182 ILE A O     1 
ATOM   1991 C CB    . ILE C 2 182 ? -23.056 77.970  49.786  1.00 53.43  ? 182 ILE A CB    1 
ATOM   1992 C CG1   . ILE C 2 182 ? -23.528 76.515  49.771  1.00 53.41  ? 182 ILE A CG1   1 
ATOM   1993 C CG2   . ILE C 2 182 ? -22.373 78.368  48.495  1.00 53.63  ? 182 ILE A CG2   1 
ATOM   1994 C CD1   . ILE C 2 182 ? -24.470 76.180  48.632  1.00 52.83  ? 182 ILE A CD1   1 
ATOM   1995 N N     . ALA C 2 183 ? -20.390 79.847  50.546  1.00 52.70  ? 183 ALA A N     1 
ATOM   1996 C CA    . ALA C 2 183 ? -19.837 81.201  50.481  1.00 51.20  ? 183 ALA A CA    1 
ATOM   1997 C C     . ALA C 2 183 ? -19.740 81.563  49.007  1.00 50.67  ? 183 ALA A C     1 
ATOM   1998 O O     . ALA C 2 183 ? -19.693 80.674  48.149  1.00 50.67  ? 183 ALA A O     1 
ATOM   1999 C CB    . ALA C 2 183 ? -18.461 81.252  51.135  1.00 50.48  ? 183 ALA A CB    1 
ATOM   2000 N N     . LEU C 2 184 ? -19.729 82.860  48.705  1.00 50.19  ? 184 LEU A N     1 
ATOM   2001 C CA    . LEU C 2 184 ? -19.653 83.312  47.314  1.00 49.33  ? 184 LEU A CA    1 
ATOM   2002 C C     . LEU C 2 184 ? -18.490 84.266  47.123  1.00 49.03  ? 184 LEU A C     1 
ATOM   2003 O O     . LEU C 2 184 ? -18.339 85.240  47.869  1.00 48.77  ? 184 LEU A O     1 
ATOM   2004 C CB    . LEU C 2 184 ? -20.937 84.030  46.897  1.00 49.15  ? 184 LEU A CB    1 
ATOM   2005 C CG    . LEU C 2 184 ? -22.299 83.353  47.078  1.00 48.78  ? 184 LEU A CG    1 
ATOM   2006 C CD1   . LEU C 2 184 ? -23.363 84.302  46.524  1.00 48.75  ? 184 LEU A CD1   1 
ATOM   2007 C CD2   . LEU C 2 184 ? -22.349 82.027  46.357  1.00 48.17  ? 184 LEU A CD2   1 
ATOM   2008 N N     . LEU C 2 185 ? -17.665 83.975  46.122  1.00 48.65  ? 185 LEU A N     1 
ATOM   2009 C CA    . LEU C 2 185 ? -16.517 84.815  45.803  1.00 47.95  ? 185 LEU A CA    1 
ATOM   2010 C C     . LEU C 2 185 ? -16.793 85.316  44.398  1.00 47.80  ? 185 LEU A C     1 
ATOM   2011 O O     . LEU C 2 185 ? -16.722 84.554  43.424  1.00 48.91  ? 185 LEU A O     1 
ATOM   2012 C CB    . LEU C 2 185 ? -15.243 83.978  45.847  1.00 48.43  ? 185 LEU A CB    1 
ATOM   2013 C CG    . LEU C 2 185 ? -13.914 84.673  45.554  1.00 49.15  ? 185 LEU A CG    1 
ATOM   2014 C CD1   . LEU C 2 185 ? -13.810 86.006  46.308  1.00 48.52  ? 185 LEU A CD1   1 
ATOM   2015 C CD2   . LEU C 2 185 ? -12.779 83.724  45.948  1.00 48.68  ? 185 LEU A CD2   1 
ATOM   2016 N N     . ALA C 2 186 ? -17.126 86.592  44.286  1.00 46.59  ? 186 ALA A N     1 
ATOM   2017 C CA    . ALA C 2 186 ? -17.459 87.154  42.988  1.00 45.69  ? 186 ALA A CA    1 
ATOM   2018 C C     . ALA C 2 186 ? -16.355 87.960  42.336  1.00 44.99  ? 186 ALA A C     1 
ATOM   2019 O O     . ALA C 2 186 ? -15.400 88.401  42.994  1.00 44.24  ? 186 ALA A O     1 
ATOM   2020 C CB    . ALA C 2 186 ? -18.717 88.024  43.112  1.00 46.13  ? 186 ALA A CB    1 
ATOM   2021 N N     . GLY C 2 187 ? -16.519 88.170  41.032  1.00 44.65  ? 187 GLY A N     1 
ATOM   2022 C CA    . GLY C 2 187 ? -15.560 88.949  40.278  1.00 44.82  ? 187 GLY A CA    1 
ATOM   2023 C C     . GLY C 2 187 ? -15.720 90.398  40.679  1.00 45.38  ? 187 GLY A C     1 
ATOM   2024 O O     . GLY C 2 187 ? -16.585 90.717  41.490  1.00 45.37  ? 187 GLY A O     1 
ATOM   2025 N N     . PRO C 2 188 ? -14.902 91.310  40.138  1.00 46.06  ? 188 PRO A N     1 
ATOM   2026 C CA    . PRO C 2 188 ? -15.045 92.721  40.514  1.00 46.00  ? 188 PRO A CA    1 
ATOM   2027 C C     . PRO C 2 188 ? -16.429 93.246  40.093  1.00 46.92  ? 188 PRO A C     1 
ATOM   2028 O O     . PRO C 2 188 ? -16.899 92.993  38.975  1.00 46.24  ? 188 PRO A O     1 
ATOM   2029 C CB    . PRO C 2 188 ? -13.893 93.384  39.767  1.00 45.55  ? 188 PRO A CB    1 
ATOM   2030 C CG    . PRO C 2 188 ? -13.786 92.540  38.527  1.00 45.53  ? 188 PRO A CG    1 
ATOM   2031 C CD    . PRO C 2 188 ? -13.904 91.140  39.066  1.00 45.51  ? 188 PRO A CD    1 
ATOM   2032 N N     . LEU C 2 189 ? -17.091 93.961  40.999  1.00 48.11  ? 189 LEU A N     1 
ATOM   2033 C CA    . LEU C 2 189 ? -18.420 94.497  40.713  1.00 48.84  ? 189 LEU A CA    1 
ATOM   2034 C C     . LEU C 2 189 ? -18.467 95.462  39.523  1.00 48.73  ? 189 LEU A C     1 
ATOM   2035 O O     . LEU C 2 189 ? -19.526 95.664  38.924  1.00 48.88  ? 189 LEU A O     1 
ATOM   2036 C CB    . LEU C 2 189 ? -18.982 95.163  41.966  1.00 50.14  ? 189 LEU A CB    1 
ATOM   2037 C CG    . LEU C 2 189 ? -19.949 94.324  42.823  1.00 51.39  ? 189 LEU A CG    1 
ATOM   2038 C CD1   . LEU C 2 189 ? -19.778 92.816  42.574  1.00 51.02  ? 189 LEU A CD1   1 
ATOM   2039 C CD2   . LEU C 2 189 ? -19.718 94.687  44.284  1.00 50.57  ? 189 LEU A CD2   1 
ATOM   2040 N N     . SER C 2 190 ? -17.324 96.040  39.167  1.00 48.25  ? 190 SER A N     1 
ATOM   2041 C CA    . SER C 2 190 ? -17.277 96.939  38.025  1.00 48.10  ? 190 SER A CA    1 
ATOM   2042 C C     . SER C 2 190 ? -17.470 96.138  36.738  1.00 48.14  ? 190 SER A C     1 
ATOM   2043 O O     . SER C 2 190 ? -17.562 96.716  35.655  1.00 49.11  ? 190 SER A O     1 
ATOM   2044 C CB    . SER C 2 190 ? -15.934 97.643  37.964  1.00 48.19  ? 190 SER A CB    1 
ATOM   2045 O OG    . SER C 2 190 ? -14.909 96.689  37.779  1.00 50.47  ? 190 SER A OG    1 
ATOM   2046 N N     . SER C 2 191 ? -17.525 94.812  36.855  1.00 47.04  ? 191 SER A N     1 
ATOM   2047 C CA    . SER C 2 191 ? -17.712 93.945  35.691  1.00 46.62  ? 191 SER A CA    1 
ATOM   2048 C C     . SER C 2 191 ? -19.158 93.464  35.543  1.00 46.49  ? 191 SER A C     1 
ATOM   2049 O O     . SER C 2 191 ? -19.722 92.846  36.448  1.00 46.38  ? 191 SER A O     1 
ATOM   2050 C CB    . SER C 2 191 ? -16.784 92.720  35.783  1.00 46.86  ? 191 SER A CB    1 
ATOM   2051 O OG    . SER C 2 191 ? -17.157 91.715  34.847  1.00 46.95  ? 191 SER A OG    1 
ATOM   2052 N N     . VAL C 2 192 ? -19.753 93.721  34.387  1.00 45.80  ? 192 VAL A N     1 
ATOM   2053 C CA    . VAL C 2 192 ? -21.126 93.303  34.167  1.00 45.56  ? 192 VAL A CA    1 
ATOM   2054 C C     . VAL C 2 192 ? -21.244 91.792  34.306  1.00 46.27  ? 192 VAL A C     1 
ATOM   2055 O O     . VAL C 2 192 ? -22.137 91.265  34.995  1.00 47.16  ? 192 VAL A O     1 
ATOM   2056 C CB    . VAL C 2 192 ? -21.606 93.721  32.769  1.00 45.16  ? 192 VAL A CB    1 
ATOM   2057 C CG1   . VAL C 2 192 ? -23.019 93.200  32.519  1.00 44.00  ? 192 VAL A CG1   1 
ATOM   2058 C CG2   . VAL C 2 192 ? -21.554 95.239  32.646  1.00 43.54  ? 192 VAL A CG2   1 
ATOM   2059 N N     . SER C 2 193 ? -20.339 91.089  33.646  1.00 46.26  ? 193 SER A N     1 
ATOM   2060 C CA    . SER C 2 193 ? -20.351 89.637  33.699  1.00 46.27  ? 193 SER A CA    1 
ATOM   2061 C C     . SER C 2 193 ? -20.263 89.138  35.149  1.00 45.57  ? 193 SER A C     1 
ATOM   2062 O O     . SER C 2 193 ? -20.949 88.186  35.537  1.00 44.99  ? 193 SER A O     1 
ATOM   2063 C CB    . SER C 2 193 ? -19.181 89.090  32.884  1.00 47.30  ? 193 SER A CB    1 
ATOM   2064 O OG    . SER C 2 193 ? -19.361 87.706  32.647  1.00 49.56  ? 193 SER A OG    1 
ATOM   2065 N N     . ALA C 2 194 ? -19.414 89.782  35.946  1.00 44.88  ? 194 ALA A N     1 
ATOM   2066 C CA    . ALA C 2 194 ? -19.269 89.375  37.336  1.00 45.08  ? 194 ALA A CA    1 
ATOM   2067 C C     . ALA C 2 194 ? -20.625 89.525  38.029  1.00 45.72  ? 194 ALA A C     1 
ATOM   2068 O O     . ALA C 2 194 ? -21.112 88.572  38.671  1.00 45.88  ? 194 ALA A O     1 
ATOM   2069 C CB    . ALA C 2 194 ? -18.211 90.226  38.040  1.00 44.15  ? 194 ALA A CB    1 
ATOM   2070 N N     . ARG C 2 195 ? -21.238 90.707  37.866  1.00 45.14  ? 195 ARG A N     1 
ATOM   2071 C CA    . ARG C 2 195 ? -22.532 90.997  38.478  1.00 44.26  ? 195 ARG A CA    1 
ATOM   2072 C C     . ARG C 2 195 ? -23.583 90.006  38.027  1.00 44.35  ? 195 ARG A C     1 
ATOM   2073 O O     . ARG C 2 195 ? -24.375 89.527  38.846  1.00 44.49  ? 195 ARG A O     1 
ATOM   2074 C CB    . ARG C 2 195 ? -22.986 92.426  38.163  1.00 43.83  ? 195 ARG A CB    1 
ATOM   2075 C CG    . ARG C 2 195 ? -22.036 93.493  38.717  1.00 44.17  ? 195 ARG A CG    1 
ATOM   2076 C CD    . ARG C 2 195 ? -22.653 94.861  38.658  1.00 42.58  ? 195 ARG A CD    1 
ATOM   2077 N NE    . ARG C 2 195 ? -23.132 95.202  37.324  1.00 42.51  ? 195 ARG A NE    1 
ATOM   2078 C CZ    . ARG C 2 195 ? -22.483 95.995  36.479  1.00 43.23  ? 195 ARG A CZ    1 
ATOM   2079 N NH1   . ARG C 2 195 ? -21.312 96.529  36.833  1.00 43.82  ? 195 ARG A NH1   1 
ATOM   2080 N NH2   . ARG C 2 195 ? -23.016 96.278  35.293  1.00 42.48  ? 195 ARG A NH2   1 
ATOM   2081 N N     . LEU C 2 196 ? -23.595 89.676  36.739  1.00 43.76  ? 196 LEU A N     1 
ATOM   2082 C CA    . LEU C 2 196 ? -24.578 88.715  36.269  1.00 44.97  ? 196 LEU A CA    1 
ATOM   2083 C C     . LEU C 2 196 ? -24.424 87.385  37.002  1.00 45.78  ? 196 LEU A C     1 
ATOM   2084 O O     . LEU C 2 196 ? -25.414 86.759  37.381  1.00 46.07  ? 196 LEU A O     1 
ATOM   2085 C CB    . LEU C 2 196 ? -24.434 88.478  34.767  1.00 45.42  ? 196 LEU A CB    1 
ATOM   2086 C CG    . LEU C 2 196 ? -24.691 89.684  33.874  1.00 46.07  ? 196 LEU A CG    1 
ATOM   2087 C CD1   . LEU C 2 196 ? -24.390 89.297  32.427  1.00 45.76  ? 196 LEU A CD1   1 
ATOM   2088 C CD2   . LEU C 2 196 ? -26.152 90.129  34.023  1.00 45.71  ? 196 LEU A CD2   1 
ATOM   2089 N N     . ARG C 2 197 ? -23.184 86.942  37.201  1.00 46.49  ? 197 ARG A N     1 
ATOM   2090 C CA    . ARG C 2 197 ? -22.974 85.674  37.887  1.00 46.71  ? 197 ARG A CA    1 
ATOM   2091 C C     . ARG C 2 197 ? -23.403 85.790  39.343  1.00 45.99  ? 197 ARG A C     1 
ATOM   2092 O O     . ARG C 2 197 ? -24.023 84.879  39.888  1.00 46.03  ? 197 ARG A O     1 
ATOM   2093 C CB    . ARG C 2 197 ? -21.499 85.245  37.792  1.00 47.68  ? 197 ARG A CB    1 
ATOM   2094 C CG    . ARG C 2 197 ? -21.061 84.898  36.370  1.00 49.26  ? 197 ARG A CG    1 
ATOM   2095 C CD    . ARG C 2 197 ? -19.555 84.658  36.245  1.00 49.46  ? 197 ARG A CD    1 
ATOM   2096 N NE    . ARG C 2 197 ? -19.151 84.858  34.856  1.00 51.23  ? 197 ARG A NE    1 
ATOM   2097 C CZ    . ARG C 2 197 ? -17.894 84.885  34.418  1.00 51.53  ? 197 ARG A CZ    1 
ATOM   2098 N NH1   . ARG C 2 197 ? -16.885 84.713  35.265  1.00 51.65  ? 197 ARG A NH1   1 
ATOM   2099 N NH2   . ARG C 2 197 ? -17.651 85.112  33.127  1.00 51.19  ? 197 ARG A NH2   1 
ATOM   2100 N N     . LEU C 2 198 ? -23.074 86.913  39.972  1.00 45.48  ? 198 LEU A N     1 
ATOM   2101 C CA    . LEU C 2 198 ? -23.436 87.108  41.373  1.00 45.28  ? 198 LEU A CA    1 
ATOM   2102 C C     . LEU C 2 198 ? -24.956 86.949  41.488  1.00 45.97  ? 198 LEU A C     1 
ATOM   2103 O O     . LEU C 2 198 ? -25.459 86.164  42.303  1.00 46.19  ? 198 LEU A O     1 
ATOM   2104 C CB    . LEU C 2 198 ? -23.029 88.505  41.842  1.00 43.34  ? 198 LEU A CB    1 
ATOM   2105 C CG    . LEU C 2 198 ? -22.497 88.559  43.274  1.00 43.37  ? 198 LEU A CG    1 
ATOM   2106 C CD1   . LEU C 2 198 ? -22.449 90.009  43.759  1.00 41.50  ? 198 LEU A CD1   1 
ATOM   2107 C CD2   . LEU C 2 198 ? -23.371 87.703  44.176  1.00 42.56  ? 198 LEU A CD2   1 
ATOM   2108 N N     . ALA C 2 199 ? -25.673 87.686  40.641  1.00 45.97  ? 199 ALA A N     1 
ATOM   2109 C CA    . ALA C 2 199 ? -27.122 87.650  40.624  1.00 46.07  ? 199 ALA A CA    1 
ATOM   2110 C C     . ALA C 2 199 ? -27.601 86.223  40.413  1.00 46.83  ? 199 ALA A C     1 
ATOM   2111 O O     . ALA C 2 199 ? -28.482 85.739  41.128  1.00 48.03  ? 199 ALA A O     1 
ATOM   2112 C CB    . ALA C 2 199 ? -27.648 88.542  39.520  1.00 45.61  ? 199 ALA A CB    1 
ATOM   2113 N N     . GLY C 2 200 ? -27.014 85.539  39.436  1.00 46.96  ? 200 GLY A N     1 
ATOM   2114 C CA    . GLY C 2 200 ? -27.422 84.173  39.160  1.00 46.17  ? 200 GLY A CA    1 
ATOM   2115 C C     . GLY C 2 200 ? -27.343 83.275  40.380  1.00 46.51  ? 200 GLY A C     1 
ATOM   2116 O O     . GLY C 2 200 ? -28.241 82.458  40.625  1.00 46.27  ? 200 GLY A O     1 
ATOM   2117 N N     . TRP C 2 201 ? -26.271 83.418  41.156  1.00 46.35  ? 201 TRP A N     1 
ATOM   2118 C CA    . TRP C 2 201 ? -26.110 82.579  42.335  1.00 46.74  ? 201 TRP A CA    1 
ATOM   2119 C C     . TRP C 2 201 ? -27.185 82.905  43.348  1.00 47.12  ? 201 TRP A C     1 
ATOM   2120 O O     . TRP C 2 201 ? -27.810 81.998  43.910  1.00 48.23  ? 201 TRP A O     1 
ATOM   2121 C CB    . TRP C 2 201 ? -24.739 82.769  42.999  1.00 46.33  ? 201 TRP A CB    1 
ATOM   2122 C CG    . TRP C 2 201 ? -23.573 82.250  42.219  1.00 46.36  ? 201 TRP A CG    1 
ATOM   2123 C CD1   . TRP C 2 201 ? -23.542 81.145  41.416  1.00 46.23  ? 201 TRP A CD1   1 
ATOM   2124 C CD2   . TRP C 2 201 ? -22.248 82.791  42.208  1.00 46.13  ? 201 TRP A CD2   1 
ATOM   2125 N NE1   . TRP C 2 201 ? -22.278 80.966  40.906  1.00 45.86  ? 201 TRP A NE1   1 
ATOM   2126 C CE2   . TRP C 2 201 ? -21.464 81.963  41.377  1.00 45.92  ? 201 TRP A CE2   1 
ATOM   2127 C CE3   . TRP C 2 201 ? -21.643 83.899  42.822  1.00 46.12  ? 201 TRP A CE3   1 
ATOM   2128 C CZ2   . TRP C 2 201 ? -20.103 82.205  41.144  1.00 45.53  ? 201 TRP A CZ2   1 
ATOM   2129 C CZ3   . TRP C 2 201 ? -20.276 84.139  42.587  1.00 46.21  ? 201 TRP A CZ3   1 
ATOM   2130 C CH2   . TRP C 2 201 ? -19.530 83.292  41.754  1.00 44.85  ? 201 TRP A CH2   1 
ATOM   2131 N N     . HIS C 2 202 ? -27.395 84.198  43.597  1.00 46.83  ? 202 HIS A N     1 
ATOM   2132 C CA    . HIS C 2 202 ? -28.405 84.601  44.571  1.00 46.33  ? 202 HIS A CA    1 
ATOM   2133 C C     . HIS C 2 202 ? -29.754 84.062  44.120  1.00 46.94  ? 202 HIS A C     1 
ATOM   2134 O O     . HIS C 2 202 ? -30.477 83.423  44.897  1.00 46.91  ? 202 HIS A O     1 
ATOM   2135 C CB    . HIS C 2 202 ? -28.419 86.114  44.716  1.00 44.47  ? 202 HIS A CB    1 
ATOM   2136 C CG    . HIS C 2 202 ? -27.346 86.629  45.627  1.00 44.03  ? 202 HIS A CG    1 
ATOM   2137 N ND1   . HIS C 2 202 ? -26.622 87.775  45.363  1.00 44.55  ? 202 HIS A ND1   1 
ATOM   2138 C CD2   . HIS C 2 202 ? -26.881 86.158  46.808  1.00 43.95  ? 202 HIS A CD2   1 
ATOM   2139 C CE1   . HIS C 2 202 ? -25.759 87.987  46.343  1.00 44.25  ? 202 HIS A CE1   1 
ATOM   2140 N NE2   . HIS C 2 202 ? -25.896 87.020  47.234  1.00 44.19  ? 202 HIS A NE2   1 
ATOM   2141 N N     . LYS C 2 203 ? -30.071 84.259  42.848  1.00 47.08  ? 203 LYS A N     1 
ATOM   2142 C CA    . LYS C 2 203 ? -31.333 83.764  42.361  1.00 47.82  ? 203 LYS A CA    1 
ATOM   2143 C C     . LYS C 2 203 ? -31.525 82.277  42.669  1.00 49.56  ? 203 LYS A C     1 
ATOM   2144 O O     . LYS C 2 203 ? -32.504 81.911  43.335  1.00 51.37  ? 203 LYS A O     1 
ATOM   2145 C CB    . LYS C 2 203 ? -31.474 84.000  40.862  1.00 47.13  ? 203 LYS A CB    1 
ATOM   2146 C CG    . LYS C 2 203 ? -32.639 83.232  40.276  1.00 46.80  ? 203 LYS A CG    1 
ATOM   2147 C CD    . LYS C 2 203 ? -32.881 83.555  38.821  1.00 46.90  ? 203 LYS A CD    1 
ATOM   2148 C CE    . LYS C 2 203 ? -33.991 82.668  38.310  1.00 47.89  ? 203 LYS A CE    1 
ATOM   2149 N NZ    . LYS C 2 203 ? -34.315 82.891  36.864  1.00 49.78  ? 203 LYS A NZ    1 
ATOM   2150 N N     . TYR C 2 204 ? -30.609 81.409  42.235  1.00 50.14  ? 204 TYR A N     1 
ATOM   2151 C CA    . TYR C 2 204 ? -30.822 79.978  42.485  1.00 50.10  ? 204 TYR A CA    1 
ATOM   2152 C C     . TYR C 2 204 ? -30.567 79.501  43.904  1.00 50.61  ? 204 TYR A C     1 
ATOM   2153 O O     . TYR C 2 204 ? -31.069 78.448  44.312  1.00 50.85  ? 204 TYR A O     1 
ATOM   2154 C CB    . TYR C 2 204 ? -30.047 79.135  41.476  1.00 49.13  ? 204 TYR A CB    1 
ATOM   2155 C CG    . TYR C 2 204 ? -30.533 79.378  40.067  1.00 48.51  ? 204 TYR A CG    1 
ATOM   2156 C CD1   . TYR C 2 204 ? -30.029 80.433  39.309  1.00 47.87  ? 204 TYR A CD1   1 
ATOM   2157 C CD2   . TYR C 2 204 ? -31.568 78.613  39.527  1.00 48.10  ? 204 TYR A CD2   1 
ATOM   2158 C CE1   . TYR C 2 204 ? -30.547 80.724  38.052  1.00 48.04  ? 204 TYR A CE1   1 
ATOM   2159 C CE2   . TYR C 2 204 ? -32.096 78.898  38.265  1.00 47.54  ? 204 TYR A CE2   1 
ATOM   2160 C CZ    . TYR C 2 204 ? -31.582 79.956  37.538  1.00 48.26  ? 204 TYR A CZ    1 
ATOM   2161 O OH    . TYR C 2 204 ? -32.123 80.274  36.305  1.00 49.57  ? 204 TYR A OH    1 
ATOM   2162 N N     . LEU C 2 205 ? -29.800 80.256  44.673  1.00 51.36  ? 205 LEU A N     1 
ATOM   2163 C CA    . LEU C 2 205 ? -29.585 79.834  46.051  1.00 52.83  ? 205 LEU A CA    1 
ATOM   2164 C C     . LEU C 2 205 ? -30.904 80.093  46.787  1.00 54.28  ? 205 LEU A C     1 
ATOM   2165 O O     . LEU C 2 205 ? -31.311 79.316  47.663  1.00 54.53  ? 205 LEU A O     1 
ATOM   2166 C CB    . LEU C 2 205 ? -28.450 80.631  46.699  1.00 52.20  ? 205 LEU A CB    1 
ATOM   2167 C CG    . LEU C 2 205 ? -27.034 80.121  46.398  1.00 52.70  ? 205 LEU A CG    1 
ATOM   2168 C CD1   . LEU C 2 205 ? -26.016 81.047  47.066  1.00 52.76  ? 205 LEU A CD1   1 
ATOM   2169 C CD2   . LEU C 2 205 ? -26.872 78.689  46.914  1.00 51.48  ? 205 LEU A CD2   1 
ATOM   2170 N N     . THR C 2 206 ? -31.568 81.190  46.408  1.00 55.21  ? 206 THR A N     1 
ATOM   2171 C CA    . THR C 2 206 ? -32.845 81.576  47.002  1.00 54.96  ? 206 THR A CA    1 
ATOM   2172 C C     . THR C 2 206 ? -33.884 80.508  46.698  1.00 55.11  ? 206 THR A C     1 
ATOM   2173 O O     . THR C 2 206 ? -34.602 80.068  47.590  1.00 54.88  ? 206 THR A O     1 
ATOM   2174 C CB    . THR C 2 206 ? -33.321 82.949  46.459  1.00 54.98  ? 206 THR A CB    1 
ATOM   2175 O OG1   . THR C 2 206 ? -32.583 83.997  47.107  1.00 54.99  ? 206 THR A OG1   1 
ATOM   2176 C CG2   . THR C 2 206 ? -34.804 83.143  46.704  1.00 54.26  ? 206 THR A CG2   1 
ATOM   2177 N N     . ARG C 2 207 ? -33.949 80.070  45.445  1.00 55.45  ? 207 ARG A N     1 
ATOM   2178 C CA    . ARG C 2 207 ? -34.908 79.035  45.081  1.00 56.24  ? 207 ARG A CA    1 
ATOM   2179 C C     . ARG C 2 207 ? -34.660 77.720  45.804  1.00 57.04  ? 207 ARG A C     1 
ATOM   2180 O O     . ARG C 2 207 ? -35.417 76.770  45.622  1.00 58.14  ? 207 ARG A O     1 
ATOM   2181 C CB    . ARG C 2 207 ? -34.885 78.751  43.583  1.00 56.27  ? 207 ARG A CB    1 
ATOM   2182 C CG    . ARG C 2 207 ? -35.417 79.862  42.722  1.00 57.31  ? 207 ARG A CG    1 
ATOM   2183 C CD    . ARG C 2 207 ? -35.775 79.318  41.351  1.00 58.71  ? 207 ARG A CD    1 
ATOM   2184 N NE    . ARG C 2 207 ? -36.214 80.380  40.452  1.00 60.31  ? 207 ARG A NE    1 
ATOM   2185 C CZ    . ARG C 2 207 ? -36.475 80.196  39.165  1.00 61.42  ? 207 ARG A CZ    1 
ATOM   2186 N NH1   . ARG C 2 207 ? -36.339 78.981  38.640  1.00 61.47  ? 207 ARG A NH1   1 
ATOM   2187 N NH2   . ARG C 2 207 ? -36.856 81.225  38.407  1.00 62.25  ? 207 ARG A NH2   1 
ATOM   2188 N N     . ASN C 2 208 ? -33.591 77.630  46.588  1.00 57.67  ? 208 ASN A N     1 
ATOM   2189 C CA    . ASN C 2 208 ? -33.317 76.389  47.321  1.00 58.42  ? 208 ASN A CA    1 
ATOM   2190 C C     . ASN C 2 208 ? -33.297 76.732  48.792  1.00 59.62  ? 208 ASN A C     1 
ATOM   2191 O O     . ASN C 2 208 ? -32.792 75.974  49.624  1.00 59.96  ? 208 ASN A O     1 
ATOM   2192 C CB    . ASN C 2 208 ? -31.972 75.762  46.913  1.00 57.04  ? 208 ASN A CB    1 
ATOM   2193 C CG    . ASN C 2 208 ? -32.008 75.159  45.520  1.00 56.77  ? 208 ASN A CG    1 
ATOM   2194 O OD1   . ASN C 2 208 ? -31.986 75.881  44.509  1.00 56.58  ? 208 ASN A OD1   1 
ATOM   2195 N ND2   . ASN C 2 208 ? -32.075 73.826  45.453  1.00 55.53  ? 208 ASN A ND2   1 
ATOM   2196 N N     . GLN C 2 209 ? -33.846 77.900  49.101  1.00 60.93  ? 209 GLN A N     1 
ATOM   2197 C CA    . GLN C 2 209 ? -33.924 78.371  50.473  1.00 61.88  ? 209 GLN A CA    1 
ATOM   2198 C C     . GLN C 2 209 ? -32.575 78.312  51.166  1.00 61.67  ? 209 GLN A C     1 
ATOM   2199 O O     . GLN C 2 209 ? -32.439 77.763  52.259  1.00 61.85  ? 209 GLN A O     1 
ATOM   2200 C CB    . GLN C 2 209 ? -34.952 77.543  51.238  1.00 63.30  ? 209 GLN A CB    1 
ATOM   2201 C CG    . GLN C 2 209 ? -36.310 77.514  50.543  1.00 66.41  ? 209 GLN A CG    1 
ATOM   2202 C CD    . GLN C 2 209 ? -36.831 76.095  50.357  1.00 68.64  ? 209 GLN A CD    1 
ATOM   2203 O OE1   . GLN C 2 209 ? -37.269 75.446  51.321  1.00 69.52  ? 209 GLN A OE1   1 
ATOM   2204 N NE2   . GLN C 2 209 ? -36.767 75.594  49.116  1.00 68.94  ? 209 GLN A NE2   1 
ATOM   2205 N N     . ILE C 2 210 ? -31.574 78.884  50.511  1.00 61.60  ? 210 ILE A N     1 
ATOM   2206 C CA    . ILE C 2 210 ? -30.231 78.940  51.060  1.00 61.18  ? 210 ILE A CA    1 
ATOM   2207 C C     . ILE C 2 210 ? -29.754 80.385  51.022  1.00 61.20  ? 210 ILE A C     1 
ATOM   2208 O O     . ILE C 2 210 ? -30.042 81.116  50.070  1.00 61.35  ? 210 ILE A O     1 
ATOM   2209 C CB    . ILE C 2 210 ? -29.249 78.077  50.233  1.00 60.97  ? 210 ILE A CB    1 
ATOM   2210 C CG1   . ILE C 2 210 ? -29.711 76.619  50.238  1.00 60.45  ? 210 ILE A CG1   1 
ATOM   2211 C CG2   . ILE C 2 210 ? -27.832 78.196  50.813  1.00 60.60  ? 210 ILE A CG2   1 
ATOM   2212 C CD1   . ILE C 2 210 ? -28.784 75.679  49.499  1.00 60.49  ? 210 ILE A CD1   1 
ATOM   2213 N N     . GLN C 2 211 ? -29.042 80.797  52.061  1.00 61.34  ? 211 GLN A N     1 
ATOM   2214 C CA    . GLN C 2 211 ? -28.501 82.140  52.115  1.00 62.59  ? 211 GLN A CA    1 
ATOM   2215 C C     . GLN C 2 211 ? -26.998 82.023  52.268  1.00 62.20  ? 211 GLN A C     1 
ATOM   2216 O O     . GLN C 2 211 ? -26.516 81.427  53.229  1.00 62.85  ? 211 GLN A O     1 
ATOM   2217 C CB    . GLN C 2 211 ? -29.054 82.902  53.306  1.00 64.63  ? 211 GLN A CB    1 
ATOM   2218 C CG    . GLN C 2 211 ? -30.522 83.211  53.212  1.00 68.32  ? 211 GLN A CG    1 
ATOM   2219 C CD    . GLN C 2 211 ? -31.010 83.955  54.441  1.00 70.91  ? 211 GLN A CD    1 
ATOM   2220 O OE1   . GLN C 2 211 ? -30.593 85.096  54.705  1.00 72.03  ? 211 GLN A OE1   1 
ATOM   2221 N NE2   . GLN C 2 211 ? -31.889 83.308  55.213  1.00 71.79  ? 211 GLN A NE2   1 
ATOM   2222 N N     . PRO C 2 212 ? -26.231 82.585  51.323  1.00 61.63  ? 212 PRO A N     1 
ATOM   2223 C CA    . PRO C 2 212 ? -24.774 82.482  51.454  1.00 60.66  ? 212 PRO A CA    1 
ATOM   2224 C C     . PRO C 2 212 ? -24.297 82.957  52.818  1.00 59.79  ? 212 PRO A C     1 
ATOM   2225 O O     . PRO C 2 212 ? -24.713 84.014  53.279  1.00 59.67  ? 212 PRO A O     1 
ATOM   2226 C CB    . PRO C 2 212 ? -24.260 83.369  50.318  1.00 61.00  ? 212 PRO A CB    1 
ATOM   2227 C CG    . PRO C 2 212 ? -25.376 84.373  50.123  1.00 61.20  ? 212 PRO A CG    1 
ATOM   2228 C CD    . PRO C 2 212 ? -26.594 83.477  50.207  1.00 61.64  ? 212 PRO A CD    1 
ATOM   2229 N N     . ILE C 2 213 ? -23.437 82.179  53.468  1.00 58.94  ? 213 ILE A N     1 
ATOM   2230 C CA    . ILE C 2 213 ? -22.933 82.587  54.772  1.00 58.66  ? 213 ILE A CA    1 
ATOM   2231 C C     . ILE C 2 213 ? -21.789 83.579  54.628  1.00 57.71  ? 213 ILE A C     1 
ATOM   2232 O O     . ILE C 2 213 ? -21.223 84.027  55.622  1.00 57.75  ? 213 ILE A O     1 
ATOM   2233 C CB    . ILE C 2 213 ? -22.437 81.388  55.611  1.00 59.31  ? 213 ILE A CB    1 
ATOM   2234 C CG1   . ILE C 2 213 ? -21.157 80.814  55.008  1.00 59.68  ? 213 ILE A CG1   1 
ATOM   2235 C CG2   . ILE C 2 213 ? -23.511 80.315  55.666  1.00 59.25  ? 213 ILE A CG2   1 
ATOM   2236 C CD1   . ILE C 2 213 ? -20.574 79.695  55.836  1.00 60.11  ? 213 ILE A CD1   1 
ATOM   2237 N N     . ALA C 2 214 ? -21.448 83.909  53.384  1.00 57.24  ? 214 ALA A N     1 
ATOM   2238 C CA    . ALA C 2 214 ? -20.381 84.870  53.087  1.00 56.43  ? 214 ALA A CA    1 
ATOM   2239 C C     . ALA C 2 214 ? -20.455 85.253  51.614  1.00 56.26  ? 214 ALA A C     1 
ATOM   2240 O O     . ALA C 2 214 ? -20.935 84.484  50.780  1.00 55.90  ? 214 ALA A O     1 
ATOM   2241 C CB    . ALA C 2 214 ? -19.023 84.280  53.410  1.00 56.04  ? 214 ALA A CB    1 
ATOM   2242 N N     . GLU C 2 215 ? -19.981 86.450  51.300  1.00 56.39  ? 215 GLU A N     1 
ATOM   2243 C CA    . GLU C 2 215 ? -20.022 86.943  49.935  1.00 57.18  ? 215 GLU A CA    1 
ATOM   2244 C C     . GLU C 2 215 ? -18.926 87.997  49.766  1.00 57.43  ? 215 GLU A C     1 
ATOM   2245 O O     . GLU C 2 215 ? -19.057 89.120  50.245  1.00 57.72  ? 215 GLU A O     1 
ATOM   2246 C CB    . GLU C 2 215 ? -21.421 87.513  49.674  1.00 58.03  ? 215 GLU A CB    1 
ATOM   2247 C CG    . GLU C 2 215 ? -21.569 88.467  48.498  1.00 60.50  ? 215 GLU A CG    1 
ATOM   2248 C CD    . GLU C 2 215 ? -23.042 88.712  48.114  1.00 61.92  ? 215 GLU A CD    1 
ATOM   2249 O OE1   . GLU C 2 215 ? -23.295 89.592  47.249  1.00 61.97  ? 215 GLU A OE1   1 
ATOM   2250 O OE2   . GLU C 2 215 ? -23.942 88.017  48.666  1.00 62.27  ? 215 GLU A OE2   1 
ATOM   2251 N N     . ARG C 2 216 ? -17.832 87.624  49.099  1.00 57.51  ? 216 ARG A N     1 
ATOM   2252 C CA    . ARG C 2 216 ? -16.714 88.544  48.899  1.00 57.24  ? 216 ARG A CA    1 
ATOM   2253 C C     . ARG C 2 216 ? -16.512 88.875  47.435  1.00 56.37  ? 216 ARG A C     1 
ATOM   2254 O O     . ARG C 2 216 ? -17.043 88.205  46.549  1.00 55.99  ? 216 ARG A O     1 
ATOM   2255 C CB    . ARG C 2 216 ? -15.424 87.946  49.450  1.00 58.21  ? 216 ARG A CB    1 
ATOM   2256 C CG    . ARG C 2 216 ? -15.650 86.952  50.559  1.00 60.18  ? 216 ARG A CG    1 
ATOM   2257 C CD    . ARG C 2 216 ? -15.859 87.633  51.877  1.00 62.45  ? 216 ARG A CD    1 
ATOM   2258 N NE    . ARG C 2 216 ? -14.618 88.218  52.379  1.00 63.99  ? 216 ARG A NE    1 
ATOM   2259 C CZ    . ARG C 2 216 ? -14.359 88.402  53.672  1.00 65.21  ? 216 ARG A CZ    1 
ATOM   2260 N NH1   . ARG C 2 216 ? -15.257 88.038  54.591  1.00 65.00  ? 216 ARG A NH1   1 
ATOM   2261 N NH2   . ARG C 2 216 ? -13.211 88.956  54.047  1.00 65.51  ? 216 ARG A NH2   1 
ATOM   2262 N N     . GLU C 2 217 ? -15.712 89.907  47.194  1.00 55.95  ? 217 GLU A N     1 
ATOM   2263 C CA    . GLU C 2 217 ? -15.426 90.372  45.842  1.00 55.67  ? 217 GLU A CA    1 
ATOM   2264 C C     . GLU C 2 217 ? -13.930 90.334  45.532  1.00 54.71  ? 217 GLU A C     1 
ATOM   2265 O O     . GLU C 2 217 ? -13.114 90.909  46.262  1.00 54.23  ? 217 GLU A O     1 
ATOM   2266 C CB    . GLU C 2 217 ? -15.928 91.810  45.677  1.00 56.86  ? 217 GLU A CB    1 
ATOM   2267 C CG    . GLU C 2 217 ? -15.853 92.382  44.256  1.00 59.44  ? 217 GLU A CG    1 
ATOM   2268 C CD    . GLU C 2 217 ? -16.180 93.883  44.207  1.00 60.87  ? 217 GLU A CD    1 
ATOM   2269 O OE1   . GLU C 2 217 ? -16.976 94.335  45.065  1.00 62.29  ? 217 GLU A OE1   1 
ATOM   2270 O OE2   . GLU C 2 217 ? -15.654 94.604  43.317  1.00 60.17  ? 217 GLU A OE2   1 
ATOM   2271 N N     . GLY C 2 218 ? -13.582 89.657  44.441  1.00 53.28  ? 218 GLY A N     1 
ATOM   2272 C CA    . GLY C 2 218 ? -12.197 89.588  44.025  1.00 51.78  ? 218 GLY A CA    1 
ATOM   2273 C C     . GLY C 2 218 ? -12.026 90.478  42.809  1.00 50.83  ? 218 GLY A C     1 
ATOM   2274 O O     . GLY C 2 218 ? -12.882 91.326  42.535  1.00 51.41  ? 218 GLY A O     1 
ATOM   2275 N N     . ASP C 2 219 ? -10.937 90.294  42.071  1.00 49.31  ? 219 ASP A N     1 
ATOM   2276 C CA    . ASP C 2 219 ? -10.702 91.110  40.892  1.00 48.16  ? 219 ASP A CA    1 
ATOM   2277 C C     . ASP C 2 219 ? -10.298 90.244  39.711  1.00 46.89  ? 219 ASP A C     1 
ATOM   2278 O O     . ASP C 2 219 ? -9.651  90.718  38.776  1.00 46.37  ? 219 ASP A O     1 
ATOM   2279 C CB    . ASP C 2 219 ? -9.614  92.139  41.177  1.00 48.25  ? 219 ASP A CB    1 
ATOM   2280 C CG    . ASP C 2 219 ? -8.283  91.498  41.487  1.00 49.45  ? 219 ASP A CG    1 
ATOM   2281 O OD1   . ASP C 2 219 ? -7.332  92.246  41.829  1.00 49.99  ? 219 ASP A OD1   1 
ATOM   2282 O OD2   . ASP C 2 219 ? -8.188  90.250  41.383  1.00 48.88  ? 219 ASP A OD2   1 
ATOM   2283 N N     . TRP C 2 220 ? -10.685 88.974  39.773  1.00 45.54  ? 220 TRP A N     1 
ATOM   2284 C CA    . TRP C 2 220 ? -10.388 88.002  38.723  1.00 44.32  ? 220 TRP A CA    1 
ATOM   2285 C C     . TRP C 2 220 ? -9.057  87.280  38.943  1.00 43.64  ? 220 TRP A C     1 
ATOM   2286 O O     . TRP C 2 220 ? -8.887  86.157  38.478  1.00 43.87  ? 220 TRP A O     1 
ATOM   2287 C CB    . TRP C 2 220 ? -10.359 88.677  37.354  1.00 42.92  ? 220 TRP A CB    1 
ATOM   2288 C CG    . TRP C 2 220 ? -11.679 89.186  36.865  1.00 42.57  ? 220 TRP A CG    1 
ATOM   2289 C CD1   . TRP C 2 220 ? -11.902 90.374  36.221  1.00 41.73  ? 220 TRP A CD1   1 
ATOM   2290 C CD2   . TRP C 2 220 ? -12.921 88.463  36.808  1.00 41.30  ? 220 TRP A CD2   1 
ATOM   2291 N NE1   . TRP C 2 220 ? -13.193 90.424  35.750  1.00 41.80  ? 220 TRP A NE1   1 
ATOM   2292 C CE2   . TRP C 2 220 ? -13.841 89.268  36.098  1.00 41.31  ? 220 TRP A CE2   1 
ATOM   2293 C CE3   . TRP C 2 220 ? -13.340 87.213  37.278  1.00 41.28  ? 220 TRP A CE3   1 
ATOM   2294 C CZ2   . TRP C 2 220 ? -15.157 88.863  35.845  1.00 41.25  ? 220 TRP A CZ2   1 
ATOM   2295 C CZ3   . TRP C 2 220 ? -14.656 86.801  37.024  1.00 41.58  ? 220 TRP A CZ3   1 
ATOM   2296 C CH2   . TRP C 2 220 ? -15.546 87.628  36.312  1.00 41.67  ? 220 TRP A CH2   1 
ATOM   2297 N N     . SER C 2 221 ? -8.132  87.915  39.657  1.00 42.39  ? 221 SER A N     1 
ATOM   2298 C CA    . SER C 2 221 ? -6.827  87.320  39.905  1.00 42.28  ? 221 SER A CA    1 
ATOM   2299 C C     . SER C 2 221 ? -6.829  86.274  41.012  1.00 43.60  ? 221 SER A C     1 
ATOM   2300 O O     . SER C 2 221 ? -7.608  86.362  41.965  1.00 43.98  ? 221 SER A O     1 
ATOM   2301 C CB    . SER C 2 221 ? -5.832  88.394  40.283  1.00 40.87  ? 221 SER A CB    1 
ATOM   2302 O OG    . SER C 2 221 ? -5.866  88.598  41.675  1.00 41.68  ? 221 SER A OG    1 
ATOM   2303 N N     . ALA C 2 222 ? -5.941  85.290  40.889  1.00 44.60  ? 222 ALA A N     1 
ATOM   2304 C CA    . ALA C 2 222 ? -5.825  84.222  41.881  1.00 45.23  ? 222 ALA A CA    1 
ATOM   2305 C C     . ALA C 2 222 ? -5.448  84.787  43.252  1.00 45.75  ? 222 ALA A C     1 
ATOM   2306 O O     . ALA C 2 222 ? -5.889  84.302  44.287  1.00 45.28  ? 222 ALA A O     1 
ATOM   2307 C CB    . ALA C 2 222 ? -4.768  83.207  41.424  1.00 45.05  ? 222 ALA A CB    1 
ATOM   2308 N N     . MET C 2 223 ? -4.619  85.814  43.259  1.00 47.39  ? 223 MET A N     1 
ATOM   2309 C CA    . MET C 2 223 ? -4.197  86.403  44.513  1.00 49.53  ? 223 MET A CA    1 
ATOM   2310 C C     . MET C 2 223 ? -5.415  86.962  45.245  1.00 50.38  ? 223 MET A C     1 
ATOM   2311 O O     . MET C 2 223 ? -5.517  86.854  46.471  1.00 50.63  ? 223 MET A O     1 
ATOM   2312 C CB    . MET C 2 223 ? -3.180  87.508  44.250  1.00 51.09  ? 223 MET A CB    1 
ATOM   2313 C CG    . MET C 2 223 ? -2.376  87.934  45.462  1.00 54.95  ? 223 MET A CG    1 
ATOM   2314 S SD    . MET C 2 223 ? -1.517  86.535  46.284  1.00 60.05  ? 223 MET A SD    1 
ATOM   2315 C CE    . MET C 2 223 ? -1.828  86.936  48.008  1.00 58.86  ? 223 MET A CE    1 
ATOM   2316 N N     . SER C 2 224 ? -6.348  87.554  44.502  1.00 50.43  ? 224 SER A N     1 
ATOM   2317 C CA    . SER C 2 224 ? -7.532  88.103  45.151  1.00 50.35  ? 224 SER A CA    1 
ATOM   2318 C C     . SER C 2 224 ? -8.335  86.933  45.723  1.00 50.14  ? 224 SER A C     1 
ATOM   2319 O O     . SER C 2 224 ? -8.854  87.003  46.834  1.00 50.29  ? 224 SER A O     1 
ATOM   2320 C CB    . SER C 2 224 ? -8.375  88.944  44.169  1.00 49.86  ? 224 SER A CB    1 
ATOM   2321 O OG    . SER C 2 224 ? -9.069  88.158  43.210  1.00 51.18  ? 224 SER A OG    1 
ATOM   2322 N N     . GLY C 2 225 ? -8.411  85.842  44.976  1.00 50.01  ? 225 GLY A N     1 
ATOM   2323 C CA    . GLY C 2 225 ? -9.144  84.693  45.466  1.00 50.99  ? 225 GLY A CA    1 
ATOM   2324 C C     . GLY C 2 225 ? -8.516  84.192  46.753  1.00 51.76  ? 225 GLY A C     1 
ATOM   2325 O O     . GLY C 2 225 ? -9.207  83.780  47.681  1.00 52.60  ? 225 GLY A O     1 
ATOM   2326 N N     . PHE C 2 226 ? -7.190  84.247  46.814  1.00 52.06  ? 226 PHE A N     1 
ATOM   2327 C CA    . PHE C 2 226 ? -6.462  83.777  47.980  1.00 52.02  ? 226 PHE A CA    1 
ATOM   2328 C C     . PHE C 2 226 ? -6.711  84.681  49.178  1.00 53.13  ? 226 PHE A C     1 
ATOM   2329 O O     . PHE C 2 226 ? -7.068  84.211  50.257  1.00 53.74  ? 226 PHE A O     1 
ATOM   2330 C CB    . PHE C 2 226 ? -4.957  83.729  47.679  1.00 49.99  ? 226 PHE A CB    1 
ATOM   2331 C CG    . PHE C 2 226 ? -4.106  83.368  48.869  1.00 46.91  ? 226 PHE A CG    1 
ATOM   2332 C CD1   . PHE C 2 226 ? -4.084  82.067  49.358  1.00 45.89  ? 226 PHE A CD1   1 
ATOM   2333 C CD2   . PHE C 2 226 ? -3.332  84.334  49.500  1.00 45.15  ? 226 PHE A CD2   1 
ATOM   2334 C CE1   . PHE C 2 226 ? -3.296  81.729  50.465  1.00 44.70  ? 226 PHE A CE1   1 
ATOM   2335 C CE2   . PHE C 2 226 ? -2.542  84.009  50.605  1.00 44.75  ? 226 PHE A CE2   1 
ATOM   2336 C CZ    . PHE C 2 226 ? -2.525  82.701  51.086  1.00 44.06  ? 226 PHE A CZ    1 
ATOM   2337 N N     . GLN C 2 227 ? -6.510  85.977  48.980  1.00 54.23  ? 227 GLN A N     1 
ATOM   2338 C CA    . GLN C 2 227 ? -6.701  86.950  50.042  1.00 55.71  ? 227 GLN A CA    1 
ATOM   2339 C C     . GLN C 2 227 ? -8.130  86.993  50.570  1.00 55.63  ? 227 GLN A C     1 
ATOM   2340 O O     . GLN C 2 227 ? -8.351  86.965  51.779  1.00 55.84  ? 227 GLN A O     1 
ATOM   2341 C CB    . GLN C 2 227 ? -6.282  88.321  49.547  1.00 57.28  ? 227 GLN A CB    1 
ATOM   2342 C CG    . GLN C 2 227 ? -4.787  88.482  49.488  1.00 61.04  ? 227 GLN A CG    1 
ATOM   2343 C CD    . GLN C 2 227 ? -4.369  89.637  48.608  1.00 64.63  ? 227 GLN A CD    1 
ATOM   2344 O OE1   . GLN C 2 227 ? -3.198  90.052  48.614  1.00 66.75  ? 227 GLN A OE1   1 
ATOM   2345 N NE2   . GLN C 2 227 ? -5.321  90.167  47.827  1.00 66.11  ? 227 GLN A NE2   1 
ATOM   2346 N N     . GLN C 2 228 ? -9.103  87.055  49.667  1.00 55.70  ? 228 GLN A N     1 
ATOM   2347 C CA    . GLN C 2 228 ? -10.499 87.080  50.082  1.00 55.56  ? 228 GLN A CA    1 
ATOM   2348 C C     . GLN C 2 228 ? -10.861 85.839  50.881  1.00 55.83  ? 228 GLN A C     1 
ATOM   2349 O O     . GLN C 2 228 ? -11.466 85.949  51.943  1.00 56.27  ? 228 GLN A O     1 
ATOM   2350 C CB    . GLN C 2 228 ? -11.419 87.197  48.872  1.00 54.85  ? 228 GLN A CB    1 
ATOM   2351 C CG    . GLN C 2 228 ? -11.386 88.565  48.227  1.00 54.79  ? 228 GLN A CG    1 
ATOM   2352 C CD    . GLN C 2 228 ? -11.729 89.668  49.207  1.00 55.14  ? 228 GLN A CD    1 
ATOM   2353 O OE1   . GLN C 2 228 ? -12.723 89.572  49.937  1.00 56.86  ? 228 GLN A OE1   1 
ATOM   2354 N NE2   . GLN C 2 228 ? -10.918 90.725  49.228  1.00 53.63  ? 228 GLN A NE2   1 
ATOM   2355 N N     . THR C 2 229 ? -10.490 84.660  50.391  1.00 55.94  ? 229 THR A N     1 
ATOM   2356 C CA    . THR C 2 229 ? -10.813 83.446  51.118  1.00 56.12  ? 229 THR A CA    1 
ATOM   2357 C C     . THR C 2 229 ? -10.055 83.369  52.438  1.00 57.52  ? 229 THR A C     1 
ATOM   2358 O O     . THR C 2 229 ? -10.513 82.727  53.376  1.00 58.15  ? 229 THR A O     1 
ATOM   2359 C CB    . THR C 2 229 ? -10.528 82.206  50.275  1.00 55.46  ? 229 THR A CB    1 
ATOM   2360 O OG1   . THR C 2 229 ? -11.319 82.261  49.080  1.00 55.82  ? 229 THR A OG1   1 
ATOM   2361 C CG2   . THR C 2 229 ? -10.887 80.942  51.043  1.00 54.37  ? 229 THR A CG2   1 
ATOM   2362 N N     . MET C 2 230 ? -8.905  84.029  52.528  1.00 58.82  ? 230 MET A N     1 
ATOM   2363 C CA    . MET C 2 230 ? -8.145  84.007  53.773  1.00 60.72  ? 230 MET A CA    1 
ATOM   2364 C C     . MET C 2 230 ? -8.824  84.883  54.811  1.00 61.41  ? 230 MET A C     1 
ATOM   2365 O O     . MET C 2 230 ? -8.962  84.481  55.962  1.00 61.78  ? 230 MET A O     1 
ATOM   2366 C CB    . MET C 2 230 ? -6.707  84.488  53.562  1.00 62.09  ? 230 MET A CB    1 
ATOM   2367 C CG    . MET C 2 230 ? -5.746  83.385  53.153  1.00 64.77  ? 230 MET A CG    1 
ATOM   2368 S SD    . MET C 2 230 ? -5.589  82.066  54.412  1.00 68.18  ? 230 MET A SD    1 
ATOM   2369 C CE    . MET C 2 230 ? -4.436  82.927  55.568  1.00 67.70  ? 230 MET A CE    1 
ATOM   2370 N N     . GLN C 2 231 ? -9.233  86.085  54.407  1.00 61.88  ? 231 GLN A N     1 
ATOM   2371 C CA    . GLN C 2 231 ? -9.925  86.996  55.313  1.00 62.38  ? 231 GLN A CA    1 
ATOM   2372 C C     . GLN C 2 231 ? -11.186 86.299  55.823  1.00 62.25  ? 231 GLN A C     1 
ATOM   2373 O O     . GLN C 2 231 ? -11.466 86.301  57.021  1.00 62.77  ? 231 GLN A O     1 
ATOM   2374 C CB    . GLN C 2 231 ? -10.314 88.286  54.591  1.00 63.09  ? 231 GLN A CB    1 
ATOM   2375 C CG    . GLN C 2 231 ? -9.135  89.136  54.163  1.00 65.42  ? 231 GLN A CG    1 
ATOM   2376 C CD    . GLN C 2 231 ? -9.536  90.307  53.267  1.00 67.03  ? 231 GLN A CD    1 
ATOM   2377 O OE1   . GLN C 2 231 ? -8.674  91.016  52.729  1.00 67.56  ? 231 GLN A OE1   1 
ATOM   2378 N NE2   . GLN C 2 231 ? -10.847 90.514  53.098  1.00 68.05  ? 231 GLN A NE2   1 
ATOM   2379 N N     . MET C 2 232 ? -11.935 85.693  54.907  1.00 61.25  ? 232 MET A N     1 
ATOM   2380 C CA    . MET C 2 232 ? -13.151 84.994  55.270  1.00 60.97  ? 232 MET A CA    1 
ATOM   2381 C C     . MET C 2 232 ? -12.880 83.953  56.351  1.00 61.65  ? 232 MET A C     1 
ATOM   2382 O O     . MET C 2 232 ? -13.562 83.928  57.376  1.00 62.58  ? 232 MET A O     1 
ATOM   2383 C CB    . MET C 2 232 ? -13.763 84.322  54.038  1.00 59.92  ? 232 MET A CB    1 
ATOM   2384 C CG    . MET C 2 232 ? -14.912 83.409  54.363  1.00 59.16  ? 232 MET A CG    1 
ATOM   2385 S SD    . MET C 2 232 ? -15.670 82.649  52.916  1.00 60.41  ? 232 MET A SD    1 
ATOM   2386 C CE    . MET C 2 232 ? -14.711 81.080  52.789  1.00 60.25  ? 232 MET A CE    1 
ATOM   2387 N N     . LEU C 2 233 ? -11.883 83.099  56.127  1.00 62.12  ? 233 LEU A N     1 
ATOM   2388 C CA    . LEU C 2 233 ? -11.544 82.048  57.083  1.00 62.28  ? 233 LEU A CA    1 
ATOM   2389 C C     . LEU C 2 233 ? -11.016 82.609  58.395  1.00 62.96  ? 233 LEU A C     1 
ATOM   2390 O O     . LEU C 2 233 ? -11.275 82.049  59.457  1.00 62.97  ? 233 LEU A O     1 
ATOM   2391 C CB    . LEU C 2 233 ? -10.522 81.086  56.471  1.00 61.32  ? 233 LEU A CB    1 
ATOM   2392 C CG    . LEU C 2 233 ? -11.051 80.210  55.326  1.00 61.08  ? 233 LEU A CG    1 
ATOM   2393 C CD1   . LEU C 2 233 ? -9.889  79.465  54.676  1.00 60.34  ? 233 LEU A CD1   1 
ATOM   2394 C CD2   . LEU C 2 233 ? -12.109 79.231  55.845  1.00 60.04  ? 233 LEU A CD2   1 
ATOM   2395 N N     . ASN C 2 234 ? -10.287 83.719  58.325  1.00 63.56  ? 234 ASN A N     1 
ATOM   2396 C CA    . ASN C 2 234 ? -9.751  84.334  59.529  1.00 64.75  ? 234 ASN A CA    1 
ATOM   2397 C C     . ASN C 2 234 ? -10.856 84.950  60.375  1.00 65.33  ? 234 ASN A C     1 
ATOM   2398 O O     . ASN C 2 234 ? -10.659 85.218  61.560  1.00 65.94  ? 234 ASN A O     1 
ATOM   2399 C CB    . ASN C 2 234 ? -8.719  85.408  59.187  1.00 65.25  ? 234 ASN A CB    1 
ATOM   2400 C CG    . ASN C 2 234 ? -7.445  84.825  58.605  1.00 66.02  ? 234 ASN A CG    1 
ATOM   2401 O OD1   . ASN C 2 234 ? -6.959  83.785  59.060  1.00 65.86  ? 234 ASN A OD1   1 
ATOM   2402 N ND2   . ASN C 2 234 ? -6.888  85.498  57.602  1.00 66.40  ? 234 ASN A ND2   1 
ATOM   2403 N N     . GLU C 2 235 ? -12.011 85.187  59.763  1.00 65.54  ? 235 GLU A N     1 
ATOM   2404 C CA    . GLU C 2 235 ? -13.148 85.751  60.480  1.00 65.68  ? 235 GLU A CA    1 
ATOM   2405 C C     . GLU C 2 235 ? -13.960 84.613  61.074  1.00 65.00  ? 235 GLU A C     1 
ATOM   2406 O O     . GLU C 2 235 ? -15.081 84.812  61.518  1.00 65.74  ? 235 GLU A O     1 
ATOM   2407 C CB    . GLU C 2 235 ? -14.053 86.550  59.543  1.00 66.88  ? 235 GLU A CB    1 
ATOM   2408 C CG    . GLU C 2 235 ? -13.481 87.869  59.066  1.00 69.27  ? 235 GLU A CG    1 
ATOM   2409 C CD    . GLU C 2 235 ? -14.385 88.539  58.044  1.00 71.17  ? 235 GLU A CD    1 
ATOM   2410 O OE1   . GLU C 2 235 ? -13.970 89.564  57.452  1.00 72.45  ? 235 GLU A OE1   1 
ATOM   2411 O OE2   . GLU C 2 235 ? -15.516 88.032  57.832  1.00 72.56  ? 235 GLU A OE2   1 
ATOM   2412 N N     . GLY C 2 236 ? -13.409 83.410  61.066  1.00 63.63  ? 236 GLY A N     1 
ATOM   2413 C CA    . GLY C 2 236 ? -14.141 82.299  61.631  1.00 62.12  ? 236 GLY A CA    1 
ATOM   2414 C C     . GLY C 2 236 ? -15.242 81.763  60.739  1.00 61.72  ? 236 GLY A C     1 
ATOM   2415 O O     . GLY C 2 236 ? -15.855 80.740  61.058  1.00 61.88  ? 236 GLY A O     1 
ATOM   2416 N N     . ILE C 2 237 ? -15.518 82.435  59.627  1.00 60.59  ? 237 ILE A N     1 
ATOM   2417 C CA    . ILE C 2 237 ? -16.550 81.941  58.722  1.00 59.99  ? 237 ILE A CA    1 
ATOM   2418 C C     . ILE C 2 237 ? -15.956 80.826  57.860  1.00 59.81  ? 237 ILE A C     1 
ATOM   2419 O O     . ILE C 2 237 ? -15.141 81.095  56.972  1.00 60.93  ? 237 ILE A O     1 
ATOM   2420 C CB    . ILE C 2 237 ? -17.054 83.044  57.776  1.00 60.00  ? 237 ILE A CB    1 
ATOM   2421 C CG1   . ILE C 2 237 ? -17.537 84.248  58.589  1.00 60.14  ? 237 ILE A CG1   1 
ATOM   2422 C CG2   . ILE C 2 237 ? -18.160 82.485  56.877  1.00 59.46  ? 237 ILE A CG2   1 
ATOM   2423 C CD1   . ILE C 2 237 ? -17.913 85.459  57.751  1.00 59.93  ? 237 ILE A CD1   1 
ATOM   2424 N N     . VAL C 2 238 ? -16.349 79.583  58.106  1.00 58.43  ? 238 VAL A N     1 
ATOM   2425 C CA    . VAL C 2 238 ? -15.824 78.470  57.320  1.00 57.19  ? 238 VAL A CA    1 
ATOM   2426 C C     . VAL C 2 238 ? -16.947 77.631  56.714  1.00 56.31  ? 238 VAL A C     1 
ATOM   2427 O O     . VAL C 2 238 ? -17.500 76.755  57.370  1.00 56.59  ? 238 VAL A O     1 
ATOM   2428 C CB    . VAL C 2 238 ? -14.900 77.571  58.192  1.00 57.43  ? 238 VAL A CB    1 
ATOM   2429 C CG1   . VAL C 2 238 ? -15.545 77.312  59.537  1.00 57.74  ? 238 VAL A CG1   1 
ATOM   2430 C CG2   . VAL C 2 238 ? -14.631 76.247  57.484  1.00 56.72  ? 238 VAL A CG2   1 
ATOM   2431 N N     . PRO C 2 239 ? -17.293 77.893  55.442  1.00 55.41  ? 239 PRO A N     1 
ATOM   2432 C CA    . PRO C 2 239 ? -18.352 77.190  54.698  1.00 54.48  ? 239 PRO A CA    1 
ATOM   2433 C C     . PRO C 2 239 ? -17.948 75.776  54.351  1.00 53.97  ? 239 PRO A C     1 
ATOM   2434 O O     . PRO C 2 239 ? -16.861 75.339  54.708  1.00 54.81  ? 239 PRO A O     1 
ATOM   2435 C CB    . PRO C 2 239 ? -18.507 78.038  53.439  1.00 54.47  ? 239 PRO A CB    1 
ATOM   2436 C CG    . PRO C 2 239 ? -17.097 78.452  53.175  1.00 54.76  ? 239 PRO A CG    1 
ATOM   2437 C CD    . PRO C 2 239 ? -16.599 78.857  54.568  1.00 55.02  ? 239 PRO A CD    1 
ATOM   2438 N N     . THR C 2 240 ? -18.813 75.062  53.646  1.00 52.99  ? 240 THR A N     1 
ATOM   2439 C CA    . THR C 2 240 ? -18.486 73.707  53.236  1.00 52.35  ? 240 THR A CA    1 
ATOM   2440 C C     . THR C 2 240 ? -18.365 73.676  51.721  1.00 52.20  ? 240 THR A C     1 
ATOM   2441 O O     . THR C 2 240 ? -18.091 72.628  51.131  1.00 52.98  ? 240 THR A O     1 
ATOM   2442 C CB    . THR C 2 240 ? -19.577 72.701  53.628  1.00 52.61  ? 240 THR A CB    1 
ATOM   2443 O OG1   . THR C 2 240 ? -20.767 72.955  52.863  1.00 52.97  ? 240 THR A OG1   1 
ATOM   2444 C CG2   . THR C 2 240 ? -19.866 72.799  55.115  1.00 51.89  ? 240 THR A CG2   1 
ATOM   2445 N N     . ALA C 2 241 ? -18.596 74.822  51.090  1.00 50.56  ? 241 ALA A N     1 
ATOM   2446 C CA    . ALA C 2 241 ? -18.521 74.905  49.642  1.00 49.51  ? 241 ALA A CA    1 
ATOM   2447 C C     . ALA C 2 241 ? -18.456 76.367  49.235  1.00 49.21  ? 241 ALA A C     1 
ATOM   2448 O O     . ALA C 2 241 ? -18.966 77.236  49.952  1.00 49.52  ? 241 ALA A O     1 
ATOM   2449 C CB    . ALA C 2 241 ? -19.729 74.235  49.005  1.00 49.00  ? 241 ALA A CB    1 
ATOM   2450 N N     . MET C 2 242 ? -17.807 76.634  48.099  1.00 47.95  ? 242 MET A N     1 
ATOM   2451 C CA    . MET C 2 242 ? -17.663 77.988  47.593  1.00 47.19  ? 242 MET A CA    1 
ATOM   2452 C C     . MET C 2 242 ? -17.941 78.028  46.106  1.00 47.29  ? 242 MET A C     1 
ATOM   2453 O O     . MET C 2 242 ? -17.535 77.127  45.367  1.00 48.47  ? 242 MET A O     1 
ATOM   2454 C CB    . MET C 2 242 ? -16.243 78.514  47.828  1.00 46.79  ? 242 MET A CB    1 
ATOM   2455 C CG    . MET C 2 242 ? -15.911 78.819  49.253  1.00 46.78  ? 242 MET A CG    1 
ATOM   2456 S SD    . MET C 2 242 ? -14.209 79.390  49.458  1.00 49.53  ? 242 MET A SD    1 
ATOM   2457 C CE    . MET C 2 242 ? -14.276 81.057  48.780  1.00 47.74  ? 242 MET A CE    1 
ATOM   2458 N N     . LEU C 2 243 ? -18.653 79.062  45.671  1.00 46.20  ? 243 LEU A N     1 
ATOM   2459 C CA    . LEU C 2 243 ? -18.922 79.254  44.258  1.00 45.22  ? 243 LEU A CA    1 
ATOM   2460 C C     . LEU C 2 243 ? -18.010 80.440  43.946  1.00 44.93  ? 243 LEU A C     1 
ATOM   2461 O O     . LEU C 2 243 ? -18.090 81.488  44.621  1.00 44.93  ? 243 LEU A O     1 
ATOM   2462 C CB    . LEU C 2 243 ? -20.388 79.611  44.034  1.00 45.38  ? 243 LEU A CB    1 
ATOM   2463 C CG    . LEU C 2 243 ? -21.362 78.443  44.219  1.00 45.57  ? 243 LEU A CG    1 
ATOM   2464 C CD1   . LEU C 2 243 ? -22.771 78.987  44.510  1.00 45.57  ? 243 LEU A CD1   1 
ATOM   2465 C CD2   . LEU C 2 243 ? -21.362 77.568  42.964  1.00 44.63  ? 243 LEU A CD2   1 
ATOM   2466 N N     . VAL C 2 244 ? -17.124 80.270  42.961  1.00 43.75  ? 244 VAL A N     1 
ATOM   2467 C CA    . VAL C 2 244 ? -16.181 81.324  42.605  1.00 42.05  ? 244 VAL A CA    1 
ATOM   2468 C C     . VAL C 2 244 ? -16.417 81.786  41.165  1.00 42.06  ? 244 VAL A C     1 
ATOM   2469 O O     . VAL C 2 244 ? -16.679 80.982  40.270  1.00 41.44  ? 244 VAL A O     1 
ATOM   2470 C CB    . VAL C 2 244 ? -14.734 80.829  42.832  1.00 41.51  ? 244 VAL A CB    1 
ATOM   2471 C CG1   . VAL C 2 244 ? -13.773 82.006  42.953  1.00 41.19  ? 244 VAL A CG1   1 
ATOM   2472 C CG2   . VAL C 2 244 ? -14.680 80.011  44.120  1.00 40.96  ? 244 VAL A CG2   1 
ATOM   2473 N N     . ALA C 2 245 ? -16.341 83.100  40.961  1.00 42.07  ? 245 ALA A N     1 
ATOM   2474 C CA    . ALA C 2 245 ? -16.594 83.711  39.664  1.00 41.98  ? 245 ALA A CA    1 
ATOM   2475 C C     . ALA C 2 245 ? -15.729 83.234  38.493  1.00 42.40  ? 245 ALA A C     1 
ATOM   2476 O O     . ALA C 2 245 ? -16.146 83.346  37.334  1.00 43.00  ? 245 ALA A O     1 
ATOM   2477 C CB    . ALA C 2 245 ? -16.522 85.221  39.797  1.00 41.22  ? 245 ALA A CB    1 
ATOM   2478 N N     . ASN C 2 246 ? -14.528 82.728  38.772  1.00 41.76  ? 246 ASN A N     1 
ATOM   2479 C CA    . ASN C 2 246 ? -13.657 82.207  37.706  1.00 40.74  ? 246 ASN A CA    1 
ATOM   2480 C C     . ASN C 2 246 ? -12.621 81.234  38.260  1.00 40.52  ? 246 ASN A C     1 
ATOM   2481 O O     . ASN C 2 246 ? -12.369 81.190  39.481  1.00 40.01  ? 246 ASN A O     1 
ATOM   2482 C CB    . ASN C 2 246 ? -12.978 83.347  36.938  1.00 39.75  ? 246 ASN A CB    1 
ATOM   2483 C CG    . ASN C 2 246 ? -11.850 83.993  37.706  1.00 40.64  ? 246 ASN A CG    1 
ATOM   2484 O OD1   . ASN C 2 246 ? -11.718 83.814  38.919  1.00 42.15  ? 246 ASN A OD1   1 
ATOM   2485 N ND2   . ASN C 2 246 ? -11.025 84.774  37.000  1.00 40.76  ? 246 ASN A ND2   1 
ATOM   2486 N N     . ASP C 2 247 ? -12.031 80.449  37.360  1.00 40.60  ? 247 ASP A N     1 
ATOM   2487 C CA    . ASP C 2 247 ? -11.044 79.440  37.738  1.00 39.88  ? 247 ASP A CA    1 
ATOM   2488 C C     . ASP C 2 247 ? -9.846  80.037  38.449  1.00 39.49  ? 247 ASP A C     1 
ATOM   2489 O O     . ASP C 2 247 ? -9.376  79.494  39.436  1.00 39.72  ? 247 ASP A O     1 
ATOM   2490 C CB    . ASP C 2 247 ? -10.591 78.670  36.508  1.00 40.56  ? 247 ASP A CB    1 
ATOM   2491 C CG    . ASP C 2 247 ? -11.710 77.828  35.893  1.00 42.93  ? 247 ASP A CG    1 
ATOM   2492 O OD1   . ASP C 2 247 ? -11.561 77.424  34.704  1.00 42.78  ? 247 ASP A OD1   1 
ATOM   2493 O OD2   . ASP C 2 247 ? -12.730 77.564  36.596  1.00 42.56  ? 247 ASP A OD2   1 
ATOM   2494 N N     . GLN C 2 248 ? -9.360  81.171  37.977  1.00 39.45  ? 248 GLN A N     1 
ATOM   2495 C CA    . GLN C 2 248 ? -8.212  81.759  38.623  1.00 39.70  ? 248 GLN A CA    1 
ATOM   2496 C C     . GLN C 2 248 ? -8.451  82.103  40.074  1.00 40.49  ? 248 GLN A C     1 
ATOM   2497 O O     . GLN C 2 248 ? -7.593  81.830  40.921  1.00 41.32  ? 248 GLN A O     1 
ATOM   2498 C CB    . GLN C 2 248 ? -7.741  82.968  37.836  1.00 39.76  ? 248 GLN A CB    1 
ATOM   2499 C CG    . GLN C 2 248 ? -7.013  82.542  36.577  1.00 41.11  ? 248 GLN A CG    1 
ATOM   2500 C CD    . GLN C 2 248 ? -6.918  83.635  35.549  1.00 41.58  ? 248 GLN A CD    1 
ATOM   2501 O OE1   . GLN C 2 248 ? -7.849  83.852  34.765  1.00 43.08  ? 248 GLN A OE1   1 
ATOM   2502 N NE2   . GLN C 2 248 ? -5.796  84.341  35.545  1.00 40.77  ? 248 GLN A NE2   1 
ATOM   2503 N N     . MET C 2 249 ? -9.597  82.700  40.395  1.00 41.13  ? 249 MET A N     1 
ATOM   2504 C CA    . MET C 2 249 ? -9.850  83.012  41.805  1.00 41.28  ? 249 MET A CA    1 
ATOM   2505 C C     . MET C 2 249 ? -10.061 81.711  42.577  1.00 40.36  ? 249 MET A C     1 
ATOM   2506 O O     . MET C 2 249 ? -9.648  81.599  43.726  1.00 39.44  ? 249 MET A O     1 
ATOM   2507 C CB    . MET C 2 249 ? -11.051 83.946  41.962  1.00 41.36  ? 249 MET A CB    1 
ATOM   2508 C CG    . MET C 2 249 ? -10.755 85.348  41.433  1.00 42.74  ? 249 MET A CG    1 
ATOM   2509 S SD    . MET C 2 249 ? -12.053 86.573  41.861  1.00 44.04  ? 249 MET A SD    1 
ATOM   2510 C CE    . MET C 2 249 ? -13.473 85.822  40.968  1.00 39.78  ? 249 MET A CE    1 
ATOM   2511 N N     . ALA C 2 250 ? -10.685 80.726  41.939  1.00 40.52  ? 250 ALA A N     1 
ATOM   2512 C CA    . ALA C 2 250 ? -10.890 79.441  42.594  1.00 41.67  ? 250 ALA A CA    1 
ATOM   2513 C C     . ALA C 2 250 ? -9.520  78.912  43.030  1.00 43.20  ? 250 ALA A C     1 
ATOM   2514 O O     . ALA C 2 250 ? -9.361  78.420  44.163  1.00 43.93  ? 250 ALA A O     1 
ATOM   2515 C CB    . ALA C 2 250 ? -11.548 78.467  41.645  1.00 41.53  ? 250 ALA A CB    1 
ATOM   2516 N N     . LEU C 2 251 ? -8.527  79.035  42.139  1.00 43.17  ? 251 LEU A N     1 
ATOM   2517 C CA    . LEU C 2 251 ? -7.171  78.591  42.437  1.00 43.35  ? 251 LEU A CA    1 
ATOM   2518 C C     . LEU C 2 251 ? -6.677  79.238  43.726  1.00 43.85  ? 251 LEU A C     1 
ATOM   2519 O O     . LEU C 2 251 ? -6.143  78.566  44.611  1.00 44.33  ? 251 LEU A O     1 
ATOM   2520 C CB    . LEU C 2 251 ? -6.216  78.955  41.300  1.00 44.22  ? 251 LEU A CB    1 
ATOM   2521 C CG    . LEU C 2 251 ? -4.743  78.595  41.539  1.00 43.32  ? 251 LEU A CG    1 
ATOM   2522 C CD1   . LEU C 2 251 ? -4.588  77.098  41.458  1.00 43.42  ? 251 LEU A CD1   1 
ATOM   2523 C CD2   . LEU C 2 251 ? -3.862  79.274  40.510  1.00 42.87  ? 251 LEU A CD2   1 
ATOM   2524 N N     . GLY C 2 252 ? -6.849  80.547  43.832  1.00 44.11  ? 252 GLY A N     1 
ATOM   2525 C CA    . GLY C 2 252 ? -6.423  81.235  45.037  1.00 44.97  ? 252 GLY A CA    1 
ATOM   2526 C C     . GLY C 2 252 ? -7.230  80.787  46.250  1.00 45.65  ? 252 GLY A C     1 
ATOM   2527 O O     . GLY C 2 252 ? -6.706  80.723  47.370  1.00 45.75  ? 252 GLY A O     1 
ATOM   2528 N N     . ALA C 2 253 ? -8.506  80.472  46.040  1.00 45.71  ? 253 ALA A N     1 
ATOM   2529 C CA    . ALA C 2 253 ? -9.338  80.038  47.151  1.00 46.48  ? 253 ALA A CA    1 
ATOM   2530 C C     . ALA C 2 253 ? -8.779  78.709  47.623  1.00 46.74  ? 253 ALA A C     1 
ATOM   2531 O O     . ALA C 2 253 ? -8.536  78.513  48.825  1.00 46.94  ? 253 ALA A O     1 
ATOM   2532 C CB    . ALA C 2 253 ? -10.794 79.873  46.709  1.00 46.07  ? 253 ALA A CB    1 
ATOM   2533 N N     . MET C 2 254 ? -8.567  77.805  46.670  1.00 46.39  ? 254 MET A N     1 
ATOM   2534 C CA    . MET C 2 254 ? -8.020  76.490  46.978  1.00 46.89  ? 254 MET A CA    1 
ATOM   2535 C C     . MET C 2 254 ? -6.703  76.580  47.754  1.00 47.05  ? 254 MET A C     1 
ATOM   2536 O O     . MET C 2 254 ? -6.457  75.783  48.655  1.00 47.29  ? 254 MET A O     1 
ATOM   2537 C CB    . MET C 2 254 ? -7.826  75.714  45.689  1.00 47.21  ? 254 MET A CB    1 
ATOM   2538 C CG    . MET C 2 254 ? -9.135  75.402  45.030  1.00 48.39  ? 254 MET A CG    1 
ATOM   2539 S SD    . MET C 2 254 ? -8.926  74.750  43.387  1.00 50.62  ? 254 MET A SD    1 
ATOM   2540 C CE    . MET C 2 254 ? -8.171  73.140  43.742  1.00 48.80  ? 254 MET A CE    1 
ATOM   2541 N N     . ARG C 2 255 ? -5.864  77.557  47.421  1.00 47.08  ? 255 ARG A N     1 
ATOM   2542 C CA    . ARG C 2 255 ? -4.596  77.719  48.121  1.00 47.59  ? 255 ARG A CA    1 
ATOM   2543 C C     . ARG C 2 255 ? -4.867  78.070  49.574  1.00 48.37  ? 255 ARG A C     1 
ATOM   2544 O O     . ARG C 2 255 ? -4.289  77.471  50.479  1.00 48.65  ? 255 ARG A O     1 
ATOM   2545 C CB    . ARG C 2 255 ? -3.754  78.828  47.478  1.00 46.87  ? 255 ARG A CB    1 
ATOM   2546 C CG    . ARG C 2 255 ? -2.264  78.590  47.572  1.00 46.68  ? 255 ARG A CG    1 
ATOM   2547 C CD    . ARG C 2 255 ? -1.552  79.403  48.623  1.00 46.19  ? 255 ARG A CD    1 
ATOM   2548 N NE    . ARG C 2 255 ? -1.070  80.673  48.099  1.00 46.93  ? 255 ARG A NE    1 
ATOM   2549 C CZ    . ARG C 2 255 ? -0.254  81.496  48.756  1.00 47.99  ? 255 ARG A CZ    1 
ATOM   2550 N NH1   . ARG C 2 255 ? 0.194   81.186  49.966  1.00 47.59  ? 255 ARG A NH1   1 
ATOM   2551 N NH2   . ARG C 2 255 ? 0.077   82.662  48.222  1.00 49.00  ? 255 ARG A NH2   1 
ATOM   2552 N N     . ALA C 2 256 ? -5.752  79.047  49.786  1.00 49.00  ? 256 ALA A N     1 
ATOM   2553 C CA    . ALA C 2 256 ? -6.107  79.492  51.133  1.00 49.42  ? 256 ALA A CA    1 
ATOM   2554 C C     . ALA C 2 256 ? -6.715  78.344  51.934  1.00 49.50  ? 256 ALA A C     1 
ATOM   2555 O O     . ALA C 2 256 ? -6.342  78.106  53.078  1.00 49.18  ? 256 ALA A O     1 
ATOM   2556 C CB    . ALA C 2 256 ? -7.086  80.651  51.060  1.00 49.67  ? 256 ALA A CB    1 
ATOM   2557 N N     . ILE C 2 257 ? -7.645  77.627  51.327  1.00 49.48  ? 257 ILE A N     1 
ATOM   2558 C CA    . ILE C 2 257 ? -8.256  76.513  52.010  1.00 50.64  ? 257 ILE A CA    1 
ATOM   2559 C C     . ILE C 2 257 ? -7.170  75.537  52.473  1.00 52.41  ? 257 ILE A C     1 
ATOM   2560 O O     . ILE C 2 257 ? -7.063  75.205  53.667  1.00 53.25  ? 257 ILE A O     1 
ATOM   2561 C CB    . ILE C 2 257 ? -9.218  75.770  51.083  1.00 50.14  ? 257 ILE A CB    1 
ATOM   2562 C CG1   . ILE C 2 257 ? -10.391 76.681  50.707  1.00 49.13  ? 257 ILE A CG1   1 
ATOM   2563 C CG2   . ILE C 2 257 ? -9.687  74.488  51.758  1.00 49.88  ? 257 ILE A CG2   1 
ATOM   2564 C CD1   . ILE C 2 257 ? -11.433 76.005  49.835  1.00 48.87  ? 257 ILE A CD1   1 
ATOM   2565 N N     . THR C 2 258 ? -6.354  75.092  51.520  1.00 53.61  ? 258 THR A N     1 
ATOM   2566 C CA    . THR C 2 258 ? -5.289  74.141  51.799  1.00 53.76  ? 258 THR A CA    1 
ATOM   2567 C C     . THR C 2 258 ? -4.284  74.626  52.823  1.00 54.39  ? 258 THR A C     1 
ATOM   2568 O O     . THR C 2 258 ? -3.925  73.880  53.728  1.00 54.33  ? 258 THR A O     1 
ATOM   2569 C CB    . THR C 2 258 ? -4.533  73.764  50.522  1.00 53.83  ? 258 THR A CB    1 
ATOM   2570 O OG1   . THR C 2 258 ? -5.458  73.248  49.557  1.00 54.14  ? 258 THR A OG1   1 
ATOM   2571 C CG2   . THR C 2 258 ? -3.500  72.685  50.821  1.00 53.95  ? 258 THR A CG2   1 
ATOM   2572 N N     . GLU C 2 259 ? -3.831  75.866  52.695  1.00 55.41  ? 259 GLU A N     1 
ATOM   2573 C CA    . GLU C 2 259 ? -2.852  76.386  53.643  1.00 57.03  ? 259 GLU A CA    1 
ATOM   2574 C C     . GLU C 2 259 ? -3.462  76.654  55.013  1.00 58.15  ? 259 GLU A C     1 
ATOM   2575 O O     . GLU C 2 259 ? -2.786  77.140  55.921  1.00 58.18  ? 259 GLU A O     1 
ATOM   2576 C CB    . GLU C 2 259 ? -2.195  77.655  53.096  1.00 56.87  ? 259 GLU A CB    1 
ATOM   2577 C CG    . GLU C 2 259 ? -1.332  77.405  51.854  1.00 57.27  ? 259 GLU A CG    1 
ATOM   2578 C CD    . GLU C 2 259 ? -0.477  78.613  51.465  1.00 58.15  ? 259 GLU A CD    1 
ATOM   2579 O OE1   . GLU C 2 259 ? 0.305   78.500  50.490  1.00 57.38  ? 259 GLU A OE1   1 
ATOM   2580 O OE2   . GLU C 2 259 ? -0.588  79.672  52.136  1.00 58.24  ? 259 GLU A OE2   1 
ATOM   2581 N N     . SER C 2 260 ? -4.745  76.331  55.153  1.00 59.32  ? 260 SER A N     1 
ATOM   2582 C CA    . SER C 2 260 ? -5.449  76.513  56.419  1.00 59.92  ? 260 SER A CA    1 
ATOM   2583 C C     . SER C 2 260 ? -5.624  75.181  57.146  1.00 60.25  ? 260 SER A C     1 
ATOM   2584 O O     . SER C 2 260 ? -6.129  75.140  58.263  1.00 61.22  ? 260 SER A O     1 
ATOM   2585 C CB    . SER C 2 260 ? -6.823  77.151  56.187  1.00 59.68  ? 260 SER A CB    1 
ATOM   2586 O OG    . SER C 2 260 ? -6.688  78.524  55.857  1.00 60.85  ? 260 SER A OG    1 
ATOM   2587 N N     . GLY C 2 261 ? -5.212  74.091  56.517  1.00 59.85  ? 261 GLY A N     1 
ATOM   2588 C CA    . GLY C 2 261 ? -5.345  72.803  57.162  1.00 59.45  ? 261 GLY A CA    1 
ATOM   2589 C C     . GLY C 2 261 ? -6.607  72.087  56.739  1.00 59.87  ? 261 GLY A C     1 
ATOM   2590 O O     . GLY C 2 261 ? -6.914  71.007  57.247  1.00 60.44  ? 261 GLY A O     1 
ATOM   2591 N N     . LEU C 2 262 ? -7.345  72.678  55.808  1.00 59.44  ? 262 LEU A N     1 
ATOM   2592 C CA    . LEU C 2 262 ? -8.576  72.060  55.330  1.00 58.86  ? 262 LEU A CA    1 
ATOM   2593 C C     . LEU C 2 262 ? -8.349  71.420  53.967  1.00 58.58  ? 262 LEU A C     1 
ATOM   2594 O O     . LEU C 2 262 ? -7.486  71.854  53.216  1.00 59.09  ? 262 LEU A O     1 
ATOM   2595 C CB    . LEU C 2 262 ? -9.679  73.116  55.253  1.00 58.69  ? 262 LEU A CB    1 
ATOM   2596 C CG    . LEU C 2 262 ? -9.973  73.809  56.590  1.00 58.57  ? 262 LEU A CG    1 
ATOM   2597 C CD1   . LEU C 2 262 ? -11.137 74.783  56.429  1.00 58.41  ? 262 LEU A CD1   1 
ATOM   2598 C CD2   . LEU C 2 262 ? -10.303 72.753  57.636  1.00 58.13  ? 262 LEU A CD2   1 
ATOM   2599 N N     . ARG C 2 263 ? -9.130  70.398  53.645  1.00 58.20  ? 263 ARG A N     1 
ATOM   2600 C CA    . ARG C 2 263 ? -8.987  69.700  52.376  1.00 58.30  ? 263 ARG A CA    1 
ATOM   2601 C C     . ARG C 2 263 ? -9.979  70.155  51.319  1.00 58.08  ? 263 ARG A C     1 
ATOM   2602 O O     . ARG C 2 263 ? -11.185 69.975  51.477  1.00 58.41  ? 263 ARG A O     1 
ATOM   2603 C CB    . ARG C 2 263 ? -9.169  68.190  52.572  1.00 59.19  ? 263 ARG A CB    1 
ATOM   2604 C CG    . ARG C 2 263 ? -8.378  67.615  53.724  1.00 61.24  ? 263 ARG A CG    1 
ATOM   2605 C CD    . ARG C 2 263 ? -8.387  66.094  53.704  1.00 63.20  ? 263 ARG A CD    1 
ATOM   2606 N NE    . ARG C 2 263 ? -9.707  65.511  53.954  1.00 65.24  ? 263 ARG A NE    1 
ATOM   2607 C CZ    . ARG C 2 263 ? -10.442 65.755  55.036  1.00 65.87  ? 263 ARG A CZ    1 
ATOM   2608 N NH1   . ARG C 2 263 ? -9.989  66.583  55.973  1.00 66.07  ? 263 ARG A NH1   1 
ATOM   2609 N NH2   . ARG C 2 263 ? -11.620 65.156  55.190  1.00 65.82  ? 263 ARG A NH2   1 
ATOM   2610 N N     . VAL C 2 264 ? -9.481  70.729  50.230  1.00 57.35  ? 264 VAL A N     1 
ATOM   2611 C CA    . VAL C 2 264 ? -10.376 71.149  49.166  1.00 56.52  ? 264 VAL A CA    1 
ATOM   2612 C C     . VAL C 2 264 ? -11.151 69.904  48.765  1.00 56.94  ? 264 VAL A C     1 
ATOM   2613 O O     . VAL C 2 264 ? -10.568 68.847  48.535  1.00 56.95  ? 264 VAL A O     1 
ATOM   2614 C CB    . VAL C 2 264 ? -9.602  71.684  47.952  1.00 55.41  ? 264 VAL A CB    1 
ATOM   2615 C CG1   . VAL C 2 264 ? -10.542 71.868  46.773  1.00 55.12  ? 264 VAL A CG1   1 
ATOM   2616 C CG2   . VAL C 2 264 ? -8.947  73.007  48.313  1.00 55.53  ? 264 VAL A CG2   1 
ATOM   2617 N N     . GLY C 2 265 ? -12.468 70.030  48.689  1.00 57.60  ? 265 GLY A N     1 
ATOM   2618 C CA    . GLY C 2 265 ? -13.290 68.890  48.335  1.00 58.21  ? 265 GLY A CA    1 
ATOM   2619 C C     . GLY C 2 265 ? -13.902 68.308  49.597  1.00 58.75  ? 265 GLY A C     1 
ATOM   2620 O O     . GLY C 2 265 ? -15.049 68.596  49.935  1.00 59.68  ? 265 GLY A O     1 
ATOM   2621 N N     . ALA C 2 266 ? -13.123 67.511  50.318  1.00 58.70  ? 266 ALA A N     1 
ATOM   2622 C CA    . ALA C 2 266 ? -13.589 66.870  51.545  1.00 58.11  ? 266 ALA A CA    1 
ATOM   2623 C C     . ALA C 2 266 ? -14.058 67.837  52.638  1.00 57.86  ? 266 ALA A C     1 
ATOM   2624 O O     . ALA C 2 266 ? -15.031 67.560  53.328  1.00 58.31  ? 266 ALA A O     1 
ATOM   2625 C CB    . ALA C 2 266 ? -12.500 65.962  52.094  1.00 57.73  ? 266 ALA A CB    1 
ATOM   2626 N N     . ASP C 2 267 ? -13.375 68.958  52.820  1.00 57.03  ? 267 ASP A N     1 
ATOM   2627 C CA    . ASP C 2 267 ? -13.799 69.894  53.853  1.00 56.77  ? 267 ASP A CA    1 
ATOM   2628 C C     . ASP C 2 267 ? -14.550 71.076  53.256  1.00 56.04  ? 267 ASP A C     1 
ATOM   2629 O O     . ASP C 2 267 ? -15.651 71.410  53.696  1.00 56.84  ? 267 ASP A O     1 
ATOM   2630 C CB    . ASP C 2 267 ? -12.604 70.391  54.652  1.00 58.28  ? 267 ASP A CB    1 
ATOM   2631 C CG    . ASP C 2 267 ? -11.826 69.260  55.280  1.00 60.01  ? 267 ASP A CG    1 
ATOM   2632 O OD1   . ASP C 2 267 ? -12.455 68.219  55.593  1.00 61.29  ? 267 ASP A OD1   1 
ATOM   2633 O OD2   . ASP C 2 267 ? -10.595 69.417  55.466  1.00 60.96  ? 267 ASP A OD2   1 
ATOM   2634 N N     . ILE C 2 268 ? -13.956 71.717  52.258  1.00 54.21  ? 268 ILE A N     1 
ATOM   2635 C CA    . ILE C 2 268 ? -14.615 72.830  51.598  1.00 51.74  ? 268 ILE A CA    1 
ATOM   2636 C C     . ILE C 2 268 ? -14.617 72.604  50.096  1.00 51.03  ? 268 ILE A C     1 
ATOM   2637 O O     . ILE C 2 268 ? -13.582 72.728  49.452  1.00 51.86  ? 268 ILE A O     1 
ATOM   2638 C CB    . ILE C 2 268 ? -13.906 74.143  51.858  1.00 51.18  ? 268 ILE A CB    1 
ATOM   2639 C CG1   . ILE C 2 268 ? -13.826 74.416  53.358  1.00 50.37  ? 268 ILE A CG1   1 
ATOM   2640 C CG2   . ILE C 2 268 ? -14.648 75.252  51.144  1.00 51.29  ? 268 ILE A CG2   1 
ATOM   2641 C CD1   . ILE C 2 268 ? -13.223 75.765  53.686  1.00 49.44  ? 268 ILE A CD1   1 
ATOM   2642 N N     . SER C 2 269 ? -15.765 72.257  49.532  1.00 49.46  ? 269 SER A N     1 
ATOM   2643 C CA    . SER C 2 269 ? -15.838 72.053  48.099  1.00 47.91  ? 269 SER A CA    1 
ATOM   2644 C C     . SER C 2 269 ? -15.684 73.406  47.398  1.00 46.78  ? 269 SER A C     1 
ATOM   2645 O O     . SER C 2 269 ? -15.847 74.450  48.024  1.00 46.34  ? 269 SER A O     1 
ATOM   2646 C CB    . SER C 2 269 ? -17.169 71.404  47.733  1.00 48.79  ? 269 SER A CB    1 
ATOM   2647 O OG    . SER C 2 269 ? -17.215 70.069  48.224  1.00 49.39  ? 269 SER A OG    1 
ATOM   2648 N N     . VAL C 2 270 ? -15.351 73.390  46.110  1.00 45.57  ? 270 VAL A N     1 
ATOM   2649 C CA    . VAL C 2 270 ? -15.164 74.627  45.361  1.00 43.97  ? 270 VAL A CA    1 
ATOM   2650 C C     . VAL C 2 270 ? -15.634 74.462  43.936  1.00 43.67  ? 270 VAL A C     1 
ATOM   2651 O O     . VAL C 2 270 ? -15.537 73.379  43.366  1.00 44.20  ? 270 VAL A O     1 
ATOM   2652 C CB    . VAL C 2 270 ? -13.686 75.047  45.331  1.00 43.64  ? 270 VAL A CB    1 
ATOM   2653 C CG1   . VAL C 2 270 ? -13.520 76.311  44.494  1.00 42.64  ? 270 VAL A CG1   1 
ATOM   2654 C CG2   . VAL C 2 270 ? -13.179 75.283  46.768  1.00 43.72  ? 270 VAL A CG2   1 
ATOM   2655 N N     . VAL C 2 271 ? -16.172 75.529  43.361  1.00 42.83  ? 271 VAL A N     1 
ATOM   2656 C CA    . VAL C 2 271 ? -16.621 75.470  41.982  1.00 42.62  ? 271 VAL A CA    1 
ATOM   2657 C C     . VAL C 2 271 ? -16.106 76.724  41.318  1.00 43.39  ? 271 VAL A C     1 
ATOM   2658 O O     . VAL C 2 271 ? -16.169 77.809  41.897  1.00 44.65  ? 271 VAL A O     1 
ATOM   2659 C CB    . VAL C 2 271 ? -18.146 75.401  41.885  1.00 42.13  ? 271 VAL A CB    1 
ATOM   2660 C CG1   . VAL C 2 271 ? -18.579 75.392  40.416  1.00 40.54  ? 271 VAL A CG1   1 
ATOM   2661 C CG2   . VAL C 2 271 ? -18.637 74.139  42.595  1.00 41.98  ? 271 VAL A CG2   1 
ATOM   2662 N N     . GLY C 2 272 ? -15.571 76.579  40.114  1.00 43.41  ? 272 GLY A N     1 
ATOM   2663 C CA    . GLY C 2 272 ? -15.028 77.733  39.428  1.00 44.04  ? 272 GLY A CA    1 
ATOM   2664 C C     . GLY C 2 272 ? -15.847 78.114  38.223  1.00 44.76  ? 272 GLY A C     1 
ATOM   2665 O O     . GLY C 2 272 ? -16.925 77.573  38.001  1.00 45.31  ? 272 GLY A O     1 
ATOM   2666 N N     . TYR C 2 273 ? -15.327 79.030  37.423  1.00 45.63  ? 273 TYR A N     1 
ATOM   2667 C CA    . TYR C 2 273 ? -16.052 79.481  36.245  1.00 46.59  ? 273 TYR A CA    1 
ATOM   2668 C C     . TYR C 2 273 ? -15.048 79.746  35.108  1.00 46.68  ? 273 TYR A C     1 
ATOM   2669 O O     . TYR C 2 273 ? -14.033 80.416  35.326  1.00 46.66  ? 273 TYR A O     1 
ATOM   2670 C CB    . TYR C 2 273 ? -16.825 80.760  36.626  1.00 47.10  ? 273 TYR A CB    1 
ATOM   2671 C CG    . TYR C 2 273 ? -18.206 80.885  36.011  1.00 48.01  ? 273 TYR A CG    1 
ATOM   2672 C CD1   . TYR C 2 273 ? -18.363 81.342  34.696  1.00 48.39  ? 273 TYR A CD1   1 
ATOM   2673 C CD2   . TYR C 2 273 ? -19.355 80.507  36.726  1.00 46.93  ? 273 TYR A CD2   1 
ATOM   2674 C CE1   . TYR C 2 273 ? -19.618 81.414  34.104  1.00 48.41  ? 273 TYR A CE1   1 
ATOM   2675 C CE2   . TYR C 2 273 ? -20.616 80.571  36.143  1.00 47.00  ? 273 TYR A CE2   1 
ATOM   2676 C CZ    . TYR C 2 273 ? -20.742 81.021  34.828  1.00 48.31  ? 273 TYR A CZ    1 
ATOM   2677 O OH    . TYR C 2 273 ? -21.972 81.026  34.193  1.00 48.09  ? 273 TYR A OH    1 
ATOM   2678 N N     . ASP C 2 274 ? -15.342 79.206  33.920  1.00 46.99  ? 274 ASP A N     1 
ATOM   2679 C CA    . ASP C 2 274 ? -14.522 79.341  32.695  1.00 47.37  ? 274 ASP A CA    1 
ATOM   2680 C C     . ASP C 2 274 ? -14.147 78.000  32.090  1.00 47.20  ? 274 ASP A C     1 
ATOM   2681 O O     . ASP C 2 274 ? -14.345 77.757  30.900  1.00 46.97  ? 274 ASP A O     1 
ATOM   2682 C CB    . ASP C 2 274 ? -13.175 80.042  32.939  1.00 47.92  ? 274 ASP A CB    1 
ATOM   2683 C CG    . ASP C 2 274 ? -13.274 81.561  33.024  1.00 49.03  ? 274 ASP A CG    1 
ATOM   2684 O OD1   . ASP C 2 274 ? -14.338 82.148  32.688  1.00 49.39  ? 274 ASP A OD1   1 
ATOM   2685 O OD2   . ASP C 2 274 ? -12.246 82.164  33.426  1.00 48.60  ? 274 ASP A OD2   1 
ATOM   2686 N N     . ASP C 2 275 ? -13.589 77.141  32.943  1.00 47.46  ? 275 ASP A N     1 
ATOM   2687 C CA    . ASP C 2 275 ? -13.052 75.841  32.545  1.00 47.46  ? 275 ASP A CA    1 
ATOM   2688 C C     . ASP C 2 275 ? -11.818 76.134  31.708  1.00 46.62  ? 275 ASP A C     1 
ATOM   2689 O O     . ASP C 2 275 ? -11.711 75.657  30.588  1.00 46.20  ? 275 ASP A O     1 
ATOM   2690 C CB    . ASP C 2 275 ? -14.011 74.995  31.687  1.00 48.13  ? 275 ASP A CB    1 
ATOM   2691 C CG    . ASP C 2 275 ? -13.370 73.642  31.257  1.00 48.98  ? 275 ASP A CG    1 
ATOM   2692 O OD1   . ASP C 2 275 ? -12.488 73.140  32.004  1.00 48.59  ? 275 ASP A OD1   1 
ATOM   2693 O OD2   . ASP C 2 275 ? -13.743 73.077  30.191  1.00 48.54  ? 275 ASP A OD2   1 
ATOM   2694 N N     . THR C 2 276 ? -10.918 76.955  32.238  1.00 46.31  ? 276 THR A N     1 
ATOM   2695 C CA    . THR C 2 276 ? -9.681  77.283  31.541  1.00 46.92  ? 276 THR A CA    1 
ATOM   2696 C C     . THR C 2 276 ? -8.850  76.005  31.380  1.00 47.99  ? 276 THR A C     1 
ATOM   2697 O O     . THR C 2 276 ? -9.047  75.034  32.120  1.00 47.64  ? 276 THR A O     1 
ATOM   2698 C CB    . THR C 2 276 ? -8.814  78.264  32.352  1.00 46.56  ? 276 THR A CB    1 
ATOM   2699 O OG1   . THR C 2 276 ? -8.517  77.677  33.627  1.00 46.24  ? 276 THR A OG1   1 
ATOM   2700 C CG2   . THR C 2 276 ? -9.511  79.592  32.544  1.00 45.04  ? 276 THR A CG2   1 
ATOM   2701 N N     . GLU C 2 277 ? -7.921  76.012  30.421  1.00 49.34  ? 277 GLU A N     1 
ATOM   2702 C CA    . GLU C 2 277 ? -7.036  74.866  30.177  1.00 50.01  ? 277 GLU A CA    1 
ATOM   2703 C C     . GLU C 2 277 ? -6.331  74.387  31.450  1.00 48.99  ? 277 GLU A C     1 
ATOM   2704 O O     . GLU C 2 277 ? -6.306  73.193  31.736  1.00 48.68  ? 277 GLU A O     1 
ATOM   2705 C CB    . GLU C 2 277 ? -5.995  75.248  29.134  1.00 52.81  ? 277 GLU A CB    1 
ATOM   2706 C CG    . GLU C 2 277 ? -6.531  75.252  27.725  1.00 56.93  ? 277 GLU A CG    1 
ATOM   2707 C CD    . GLU C 2 277 ? -6.689  73.844  27.190  1.00 60.26  ? 277 GLU A CD    1 
ATOM   2708 O OE1   . GLU C 2 277 ? -5.643  73.193  26.926  1.00 63.25  ? 277 GLU A OE1   1 
ATOM   2709 O OE2   . GLU C 2 277 ? -7.848  73.379  27.047  1.00 61.38  ? 277 GLU A OE2   1 
ATOM   2710 N N     . ASP C 2 278 ? -5.777  75.319  32.217  1.00 48.14  ? 278 ASP A N     1 
ATOM   2711 C CA    . ASP C 2 278 ? -5.084  74.964  33.443  1.00 48.43  ? 278 ASP A CA    1 
ATOM   2712 C C     . ASP C 2 278 ? -5.982  74.330  34.509  1.00 48.99  ? 278 ASP A C     1 
ATOM   2713 O O     . ASP C 2 278 ? -5.508  73.500  35.290  1.00 49.37  ? 278 ASP A O     1 
ATOM   2714 C CB    . ASP C 2 278 ? -4.406  76.191  34.077  1.00 48.47  ? 278 ASP A CB    1 
ATOM   2715 C CG    . ASP C 2 278 ? -3.294  76.795  33.209  1.00 49.77  ? 278 ASP A CG    1 
ATOM   2716 O OD1   . ASP C 2 278 ? -2.939  76.234  32.140  1.00 49.52  ? 278 ASP A OD1   1 
ATOM   2717 O OD2   . ASP C 2 278 ? -2.765  77.855  33.621  1.00 50.54  ? 278 ASP A OD2   1 
ATOM   2718 N N     . SER C 2 279 ? -7.263  74.704  34.559  1.00 48.89  ? 279 SER A N     1 
ATOM   2719 C CA    . SER C 2 279 ? -8.156  74.175  35.605  1.00 49.01  ? 279 SER A CA    1 
ATOM   2720 C C     . SER C 2 279 ? -8.188  72.654  35.749  1.00 47.96  ? 279 SER A C     1 
ATOM   2721 O O     . SER C 2 279 ? -8.456  72.138  36.833  1.00 47.33  ? 279 SER A O     1 
ATOM   2722 C CB    . SER C 2 279 ? -9.594  74.715  35.443  1.00 49.81  ? 279 SER A CB    1 
ATOM   2723 O OG    . SER C 2 279 ? -10.230 74.246  34.262  1.00 50.76  ? 279 SER A OG    1 
ATOM   2724 N N     . SER C 2 280 ? -7.903  71.938  34.670  1.00 47.50  ? 280 SER A N     1 
ATOM   2725 C CA    . SER C 2 280 ? -7.894  70.477  34.736  1.00 47.25  ? 280 SER A CA    1 
ATOM   2726 C C     . SER C 2 280 ? -6.670  69.932  35.483  1.00 46.60  ? 280 SER A C     1 
ATOM   2727 O O     . SER C 2 280 ? -6.614  68.741  35.777  1.00 46.48  ? 280 SER A O     1 
ATOM   2728 C CB    . SER C 2 280 ? -7.924  69.879  33.335  1.00 46.92  ? 280 SER A CB    1 
ATOM   2729 O OG    . SER C 2 280 ? -6.725  70.186  32.652  1.00 50.13  ? 280 SER A OG    1 
ATOM   2730 N N     . CYS C 2 281 ? -5.701  70.793  35.796  1.00 46.35  ? 281 CYS A N     1 
ATOM   2731 C CA    . CYS C 2 281 ? -4.502  70.352  36.503  1.00 46.36  ? 281 CYS A CA    1 
ATOM   2732 C C     . CYS C 2 281 ? -4.256  71.028  37.848  1.00 46.52  ? 281 CYS A C     1 
ATOM   2733 O O     . CYS C 2 281 ? -3.138  71.012  38.365  1.00 47.13  ? 281 CYS A O     1 
ATOM   2734 C CB    . CYS C 2 281 ? -3.265  70.509  35.607  1.00 46.62  ? 281 CYS A CB    1 
ATOM   2735 S SG    . CYS C 2 281 ? -3.265  69.414  34.141  1.00 49.62  ? 281 CYS A SG    1 
ATOM   2736 N N     . TYR C 2 282 ? -5.283  71.637  38.423  1.00 46.87  ? 282 TYR A N     1 
ATOM   2737 C CA    . TYR C 2 282 ? -5.117  72.245  39.738  1.00 46.85  ? 282 TYR A CA    1 
ATOM   2738 C C     . TYR C 2 282 ? -5.022  71.093  40.744  1.00 46.57  ? 282 TYR A C     1 
ATOM   2739 O O     . TYR C 2 282 ? -5.330  69.954  40.406  1.00 46.79  ? 282 TYR A O     1 
ATOM   2740 C CB    . TYR C 2 282 ? -6.317  73.118  40.080  1.00 48.60  ? 282 TYR A CB    1 
ATOM   2741 C CG    . TYR C 2 282 ? -6.409  74.429  39.321  1.00 50.08  ? 282 TYR A CG    1 
ATOM   2742 C CD1   . TYR C 2 282 ? -5.376  74.861  38.486  1.00 50.62  ? 282 TYR A CD1   1 
ATOM   2743 C CD2   . TYR C 2 282 ? -7.512  75.270  39.490  1.00 50.38  ? 282 TYR A CD2   1 
ATOM   2744 C CE1   . TYR C 2 282 ? -5.441  76.098  37.850  1.00 50.95  ? 282 TYR A CE1   1 
ATOM   2745 C CE2   . TYR C 2 282 ? -7.583  76.505  38.859  1.00 50.62  ? 282 TYR A CE2   1 
ATOM   2746 C CZ    . TYR C 2 282 ? -6.547  76.915  38.047  1.00 51.03  ? 282 TYR A CZ    1 
ATOM   2747 O OH    . TYR C 2 282 ? -6.598  78.158  37.463  1.00 51.91  ? 282 TYR A OH    1 
ATOM   2748 N N     . ILE C 2 283 ? -4.596  71.374  41.970  1.00 46.46  ? 283 ILE A N     1 
ATOM   2749 C CA    . ILE C 2 283 ? -4.490  70.324  42.988  1.00 46.66  ? 283 ILE A CA    1 
ATOM   2750 C C     . ILE C 2 283 ? -5.588  70.530  44.030  1.00 46.58  ? 283 ILE A C     1 
ATOM   2751 O O     . ILE C 2 283 ? -5.420  71.339  44.947  1.00 47.20  ? 283 ILE A O     1 
ATOM   2752 C CB    . ILE C 2 283 ? -3.145  70.390  43.784  1.00 47.88  ? 283 ILE A CB    1 
ATOM   2753 C CG1   . ILE C 2 283 ? -1.958  70.703  42.864  1.00 48.99  ? 283 ILE A CG1   1 
ATOM   2754 C CG2   . ILE C 2 283 ? -2.919  69.075  44.509  1.00 46.83  ? 283 ILE A CG2   1 
ATOM   2755 C CD1   . ILE C 2 283 ? -1.659  69.642  41.847  1.00 50.13  ? 283 ILE A CD1   1 
ATOM   2756 N N     . PRO C 2 284 ? -6.716  69.809  43.927  1.00 45.93  ? 284 PRO A N     1 
ATOM   2757 C CA    . PRO C 2 284 ? -7.107  68.809  42.930  1.00 45.80  ? 284 PRO A CA    1 
ATOM   2758 C C     . PRO C 2 284 ? -7.832  69.446  41.756  1.00 45.95  ? 284 PRO A C     1 
ATOM   2759 O O     . PRO C 2 284 ? -8.276  70.589  41.841  1.00 45.93  ? 284 PRO A O     1 
ATOM   2760 C CB    . PRO C 2 284 ? -8.025  67.883  43.715  1.00 45.81  ? 284 PRO A CB    1 
ATOM   2761 C CG    . PRO C 2 284 ? -8.728  68.836  44.614  1.00 46.27  ? 284 PRO A CG    1 
ATOM   2762 C CD    . PRO C 2 284 ? -7.623  69.765  45.088  1.00 45.89  ? 284 PRO A CD    1 
ATOM   2763 N N     . PRO C 2 285 ? -7.965  68.704  40.646  1.00 45.89  ? 285 PRO A N     1 
ATOM   2764 C CA    . PRO C 2 285 ? -8.648  69.223  39.458  1.00 45.71  ? 285 PRO A CA    1 
ATOM   2765 C C     . PRO C 2 285 ? -9.947  69.932  39.856  1.00 46.01  ? 285 PRO A C     1 
ATOM   2766 O O     . PRO C 2 285 ? -10.762 69.407  40.624  1.00 46.07  ? 285 PRO A O     1 
ATOM   2767 C CB    . PRO C 2 285 ? -8.883  67.969  38.627  1.00 45.93  ? 285 PRO A CB    1 
ATOM   2768 C CG    . PRO C 2 285 ? -7.709  67.137  38.959  1.00 45.89  ? 285 PRO A CG    1 
ATOM   2769 C CD    . PRO C 2 285 ? -7.592  67.295  40.462  1.00 45.58  ? 285 PRO A CD    1 
ATOM   2770 N N     . LEU C 2 286 ? -10.112 71.138  39.322  1.00 45.66  ? 286 LEU A N     1 
ATOM   2771 C CA    . LEU C 2 286 ? -11.242 72.009  39.611  1.00 44.35  ? 286 LEU A CA    1 
ATOM   2772 C C     . LEU C 2 286 ? -12.539 71.781  38.851  1.00 44.74  ? 286 LEU A C     1 
ATOM   2773 O O     . LEU C 2 286 ? -12.572 71.805  37.613  1.00 44.36  ? 286 LEU A O     1 
ATOM   2774 C CB    . LEU C 2 286 ? -10.810 73.454  39.399  1.00 43.40  ? 286 LEU A CB    1 
ATOM   2775 C CG    . LEU C 2 286 ? -11.875 74.541  39.524  1.00 43.58  ? 286 LEU A CG    1 
ATOM   2776 C CD1   . LEU C 2 286 ? -12.466 74.550  40.955  1.00 42.43  ? 286 LEU A CD1   1 
ATOM   2777 C CD2   . LEU C 2 286 ? -11.236 75.898  39.184  1.00 42.63  ? 286 LEU A CD2   1 
ATOM   2778 N N     . THR C 2 287 ? -13.614 71.567  39.613  1.00 45.05  ? 287 THR A N     1 
ATOM   2779 C CA    . THR C 2 287 ? -14.949 71.417  39.035  1.00 45.08  ? 287 THR A CA    1 
ATOM   2780 C C     . THR C 2 287 ? -15.298 72.852  38.596  1.00 44.52  ? 287 THR A C     1 
ATOM   2781 O O     . THR C 2 287 ? -15.098 73.815  39.362  1.00 43.72  ? 287 THR A O     1 
ATOM   2782 C CB    . THR C 2 287 ? -15.944 70.933  40.086  1.00 45.73  ? 287 THR A CB    1 
ATOM   2783 O OG1   . THR C 2 287 ? -15.602 69.592  40.467  1.00 47.06  ? 287 THR A OG1   1 
ATOM   2784 C CG2   . THR C 2 287 ? -17.366 70.971  39.531  1.00 46.04  ? 287 THR A CG2   1 
ATOM   2785 N N     . THR C 2 288 ? -15.816 73.008  37.386  1.00 43.91  ? 288 THR A N     1 
ATOM   2786 C CA    . THR C 2 288 ? -16.066 74.359  36.902  1.00 44.26  ? 288 THR A CA    1 
ATOM   2787 C C     . THR C 2 288 ? -17.151 74.416  35.837  1.00 44.20  ? 288 THR A C     1 
ATOM   2788 O O     . THR C 2 288 ? -17.675 73.385  35.393  1.00 45.16  ? 288 THR A O     1 
ATOM   2789 C CB    . THR C 2 288 ? -14.737 74.933  36.318  1.00 44.74  ? 288 THR A CB    1 
ATOM   2790 O OG1   . THR C 2 288 ? -14.888 76.315  35.961  1.00 45.49  ? 288 THR A OG1   1 
ATOM   2791 C CG2   . THR C 2 288 ? -14.331 74.134  35.071  1.00 44.53  ? 288 THR A CG2   1 
ATOM   2792 N N     . ILE C 2 289 ? -17.478 75.631  35.426  1.00 43.86  ? 289 ILE A N     1 
ATOM   2793 C CA    . ILE C 2 289 ? -18.492 75.833  34.407  1.00 43.87  ? 289 ILE A CA    1 
ATOM   2794 C C     . ILE C 2 289 ? -17.744 76.164  33.131  1.00 44.56  ? 289 ILE A C     1 
ATOM   2795 O O     . ILE C 2 289 ? -16.942 77.103  33.097  1.00 44.79  ? 289 ILE A O     1 
ATOM   2796 C CB    . ILE C 2 289 ? -19.425 77.018  34.757  1.00 43.29  ? 289 ILE A CB    1 
ATOM   2797 C CG1   . ILE C 2 289 ? -20.067 76.818  36.143  1.00 42.04  ? 289 ILE A CG1   1 
ATOM   2798 C CG2   . ILE C 2 289 ? -20.462 77.172  33.656  1.00 42.55  ? 289 ILE A CG2   1 
ATOM   2799 C CD1   . ILE C 2 289 ? -20.963 75.594  36.259  1.00 41.35  ? 289 ILE A CD1   1 
ATOM   2800 N N     . LYS C 2 290 ? -18.012 75.413  32.076  1.00 45.07  ? 290 LYS A N     1 
ATOM   2801 C CA    . LYS C 2 290 ? -17.315 75.639  30.830  1.00 46.44  ? 290 LYS A CA    1 
ATOM   2802 C C     . LYS C 2 290 ? -17.878 76.723  29.926  1.00 47.41  ? 290 LYS A C     1 
ATOM   2803 O O     . LYS C 2 290 ? -19.039 76.673  29.520  1.00 48.13  ? 290 LYS A O     1 
ATOM   2804 C CB    . LYS C 2 290 ? -17.234 74.331  30.049  1.00 47.25  ? 290 LYS A CB    1 
ATOM   2805 C CG    . LYS C 2 290 ? -16.679 74.486  28.639  1.00 47.99  ? 290 LYS A CG    1 
ATOM   2806 C CD    . LYS C 2 290 ? -16.680 73.147  27.918  1.00 49.84  ? 290 LYS A CD    1 
ATOM   2807 C CE    . LYS C 2 290 ? -16.087 73.277  26.530  1.00 50.57  ? 290 LYS A CE    1 
ATOM   2808 N NZ    . LYS C 2 290 ? -16.276 72.011  25.766  1.00 52.27  ? 290 LYS A NZ    1 
ATOM   2809 N N     . GLN C 2 291 ? -17.034 77.693  29.595  1.00 48.23  ? 291 GLN A N     1 
ATOM   2810 C CA    . GLN C 2 291 ? -17.411 78.772  28.696  1.00 49.48  ? 291 GLN A CA    1 
ATOM   2811 C C     . GLN C 2 291 ? -16.518 78.669  27.468  1.00 49.84  ? 291 GLN A C     1 
ATOM   2812 O O     . GLN C 2 291 ? -15.350 79.067  27.494  1.00 50.82  ? 291 GLN A O     1 
ATOM   2813 C CB    . GLN C 2 291 ? -17.201 80.133  29.352  1.00 50.76  ? 291 GLN A CB    1 
ATOM   2814 C CG    . GLN C 2 291 ? -18.053 80.403  30.580  1.00 52.57  ? 291 GLN A CG    1 
ATOM   2815 C CD    . GLN C 2 291 ? -18.052 81.875  30.912  1.00 54.35  ? 291 GLN A CD    1 
ATOM   2816 O OE1   . GLN C 2 291 ? -19.062 82.565  30.738  1.00 55.23  ? 291 GLN A OE1   1 
ATOM   2817 N NE2   . GLN C 2 291 ? -16.899 82.382  31.362  1.00 55.17  ? 291 GLN A NE2   1 
ATOM   2818 N N     . ASP C 2 292 ? -17.077 78.147  26.387  1.00 50.04  ? 292 ASP A N     1 
ATOM   2819 C CA    . ASP C 2 292 ? -16.334 77.972  25.149  1.00 49.76  ? 292 ASP A CA    1 
ATOM   2820 C C     . ASP C 2 292 ? -16.029 79.274  24.426  1.00 49.80  ? 292 ASP A C     1 
ATOM   2821 O O     . ASP C 2 292 ? -16.764 79.692  23.525  1.00 49.98  ? 292 ASP A O     1 
ATOM   2822 C CB    . ASP C 2 292 ? -17.112 77.040  24.229  1.00 50.93  ? 292 ASP A CB    1 
ATOM   2823 C CG    . ASP C 2 292 ? -16.333 76.661  22.986  1.00 52.38  ? 292 ASP A CG    1 
ATOM   2824 O OD1   . ASP C 2 292 ? -16.765 75.683  22.327  1.00 52.97  ? 292 ASP A OD1   1 
ATOM   2825 O OD2   . ASP C 2 292 ? -15.311 77.333  22.665  1.00 52.45  ? 292 ASP A OD2   1 
ATOM   2826 N N     . PHE C 2 293 ? -14.924 79.903  24.795  1.00 49.65  ? 293 PHE A N     1 
ATOM   2827 C CA    . PHE C 2 293 ? -14.544 81.157  24.172  1.00 50.28  ? 293 PHE A CA    1 
ATOM   2828 C C     . PHE C 2 293 ? -14.399 81.098  22.655  1.00 51.08  ? 293 PHE A C     1 
ATOM   2829 O O     . PHE C 2 293 ? -14.678 82.076  21.965  1.00 50.85  ? 293 PHE A O     1 
ATOM   2830 C CB    . PHE C 2 293 ? -13.258 81.660  24.798  1.00 50.19  ? 293 PHE A CB    1 
ATOM   2831 C CG    . PHE C 2 293 ? -13.356 81.855  26.276  1.00 50.72  ? 293 PHE A CG    1 
ATOM   2832 C CD1   . PHE C 2 293 ? -12.573 81.104  27.144  1.00 50.52  ? 293 PHE A CD1   1 
ATOM   2833 C CD2   . PHE C 2 293 ? -14.228 82.799  26.806  1.00 50.52  ? 293 PHE A CD2   1 
ATOM   2834 C CE1   . PHE C 2 293 ? -12.657 81.295  28.528  1.00 51.71  ? 293 PHE A CE1   1 
ATOM   2835 C CE2   . PHE C 2 293 ? -14.318 82.996  28.180  1.00 51.23  ? 293 PHE A CE2   1 
ATOM   2836 C CZ    . PHE C 2 293 ? -13.536 82.247  29.044  1.00 51.22  ? 293 PHE A CZ    1 
ATOM   2837 N N     . ARG C 2 294 ? -13.955 79.964  22.125  1.00 52.37  ? 294 ARG A N     1 
ATOM   2838 C CA    . ARG C 2 294 ? -13.800 79.851  20.676  1.00 53.58  ? 294 ARG A CA    1 
ATOM   2839 C C     . ARG C 2 294 ? -15.169 80.107  20.060  1.00 52.99  ? 294 ARG A C     1 
ATOM   2840 O O     . ARG C 2 294 ? -15.323 80.908  19.124  1.00 52.62  ? 294 ARG A O     1 
ATOM   2841 C CB    . ARG C 2 294 ? -13.335 78.440  20.289  1.00 56.21  ? 294 ARG A CB    1 
ATOM   2842 C CG    . ARG C 2 294 ? -11.868 78.131  20.561  1.00 59.31  ? 294 ARG A CG    1 
ATOM   2843 C CD    . ARG C 2 294 ? -11.113 78.076  19.239  1.00 62.04  ? 294 ARG A CD    1 
ATOM   2844 N NE    . ARG C 2 294 ? -10.325 79.272  18.993  1.00 64.63  ? 294 ARG A NE    1 
ATOM   2845 C CZ    . ARG C 2 294 ? -9.894  79.702  17.809  1.00 65.25  ? 294 ARG A CZ    1 
ATOM   2846 N NH1   . ARG C 2 294 ? -10.174 79.045  16.682  1.00 65.55  ? 294 ARG A NH1   1 
ATOM   2847 N NH2   . ARG C 2 294 ? -9.147  80.801  17.771  1.00 65.32  ? 294 ARG A NH2   1 
ATOM   2848 N N     . LEU C 2 295 ? -16.168 79.418  20.605  1.00 51.78  ? 295 LEU A N     1 
ATOM   2849 C CA    . LEU C 2 295 ? -17.532 79.548  20.120  1.00 51.21  ? 295 LEU A CA    1 
ATOM   2850 C C     . LEU C 2 295 ? -18.021 81.004  20.169  1.00 50.84  ? 295 LEU A C     1 
ATOM   2851 O O     . LEU C 2 295 ? -18.623 81.502  19.216  1.00 50.33  ? 295 LEU A O     1 
ATOM   2852 C CB    . LEU C 2 295 ? -18.445 78.648  20.947  1.00 50.94  ? 295 LEU A CB    1 
ATOM   2853 C CG    . LEU C 2 295 ? -19.932 78.725  20.603  1.00 51.58  ? 295 LEU A CG    1 
ATOM   2854 C CD1   . LEU C 2 295 ? -20.156 78.335  19.146  1.00 50.03  ? 295 LEU A CD1   1 
ATOM   2855 C CD2   . LEU C 2 295 ? -20.706 77.801  21.553  1.00 50.87  ? 295 LEU A CD2   1 
ATOM   2856 N N     . LEU C 2 296 ? -17.750 81.691  21.273  1.00 50.50  ? 296 LEU A N     1 
ATOM   2857 C CA    . LEU C 2 296 ? -18.178 83.077  21.400  1.00 50.80  ? 296 LEU A CA    1 
ATOM   2858 C C     . LEU C 2 296 ? -17.560 83.935  20.298  1.00 51.79  ? 296 LEU A C     1 
ATOM   2859 O O     . LEU C 2 296 ? -18.272 84.682  19.618  1.00 52.19  ? 296 LEU A O     1 
ATOM   2860 C CB    . LEU C 2 296 ? -17.806 83.632  22.777  1.00 49.84  ? 296 LEU A CB    1 
ATOM   2861 C CG    . LEU C 2 296 ? -18.027 85.134  22.963  1.00 48.98  ? 296 LEU A CG    1 
ATOM   2862 C CD1   . LEU C 2 296 ? -19.507 85.434  22.808  1.00 48.61  ? 296 LEU A CD1   1 
ATOM   2863 C CD2   . LEU C 2 296 ? -17.511 85.587  24.339  1.00 47.85  ? 296 LEU A CD2   1 
ATOM   2864 N N     . GLY C 2 297 ? -16.244 83.817  20.112  1.00 52.57  ? 297 GLY A N     1 
ATOM   2865 C CA    . GLY C 2 297 ? -15.558 84.591  19.080  1.00 53.05  ? 297 GLY A CA    1 
ATOM   2866 C C     . GLY C 2 297 ? -16.005 84.210  17.679  1.00 53.55  ? 297 GLY A C     1 
ATOM   2867 O O     . GLY C 2 297 ? -16.153 85.067  16.812  1.00 53.42  ? 297 GLY A O     1 
ATOM   2868 N N     . GLN C 2 298 ? -16.219 82.921  17.449  1.00 54.50  ? 298 GLN A N     1 
ATOM   2869 C CA    . GLN C 2 298 ? -16.662 82.455  16.137  1.00 55.94  ? 298 GLN A CA    1 
ATOM   2870 C C     . GLN C 2 298 ? -18.042 83.044  15.832  1.00 56.23  ? 298 GLN A C     1 
ATOM   2871 O O     . GLN C 2 298 ? -18.273 83.633  14.768  1.00 56.08  ? 298 GLN A O     1 
ATOM   2872 C CB    . GLN C 2 298 ? -16.713 80.926  16.126  1.00 56.87  ? 298 GLN A CB    1 
ATOM   2873 C CG    . GLN C 2 298 ? -17.296 80.337  14.863  1.00 59.83  ? 298 GLN A CG    1 
ATOM   2874 C CD    . GLN C 2 298 ? -18.798 80.155  14.959  1.00 62.00  ? 298 GLN A CD    1 
ATOM   2875 O OE1   . GLN C 2 298 ? -19.285 79.262  15.669  1.00 62.67  ? 298 GLN A OE1   1 
ATOM   2876 N NE2   . GLN C 2 298 ? -19.549 81.009  14.252  1.00 62.79  ? 298 GLN A NE2   1 
ATOM   2877 N N     . THR C 2 299 ? -18.947 82.895  16.795  1.00 56.64  ? 299 THR A N     1 
ATOM   2878 C CA    . THR C 2 299 ? -20.304 83.399  16.670  1.00 56.35  ? 299 THR A CA    1 
ATOM   2879 C C     . THR C 2 299 ? -20.332 84.915  16.533  1.00 56.37  ? 299 THR A C     1 
ATOM   2880 O O     . THR C 2 299 ? -21.083 85.454  15.737  1.00 56.13  ? 299 THR A O     1 
ATOM   2881 C CB    . THR C 2 299 ? -21.132 82.996  17.878  1.00 56.28  ? 299 THR A CB    1 
ATOM   2882 O OG1   . THR C 2 299 ? -21.073 81.573  18.040  1.00 56.71  ? 299 THR A OG1   1 
ATOM   2883 C CG2   . THR C 2 299 ? -22.572 83.404  17.672  1.00 57.02  ? 299 THR A CG2   1 
ATOM   2884 N N     . SER C 2 300 ? -19.505 85.604  17.304  1.00 56.94  ? 300 SER A N     1 
ATOM   2885 C CA    . SER C 2 300 ? -19.462 87.056  17.237  1.00 58.27  ? 300 SER A CA    1 
ATOM   2886 C C     . SER C 2 300 ? -19.199 87.574  15.835  1.00 59.32  ? 300 SER A C     1 
ATOM   2887 O O     . SER C 2 300 ? -19.843 88.517  15.378  1.00 59.93  ? 300 SER A O     1 
ATOM   2888 C CB    . SER C 2 300 ? -18.377 87.601  18.159  1.00 58.65  ? 300 SER A CB    1 
ATOM   2889 O OG    . SER C 2 300 ? -18.612 87.212  19.499  1.00 60.83  ? 300 SER A OG    1 
ATOM   2890 N N     . VAL C 2 301 ? -18.232 86.974  15.154  1.00 60.63  ? 301 VAL A N     1 
ATOM   2891 C CA    . VAL C 2 301 ? -17.902 87.418  13.813  1.00 61.07  ? 301 VAL A CA    1 
ATOM   2892 C C     . VAL C 2 301 ? -19.039 87.103  12.860  1.00 61.39  ? 301 VAL A C     1 
ATOM   2893 O O     . VAL C 2 301 ? -19.497 87.981  12.131  1.00 61.22  ? 301 VAL A O     1 
ATOM   2894 C CB    . VAL C 2 301 ? -16.585 86.772  13.315  1.00 61.50  ? 301 VAL A CB    1 
ATOM   2895 C CG1   . VAL C 2 301 ? -16.369 87.087  11.823  1.00 60.70  ? 301 VAL A CG1   1 
ATOM   2896 C CG2   . VAL C 2 301 ? -15.412 87.315  14.135  1.00 60.87  ? 301 VAL A CG2   1 
ATOM   2897 N N     . ASP C 2 302 ? -19.499 85.859  12.867  1.00 61.94  ? 302 ASP A N     1 
ATOM   2898 C CA    . ASP C 2 302 ? -20.597 85.476  11.994  1.00 63.54  ? 302 ASP A CA    1 
ATOM   2899 C C     . ASP C 2 302 ? -21.760 86.449  12.177  1.00 64.50  ? 302 ASP A C     1 
ATOM   2900 O O     . ASP C 2 302 ? -22.303 86.979  11.197  1.00 64.61  ? 302 ASP A O     1 
ATOM   2901 C CB    . ASP C 2 302 ? -21.035 84.049  12.308  1.00 63.90  ? 302 ASP A CB    1 
ATOM   2902 C CG    . ASP C 2 302 ? -19.980 83.026  11.908  1.00 65.59  ? 302 ASP A CG    1 
ATOM   2903 O OD1   . ASP C 2 302 ? -18.828 83.448  11.634  1.00 66.07  ? 302 ASP A OD1   1 
ATOM   2904 O OD2   . ASP C 2 302 ? -20.292 81.810  11.871  1.00 66.04  ? 302 ASP A OD2   1 
ATOM   2905 N N     . ARG C 2 303 ? -22.109 86.709  13.437  1.00 65.05  ? 303 ARG A N     1 
ATOM   2906 C CA    . ARG C 2 303 ? -23.206 87.611  13.765  1.00 64.95  ? 303 ARG A CA    1 
ATOM   2907 C C     . ARG C 2 303 ? -22.974 89.042  13.315  1.00 64.73  ? 303 ARG A C     1 
ATOM   2908 O O     . ARG C 2 303 ? -23.877 89.669  12.766  1.00 65.12  ? 303 ARG A O     1 
ATOM   2909 C CB    . ARG C 2 303 ? -23.476 87.619  15.269  1.00 65.84  ? 303 ARG A CB    1 
ATOM   2910 C CG    . ARG C 2 303 ? -24.502 88.668  15.671  1.00 66.84  ? 303 ARG A CG    1 
ATOM   2911 C CD    . ARG C 2 303 ? -25.923 88.137  15.646  1.00 68.09  ? 303 ARG A CD    1 
ATOM   2912 N NE    . ARG C 2 303 ? -26.234 87.596  16.952  1.00 70.11  ? 303 ARG A NE    1 
ATOM   2913 C CZ    . ARG C 2 303 ? -26.798 88.248  17.976  1.00 71.09  ? 303 ARG A CZ    1 
ATOM   2914 N NH1   . ARG C 2 303 ? -27.189 89.526  17.905  1.00 69.85  ? 303 ARG A NH1   1 
ATOM   2915 N NH2   . ARG C 2 303 ? -26.888 87.603  19.133  1.00 71.31  ? 303 ARG A NH2   1 
ATOM   2916 N N     . LEU C 2 304 ? -21.785 89.578  13.555  1.00 64.52  ? 304 LEU A N     1 
ATOM   2917 C CA    . LEU C 2 304 ? -21.537 90.954  13.151  1.00 65.12  ? 304 LEU A CA    1 
ATOM   2918 C C     . LEU C 2 304 ? -21.656 91.101  11.643  1.00 66.01  ? 304 LEU A C     1 
ATOM   2919 O O     . LEU C 2 304 ? -22.055 92.152  11.153  1.00 66.10  ? 304 LEU A O     1 
ATOM   2920 C CB    . LEU C 2 304 ? -20.155 91.436  13.592  1.00 64.06  ? 304 LEU A CB    1 
ATOM   2921 C CG    . LEU C 2 304 ? -19.927 92.906  13.215  1.00 63.51  ? 304 LEU A CG    1 
ATOM   2922 C CD1   . LEU C 2 304 ? -20.791 93.795  14.100  1.00 63.65  ? 304 LEU A CD1   1 
ATOM   2923 C CD2   . LEU C 2 304 ? -18.474 93.279  13.378  1.00 63.49  ? 304 LEU A CD2   1 
ATOM   2924 N N     . LEU C 2 305 ? -21.309 90.053  10.903  1.00 67.21  ? 305 LEU A N     1 
ATOM   2925 C CA    . LEU C 2 305 ? -21.391 90.117  9.452   1.00 68.60  ? 305 LEU A CA    1 
ATOM   2926 C C     . LEU C 2 305 ? -22.857 90.084  9.012   1.00 69.72  ? 305 LEU A C     1 
ATOM   2927 O O     . LEU C 2 305 ? -23.270 90.861  8.141   1.00 69.46  ? 305 LEU A O     1 
ATOM   2928 C CB    . LEU C 2 305 ? -20.597 88.966  8.821   1.00 68.46  ? 305 LEU A CB    1 
ATOM   2929 C CG    . LEU C 2 305 ? -19.074 89.021  9.038   1.00 69.13  ? 305 LEU A CG    1 
ATOM   2930 C CD1   . LEU C 2 305 ? -18.417 87.784  8.420   1.00 68.48  ? 305 LEU A CD1   1 
ATOM   2931 C CD2   . LEU C 2 305 ? -18.499 90.307  8.431   1.00 68.59  ? 305 LEU A CD2   1 
ATOM   2932 N N     . GLN C 2 306 ? -23.641 89.191  9.619   1.00 70.88  ? 306 GLN A N     1 
ATOM   2933 C CA    . GLN C 2 306 ? -25.063 89.088  9.303   1.00 72.06  ? 306 GLN A CA    1 
ATOM   2934 C C     . GLN C 2 306 ? -25.682 90.465  9.499   1.00 72.69  ? 306 GLN A C     1 
ATOM   2935 O O     . GLN C 2 306 ? -26.383 90.967  8.625   1.00 72.98  ? 306 GLN A O     1 
ATOM   2936 C CB    . GLN C 2 306 ? -25.755 88.086  10.228  1.00 72.31  ? 306 GLN A CB    1 
ATOM   2937 C CG    . GLN C 2 306 ? -25.296 86.644  10.064  1.00 73.73  ? 306 GLN A CG    1 
ATOM   2938 C CD    . GLN C 2 306 ? -25.733 85.739  11.221  1.00 74.88  ? 306 GLN A CD    1 
ATOM   2939 O OE1   . GLN C 2 306 ? -25.408 84.549  11.246  1.00 75.36  ? 306 GLN A OE1   1 
ATOM   2940 N NE2   . GLN C 2 306 ? -26.465 86.304  12.185  1.00 74.93  ? 306 GLN A NE2   1 
ATOM   2941 N N     . LEU C 2 307 ? -25.413 91.071  10.649  1.00 73.56  ? 307 LEU A N     1 
ATOM   2942 C CA    . LEU C 2 307 ? -25.939 92.395  10.954  1.00 74.97  ? 307 LEU A CA    1 
ATOM   2943 C C     . LEU C 2 307 ? -25.532 93.391  9.886   1.00 75.88  ? 307 LEU A C     1 
ATOM   2944 O O     . LEU C 2 307 ? -26.348 94.190  9.428   1.00 76.25  ? 307 LEU A O     1 
ATOM   2945 C CB    . LEU C 2 307 ? -25.424 92.886  12.311  1.00 74.85  ? 307 LEU A CB    1 
ATOM   2946 C CG    . LEU C 2 307 ? -26.000 92.197  13.545  1.00 74.72  ? 307 LEU A CG    1 
ATOM   2947 C CD1   . LEU C 2 307 ? -25.287 92.714  14.778  1.00 74.75  ? 307 LEU A CD1   1 
ATOM   2948 C CD2   . LEU C 2 307 ? -27.499 92.452  13.635  1.00 74.39  ? 307 LEU A CD2   1 
ATOM   2949 N N     . SER C 2 308 ? -24.263 93.341  9.498   1.00 76.95  ? 308 SER A N     1 
ATOM   2950 C CA    . SER C 2 308 ? -23.731 94.241  8.484   1.00 78.02  ? 308 SER A CA    1 
ATOM   2951 C C     . SER C 2 308 ? -24.533 94.097  7.190   1.00 78.68  ? 308 SER A C     1 
ATOM   2952 O O     . SER C 2 308 ? -24.633 95.036  6.399   1.00 78.30  ? 308 SER A O     1 
ATOM   2953 C CB    . SER C 2 308 ? -22.258 93.922  8.230   1.00 78.06  ? 308 SER A CB    1 
ATOM   2954 O OG    . SER C 2 308 ? -21.573 95.075  7.776   1.00 79.04  ? 308 SER A OG    1 
ATOM   2955 N N     . GLN C 2 309 ? -25.107 92.913  6.992   1.00 79.72  ? 309 GLN A N     1 
ATOM   2956 C CA    . GLN C 2 309 ? -25.913 92.625  5.813   1.00 80.96  ? 309 GLN A CA    1 
ATOM   2957 C C     . GLN C 2 309 ? -27.402 92.830  6.085   1.00 81.36  ? 309 GLN A C     1 
ATOM   2958 O O     . GLN C 2 309 ? -28.247 92.208  5.442   1.00 81.63  ? 309 GLN A O     1 
ATOM   2959 C CB    . GLN C 2 309 ? -25.679 91.186  5.366   1.00 81.65  ? 309 GLN A CB    1 
ATOM   2960 C CG    . GLN C 2 309 ? -24.360 90.970  4.661   1.00 83.49  ? 309 GLN A CG    1 
ATOM   2961 C CD    . GLN C 2 309 ? -24.121 89.505  4.363   1.00 84.96  ? 309 GLN A CD    1 
ATOM   2962 O OE1   . GLN C 2 309 ? -25.065 88.709  4.332   1.00 85.94  ? 309 GLN A OE1   1 
ATOM   2963 N NE2   . GLN C 2 309 ? -22.860 89.138  4.131   1.00 85.43  ? 309 GLN A NE2   1 
ATOM   2964 N N     . GLY C 2 310 ? -27.718 93.694  7.045   1.00 81.58  ? 310 GLY A N     1 
ATOM   2965 C CA    . GLY C 2 310 ? -29.104 93.960  7.378   1.00 81.65  ? 310 GLY A CA    1 
ATOM   2966 C C     . GLY C 2 310 ? -29.937 92.720  7.658   1.00 81.89  ? 310 GLY A C     1 
ATOM   2967 O O     . GLY C 2 310 ? -31.161 92.761  7.548   1.00 82.16  ? 310 GLY A O     1 
ATOM   2968 N N     . GLN C 2 311 ? -29.292 91.615  8.017   1.00 81.81  ? 311 GLN A N     1 
ATOM   2969 C CA    . GLN C 2 311 ? -30.017 90.384  8.312   1.00 81.91  ? 311 GLN A CA    1 
ATOM   2970 C C     . GLN C 2 311 ? -30.793 90.594  9.620   1.00 81.37  ? 311 GLN A C     1 
ATOM   2971 O O     . GLN C 2 311 ? -30.268 91.175  10.570  1.00 81.47  ? 311 GLN A O     1 
ATOM   2972 C CB    . GLN C 2 311 ? -29.025 89.228  8.448   1.00 83.05  ? 311 GLN A CB    1 
ATOM   2973 C CG    . GLN C 2 311 ? -29.619 87.841  8.227   1.00 84.95  ? 311 GLN A CG    1 
ATOM   2974 C CD    . GLN C 2 311 ? -28.544 86.751  8.132   1.00 86.17  ? 311 GLN A CD    1 
ATOM   2975 O OE1   . GLN C 2 311 ? -27.579 86.876  7.364   1.00 86.38  ? 311 GLN A OE1   1 
ATOM   2976 N NE2   . GLN C 2 311 ? -28.712 85.675  8.908   1.00 86.37  ? 311 GLN A NE2   1 
ATOM   2977 N N     . ALA C 2 312 ? -32.041 90.133  9.666   1.00 80.54  ? 312 ALA A N     1 
ATOM   2978 C CA    . ALA C 2 312 ? -32.883 90.299  10.857  1.00 79.04  ? 312 ALA A CA    1 
ATOM   2979 C C     . ALA C 2 312 ? -32.499 89.369  12.012  1.00 77.83  ? 312 ALA A C     1 
ATOM   2980 O O     . ALA C 2 312 ? -33.162 88.350  12.257  1.00 77.94  ? 312 ALA A O     1 
ATOM   2981 C CB    . ALA C 2 312 ? -34.356 90.092  10.489  1.00 79.05  ? 312 ALA A CB    1 
ATOM   2982 N N     . VAL C 2 313 ? -31.440 89.742  12.729  1.00 75.78  ? 313 VAL A N     1 
ATOM   2983 C CA    . VAL C 2 313 ? -30.942 88.962  13.860  1.00 73.55  ? 313 VAL A CA    1 
ATOM   2984 C C     . VAL C 2 313 ? -30.573 89.875  15.034  1.00 72.04  ? 313 VAL A C     1 
ATOM   2985 O O     . VAL C 2 313 ? -29.629 89.601  15.781  1.00 71.97  ? 313 VAL A O     1 
ATOM   2986 C CB    . VAL C 2 313 ? -29.704 88.170  13.438  1.00 73.64  ? 313 VAL A CB    1 
ATOM   2987 C CG1   . VAL C 2 313 ? -30.106 87.059  12.488  1.00 73.63  ? 313 VAL A CG1   1 
ATOM   2988 C CG2   . VAL C 2 313 ? -28.710 89.104  12.753  1.00 73.23  ? 313 VAL A CG2   1 
ATOM   2989 N N     . LYS C 2 314 ? -31.325 90.964  15.180  1.00 70.09  ? 314 LYS A N     1 
ATOM   2990 C CA    . LYS C 2 314 ? -31.100 91.945  16.238  1.00 67.47  ? 314 LYS A CA    1 
ATOM   2991 C C     . LYS C 2 314 ? -31.407 91.359  17.614  1.00 65.25  ? 314 LYS A C     1 
ATOM   2992 O O     . LYS C 2 314 ? -32.095 90.341  17.728  1.00 64.36  ? 314 LYS A O     1 
ATOM   2993 C CB    . LYS C 2 314 ? -31.985 93.179  15.997  1.00 68.28  ? 314 LYS A CB    1 
ATOM   2994 C CG    . LYS C 2 314 ? -31.568 94.081  14.824  1.00 69.08  ? 314 LYS A CG    1 
ATOM   2995 C CD    . LYS C 2 314 ? -30.301 94.873  15.170  1.00 70.45  ? 314 LYS A CD    1 
ATOM   2996 C CE    . LYS C 2 314 ? -29.921 95.926  14.109  1.00 71.35  ? 314 LYS A CE    1 
ATOM   2997 N NZ    . LYS C 2 314 ? -28.561 96.565  14.348  1.00 70.79  ? 314 LYS A NZ    1 
ATOM   2998 N N     . GLY C 2 315 ? -30.873 91.986  18.656  1.00 62.95  ? 315 GLY A N     1 
ATOM   2999 C CA    . GLY C 2 315 ? -31.160 91.509  19.992  1.00 61.12  ? 315 GLY A CA    1 
ATOM   3000 C C     . GLY C 2 315 ? -30.041 90.897  20.802  1.00 60.05  ? 315 GLY A C     1 
ATOM   3001 O O     . GLY C 2 315 ? -28.864 91.191  20.594  1.00 60.66  ? 315 GLY A O     1 
ATOM   3002 N N     . ASN C 2 316 ? -30.429 90.050  21.747  1.00 58.23  ? 316 ASN A N     1 
ATOM   3003 C CA    . ASN C 2 316 ? -29.481 89.385  22.613  1.00 56.61  ? 316 ASN A CA    1 
ATOM   3004 C C     . ASN C 2 316 ? -29.528 87.888  22.423  1.00 56.07  ? 316 ASN A C     1 
ATOM   3005 O O     . ASN C 2 316 ? -30.602 87.289  22.348  1.00 55.56  ? 316 ASN A O     1 
ATOM   3006 C CB    . ASN C 2 316 ? -29.758 89.691  24.080  1.00 55.70  ? 316 ASN A CB    1 
ATOM   3007 C CG    . ASN C 2 316 ? -29.098 88.688  25.003  1.00 55.56  ? 316 ASN A CG    1 
ATOM   3008 O OD1   . ASN C 2 316 ? -29.660 87.634  25.300  1.00 54.96  ? 316 ASN A OD1   1 
ATOM   3009 N ND2   . ASN C 2 316 ? -27.881 88.997  25.437  1.00 55.40  ? 316 ASN A ND2   1 
ATOM   3010 N N     . GLN C 2 317 ? -28.343 87.291  22.366  1.00 55.61  ? 317 GLN A N     1 
ATOM   3011 C CA    . GLN C 2 317 ? -28.207 85.858  22.195  1.00 54.72  ? 317 GLN A CA    1 
ATOM   3012 C C     . GLN C 2 317 ? -27.480 85.292  23.401  1.00 53.18  ? 317 GLN A C     1 
ATOM   3013 O O     . GLN C 2 317 ? -26.559 85.909  23.946  1.00 52.10  ? 317 GLN A O     1 
ATOM   3014 C CB    . GLN C 2 317 ? -27.421 85.553  20.922  1.00 57.22  ? 317 GLN A CB    1 
ATOM   3015 C CG    . GLN C 2 317 ? -27.444 84.080  20.494  1.00 60.47  ? 317 GLN A CG    1 
ATOM   3016 C CD    . GLN C 2 317 ? -26.628 83.836  19.221  1.00 62.44  ? 317 GLN A CD    1 
ATOM   3017 O OE1   . GLN C 2 317 ? -26.380 84.769  18.428  1.00 63.30  ? 317 GLN A OE1   1 
ATOM   3018 N NE2   . GLN C 2 317 ? -26.220 82.580  19.011  1.00 62.77  ? 317 GLN A NE2   1 
ATOM   3019 N N     . LEU C 2 318 ? -27.911 84.111  23.812  1.00 51.75  ? 318 LEU A N     1 
ATOM   3020 C CA    . LEU C 2 318 ? -27.331 83.433  24.950  1.00 51.06  ? 318 LEU A CA    1 
ATOM   3021 C C     . LEU C 2 318 ? -26.613 82.186  24.448  1.00 51.40  ? 318 LEU A C     1 
ATOM   3022 O O     . LEU C 2 318 ? -27.190 81.404  23.679  1.00 51.57  ? 318 LEU A O     1 
ATOM   3023 C CB    . LEU C 2 318 ? -28.440 83.044  25.925  1.00 50.19  ? 318 LEU A CB    1 
ATOM   3024 C CG    . LEU C 2 318 ? -28.700 83.908  27.171  1.00 50.58  ? 318 LEU A CG    1 
ATOM   3025 C CD1   . LEU C 2 318 ? -28.502 85.391  26.898  1.00 49.97  ? 318 LEU A CD1   1 
ATOM   3026 C CD2   . LEU C 2 318 ? -30.100 83.625  27.649  1.00 48.55  ? 318 LEU A CD2   1 
ATOM   3027 N N     . LEU C 2 319 ? -25.353 82.017  24.863  1.00 50.95  ? 319 LEU A N     1 
ATOM   3028 C CA    . LEU C 2 319 ? -24.555 80.852  24.466  1.00 49.93  ? 319 LEU A CA    1 
ATOM   3029 C C     . LEU C 2 319 ? -24.612 79.816  25.586  1.00 49.34  ? 319 LEU A C     1 
ATOM   3030 O O     . LEU C 2 319 ? -24.582 80.160  26.771  1.00 49.21  ? 319 LEU A O     1 
ATOM   3031 C CB    . LEU C 2 319 ? -23.107 81.266  24.220  1.00 50.34  ? 319 LEU A CB    1 
ATOM   3032 C CG    . LEU C 2 319 ? -22.656 81.516  22.779  1.00 50.85  ? 319 LEU A CG    1 
ATOM   3033 C CD1   . LEU C 2 319 ? -23.793 82.008  21.913  1.00 50.49  ? 319 LEU A CD1   1 
ATOM   3034 C CD2   . LEU C 2 319 ? -21.505 82.518  22.810  1.00 50.56  ? 319 LEU A CD2   1 
ATOM   3035 N N     . PRO C 2 320 ? -24.694 78.529  25.228  1.00 48.61  ? 320 PRO A N     1 
ATOM   3036 C CA    . PRO C 2 320 ? -24.757 77.483  26.255  1.00 47.90  ? 320 PRO A CA    1 
ATOM   3037 C C     . PRO C 2 320 ? -23.475 77.332  27.049  1.00 47.72  ? 320 PRO A C     1 
ATOM   3038 O O     . PRO C 2 320 ? -22.418 77.770  26.614  1.00 48.26  ? 320 PRO A O     1 
ATOM   3039 C CB    . PRO C 2 320 ? -25.071 76.232  25.454  1.00 47.81  ? 320 PRO A CB    1 
ATOM   3040 C CG    . PRO C 2 320 ? -24.385 76.511  24.131  1.00 48.55  ? 320 PRO A CG    1 
ATOM   3041 C CD    . PRO C 2 320 ? -24.723 77.956  23.869  1.00 48.24  ? 320 PRO A CD    1 
ATOM   3042 N N     . VAL C 2 321 ? -23.589 76.738  28.231  1.00 46.96  ? 321 VAL A N     1 
ATOM   3043 C CA    . VAL C 2 321 ? -22.440 76.482  29.082  1.00 46.18  ? 321 VAL A CA    1 
ATOM   3044 C C     . VAL C 2 321 ? -22.704 75.100  29.639  1.00 46.74  ? 321 VAL A C     1 
ATOM   3045 O O     . VAL C 2 321 ? -23.736 74.511  29.341  1.00 47.11  ? 321 VAL A O     1 
ATOM   3046 C CB    . VAL C 2 321 ? -22.319 77.495  30.243  1.00 45.97  ? 321 VAL A CB    1 
ATOM   3047 C CG1   . VAL C 2 321 ? -22.112 78.899  29.678  1.00 45.98  ? 321 VAL A CG1   1 
ATOM   3048 C CG2   . VAL C 2 321 ? -23.540 77.422  31.146  1.00 45.42  ? 321 VAL A CG2   1 
ATOM   3049 N N     . SER C 2 322 ? -21.793 74.563  30.441  1.00 46.97  ? 322 SER A N     1 
ATOM   3050 C CA    . SER C 2 322 ? -22.021 73.230  30.987  1.00 47.06  ? 322 SER A CA    1 
ATOM   3051 C C     . SER C 2 322 ? -21.185 73.015  32.220  1.00 47.00  ? 322 SER A C     1 
ATOM   3052 O O     . SER C 2 322 ? -20.212 73.727  32.453  1.00 47.86  ? 322 SER A O     1 
ATOM   3053 C CB    . SER C 2 322 ? -21.692 72.167  29.935  1.00 47.09  ? 322 SER A CB    1 
ATOM   3054 O OG    . SER C 2 322 ? -20.389 72.363  29.399  1.00 48.08  ? 322 SER A OG    1 
ATOM   3055 N N     . LEU C 2 323 ? -21.575 72.045  33.027  1.00 47.31  ? 323 LEU A N     1 
ATOM   3056 C CA    . LEU C 2 323 ? -20.840 71.764  34.243  1.00 48.17  ? 323 LEU A CA    1 
ATOM   3057 C C     . LEU C 2 323 ? -19.769 70.700  33.997  1.00 48.76  ? 323 LEU A C     1 
ATOM   3058 O O     . LEU C 2 323 ? -20.047 69.633  33.440  1.00 48.86  ? 323 LEU A O     1 
ATOM   3059 C CB    . LEU C 2 323 ? -21.795 71.294  35.339  1.00 47.99  ? 323 LEU A CB    1 
ATOM   3060 C CG    . LEU C 2 323 ? -21.121 70.771  36.610  1.00 49.28  ? 323 LEU A CG    1 
ATOM   3061 C CD1   . LEU C 2 323 ? -20.370 71.904  37.317  1.00 49.08  ? 323 LEU A CD1   1 
ATOM   3062 C CD2   . LEU C 2 323 ? -22.179 70.190  37.545  1.00 49.95  ? 323 LEU A CD2   1 
ATOM   3063 N N     . VAL C 2 324 ? -18.538 70.995  34.404  1.00 49.23  ? 324 VAL A N     1 
ATOM   3064 C CA    . VAL C 2 324 ? -17.451 70.039  34.243  1.00 49.34  ? 324 VAL A CA    1 
ATOM   3065 C C     . VAL C 2 324 ? -17.127 69.533  35.648  1.00 50.20  ? 324 VAL A C     1 
ATOM   3066 O O     . VAL C 2 324 ? -16.554 70.257  36.478  1.00 50.20  ? 324 VAL A O     1 
ATOM   3067 C CB    . VAL C 2 324 ? -16.209 70.705  33.603  1.00 49.30  ? 324 VAL A CB    1 
ATOM   3068 C CG1   . VAL C 2 324 ? -15.130 69.659  33.328  1.00 47.91  ? 324 VAL A CG1   1 
ATOM   3069 C CG2   . VAL C 2 324 ? -16.610 71.403  32.300  1.00 48.91  ? 324 VAL A CG2   1 
ATOM   3070 N N     . LYS C 2 325 ? -17.529 68.298  35.926  1.00 50.96  ? 325 LYS A N     1 
ATOM   3071 C CA    . LYS C 2 325 ? -17.288 67.722  37.240  1.00 52.13  ? 325 LYS A CA    1 
ATOM   3072 C C     . LYS C 2 325 ? -15.870 67.209  37.367  1.00 52.13  ? 325 LYS A C     1 
ATOM   3073 O O     . LYS C 2 325 ? -15.443 66.351  36.595  1.00 51.89  ? 325 LYS A O     1 
ATOM   3074 C CB    . LYS C 2 325 ? -18.251 66.571  37.504  1.00 54.08  ? 325 LYS A CB    1 
ATOM   3075 C CG    . LYS C 2 325 ? -19.688 66.997  37.770  1.00 57.54  ? 325 LYS A CG    1 
ATOM   3076 C CD    . LYS C 2 325 ? -20.538 65.816  38.242  1.00 60.51  ? 325 LYS A CD    1 
ATOM   3077 C CE    . LYS C 2 325 ? -20.474 64.660  37.236  1.00 63.16  ? 325 LYS A CE    1 
ATOM   3078 N NZ    . LYS C 2 325 ? -21.358 63.499  37.611  1.00 64.90  ? 325 LYS A NZ    1 
ATOM   3079 N N     . ARG C 2 326 ? -15.149 67.740  38.346  1.00 51.96  ? 326 ARG A N     1 
ATOM   3080 C CA    . ARG C 2 326 ? -13.784 67.328  38.581  1.00 51.40  ? 326 ARG A CA    1 
ATOM   3081 C C     . ARG C 2 326 ? -13.631 66.851  40.030  1.00 51.76  ? 326 ARG A C     1 
ATOM   3082 O O     . ARG C 2 326 ? -14.486 66.130  40.516  1.00 52.42  ? 326 ARG A O     1 
ATOM   3083 C CB    . ARG C 2 326 ? -12.818 68.466  38.233  1.00 50.76  ? 326 ARG A CB    1 
ATOM   3084 C CG    . ARG C 2 326 ? -11.845 68.083  37.125  1.00 50.56  ? 326 ARG A CG    1 
ATOM   3085 C CD    . ARG C 2 326 ? -12.176 68.610  35.717  1.00 48.89  ? 326 ARG A CD    1 
ATOM   3086 N NE    . ARG C 2 326 ? -11.816 70.019  35.587  1.00 49.10  ? 326 ARG A NE    1 
ATOM   3087 C CZ    . ARG C 2 326 ? -11.629 70.667  34.437  1.00 48.27  ? 326 ARG A CZ    1 
ATOM   3088 N NH1   . ARG C 2 326 ? -11.754 70.046  33.273  1.00 47.01  ? 326 ARG A NH1   1 
ATOM   3089 N NH2   . ARG C 2 326 ? -11.336 71.961  34.459  1.00 48.05  ? 326 ARG A NH2   1 
ATOM   3090 N N     . LYS C 2 327 ? -12.584 67.251  40.739  1.00 52.19  ? 327 LYS A N     1 
ATOM   3091 C CA    . LYS C 2 327 ? -12.384 66.735  42.099  1.00 52.65  ? 327 LYS A CA    1 
ATOM   3092 C C     . LYS C 2 327 ? -12.566 67.704  43.252  1.00 53.29  ? 327 LYS A C     1 
ATOM   3093 O O     . LYS C 2 327 ? -12.434 67.307  44.417  1.00 53.16  ? 327 LYS A O     1 
ATOM   3094 C CB    . LYS C 2 327 ? -10.977 66.130  42.231  1.00 53.63  ? 327 LYS A CB    1 
ATOM   3095 C CG    . LYS C 2 327 ? -10.633 65.061  41.214  1.00 54.11  ? 327 LYS A CG    1 
ATOM   3096 C CD    . LYS C 2 327 ? -11.496 63.851  41.414  1.00 55.78  ? 327 LYS A CD    1 
ATOM   3097 C CE    . LYS C 2 327 ? -11.115 62.752  40.449  1.00 57.34  ? 327 LYS A CE    1 
ATOM   3098 N NZ    . LYS C 2 327 ? -12.057 61.601  40.563  1.00 60.03  ? 327 LYS A NZ    1 
ATOM   3099 N N     . THR C 2 328 ? -12.845 68.968  42.956  1.00 53.93  ? 328 THR A N     1 
ATOM   3100 C CA    . THR C 2 328 ? -13.013 69.943  44.028  1.00 54.25  ? 328 THR A CA    1 
ATOM   3101 C C     . THR C 2 328 ? -14.376 69.885  44.718  1.00 54.87  ? 328 THR A C     1 
ATOM   3102 O O     . THR C 2 328 ? -14.580 70.534  45.746  1.00 54.80  ? 328 THR A O     1 
ATOM   3103 C CB    . THR C 2 328 ? -12.750 71.364  43.520  1.00 54.48  ? 328 THR A CB    1 
ATOM   3104 O OG1   . THR C 2 328 ? -13.423 71.559  42.260  1.00 54.80  ? 328 THR A OG1   1 
ATOM   3105 C CG2   . THR C 2 328 ? -11.249 71.583  43.357  1.00 54.75  ? 328 THR A CG2   1 
ATOM   3106 N N     . THR C 2 329 ? -15.309 69.112  44.168  1.00 55.15  ? 329 THR A N     1 
ATOM   3107 C CA    . THR C 2 329 ? -16.611 68.988  44.809  1.00 55.93  ? 329 THR A CA    1 
ATOM   3108 C C     . THR C 2 329 ? -16.890 67.541  45.229  1.00 56.67  ? 329 THR A C     1 
ATOM   3109 O O     . THR C 2 329 ? -17.639 66.812  44.584  1.00 57.26  ? 329 THR A O     1 
ATOM   3110 C CB    . THR C 2 329 ? -17.746 69.523  43.901  1.00 55.32  ? 329 THR A CB    1 
ATOM   3111 O OG1   . THR C 2 329 ? -17.767 68.807  42.658  1.00 54.70  ? 329 THR A OG1   1 
ATOM   3112 C CG2   . THR C 2 329 ? -17.538 71.010  43.638  1.00 55.52  ? 329 THR A CG2   1 
ATOM   3113 N N     . LYS D 2 2   ? -22.760 108.078 3.279   1.00 105.02 ? 2   LYS B N     1 
ATOM   3114 C CA    . LYS D 2 2   ? -21.368 108.599 3.145   1.00 105.32 ? 2   LYS B CA    1 
ATOM   3115 C C     . LYS D 2 2   ? -21.042 109.554 4.288   1.00 105.60 ? 2   LYS B C     1 
ATOM   3116 O O     . LYS D 2 2   ? -21.557 110.669 4.340   1.00 105.69 ? 2   LYS B O     1 
ATOM   3117 N N     . PRO D 2 3   ? -20.168 109.126 5.217   1.00 105.84 ? 3   PRO B N     1 
ATOM   3118 C CA    . PRO D 2 3   ? -19.740 109.906 6.386   1.00 105.98 ? 3   PRO B CA    1 
ATOM   3119 C C     . PRO D 2 3   ? -19.389 111.356 6.070   1.00 106.14 ? 3   PRO B C     1 
ATOM   3120 O O     . PRO D 2 3   ? -19.051 111.694 4.936   1.00 106.01 ? 3   PRO B O     1 
ATOM   3121 C CB    . PRO D 2 3   ? -18.532 109.126 6.896   1.00 105.93 ? 3   PRO B CB    1 
ATOM   3122 C CG    . PRO D 2 3   ? -18.879 107.712 6.541   1.00 105.89 ? 3   PRO B CG    1 
ATOM   3123 C CD    . PRO D 2 3   ? -19.423 107.855 5.139   1.00 105.85 ? 3   PRO B CD    1 
ATOM   3124 N N     . VAL D 2 4   ? -19.469 112.207 7.086   1.00 106.47 ? 4   VAL B N     1 
ATOM   3125 C CA    . VAL D 2 4   ? -19.151 113.618 6.922   1.00 107.12 ? 4   VAL B CA    1 
ATOM   3126 C C     . VAL D 2 4   ? -17.746 113.798 6.341   1.00 107.66 ? 4   VAL B C     1 
ATOM   3127 O O     . VAL D 2 4   ? -16.764 113.289 6.883   1.00 107.75 ? 4   VAL B O     1 
ATOM   3128 C CB    . VAL D 2 4   ? -19.267 114.367 8.276   1.00 107.02 ? 4   VAL B CB    1 
ATOM   3129 C CG1   . VAL D 2 4   ? -18.613 113.554 9.383   1.00 107.05 ? 4   VAL B CG1   1 
ATOM   3130 C CG2   . VAL D 2 4   ? -18.621 115.743 8.171   1.00 106.96 ? 4   VAL B CG2   1 
ATOM   3131 N N     . THR D 2 5   ? -17.666 114.526 5.232   1.00 108.28 ? 5   THR B N     1 
ATOM   3132 C CA    . THR D 2 5   ? -16.405 114.786 4.541   1.00 108.74 ? 5   THR B CA    1 
ATOM   3133 C C     . THR D 2 5   ? -15.742 116.066 5.044   1.00 109.19 ? 5   THR B C     1 
ATOM   3134 O O     . THR D 2 5   ? -16.334 116.816 5.821   1.00 109.26 ? 5   THR B O     1 
ATOM   3135 C CB    . THR D 2 5   ? -16.651 114.921 3.027   1.00 108.67 ? 5   THR B CB    1 
ATOM   3136 O OG1   . THR D 2 5   ? -17.295 113.735 2.547   1.00 108.82 ? 5   THR B OG1   1 
ATOM   3137 C CG2   . THR D 2 5   ? -15.348 115.124 2.280   1.00 108.73 ? 5   THR B CG2   1 
ATOM   3138 N N     . LEU D 2 6   ? -14.509 116.305 4.606   1.00 109.77 ? 6   LEU B N     1 
ATOM   3139 C CA    . LEU D 2 6   ? -13.774 117.503 4.987   1.00 110.35 ? 6   LEU B CA    1 
ATOM   3140 C C     . LEU D 2 6   ? -14.431 118.642 4.223   1.00 110.82 ? 6   LEU B C     1 
ATOM   3141 O O     . LEU D 2 6   ? -14.340 119.806 4.609   1.00 110.73 ? 6   LEU B O     1 
ATOM   3142 C CB    . LEU D 2 6   ? -12.310 117.378 4.571   1.00 110.47 ? 6   LEU B CB    1 
ATOM   3143 C CG    . LEU D 2 6   ? -11.316 118.357 5.194   1.00 110.65 ? 6   LEU B CG    1 
ATOM   3144 C CD1   . LEU D 2 6   ? -11.185 118.068 6.681   1.00 110.74 ? 6   LEU B CD1   1 
ATOM   3145 C CD2   . LEU D 2 6   ? -9.965  118.216 4.512   1.00 110.62 ? 6   LEU B CD2   1 
ATOM   3146 N N     . TYR D 2 7   ? -15.097 118.276 3.131   1.00 111.55 ? 7   TYR B N     1 
ATOM   3147 C CA    . TYR D 2 7   ? -15.809 119.218 2.274   1.00 112.39 ? 7   TYR B CA    1 
ATOM   3148 C C     . TYR D 2 7   ? -17.077 119.712 2.966   1.00 113.09 ? 7   TYR B C     1 
ATOM   3149 O O     . TYR D 2 7   ? -17.417 120.894 2.899   1.00 113.14 ? 7   TYR B O     1 
ATOM   3150 C CB    . TYR D 2 7   ? -16.194 118.536 0.961   1.00 112.26 ? 7   TYR B CB    1 
ATOM   3151 C CG    . TYR D 2 7   ? -15.045 118.283 0.010   1.00 112.28 ? 7   TYR B CG    1 
ATOM   3152 C CD1   . TYR D 2 7   ? -15.122 117.269 -0.943  1.00 112.43 ? 7   TYR B CD1   1 
ATOM   3153 C CD2   . TYR D 2 7   ? -13.902 119.080 0.031   1.00 112.28 ? 7   TYR B CD2   1 
ATOM   3154 C CE1   . TYR D 2 7   ? -14.092 117.054 -1.853  1.00 112.31 ? 7   TYR B CE1   1 
ATOM   3155 C CE2   . TYR D 2 7   ? -12.866 118.872 -0.878  1.00 112.17 ? 7   TYR B CE2   1 
ATOM   3156 C CZ    . TYR D 2 7   ? -12.969 117.860 -1.815  1.00 112.20 ? 7   TYR B CZ    1 
ATOM   3157 O OH    . TYR D 2 7   ? -11.958 117.658 -2.725  1.00 112.29 ? 7   TYR B OH    1 
ATOM   3158 N N     . ASP D 2 8   ? -17.774 118.792 3.625   1.00 113.89 ? 8   ASP B N     1 
ATOM   3159 C CA    . ASP D 2 8   ? -19.008 119.105 4.335   1.00 114.69 ? 8   ASP B CA    1 
ATOM   3160 C C     . ASP D 2 8   ? -18.793 120.174 5.399   1.00 115.31 ? 8   ASP B C     1 
ATOM   3161 O O     . ASP D 2 8   ? -19.665 121.005 5.637   1.00 115.58 ? 8   ASP B O     1 
ATOM   3162 C CB    . ASP D 2 8   ? -19.569 117.835 4.975   1.00 114.52 ? 8   ASP B CB    1 
ATOM   3163 C CG    . ASP D 2 8   ? -19.831 116.741 3.955   1.00 114.56 ? 8   ASP B CG    1 
ATOM   3164 O OD1   . ASP D 2 8   ? -20.222 115.625 4.361   1.00 114.43 ? 8   ASP B OD1   1 
ATOM   3165 O OD2   . ASP D 2 8   ? -19.644 116.999 2.746   1.00 114.41 ? 8   ASP B OD2   1 
ATOM   3166 N N     . VAL D 2 9   ? -17.630 120.150 6.037   1.00 116.03 ? 9   VAL B N     1 
ATOM   3167 C CA    . VAL D 2 9   ? -17.311 121.129 7.063   1.00 116.87 ? 9   VAL B CA    1 
ATOM   3168 C C     . VAL D 2 9   ? -16.914 122.446 6.399   1.00 117.69 ? 9   VAL B C     1 
ATOM   3169 O O     . VAL D 2 9   ? -17.060 123.518 6.986   1.00 117.83 ? 9   VAL B O     1 
ATOM   3170 C CB    . VAL D 2 9   ? -16.151 120.639 7.951   1.00 116.73 ? 9   VAL B CB    1 
ATOM   3171 C CG1   . VAL D 2 9   ? -15.907 121.621 9.083   1.00 116.60 ? 9   VAL B CG1   1 
ATOM   3172 C CG2   . VAL D 2 9   ? -16.471 119.261 8.503   1.00 116.78 ? 9   VAL B CG2   1 
ATOM   3173 N N     . ALA D 2 10  ? -16.424 122.355 5.164   1.00 118.63 ? 10  ALA B N     1 
ATOM   3174 C CA    . ALA D 2 10  ? -15.995 123.530 4.408   1.00 119.54 ? 10  ALA B CA    1 
ATOM   3175 C C     . ALA D 2 10  ? -17.103 124.571 4.258   1.00 120.11 ? 10  ALA B C     1 
ATOM   3176 O O     . ALA D 2 10  ? -16.890 125.754 4.522   1.00 120.32 ? 10  ALA B O     1 
ATOM   3177 C CB    . ALA D 2 10  ? -15.485 123.109 3.029   1.00 119.45 ? 10  ALA B CB    1 
ATOM   3178 N N     . GLU D 2 11  ? -18.284 124.137 3.833   1.00 120.64 ? 11  GLU B N     1 
ATOM   3179 C CA    . GLU D 2 11  ? -19.387 125.071 3.665   1.00 121.12 ? 11  GLU B CA    1 
ATOM   3180 C C     . GLU D 2 11  ? -20.153 125.307 4.961   1.00 121.26 ? 11  GLU B C     1 
ATOM   3181 O O     . GLU D 2 11  ? -20.739 126.371 5.152   1.00 121.49 ? 11  GLU B O     1 
ATOM   3182 C CB    . GLU D 2 11  ? -20.329 124.586 2.564   1.00 121.22 ? 11  GLU B CB    1 
ATOM   3183 C CG    . GLU D 2 11  ? -20.791 123.157 2.706   1.00 121.52 ? 11  GLU B CG    1 
ATOM   3184 C CD    . GLU D 2 11  ? -21.584 122.704 1.496   1.00 121.89 ? 11  GLU B CD    1 
ATOM   3185 O OE1   . GLU D 2 11  ? -21.024 122.726 0.379   1.00 122.05 ? 11  GLU B OE1   1 
ATOM   3186 O OE2   . GLU D 2 11  ? -22.765 122.331 1.655   1.00 122.06 ? 11  GLU B OE2   1 
ATOM   3187 N N     . TYR D 2 12  ? -20.134 124.325 5.857   1.00 121.30 ? 12  TYR B N     1 
ATOM   3188 C CA    . TYR D 2 12  ? -20.822 124.451 7.139   1.00 121.36 ? 12  TYR B CA    1 
ATOM   3189 C C     . TYR D 2 12  ? -19.966 125.309 8.074   1.00 121.35 ? 12  TYR B C     1 
ATOM   3190 O O     . TYR D 2 12  ? -20.179 125.337 9.286   1.00 121.34 ? 12  TYR B O     1 
ATOM   3191 C CB    . TYR D 2 12  ? -21.045 123.063 7.746   1.00 121.53 ? 12  TYR B CB    1 
ATOM   3192 C CG    . TYR D 2 12  ? -22.245 122.960 8.667   1.00 121.83 ? 12  TYR B CG    1 
ATOM   3193 C CD1   . TYR D 2 12  ? -22.265 123.607 9.905   1.00 121.80 ? 12  TYR B CD1   1 
ATOM   3194 C CD2   . TYR D 2 12  ? -23.365 122.212 8.296   1.00 121.92 ? 12  TYR B CD2   1 
ATOM   3195 C CE1   . TYR D 2 12  ? -23.370 123.511 10.751  1.00 121.88 ? 12  TYR B CE1   1 
ATOM   3196 C CE2   . TYR D 2 12  ? -24.474 122.109 9.133   1.00 122.00 ? 12  TYR B CE2   1 
ATOM   3197 C CZ    . TYR D 2 12  ? -24.470 122.762 10.358  1.00 122.02 ? 12  TYR B CZ    1 
ATOM   3198 O OH    . TYR D 2 12  ? -25.565 122.669 11.185  1.00 122.06 ? 12  TYR B OH    1 
ATOM   3199 N N     . ALA D 2 13  ? -18.992 126.005 7.493   1.00 121.31 ? 13  ALA B N     1 
ATOM   3200 C CA    . ALA D 2 13  ? -18.095 126.874 8.249   1.00 121.28 ? 13  ALA B CA    1 
ATOM   3201 C C     . ALA D 2 13  ? -17.648 128.044 7.379   1.00 121.29 ? 13  ALA B C     1 
ATOM   3202 O O     . ALA D 2 13  ? -16.970 128.955 7.850   1.00 121.27 ? 13  ALA B O     1 
ATOM   3203 C CB    . ALA D 2 13  ? -16.884 126.089 8.735   1.00 121.14 ? 13  ALA B CB    1 
ATOM   3204 N N     . GLY D 2 14  ? -18.027 128.006 6.105   1.00 121.33 ? 14  GLY B N     1 
ATOM   3205 C CA    . GLY D 2 14  ? -17.676 129.077 5.190   1.00 121.42 ? 14  GLY B CA    1 
ATOM   3206 C C     . GLY D 2 14  ? -16.230 129.118 4.735   1.00 121.60 ? 14  GLY B C     1 
ATOM   3207 O O     . GLY D 2 14  ? -15.757 130.153 4.267   1.00 121.61 ? 14  GLY B O     1 
ATOM   3208 N N     . VAL D 2 15  ? -15.523 127.999 4.867   1.00 121.76 ? 15  VAL B N     1 
ATOM   3209 C CA    . VAL D 2 15  ? -14.123 127.922 4.455   1.00 121.68 ? 15  VAL B CA    1 
ATOM   3210 C C     . VAL D 2 15  ? -13.929 126.857 3.379   1.00 121.62 ? 15  VAL B C     1 
ATOM   3211 O O     . VAL D 2 15  ? -14.897 126.314 2.844   1.00 121.52 ? 15  VAL B O     1 
ATOM   3212 C CB    . VAL D 2 15  ? -13.201 127.590 5.651   1.00 121.66 ? 15  VAL B CB    1 
ATOM   3213 C CG1   . VAL D 2 15  ? -13.239 128.716 6.667   1.00 121.56 ? 15  VAL B CG1   1 
ATOM   3214 C CG2   . VAL D 2 15  ? -13.634 126.282 6.298   1.00 121.66 ? 15  VAL B CG2   1 
ATOM   3215 N N     . SER D 2 16  ? -12.673 126.564 3.059   1.00 121.60 ? 16  SER B N     1 
ATOM   3216 C CA    . SER D 2 16  ? -12.366 125.554 2.052   1.00 121.58 ? 16  SER B CA    1 
ATOM   3217 C C     . SER D 2 16  ? -11.907 124.274 2.742   1.00 121.41 ? 16  SER B C     1 
ATOM   3218 O O     . SER D 2 16  ? -11.794 124.230 3.968   1.00 121.50 ? 16  SER B O     1 
ATOM   3219 C CB    . SER D 2 16  ? -11.274 126.053 1.106   1.00 121.56 ? 16  SER B CB    1 
ATOM   3220 O OG    . SER D 2 16  ? -10.063 126.280 1.804   1.00 121.82 ? 16  SER B OG    1 
ATOM   3221 N N     . TYR D 2 17  ? -11.643 123.234 1.957   1.00 121.03 ? 17  TYR B N     1 
ATOM   3222 C CA    . TYR D 2 17  ? -11.204 121.967 2.525   1.00 120.63 ? 17  TYR B CA    1 
ATOM   3223 C C     . TYR D 2 17  ? -9.830  122.076 3.179   1.00 120.71 ? 17  TYR B C     1 
ATOM   3224 O O     . TYR D 2 17  ? -9.538  121.371 4.143   1.00 120.66 ? 17  TYR B O     1 
ATOM   3225 C CB    . TYR D 2 17  ? -11.192 120.880 1.446   1.00 119.89 ? 17  TYR B CB    1 
ATOM   3226 C CG    . TYR D 2 17  ? -10.363 121.212 0.228   1.00 119.22 ? 17  TYR B CG    1 
ATOM   3227 C CD1   . TYR D 2 17  ? -8.979  121.327 0.311   1.00 118.93 ? 17  TYR B CD1   1 
ATOM   3228 C CD2   . TYR D 2 17  ? -10.965 121.403 -1.011  1.00 118.91 ? 17  TYR B CD2   1 
ATOM   3229 C CE1   . TYR D 2 17  ? -8.214  121.625 -0.809  1.00 118.78 ? 17  TYR B CE1   1 
ATOM   3230 C CE2   . TYR D 2 17  ? -10.210 121.698 -2.139  1.00 118.74 ? 17  TYR B CE2   1 
ATOM   3231 C CZ    . TYR D 2 17  ? -8.835  121.808 -2.031  1.00 118.66 ? 17  TYR B CZ    1 
ATOM   3232 O OH    . TYR D 2 17  ? -8.082  122.102 -3.145  1.00 118.55 ? 17  TYR B OH    1 
ATOM   3233 N N     . GLN D 2 18  ? -8.995  122.972 2.661   1.00 120.87 ? 18  GLN B N     1 
ATOM   3234 C CA    . GLN D 2 18  ? -7.650  123.164 3.194   1.00 121.02 ? 18  GLN B CA    1 
ATOM   3235 C C     . GLN D 2 18  ? -7.677  123.859 4.551   1.00 121.01 ? 18  GLN B C     1 
ATOM   3236 O O     . GLN D 2 18  ? -6.923  123.500 5.457   1.00 120.93 ? 18  GLN B O     1 
ATOM   3237 C CB    . GLN D 2 18  ? -6.806  123.983 2.214   1.00 121.17 ? 18  GLN B CB    1 
ATOM   3238 C CG    . GLN D 2 18  ? -5.345  124.124 2.617   1.00 121.41 ? 18  GLN B CG    1 
ATOM   3239 C CD    . GLN D 2 18  ? -4.598  122.804 2.577   1.00 121.54 ? 18  GLN B CD    1 
ATOM   3240 O OE1   . GLN D 2 18  ? -4.954  121.852 3.269   1.00 121.62 ? 18  GLN B OE1   1 
ATOM   3241 N NE2   . GLN D 2 18  ? -3.554  122.743 1.760   1.00 121.69 ? 18  GLN B NE2   1 
ATOM   3242 N N     . THR D 2 19  ? -8.539  124.861 4.684   1.00 121.06 ? 19  THR B N     1 
ATOM   3243 C CA    . THR D 2 19  ? -8.656  125.594 5.936   1.00 121.09 ? 19  THR B CA    1 
ATOM   3244 C C     . THR D 2 19  ? -8.952  124.593 7.041   1.00 121.11 ? 19  THR B C     1 
ATOM   3245 O O     . THR D 2 19  ? -8.300  124.587 8.084   1.00 121.13 ? 19  THR B O     1 
ATOM   3246 C CB    . THR D 2 19  ? -9.796  126.634 5.875   1.00 121.14 ? 19  THR B CB    1 
ATOM   3247 O OG1   . THR D 2 19  ? -9.528  127.581 4.832   1.00 121.34 ? 19  THR B OG1   1 
ATOM   3248 C CG2   . THR D 2 19  ? -9.916  127.373 7.199   1.00 121.13 ? 19  THR B CG2   1 
ATOM   3249 N N     . VAL D 2 20  ? -9.937  123.738 6.792   1.00 121.23 ? 20  VAL B N     1 
ATOM   3250 C CA    . VAL D 2 20  ? -10.331 122.716 7.751   1.00 121.42 ? 20  VAL B CA    1 
ATOM   3251 C C     . VAL D 2 20  ? -9.154  121.786 8.009   1.00 121.54 ? 20  VAL B C     1 
ATOM   3252 O O     . VAL D 2 20  ? -8.877  121.417 9.149   1.00 121.48 ? 20  VAL B O     1 
ATOM   3253 C CB    . VAL D 2 20  ? -11.513 121.883 7.218   1.00 121.34 ? 20  VAL B CB    1 
ATOM   3254 C CG1   . VAL D 2 20  ? -11.957 120.882 8.268   1.00 121.16 ? 20  VAL B CG1   1 
ATOM   3255 C CG2   . VAL D 2 20  ? -12.660 122.800 6.829   1.00 121.24 ? 20  VAL B CG2   1 
ATOM   3256 N N     . SER D 2 21  ? -8.464  121.411 6.937   1.00 121.69 ? 21  SER B N     1 
ATOM   3257 C CA    . SER D 2 21  ? -7.310  120.529 7.043   1.00 121.76 ? 21  SER B CA    1 
ATOM   3258 C C     . SER D 2 21  ? -6.311  121.125 8.029   1.00 121.95 ? 21  SER B C     1 
ATOM   3259 O O     . SER D 2 21  ? -5.822  120.431 8.921   1.00 122.04 ? 21  SER B O     1 
ATOM   3260 C CB    . SER D 2 21  ? -6.652  120.351 5.672   1.00 121.60 ? 21  SER B CB    1 
ATOM   3261 O OG    . SER D 2 21  ? -5.601  119.403 5.723   1.00 121.16 ? 21  SER B OG    1 
ATOM   3262 N N     . ARG D 2 22  ? -6.019  122.414 7.869   1.00 122.11 ? 22  ARG B N     1 
ATOM   3263 C CA    . ARG D 2 22  ? -5.088  123.099 8.757   1.00 122.26 ? 22  ARG B CA    1 
ATOM   3264 C C     . ARG D 2 22  ? -5.525  122.918 10.203  1.00 122.52 ? 22  ARG B C     1 
ATOM   3265 O O     . ARG D 2 22  ? -4.755  122.453 11.045  1.00 122.70 ? 22  ARG B O     1 
ATOM   3266 C CB    . ARG D 2 22  ? -5.031  124.594 8.436   1.00 121.98 ? 22  ARG B CB    1 
ATOM   3267 C CG    . ARG D 2 22  ? -4.481  124.929 7.066   1.00 121.77 ? 22  ARG B CG    1 
ATOM   3268 C CD    . ARG D 2 22  ? -4.134  126.406 6.991   1.00 121.70 ? 22  ARG B CD    1 
ATOM   3269 N NE    . ARG D 2 22  ? -3.644  126.809 5.675   1.00 121.84 ? 22  ARG B NE    1 
ATOM   3270 C CZ    . ARG D 2 22  ? -4.404  126.910 4.589   1.00 121.91 ? 22  ARG B CZ    1 
ATOM   3271 N NH1   . ARG D 2 22  ? -5.699  126.639 4.655   1.00 121.98 ? 22  ARG B NH1   1 
ATOM   3272 N NH2   . ARG D 2 22  ? -3.870  127.285 3.435   1.00 122.02 ? 22  ARG B NH2   1 
ATOM   3273 N N     . VAL D 2 23  ? -6.771  123.283 10.481  1.00 122.73 ? 23  VAL B N     1 
ATOM   3274 C CA    . VAL D 2 23  ? -7.323  123.167 11.825  1.00 122.92 ? 23  VAL B CA    1 
ATOM   3275 C C     . VAL D 2 23  ? -7.237  121.734 12.363  1.00 123.02 ? 23  VAL B C     1 
ATOM   3276 O O     . VAL D 2 23  ? -6.863  121.519 13.517  1.00 123.14 ? 23  VAL B O     1 
ATOM   3277 C CB    . VAL D 2 23  ? -8.793  123.637 11.853  1.00 122.89 ? 23  VAL B CB    1 
ATOM   3278 C CG1   . VAL D 2 23  ? -9.302  123.685 13.287  1.00 122.73 ? 23  VAL B CG1   1 
ATOM   3279 C CG2   . VAL D 2 23  ? -8.907  125.004 11.196  1.00 122.81 ? 23  VAL B CG2   1 
ATOM   3280 N N     . VAL D 2 24  ? -7.573  120.756 11.525  1.00 122.98 ? 24  VAL B N     1 
ATOM   3281 C CA    . VAL D 2 24  ? -7.525  119.356 11.933  1.00 122.93 ? 24  VAL B CA    1 
ATOM   3282 C C     . VAL D 2 24  ? -6.107  118.940 12.307  1.00 123.04 ? 24  VAL B C     1 
ATOM   3283 O O     . VAL D 2 24  ? -5.899  118.219 13.282  1.00 122.90 ? 24  VAL B O     1 
ATOM   3284 C CB    . VAL D 2 24  ? -8.021  118.423 10.805  1.00 122.79 ? 24  VAL B CB    1 
ATOM   3285 C CG1   . VAL D 2 24  ? -8.013  116.980 11.286  1.00 122.65 ? 24  VAL B CG1   1 
ATOM   3286 C CG2   . VAL D 2 24  ? -9.415  118.827 10.367  1.00 122.59 ? 24  VAL B CG2   1 
ATOM   3287 N N     . ASN D 2 25  ? -5.135  119.399 11.526  1.00 123.25 ? 25  ASN B N     1 
ATOM   3288 C CA    . ASN D 2 25  ? -3.739  119.065 11.770  1.00 123.56 ? 25  ASN B CA    1 
ATOM   3289 C C     . ASN D 2 25  ? -3.033  120.046 12.694  1.00 124.08 ? 25  ASN B C     1 
ATOM   3290 O O     . ASN D 2 25  ? -1.806  120.048 12.770  1.00 124.09 ? 25  ASN B O     1 
ATOM   3291 C CB    . ASN D 2 25  ? -2.975  118.979 10.449  1.00 123.04 ? 25  ASN B CB    1 
ATOM   3292 C CG    . ASN D 2 25  ? -3.383  117.783 9.622   1.00 122.69 ? 25  ASN B CG    1 
ATOM   3293 O OD1   . ASN D 2 25  ? -4.550  117.629 9.267   1.00 122.56 ? 25  ASN B OD1   1 
ATOM   3294 N ND2   . ASN D 2 25  ? -2.421  116.925 9.312   1.00 122.55 ? 25  ASN B ND2   1 
ATOM   3295 N N     . GLN D 2 26  ? -3.803  120.876 13.393  1.00 124.72 ? 26  GLN B N     1 
ATOM   3296 C CA    . GLN D 2 26  ? -3.222  121.848 14.317  1.00 125.48 ? 26  GLN B CA    1 
ATOM   3297 C C     . GLN D 2 26  ? -2.196  122.688 13.559  1.00 126.12 ? 26  GLN B C     1 
ATOM   3298 O O     . GLN D 2 26  ? -1.174  123.084 14.118  1.00 126.19 ? 26  GLN B O     1 
ATOM   3299 C CB    . GLN D 2 26  ? -2.514  121.121 15.463  1.00 125.36 ? 26  GLN B CB    1 
ATOM   3300 C CG    . GLN D 2 26  ? -2.722  121.721 16.840  1.00 125.18 ? 26  GLN B CG    1 
ATOM   3301 C CD    . GLN D 2 26  ? -3.956  121.169 17.525  1.00 125.16 ? 26  GLN B CD    1 
ATOM   3302 O OE1   . GLN D 2 26  ? -4.244  121.501 18.674  1.00 125.07 ? 26  GLN B OE1   1 
ATOM   3303 N NE2   . GLN D 2 26  ? -4.691  120.316 16.819  1.00 125.13 ? 26  GLN B NE2   1 
ATOM   3304 N N     . ALA D 2 27  ? -2.479  122.951 12.287  1.00 126.86 ? 27  ALA B N     1 
ATOM   3305 C CA    . ALA D 2 27  ? -1.586  123.715 11.421  1.00 127.70 ? 27  ALA B CA    1 
ATOM   3306 C C     . ALA D 2 27  ? -1.144  125.077 11.948  1.00 128.39 ? 27  ALA B C     1 
ATOM   3307 O O     . ALA D 2 27  ? -1.643  125.572 12.960  1.00 128.31 ? 27  ALA B O     1 
ATOM   3308 C CB    . ALA D 2 27  ? -2.223  123.887 10.050  1.00 127.58 ? 27  ALA B CB    1 
ATOM   3309 N N     . SER D 2 28  ? -0.196  125.671 11.228  1.00 129.33 ? 28  SER B N     1 
ATOM   3310 C CA    . SER D 2 28  ? 0.357   126.976 11.562  1.00 130.20 ? 28  SER B CA    1 
ATOM   3311 C C     . SER D 2 28  ? -0.200  127.983 10.564  1.00 130.84 ? 28  SER B C     1 
ATOM   3312 O O     . SER D 2 28  ? -0.161  127.743 9.356   1.00 130.90 ? 28  SER B O     1 
ATOM   3313 C CB    . SER D 2 28  ? 1.883   126.944 11.443  1.00 130.12 ? 28  SER B CB    1 
ATOM   3314 O OG    . SER D 2 28  ? 2.419   125.770 12.027  1.00 130.16 ? 28  SER B OG    1 
ATOM   3315 N N     . HIS D 2 29  ? -0.711  129.100 11.076  1.00 131.54 ? 29  HIS B N     1 
ATOM   3316 C CA    . HIS D 2 29  ? -1.287  130.172 10.259  1.00 132.30 ? 29  HIS B CA    1 
ATOM   3317 C C     . HIS D 2 29  ? -2.783  129.997 9.999   1.00 132.53 ? 29  HIS B C     1 
ATOM   3318 O O     . HIS D 2 29  ? -3.215  129.771 8.866   1.00 132.57 ? 29  HIS B O     1 
ATOM   3319 C CB    . HIS D 2 29  ? -0.544  130.317 8.923   1.00 132.66 ? 29  HIS B CB    1 
ATOM   3320 C CG    . HIS D 2 29  ? 0.868   130.796 9.066   1.00 133.12 ? 29  HIS B CG    1 
ATOM   3321 N ND1   . HIS D 2 29  ? 1.192   131.978 9.698   1.00 133.33 ? 29  HIS B ND1   1 
ATOM   3322 C CD2   . HIS D 2 29  ? 2.039   130.260 8.646   1.00 133.24 ? 29  HIS B CD2   1 
ATOM   3323 C CE1   . HIS D 2 29  ? 2.502   132.150 9.661   1.00 133.38 ? 29  HIS B CE1   1 
ATOM   3324 N NE2   . HIS D 2 29  ? 3.039   131.122 9.028   1.00 133.42 ? 29  HIS B NE2   1 
ATOM   3325 N N     . VAL D 2 30  ? -3.564  130.109 11.069  1.00 132.78 ? 30  VAL B N     1 
ATOM   3326 C CA    . VAL D 2 30  ? -5.017  129.995 11.002  1.00 132.87 ? 30  VAL B CA    1 
ATOM   3327 C C     . VAL D 2 30  ? -5.586  131.396 11.239  1.00 132.95 ? 30  VAL B C     1 
ATOM   3328 O O     . VAL D 2 30  ? -4.903  132.262 11.786  1.00 132.96 ? 30  VAL B O     1 
ATOM   3329 C CB    . VAL D 2 30  ? -5.556  129.042 12.094  1.00 132.82 ? 30  VAL B CB    1 
ATOM   3330 C CG1   . VAL D 2 30  ? -7.030  128.776 11.867  1.00 132.82 ? 30  VAL B CG1   1 
ATOM   3331 C CG2   . VAL D 2 30  ? -4.771  127.744 12.089  1.00 132.71 ? 30  VAL B CG2   1 
ATOM   3332 N N     . SER D 2 31  ? -6.830  131.621 10.834  1.00 132.99 ? 31  SER B N     1 
ATOM   3333 C CA    . SER D 2 31  ? -7.450  132.930 11.012  1.00 133.05 ? 31  SER B CA    1 
ATOM   3334 C C     . SER D 2 31  ? -7.834  133.206 12.455  1.00 133.16 ? 31  SER B C     1 
ATOM   3335 O O     . SER D 2 31  ? -8.823  133.888 12.716  1.00 133.14 ? 31  SER B O     1 
ATOM   3336 N N     . ALA D 2 32  ? -7.042  132.674 13.384  1.00 133.25 ? 32  ALA B N     1 
ATOM   3337 C CA    . ALA D 2 32  ? -7.281  132.855 14.813  1.00 133.30 ? 32  ALA B CA    1 
ATOM   3338 C C     . ALA D 2 32  ? -8.701  132.444 15.176  1.00 133.33 ? 32  ALA B C     1 
ATOM   3339 O O     . ALA D 2 32  ? -8.951  131.307 15.572  1.00 133.37 ? 32  ALA B O     1 
ATOM   3340 C CB    . ALA D 2 32  ? -7.038  134.312 15.206  1.00 133.19 ? 32  ALA B CB    1 
ATOM   3341 N N     . LYS D 2 33  ? -9.629  133.384 15.044  1.00 133.38 ? 33  LYS B N     1 
ATOM   3342 C CA    . LYS D 2 33  ? -11.033 133.129 15.339  1.00 133.24 ? 33  LYS B CA    1 
ATOM   3343 C C     . LYS D 2 33  ? -11.601 132.148 14.319  1.00 133.08 ? 33  LYS B C     1 
ATOM   3344 O O     . LYS D 2 33  ? -12.569 131.437 14.599  1.00 133.13 ? 33  LYS B O     1 
ATOM   3345 C CB    . LYS D 2 33  ? -11.816 134.447 15.312  1.00 133.19 ? 33  LYS B CB    1 
ATOM   3346 C CG    . LYS D 2 33  ? -11.551 135.307 14.081  1.00 132.99 ? 33  LYS B CG    1 
ATOM   3347 C CD    . LYS D 2 33  ? -11.669 136.789 14.406  1.00 132.74 ? 33  LYS B CD    1 
ATOM   3348 C CE    . LYS D 2 33  ? -10.717 137.180 15.531  1.00 132.73 ? 33  LYS B CE    1 
ATOM   3349 N NZ    . LYS D 2 33  ? -9.321  136.735 15.254  1.00 132.56 ? 33  LYS B NZ    1 
ATOM   3350 N N     . THR D 2 34  ? -10.984 132.110 13.140  1.00 132.84 ? 34  THR B N     1 
ATOM   3351 C CA    . THR D 2 34  ? -11.420 131.217 12.073  1.00 132.43 ? 34  THR B CA    1 
ATOM   3352 C C     . THR D 2 34  ? -11.418 129.769 12.545  1.00 132.39 ? 34  THR B C     1 
ATOM   3353 O O     . THR D 2 34  ? -12.384 129.041 12.312  1.00 132.41 ? 34  THR B O     1 
ATOM   3354 C CB    . THR D 2 34  ? -10.520 131.343 10.828  1.00 132.18 ? 34  THR B CB    1 
ATOM   3355 O OG1   . THR D 2 34  ? -10.610 132.674 10.307  1.00 132.03 ? 34  THR B OG1   1 
ATOM   3356 C CG2   . THR D 2 34  ? -10.954 130.359 9.751   1.00 131.88 ? 34  THR B CG2   1 
ATOM   3357 N N     . ARG D 2 35  ? -10.343 129.347 13.208  1.00 132.18 ? 35  ARG B N     1 
ATOM   3358 C CA    . ARG D 2 35  ? -10.275 127.975 13.700  1.00 131.97 ? 35  ARG B CA    1 
ATOM   3359 C C     . ARG D 2 35  ? -11.365 127.745 14.744  1.00 131.70 ? 35  ARG B C     1 
ATOM   3360 O O     . ARG D 2 35  ? -11.913 126.645 14.846  1.00 131.73 ? 35  ARG B O     1 
ATOM   3361 C CB    . ARG D 2 35  ? -8.898  127.657 14.301  1.00 132.04 ? 35  ARG B CB    1 
ATOM   3362 C CG    . ARG D 2 35  ? -8.423  128.611 15.378  1.00 132.26 ? 35  ARG B CG    1 
ATOM   3363 C CD    . ARG D 2 35  ? -7.415  127.943 16.299  1.00 132.38 ? 35  ARG B CD    1 
ATOM   3364 N NE    . ARG D 2 35  ? -8.058  126.960 17.170  1.00 132.65 ? 35  ARG B NE    1 
ATOM   3365 C CZ    . ARG D 2 35  ? -7.416  126.201 18.053  1.00 132.77 ? 35  ARG B CZ    1 
ATOM   3366 N NH1   . ARG D 2 35  ? -6.100  126.304 18.189  1.00 132.86 ? 35  ARG B NH1   1 
ATOM   3367 N NH2   . ARG D 2 35  ? -8.088  125.342 18.809  1.00 132.71 ? 35  ARG B NH2   1 
ATOM   3368 N N     . GLU D 2 36  ? -11.680 128.788 15.510  1.00 131.24 ? 36  GLU B N     1 
ATOM   3369 C CA    . GLU D 2 36  ? -12.715 128.699 16.533  1.00 130.60 ? 36  GLU B CA    1 
ATOM   3370 C C     . GLU D 2 36  ? -14.035 128.320 15.870  1.00 130.24 ? 36  GLU B C     1 
ATOM   3371 O O     . GLU D 2 36  ? -14.798 127.507 16.393  1.00 130.20 ? 36  GLU B O     1 
ATOM   3372 N N     . LYS D 2 37  ? -14.289 128.911 14.706  1.00 129.88 ? 37  LYS B N     1 
ATOM   3373 C CA    . LYS D 2 37  ? -15.507 128.646 13.950  1.00 129.35 ? 37  LYS B CA    1 
ATOM   3374 C C     . LYS D 2 37  ? -15.495 127.253 13.322  1.00 128.98 ? 37  LYS B C     1 
ATOM   3375 O O     . LYS D 2 37  ? -16.463 126.502 13.447  1.00 129.01 ? 37  LYS B O     1 
ATOM   3376 N N     . VAL D 2 38  ? -14.397 126.913 12.649  1.00 128.54 ? 38  VAL B N     1 
ATOM   3377 C CA    . VAL D 2 38  ? -14.258 125.610 11.999  1.00 128.01 ? 38  VAL B CA    1 
ATOM   3378 C C     . VAL D 2 38  ? -14.430 124.450 12.978  1.00 127.54 ? 38  VAL B C     1 
ATOM   3379 O O     . VAL D 2 38  ? -15.188 123.518 12.712  1.00 127.50 ? 38  VAL B O     1 
ATOM   3380 C CB    . VAL D 2 38  ? -12.880 125.474 11.296  1.00 128.10 ? 38  VAL B CB    1 
ATOM   3381 C CG1   . VAL D 2 38  ? -12.654 124.035 10.852  1.00 127.86 ? 38  VAL B CG1   1 
ATOM   3382 C CG2   . VAL D 2 38  ? -12.818 126.404 10.089  1.00 128.02 ? 38  VAL B CG2   1 
ATOM   3383 N N     . GLU D 2 39  ? -13.725 124.505 14.103  1.00 127.02 ? 39  GLU B N     1 
ATOM   3384 C CA    . GLU D 2 39  ? -13.820 123.452 15.110  1.00 126.45 ? 39  GLU B CA    1 
ATOM   3385 C C     . GLU D 2 39  ? -15.271 123.259 15.532  1.00 126.01 ? 39  GLU B C     1 
ATOM   3386 O O     . GLU D 2 39  ? -15.739 122.131 15.692  1.00 126.02 ? 39  GLU B O     1 
ATOM   3387 C CB    . GLU D 2 39  ? -12.967 123.808 16.328  1.00 126.41 ? 39  GLU B CB    1 
ATOM   3388 C CG    . GLU D 2 39  ? -11.488 123.928 16.017  1.00 126.65 ? 39  GLU B CG    1 
ATOM   3389 C CD    . GLU D 2 39  ? -10.666 124.353 17.216  1.00 126.77 ? 39  GLU B CD    1 
ATOM   3390 O OE1   . GLU D 2 39  ? -10.951 125.431 17.780  1.00 126.90 ? 39  GLU B OE1   1 
ATOM   3391 O OE2   . GLU D 2 39  ? -9.733  123.613 17.593  1.00 126.78 ? 39  GLU B OE2   1 
ATOM   3392 N N     . ALA D 2 40  ? -15.980 124.367 15.711  1.00 125.34 ? 40  ALA B N     1 
ATOM   3393 C CA    . ALA D 2 40  ? -17.379 124.314 16.102  1.00 124.71 ? 40  ALA B CA    1 
ATOM   3394 C C     . ALA D 2 40  ? -18.187 123.634 15.000  1.00 124.28 ? 40  ALA B C     1 
ATOM   3395 O O     . ALA D 2 40  ? -19.106 122.862 15.274  1.00 124.26 ? 40  ALA B O     1 
ATOM   3396 C CB    . ALA D 2 40  ? -17.903 125.722 16.345  1.00 124.62 ? 40  ALA B CB    1 
ATOM   3397 N N     . ALA D 2 41  ? -17.827 123.921 13.752  1.00 123.78 ? 41  ALA B N     1 
ATOM   3398 C CA    . ALA D 2 41  ? -18.513 123.356 12.592  1.00 123.20 ? 41  ALA B CA    1 
ATOM   3399 C C     . ALA D 2 41  ? -18.397 121.837 12.514  1.00 122.80 ? 41  ALA B C     1 
ATOM   3400 O O     . ALA D 2 41  ? -19.381 121.146 12.243  1.00 122.90 ? 41  ALA B O     1 
ATOM   3401 C CB    . ALA D 2 41  ? -17.973 123.987 11.310  1.00 123.13 ? 41  ALA B CB    1 
ATOM   3402 N N     . MET D 2 42  ? -17.194 121.318 12.744  1.00 122.21 ? 42  MET B N     1 
ATOM   3403 C CA    . MET D 2 42  ? -16.970 119.877 12.695  1.00 121.51 ? 42  MET B CA    1 
ATOM   3404 C C     . MET D 2 42  ? -17.476 119.196 13.962  1.00 120.73 ? 42  MET B C     1 
ATOM   3405 O O     . MET D 2 42  ? -17.810 118.010 13.955  1.00 120.50 ? 42  MET B O     1 
ATOM   3406 C CB    . MET D 2 42  ? -15.482 119.577 12.484  1.00 121.88 ? 42  MET B CB    1 
ATOM   3407 C CG    . MET D 2 42  ? -14.543 120.376 13.373  1.00 122.35 ? 42  MET B CG    1 
ATOM   3408 S SD    . MET D 2 42  ? -12.809 119.961 13.078  1.00 122.76 ? 42  MET B SD    1 
ATOM   3409 C CE    . MET D 2 42  ? -12.562 120.705 11.481  1.00 122.71 ? 42  MET B CE    1 
ATOM   3410 N N     . ALA D 2 43  ? -17.538 119.957 15.049  1.00 119.87 ? 43  ALA B N     1 
ATOM   3411 C CA    . ALA D 2 43  ? -18.021 119.425 16.314  1.00 119.03 ? 43  ALA B CA    1 
ATOM   3412 C C     . ALA D 2 43  ? -19.507 119.091 16.183  1.00 118.42 ? 43  ALA B C     1 
ATOM   3413 O O     . ALA D 2 43  ? -19.948 118.017 16.591  1.00 118.40 ? 43  ALA B O     1 
ATOM   3414 C CB    . ALA D 2 43  ? -17.805 120.447 17.427  1.00 118.87 ? 43  ALA B CB    1 
ATOM   3415 N N     . GLU D 2 44  ? -20.268 120.013 15.599  1.00 117.60 ? 44  GLU B N     1 
ATOM   3416 C CA    . GLU D 2 44  ? -21.705 119.834 15.418  1.00 116.46 ? 44  GLU B CA    1 
ATOM   3417 C C     . GLU D 2 44  ? -22.055 118.785 14.366  1.00 115.67 ? 44  GLU B C     1 
ATOM   3418 O O     . GLU D 2 44  ? -23.168 118.259 14.353  1.00 115.56 ? 44  GLU B O     1 
ATOM   3419 N N     . LEU D 2 45  ? -21.106 118.486 13.484  1.00 114.84 ? 45  LEU B N     1 
ATOM   3420 C CA    . LEU D 2 45  ? -21.328 117.500 12.431  1.00 113.97 ? 45  LEU B CA    1 
ATOM   3421 C C     . LEU D 2 45  ? -20.746 116.142 12.790  1.00 113.47 ? 45  LEU B C     1 
ATOM   3422 O O     . LEU D 2 45  ? -20.806 115.205 11.995  1.00 113.41 ? 45  LEU B O     1 
ATOM   3423 C CB    . LEU D 2 45  ? -20.704 117.972 11.115  1.00 113.60 ? 45  LEU B CB    1 
ATOM   3424 C CG    . LEU D 2 45  ? -21.390 119.107 10.356  1.00 113.36 ? 45  LEU B CG    1 
ATOM   3425 C CD1   . LEU D 2 45  ? -20.566 119.470 9.130   1.00 113.35 ? 45  LEU B CD1   1 
ATOM   3426 C CD2   . LEU D 2 45  ? -22.786 118.674 9.948   1.00 113.11 ? 45  LEU B CD2   1 
ATOM   3427 N N     . ASN D 2 46  ? -20.194 116.035 13.992  1.00 112.88 ? 46  ASN B N     1 
ATOM   3428 C CA    . ASN D 2 46  ? -19.584 114.788 14.430  1.00 112.22 ? 46  ASN B CA    1 
ATOM   3429 C C     . ASN D 2 46  ? -18.640 114.309 13.334  1.00 111.57 ? 46  ASN B C     1 
ATOM   3430 O O     . ASN D 2 46  ? -18.863 113.271 12.705  1.00 111.60 ? 46  ASN B O     1 
ATOM   3431 C CB    . ASN D 2 46  ? -20.650 113.723 14.700  1.00 112.54 ? 46  ASN B CB    1 
ATOM   3432 C CG    . ASN D 2 46  ? -20.050 112.412 15.170  1.00 112.84 ? 46  ASN B CG    1 
ATOM   3433 O OD1   . ASN D 2 46  ? -19.328 112.371 16.168  1.00 112.76 ? 46  ASN B OD1   1 
ATOM   3434 N ND2   . ASN D 2 46  ? -20.342 111.331 14.451  1.00 113.06 ? 46  ASN B ND2   1 
ATOM   3435 N N     . TYR D 2 47  ? -17.587 115.086 13.105  1.00 110.64 ? 47  TYR B N     1 
ATOM   3436 C CA    . TYR D 2 47  ? -16.602 114.766 12.081  1.00 109.59 ? 47  TYR B CA    1 
ATOM   3437 C C     . TYR D 2 47  ? -15.445 113.918 12.604  1.00 108.70 ? 47  TYR B C     1 
ATOM   3438 O O     . TYR D 2 47  ? -14.817 114.245 13.614  1.00 108.57 ? 47  TYR B O     1 
ATOM   3439 C CB    . TYR D 2 47  ? -16.051 116.057 11.470  1.00 109.70 ? 47  TYR B CB    1 
ATOM   3440 C CG    . TYR D 2 47  ? -14.878 115.838 10.543  1.00 109.82 ? 47  TYR B CG    1 
ATOM   3441 C CD1   . TYR D 2 47  ? -15.018 115.093 9.370   1.00 109.71 ? 47  TYR B CD1   1 
ATOM   3442 C CD2   . TYR D 2 47  ? -13.621 116.363 10.846  1.00 109.90 ? 47  TYR B CD2   1 
ATOM   3443 C CE1   . TYR D 2 47  ? -13.935 114.876 8.520   1.00 109.69 ? 47  TYR B CE1   1 
ATOM   3444 C CE2   . TYR D 2 47  ? -12.531 116.151 10.004  1.00 110.00 ? 47  TYR B CE2   1 
ATOM   3445 C CZ    . TYR D 2 47  ? -12.696 115.405 8.843   1.00 109.95 ? 47  TYR B CZ    1 
ATOM   3446 O OH    . TYR D 2 47  ? -11.624 115.186 8.008   1.00 110.09 ? 47  TYR B OH    1 
ATOM   3447 N N     . ILE D 2 48  ? -15.175 112.822 11.903  1.00 107.63 ? 48  ILE B N     1 
ATOM   3448 C CA    . ILE D 2 48  ? -14.088 111.919 12.259  1.00 106.32 ? 48  ILE B CA    1 
ATOM   3449 C C     . ILE D 2 48  ? -13.232 111.703 11.016  1.00 105.46 ? 48  ILE B C     1 
ATOM   3450 O O     . ILE D 2 48  ? -13.624 110.990 10.090  1.00 105.12 ? 48  ILE B O     1 
ATOM   3451 C CB    . ILE D 2 48  ? -14.618 110.559 12.747  1.00 106.22 ? 48  ILE B CB    1 
ATOM   3452 C CG1   . ILE D 2 48  ? -15.500 110.758 13.981  1.00 105.96 ? 48  ILE B CG1   1 
ATOM   3453 C CG2   . ILE D 2 48  ? -13.452 109.640 13.078  1.00 106.23 ? 48  ILE B CG2   1 
ATOM   3454 C CD1   . ILE D 2 48  ? -16.120 109.482 14.505  1.00 105.58 ? 48  ILE B CD1   1 
ATOM   3455 N N     . PRO D 2 49  ? -12.049 112.329 10.980  1.00 104.72 ? 49  PRO B N     1 
ATOM   3456 C CA    . PRO D 2 49  ? -11.116 112.224 9.855   1.00 104.20 ? 49  PRO B CA    1 
ATOM   3457 C C     . PRO D 2 49  ? -10.885 110.787 9.390   1.00 103.66 ? 49  PRO B C     1 
ATOM   3458 O O     . PRO D 2 49  ? -10.473 109.928 10.173  1.00 103.76 ? 49  PRO B O     1 
ATOM   3459 C CB    . PRO D 2 49  ? -9.846  112.865 10.406  1.00 104.27 ? 49  PRO B CB    1 
ATOM   3460 C CG    . PRO D 2 49  ? -10.381 113.905 11.341  1.00 104.46 ? 49  PRO B CG    1 
ATOM   3461 C CD    . PRO D 2 49  ? -11.477 113.153 12.060  1.00 104.60 ? 49  PRO B CD    1 
ATOM   3462 N N     . ASN D 2 50  ? -11.152 110.535 8.111   1.00 102.78 ? 50  ASN B N     1 
ATOM   3463 C CA    . ASN D 2 50  ? -10.963 109.207 7.533   1.00 101.97 ? 50  ASN B CA    1 
ATOM   3464 C C     . ASN D 2 50  ? -9.462  108.887 7.454   1.00 101.70 ? 50  ASN B C     1 
ATOM   3465 O O     . ASN D 2 50  ? -8.799  109.233 6.478   1.00 101.76 ? 50  ASN B O     1 
ATOM   3466 C CB    . ASN D 2 50  ? -11.584 109.163 6.131   1.00 101.32 ? 50  ASN B CB    1 
ATOM   3467 C CG    . ASN D 2 50  ? -11.519 107.784 5.502   1.00 100.78 ? 50  ASN B CG    1 
ATOM   3468 O OD1   . ASN D 2 50  ? -10.463 107.161 5.456   1.00 100.46 ? 50  ASN B OD1   1 
ATOM   3469 N ND2   . ASN D 2 50  ? -12.653 107.306 5.005   1.00 100.63 ? 50  ASN B ND2   1 
ATOM   3470 N N     . ARG D 2 51  ? -8.931  108.235 8.487   1.00 101.23 ? 51  ARG B N     1 
ATOM   3471 C CA    . ARG D 2 51  ? -7.515  107.883 8.531   1.00 100.77 ? 51  ARG B CA    1 
ATOM   3472 C C     . ARG D 2 51  ? -7.027  107.185 7.264   1.00 100.24 ? 51  ARG B C     1 
ATOM   3473 O O     . ARG D 2 51  ? -5.877  107.357 6.855   1.00 100.08 ? 51  ARG B O     1 
ATOM   3474 C CB    . ARG D 2 51  ? -7.229  106.992 9.740   1.00 101.29 ? 51  ARG B CB    1 
ATOM   3475 C CG    . ARG D 2 51  ? -7.054  107.733 11.056  1.00 102.17 ? 51  ARG B CG    1 
ATOM   3476 C CD    . ARG D 2 51  ? -6.796  106.742 12.190  1.00 103.07 ? 51  ARG B CD    1 
ATOM   3477 N NE    . ARG D 2 51  ? -6.244  107.370 13.392  1.00 104.10 ? 51  ARG B NE    1 
ATOM   3478 C CZ    . ARG D 2 51  ? -6.871  108.288 14.125  1.00 104.48 ? 51  ARG B CZ    1 
ATOM   3479 N NH1   . ARG D 2 51  ? -8.084  108.699 13.784  1.00 104.54 ? 51  ARG B NH1   1 
ATOM   3480 N NH2   . ARG D 2 51  ? -6.283  108.797 15.201  1.00 104.81 ? 51  ARG B NH2   1 
ATOM   3481 N N     . VAL D 2 52  ? -7.896  106.393 6.646   1.00 99.61  ? 52  VAL B N     1 
ATOM   3482 C CA    . VAL D 2 52  ? -7.531  105.683 5.425   1.00 99.15  ? 52  VAL B CA    1 
ATOM   3483 C C     . VAL D 2 52  ? -7.068  106.667 4.359   1.00 99.00  ? 52  VAL B C     1 
ATOM   3484 O O     . VAL D 2 52  ? -6.062  106.444 3.690   1.00 98.98  ? 52  VAL B O     1 
ATOM   3485 C CB    . VAL D 2 52  ? -8.719  104.896 4.862   1.00 99.02  ? 52  VAL B CB    1 
ATOM   3486 C CG1   . VAL D 2 52  ? -8.271  104.066 3.673   1.00 98.61  ? 52  VAL B CG1   1 
ATOM   3487 C CG2   . VAL D 2 52  ? -9.324  104.022 5.948   1.00 99.11  ? 52  VAL B CG2   1 
ATOM   3488 N N     . ALA D 2 53  ? -7.816  107.754 4.209   1.00 98.92  ? 53  ALA B N     1 
ATOM   3489 C CA    . ALA D 2 53  ? -7.505  108.788 3.232   1.00 98.81  ? 53  ALA B CA    1 
ATOM   3490 C C     . ALA D 2 53  ? -6.286  109.591 3.658   1.00 98.89  ? 53  ALA B C     1 
ATOM   3491 O O     . ALA D 2 53  ? -5.473  109.979 2.823   1.00 98.84  ? 53  ALA B O     1 
ATOM   3492 C CB    . ALA D 2 53  ? -8.689  109.707 3.061   1.00 98.53  ? 53  ALA B CB    1 
ATOM   3493 N N     . GLN D 2 54  ? -6.168  109.847 4.958   1.00 99.08  ? 54  GLN B N     1 
ATOM   3494 C CA    . GLN D 2 54  ? -5.038  110.605 5.484   1.00 99.25  ? 54  GLN B CA    1 
ATOM   3495 C C     . GLN D 2 54  ? -3.716  109.901 5.202   1.00 99.29  ? 54  GLN B C     1 
ATOM   3496 O O     . GLN D 2 54  ? -2.737  110.532 4.798   1.00 99.33  ? 54  GLN B O     1 
ATOM   3497 C CB    . GLN D 2 54  ? -5.190  110.813 6.988   1.00 99.26  ? 54  GLN B CB    1 
ATOM   3498 C CG    . GLN D 2 54  ? -6.303  111.755 7.373   1.00 99.30  ? 54  GLN B CG    1 
ATOM   3499 C CD    . GLN D 2 54  ? -6.323  112.018 8.855   1.00 99.59  ? 54  GLN B CD    1 
ATOM   3500 O OE1   . GLN D 2 54  ? -6.607  111.122 9.654   1.00 99.80  ? 54  GLN B OE1   1 
ATOM   3501 N NE2   . GLN D 2 54  ? -6.008  113.250 9.238   1.00 99.70  ? 54  GLN B NE2   1 
ATOM   3502 N N     . GLN D 2 55  ? -3.689  108.590 5.416   1.00 99.17  ? 55  GLN B N     1 
ATOM   3503 C CA    . GLN D 2 55  ? -2.481  107.824 5.174   1.00 99.14  ? 55  GLN B CA    1 
ATOM   3504 C C     . GLN D 2 55  ? -2.105  107.888 3.692   1.00 98.95  ? 55  GLN B C     1 
ATOM   3505 O O     . GLN D 2 55  ? -0.975  108.238 3.346   1.00 98.94  ? 55  GLN B O     1 
ATOM   3506 C CB    . GLN D 2 55  ? -2.680  106.371 5.632   1.00 99.44  ? 55  GLN B CB    1 
ATOM   3507 C CG    . GLN D 2 55  ? -1.525  105.432 5.286   1.00 100.11 ? 55  GLN B CG    1 
ATOM   3508 C CD    . GLN D 2 55  ? -1.570  104.115 6.048   1.00 100.32 ? 55  GLN B CD    1 
ATOM   3509 O OE1   . GLN D 2 55  ? -2.630  103.513 6.214   1.00 100.45 ? 55  GLN B OE1   1 
ATOM   3510 N NE2   . GLN D 2 55  ? -0.408  103.656 6.503   1.00 100.37 ? 55  GLN B NE2   1 
ATOM   3511 N N     . LEU D 2 56  ? -3.059  107.575 2.820   1.00 98.64  ? 56  LEU B N     1 
ATOM   3512 C CA    . LEU D 2 56  ? -2.815  107.595 1.379   1.00 98.42  ? 56  LEU B CA    1 
ATOM   3513 C C     . LEU D 2 56  ? -2.321  108.960 0.910   1.00 98.49  ? 56  LEU B C     1 
ATOM   3514 O O     . LEU D 2 56  ? -1.391  109.060 0.116   1.00 98.57  ? 56  LEU B O     1 
ATOM   3515 C CB    . LEU D 2 56  ? -4.095  107.234 0.622   1.00 98.04  ? 56  LEU B CB    1 
ATOM   3516 C CG    . LEU D 2 56  ? -3.936  106.952 -0.873  1.00 97.71  ? 56  LEU B CG    1 
ATOM   3517 C CD1   . LEU D 2 56  ? -3.136  105.684 -1.060  1.00 97.60  ? 56  LEU B CD1   1 
ATOM   3518 C CD2   . LEU D 2 56  ? -5.293  106.796 -1.520  1.00 97.71  ? 56  LEU B CD2   1 
ATOM   3519 N N     . ALA D 2 57  ? -2.951  110.012 1.412   1.00 98.64  ? 57  ALA B N     1 
ATOM   3520 C CA    . ALA D 2 57  ? -2.587  111.370 1.044   1.00 98.58  ? 57  ALA B CA    1 
ATOM   3521 C C     . ALA D 2 57  ? -1.150  111.706 1.414   1.00 98.72  ? 57  ALA B C     1 
ATOM   3522 O O     . ALA D 2 57  ? -0.611  112.719 0.968   1.00 98.68  ? 57  ALA B O     1 
ATOM   3523 C CB    . ALA D 2 57  ? -3.532  112.343 1.704   1.00 98.81  ? 57  ALA B CB    1 
ATOM   3524 N N     . GLY D 2 58  ? -0.536  110.870 2.243   1.00 98.79  ? 58  GLY B N     1 
ATOM   3525 C CA    . GLY D 2 58  ? 0.842   111.113 2.629   1.00 98.79  ? 58  GLY B CA    1 
ATOM   3526 C C     . GLY D 2 58  ? 1.103   111.476 4.079   1.00 98.65  ? 58  GLY B C     1 
ATOM   3527 O O     . GLY D 2 58  ? 2.256   111.683 4.458   1.00 98.77  ? 58  GLY B O     1 
ATOM   3528 N N     . LYS D 2 59  ? 0.055   111.561 4.893   1.00 98.41  ? 59  LYS B N     1 
ATOM   3529 C CA    . LYS D 2 59  ? 0.226   111.896 6.306   1.00 98.08  ? 59  LYS B CA    1 
ATOM   3530 C C     . LYS D 2 59  ? 1.204   110.927 6.966   1.00 97.74  ? 59  LYS B C     1 
ATOM   3531 O O     . LYS D 2 59  ? 0.936   109.732 7.085   1.00 97.78  ? 59  LYS B O     1 
ATOM   3532 C CB    . LYS D 2 59  ? -1.123  111.855 7.027   1.00 98.28  ? 59  LYS B CB    1 
ATOM   3533 C CG    . LYS D 2 59  ? -1.057  112.074 8.530   1.00 98.46  ? 59  LYS B CG    1 
ATOM   3534 C CD    . LYS D 2 59  ? -2.435  112.423 9.075   1.00 98.88  ? 59  LYS B CD    1 
ATOM   3535 C CE    . LYS D 2 59  ? -2.511  112.272 10.582  1.00 99.01  ? 59  LYS B CE    1 
ATOM   3536 N NZ    . LYS D 2 59  ? -2.500  110.840 10.999  1.00 99.13  ? 59  LYS B NZ    1 
ATOM   3537 N N     . GLN D 2 60  ? 2.346   111.454 7.389   1.00 97.16  ? 60  GLN B N     1 
ATOM   3538 C CA    . GLN D 2 60  ? 3.378   110.644 8.020   1.00 96.60  ? 60  GLN B CA    1 
ATOM   3539 C C     . GLN D 2 60  ? 2.954   110.182 9.421   1.00 95.50  ? 60  GLN B C     1 
ATOM   3540 O O     . GLN D 2 60  ? 3.066   110.934 10.392  1.00 95.65  ? 60  GLN B O     1 
ATOM   3541 C CB    . GLN D 2 60  ? 4.682   111.450 8.096   1.00 97.63  ? 60  GLN B CB    1 
ATOM   3542 C CG    . GLN D 2 60  ? 5.934   110.604 8.276   1.00 99.05  ? 60  GLN B CG    1 
ATOM   3543 C CD    . GLN D 2 60  ? 6.197   109.685 7.088   1.00 99.84  ? 60  GLN B CD    1 
ATOM   3544 O OE1   . GLN D 2 60  ? 5.336   108.883 6.703   1.00 99.92  ? 60  GLN B OE1   1 
ATOM   3545 N NE2   . GLN D 2 60  ? 7.390   109.796 6.505   1.00 99.95  ? 60  GLN B NE2   1 
ATOM   3546 N N     . SER D 2 61  ? 2.469   108.946 9.519   1.00 93.75  ? 61  SER B N     1 
ATOM   3547 C CA    . SER D 2 61  ? 2.035   108.379 10.804  1.00 91.62  ? 61  SER B CA    1 
ATOM   3548 C C     . SER D 2 61  ? 2.766   107.072 11.121  1.00 89.64  ? 61  SER B C     1 
ATOM   3549 O O     . SER D 2 61  ? 2.877   106.202 10.253  1.00 89.74  ? 61  SER B O     1 
ATOM   3550 C CB    . SER D 2 61  ? 0.528   108.107 10.781  1.00 91.91  ? 61  SER B CB    1 
ATOM   3551 O OG    . SER D 2 61  ? -0.211  109.296 10.576  1.00 92.63  ? 61  SER B OG    1 
ATOM   3552 N N     . LEU D 2 62  ? 3.230   106.915 12.365  1.00 86.99  ? 62  LEU B N     1 
ATOM   3553 C CA    . LEU D 2 62  ? 3.954   105.706 12.753  1.00 84.26  ? 62  LEU B CA    1 
ATOM   3554 C C     . LEU D 2 62  ? 3.037   104.529 13.068  1.00 81.79  ? 62  LEU B C     1 
ATOM   3555 O O     . LEU D 2 62  ? 2.495   104.414 14.167  1.00 81.95  ? 62  LEU B O     1 
ATOM   3556 C CB    . LEU D 2 62  ? 4.902   106.004 13.932  1.00 84.90  ? 62  LEU B CB    1 
ATOM   3557 C CG    . LEU D 2 62  ? 4.432   106.527 15.296  1.00 85.61  ? 62  LEU B CG    1 
ATOM   3558 C CD1   . LEU D 2 62  ? 5.627   107.162 16.025  1.00 85.54  ? 62  LEU B CD1   1 
ATOM   3559 C CD2   . LEU D 2 62  ? 3.330   107.559 15.131  1.00 86.02  ? 62  LEU B CD2   1 
ATOM   3560 N N     . LEU D 2 63  ? 2.877   103.656 12.076  1.00 78.54  ? 63  LEU B N     1 
ATOM   3561 C CA    . LEU D 2 63  ? 2.025   102.473 12.179  1.00 75.43  ? 63  LEU B CA    1 
ATOM   3562 C C     . LEU D 2 63  ? 2.855   101.177 12.281  1.00 73.29  ? 63  LEU B C     1 
ATOM   3563 O O     . LEU D 2 63  ? 3.488   100.734 11.318  1.00 72.97  ? 63  LEU B O     1 
ATOM   3564 C CB    . LEU D 2 63  ? 1.086   102.427 10.967  1.00 74.75  ? 63  LEU B CB    1 
ATOM   3565 C CG    . LEU D 2 63  ? -0.095  101.453 10.879  1.00 74.35  ? 63  LEU B CG    1 
ATOM   3566 C CD1   . LEU D 2 63  ? 0.184   100.443 9.810   1.00 74.20  ? 63  LEU B CD1   1 
ATOM   3567 C CD2   . LEU D 2 63  ? -0.363  100.784 12.220  1.00 74.55  ? 63  LEU B CD2   1 
ATOM   3568 N N     . ILE D 2 64  ? 2.834   100.580 13.469  1.00 70.59  ? 64  ILE B N     1 
ATOM   3569 C CA    . ILE D 2 64  ? 3.564   99.352  13.771  1.00 67.47  ? 64  ILE B CA    1 
ATOM   3570 C C     . ILE D 2 64  ? 2.771   98.088  13.452  1.00 65.64  ? 64  ILE B C     1 
ATOM   3571 O O     . ILE D 2 64  ? 1.635   97.927  13.897  1.00 65.42  ? 64  ILE B O     1 
ATOM   3572 C CB    . ILE D 2 64  ? 3.935   99.309  15.261  1.00 66.97  ? 64  ILE B CB    1 
ATOM   3573 C CG1   . ILE D 2 64  ? 4.816   100.510 15.611  1.00 66.54  ? 64  ILE B CG1   1 
ATOM   3574 C CG2   . ILE D 2 64  ? 4.619   98.012  15.580  1.00 66.66  ? 64  ILE B CG2   1 
ATOM   3575 C CD1   . ILE D 2 64  ? 5.014   100.705 17.086  1.00 66.19  ? 64  ILE B CD1   1 
ATOM   3576 N N     . GLY D 2 65  ? 3.377   97.194  12.679  1.00 63.55  ? 65  GLY B N     1 
ATOM   3577 C CA    . GLY D 2 65  ? 2.720   95.945  12.331  1.00 60.88  ? 65  GLY B CA    1 
ATOM   3578 C C     . GLY D 2 65  ? 3.228   94.855  13.257  1.00 59.26  ? 65  GLY B C     1 
ATOM   3579 O O     . GLY D 2 65  ? 4.373   94.909  13.696  1.00 59.25  ? 65  GLY B O     1 
ATOM   3580 N N     . VAL D 2 66  ? 2.393   93.869  13.568  1.00 57.50  ? 66  VAL B N     1 
ATOM   3581 C CA    . VAL D 2 66  ? 2.806   92.797  14.456  1.00 55.63  ? 66  VAL B CA    1 
ATOM   3582 C C     . VAL D 2 66  ? 2.335   91.428  14.007  1.00 54.73  ? 66  VAL B C     1 
ATOM   3583 O O     . VAL D 2 66  ? 1.140   91.169  13.911  1.00 54.21  ? 66  VAL B O     1 
ATOM   3584 C CB    . VAL D 2 66  ? 2.297   93.018  15.899  1.00 55.68  ? 66  VAL B CB    1 
ATOM   3585 C CG1   . VAL D 2 66  ? 2.689   91.834  16.772  1.00 55.72  ? 66  VAL B CG1   1 
ATOM   3586 C CG2   . VAL D 2 66  ? 2.880   94.295  16.475  1.00 55.65  ? 66  VAL B CG2   1 
ATOM   3587 N N     . ALA D 2 67  ? 3.291   90.553  13.720  1.00 53.97  ? 67  ALA B N     1 
ATOM   3588 C CA    . ALA D 2 67  ? 2.982   89.186  13.317  1.00 53.04  ? 67  ALA B CA    1 
ATOM   3589 C C     . ALA D 2 67  ? 3.223   88.419  14.609  1.00 52.09  ? 67  ALA B C     1 
ATOM   3590 O O     . ALA D 2 67  ? 4.301   88.509  15.189  1.00 51.56  ? 67  ALA B O     1 
ATOM   3591 C CB    . ALA D 2 67  ? 3.934   88.719  12.208  1.00 52.88  ? 67  ALA B CB    1 
ATOM   3592 N N     . THR D 2 68  ? 2.228   87.669  15.064  1.00 51.02  ? 68  THR B N     1 
ATOM   3593 C CA    . THR D 2 68  ? 2.371   86.973  16.330  1.00 50.56  ? 68  THR B CA    1 
ATOM   3594 C C     . THR D 2 68  ? 1.772   85.589  16.348  1.00 49.86  ? 68  THR B C     1 
ATOM   3595 O O     . THR D 2 68  ? 0.956   85.242  15.495  1.00 49.30  ? 68  THR B O     1 
ATOM   3596 C CB    . THR D 2 68  ? 1.693   87.801  17.462  1.00 51.14  ? 68  THR B CB    1 
ATOM   3597 O OG1   . THR D 2 68  ? 1.777   87.104  18.709  1.00 50.53  ? 68  THR B OG1   1 
ATOM   3598 C CG2   . THR D 2 68  ? 0.226   88.018  17.137  1.00 51.55  ? 68  THR B CG2   1 
ATOM   3599 N N     . SER D 2 69  ? 2.200   84.800  17.331  1.00 49.38  ? 69  SER B N     1 
ATOM   3600 C CA    . SER D 2 69  ? 1.665   83.459  17.525  1.00 49.27  ? 69  SER B CA    1 
ATOM   3601 C C     . SER D 2 69  ? 0.270   83.695  18.112  1.00 49.13  ? 69  SER B C     1 
ATOM   3602 O O     . SER D 2 69  ? -0.034  84.801  18.575  1.00 48.38  ? 69  SER B O     1 
ATOM   3603 C CB    . SER D 2 69  ? 2.488   82.689  18.553  1.00 49.47  ? 69  SER B CB    1 
ATOM   3604 O OG    . SER D 2 69  ? 3.864   82.706  18.242  1.00 50.53  ? 69  SER B OG    1 
ATOM   3605 N N     . SER D 2 70  ? -0.562  82.660  18.107  1.00 48.45  ? 70  SER B N     1 
ATOM   3606 C CA    . SER D 2 70  ? -1.911  82.765  18.645  1.00 48.38  ? 70  SER B CA    1 
ATOM   3607 C C     . SER D 2 70  ? -1.990  83.526  19.964  1.00 47.54  ? 70  SER B C     1 
ATOM   3608 O O     . SER D 2 70  ? -1.228  83.258  20.898  1.00 47.19  ? 70  SER B O     1 
ATOM   3609 C CB    . SER D 2 70  ? -2.503  81.381  18.867  1.00 48.86  ? 70  SER B CB    1 
ATOM   3610 O OG    . SER D 2 70  ? -3.809  81.503  19.395  1.00 50.00  ? 70  SER B OG    1 
ATOM   3611 N N     . LEU D 2 71  ? -2.935  84.459  20.039  1.00 46.59  ? 71  LEU B N     1 
ATOM   3612 C CA    . LEU D 2 71  ? -3.116  85.246  21.246  1.00 46.07  ? 71  LEU B CA    1 
ATOM   3613 C C     . LEU D 2 71  ? -3.759  84.391  22.321  1.00 45.77  ? 71  LEU B C     1 
ATOM   3614 O O     . LEU D 2 71  ? -3.934  84.832  23.459  1.00 46.30  ? 71  LEU B O     1 
ATOM   3615 C CB    . LEU D 2 71  ? -3.966  86.474  20.963  1.00 45.56  ? 71  LEU B CB    1 
ATOM   3616 C CG    . LEU D 2 71  ? -3.290  87.421  19.980  1.00 45.98  ? 71  LEU B CG    1 
ATOM   3617 C CD1   . LEU D 2 71  ? -4.260  88.524  19.597  1.00 46.12  ? 71  LEU B CD1   1 
ATOM   3618 C CD2   . LEU D 2 71  ? -2.027  88.006  20.604  1.00 46.07  ? 71  LEU B CD2   1 
ATOM   3619 N N     . ALA D 2 72  ? -4.106  83.159  21.963  1.00 44.89  ? 72  ALA B N     1 
ATOM   3620 C CA    . ALA D 2 72  ? -4.690  82.251  22.936  1.00 44.84  ? 72  ALA B CA    1 
ATOM   3621 C C     . ALA D 2 72  ? -3.602  81.742  23.875  1.00 44.85  ? 72  ALA B C     1 
ATOM   3622 O O     . ALA D 2 72  ? -3.892  81.067  24.850  1.00 45.81  ? 72  ALA B O     1 
ATOM   3623 C CB    . ALA D 2 72  ? -5.346  81.087  22.243  1.00 43.76  ? 72  ALA B CB    1 
ATOM   3624 N N     . LEU D 2 73  ? -2.346  82.055  23.577  1.00 44.65  ? 73  LEU B N     1 
ATOM   3625 C CA    . LEU D 2 73  ? -1.240  81.600  24.409  1.00 43.82  ? 73  LEU B CA    1 
ATOM   3626 C C     . LEU D 2 73  ? -0.857  82.721  25.343  1.00 43.15  ? 73  LEU B C     1 
ATOM   3627 O O     . LEU D 2 73  ? -0.884  83.896  24.965  1.00 43.22  ? 73  LEU B O     1 
ATOM   3628 C CB    . LEU D 2 73  ? -0.047  81.214  23.533  1.00 45.00  ? 73  LEU B CB    1 
ATOM   3629 C CG    . LEU D 2 73  ? -0.348  80.086  22.541  1.00 45.80  ? 73  LEU B CG    1 
ATOM   3630 C CD1   . LEU D 2 73  ? 0.639   80.123  21.348  1.00 45.89  ? 73  LEU B CD1   1 
ATOM   3631 C CD2   . LEU D 2 73  ? -0.294  78.774  23.295  1.00 44.94  ? 73  LEU B CD2   1 
ATOM   3632 N N     . HIS D 2 74  ? -0.467  82.356  26.552  1.00 41.97  ? 74  HIS B N     1 
ATOM   3633 C CA    . HIS D 2 74  ? -0.118  83.337  27.548  1.00 41.93  ? 74  HIS B CA    1 
ATOM   3634 C C     . HIS D 2 74  ? 0.862   84.427  27.153  1.00 42.34  ? 74  HIS B C     1 
ATOM   3635 O O     . HIS D 2 74  ? 0.475   85.584  27.006  1.00 43.16  ? 74  HIS B O     1 
ATOM   3636 C CB    . HIS D 2 74  ? 0.390   82.652  28.815  1.00 43.15  ? 74  HIS B CB    1 
ATOM   3637 C CG    . HIS D 2 74  ? 0.532   83.586  29.978  1.00 44.74  ? 74  HIS B CG    1 
ATOM   3638 N ND1   . HIS D 2 74  ? -0.554  84.174  30.594  1.00 43.99  ? 74  HIS B ND1   1 
ATOM   3639 C CD2   . HIS D 2 74  ? 1.631   84.111  30.573  1.00 45.73  ? 74  HIS B CD2   1 
ATOM   3640 C CE1   . HIS D 2 74  ? -0.131  85.024  31.512  1.00 44.72  ? 74  HIS B CE1   1 
ATOM   3641 N NE2   . HIS D 2 74  ? 1.190   85.007  31.520  1.00 45.90  ? 74  HIS B NE2   1 
ATOM   3642 N N     . ALA D 2 75  ? 2.132   84.081  26.983  1.00 42.35  ? 75  ALA B N     1 
ATOM   3643 C CA    . ALA D 2 75  ? 3.129   85.099  26.668  1.00 41.99  ? 75  ALA B CA    1 
ATOM   3644 C C     . ALA D 2 75  ? 2.788   86.024  25.495  1.00 41.85  ? 75  ALA B C     1 
ATOM   3645 O O     . ALA D 2 75  ? 2.926   87.248  25.605  1.00 41.38  ? 75  ALA B O     1 
ATOM   3646 C CB    . ALA D 2 75  ? 4.493   84.453  26.461  1.00 41.16  ? 75  ALA B CB    1 
ATOM   3647 N N     . PRO D 2 76  ? 2.345   85.459  24.359  1.00 41.61  ? 76  PRO B N     1 
ATOM   3648 C CA    . PRO D 2 76  ? 2.005   86.298  23.205  1.00 42.12  ? 76  PRO B CA    1 
ATOM   3649 C C     . PRO D 2 76  ? 0.929   87.343  23.550  1.00 43.30  ? 76  PRO B C     1 
ATOM   3650 O O     . PRO D 2 76  ? 1.055   88.522  23.181  1.00 44.17  ? 76  PRO B O     1 
ATOM   3651 C CB    . PRO D 2 76  ? 1.512   85.291  22.170  1.00 41.92  ? 76  PRO B CB    1 
ATOM   3652 C CG    . PRO D 2 76  ? 2.187   84.029  22.555  1.00 41.60  ? 76  PRO B CG    1 
ATOM   3653 C CD    . PRO D 2 76  ? 2.151   84.033  24.053  1.00 41.16  ? 76  PRO B CD    1 
ATOM   3654 N N     . SER D 2 77  ? -0.124  86.919  24.254  1.00 43.34  ? 77  SER B N     1 
ATOM   3655 C CA    . SER D 2 77  ? -1.184  87.848  24.634  1.00 43.61  ? 77  SER B CA    1 
ATOM   3656 C C     . SER D 2 77  ? -0.613  88.921  25.555  1.00 43.34  ? 77  SER B C     1 
ATOM   3657 O O     . SER D 2 77  ? -0.927  90.095  25.395  1.00 43.95  ? 77  SER B O     1 
ATOM   3658 C CB    . SER D 2 77  ? -2.325  87.123  25.336  1.00 43.97  ? 77  SER B CB    1 
ATOM   3659 O OG    . SER D 2 77  ? -1.956  86.767  26.661  1.00 47.05  ? 77  SER B OG    1 
ATOM   3660 N N     . GLN D 2 78  ? 0.234   88.534  26.504  1.00 42.58  ? 78  GLN B N     1 
ATOM   3661 C CA    . GLN D 2 78  ? 0.826   89.509  27.412  1.00 42.70  ? 78  GLN B CA    1 
ATOM   3662 C C     . GLN D 2 78  ? 1.683   90.499  26.660  1.00 42.63  ? 78  GLN B C     1 
ATOM   3663 O O     . GLN D 2 78  ? 1.705   91.688  26.985  1.00 41.81  ? 78  GLN B O     1 
ATOM   3664 C CB    . GLN D 2 78  ? 1.706   88.829  28.458  1.00 43.40  ? 78  GLN B CB    1 
ATOM   3665 C CG    . GLN D 2 78  ? 0.984   87.798  29.287  1.00 45.43  ? 78  GLN B CG    1 
ATOM   3666 C CD    . GLN D 2 78  ? -0.184  88.403  30.046  1.00 46.54  ? 78  GLN B CD    1 
ATOM   3667 O OE1   . GLN D 2 78  ? -0.009  89.336  30.839  1.00 46.39  ? 78  GLN B OE1   1 
ATOM   3668 N NE2   . GLN D 2 78  ? -1.383  87.879  29.801  1.00 46.20  ? 78  GLN B NE2   1 
ATOM   3669 N N     . ILE D 2 79  ? 2.396   89.995  25.654  1.00 42.59  ? 79  ILE B N     1 
ATOM   3670 C CA    . ILE D 2 79  ? 3.294   90.822  24.857  1.00 42.34  ? 79  ILE B CA    1 
ATOM   3671 C C     . ILE D 2 79  ? 2.542   91.801  23.953  1.00 42.07  ? 79  ILE B C     1 
ATOM   3672 O O     . ILE D 2 79  ? 2.854   92.987  23.933  1.00 40.85  ? 79  ILE B O     1 
ATOM   3673 C CB    . ILE D 2 79  ? 4.273   89.925  24.034  1.00 42.07  ? 79  ILE B CB    1 
ATOM   3674 C CG1   . ILE D 2 79  ? 5.300   89.294  24.987  1.00 42.54  ? 79  ILE B CG1   1 
ATOM   3675 C CG2   . ILE D 2 79  ? 5.000   90.740  22.976  1.00 41.00  ? 79  ILE B CG2   1 
ATOM   3676 C CD1   . ILE D 2 79  ? 5.968   88.024  24.456  1.00 40.57  ? 79  ILE B CD1   1 
ATOM   3677 N N     . VAL D 2 80  ? 1.551   91.315  23.217  1.00 42.34  ? 80  VAL B N     1 
ATOM   3678 C CA    . VAL D 2 80  ? 0.786   92.200  22.354  1.00 43.95  ? 80  VAL B CA    1 
ATOM   3679 C C     . VAL D 2 80  ? 0.156   93.314  23.193  1.00 44.57  ? 80  VAL B C     1 
ATOM   3680 O O     . VAL D 2 80  ? 0.147   94.479  22.790  1.00 43.88  ? 80  VAL B O     1 
ATOM   3681 C CB    . VAL D 2 80  ? -0.316  91.439  21.618  1.00 44.91  ? 80  VAL B CB    1 
ATOM   3682 C CG1   . VAL D 2 80  ? -1.433  92.384  21.223  1.00 45.22  ? 80  VAL B CG1   1 
ATOM   3683 C CG2   . VAL D 2 80  ? 0.261   90.791  20.384  1.00 44.86  ? 80  VAL B CG2   1 
ATOM   3684 N N     . ALA D 2 81  ? -0.345  92.949  24.371  1.00 44.94  ? 81  ALA B N     1 
ATOM   3685 C CA    . ALA D 2 81  ? -0.965  93.907  25.274  1.00 45.20  ? 81  ALA B CA    1 
ATOM   3686 C C     . ALA D 2 81  ? 0.006   95.016  25.636  1.00 45.89  ? 81  ALA B C     1 
ATOM   3687 O O     . ALA D 2 81  ? -0.335  96.197  25.554  1.00 46.91  ? 81  ALA B O     1 
ATOM   3688 C CB    . ALA D 2 81  ? -1.434  93.210  26.531  1.00 44.96  ? 81  ALA B CB    1 
ATOM   3689 N N     . ALA D 2 82  ? 1.217   94.649  26.043  1.00 46.05  ? 82  ALA B N     1 
ATOM   3690 C CA    . ALA D 2 82  ? 2.202   95.658  26.411  1.00 46.03  ? 82  ALA B CA    1 
ATOM   3691 C C     . ALA D 2 82  ? 2.632   96.451  25.174  1.00 46.39  ? 82  ALA B C     1 
ATOM   3692 O O     . ALA D 2 82  ? 3.027   97.610  25.285  1.00 45.56  ? 82  ALA B O     1 
ATOM   3693 C CB    . ALA D 2 82  ? 3.402   95.006  27.075  1.00 45.14  ? 82  ALA B CB    1 
ATOM   3694 N N     . ILE D 2 83  ? 2.548   95.829  23.999  1.00 47.19  ? 83  ILE B N     1 
ATOM   3695 C CA    . ILE D 2 83  ? 2.921   96.517  22.767  1.00 48.91  ? 83  ILE B CA    1 
ATOM   3696 C C     . ILE D 2 83  ? 1.881   97.598  22.483  1.00 50.09  ? 83  ILE B C     1 
ATOM   3697 O O     . ILE D 2 83  ? 2.228   98.776  22.385  1.00 49.99  ? 83  ILE B O     1 
ATOM   3698 C CB    . ILE D 2 83  ? 3.021   95.547  21.553  1.00 48.06  ? 83  ILE B CB    1 
ATOM   3699 C CG1   . ILE D 2 83  ? 4.269   94.676  21.692  1.00 47.76  ? 83  ILE B CG1   1 
ATOM   3700 C CG2   . ILE D 2 83  ? 3.092   96.329  20.240  1.00 47.71  ? 83  ILE B CG2   1 
ATOM   3701 C CD1   . ILE D 2 83  ? 4.466   93.710  20.552  1.00 46.53  ? 83  ILE B CD1   1 
ATOM   3702 N N     . LYS D 2 84  ? 0.614   97.196  22.370  1.00 51.17  ? 84  LYS B N     1 
ATOM   3703 C CA    . LYS D 2 84  ? -0.470  98.139  22.117  1.00 52.48  ? 84  LYS B CA    1 
ATOM   3704 C C     . LYS D 2 84  ? -0.479  99.220  23.195  1.00 53.20  ? 84  LYS B C     1 
ATOM   3705 O O     . LYS D 2 84  ? -0.633  100.405 22.904  1.00 53.06  ? 84  LYS B O     1 
ATOM   3706 C CB    . LYS D 2 84  ? -1.816  97.416  22.085  1.00 52.39  ? 84  LYS B CB    1 
ATOM   3707 C CG    . LYS D 2 84  ? -1.908  96.388  20.974  1.00 53.53  ? 84  LYS B CG    1 
ATOM   3708 C CD    . LYS D 2 84  ? -3.324  95.910  20.761  1.00 54.78  ? 84  LYS B CD    1 
ATOM   3709 C CE    . LYS D 2 84  ? -4.057  96.765  19.722  1.00 56.10  ? 84  LYS B CE    1 
ATOM   3710 N NZ    . LYS D 2 84  ? -3.766  96.342  18.305  1.00 57.42  ? 84  LYS B NZ    1 
ATOM   3711 N N     . SER D 2 85  ? -0.286  98.818  24.440  1.00 53.81  ? 85  SER B N     1 
ATOM   3712 C CA    . SER D 2 85  ? -0.271  99.789  25.510  1.00 55.26  ? 85  SER B CA    1 
ATOM   3713 C C     . SER D 2 85  ? 0.793   100.856 25.283  1.00 56.75  ? 85  SER B C     1 
ATOM   3714 O O     . SER D 2 85  ? 0.486   102.040 25.261  1.00 57.84  ? 85  SER B O     1 
ATOM   3715 C CB    . SER D 2 85  ? -0.034  99.100  26.845  1.00 55.15  ? 85  SER B CB    1 
ATOM   3716 O OG    . SER D 2 85  ? 0.235   100.062 27.849  1.00 55.04  ? 85  SER B OG    1 
ATOM   3717 N N     . ARG D 2 86  ? 2.043   100.442 25.110  1.00 58.30  ? 86  ARG B N     1 
ATOM   3718 C CA    . ARG D 2 86  ? 3.138   101.386 24.896  1.00 59.39  ? 86  ARG B CA    1 
ATOM   3719 C C     . ARG D 2 86  ? 2.996   102.193 23.603  1.00 60.30  ? 86  ARG B C     1 
ATOM   3720 O O     . ARG D 2 86  ? 3.406   103.349 23.542  1.00 60.08  ? 86  ARG B O     1 
ATOM   3721 C CB    . ARG D 2 86  ? 4.474   100.635 24.931  1.00 59.34  ? 86  ARG B CB    1 
ATOM   3722 C CG    . ARG D 2 86  ? 5.625   101.305 24.210  1.00 59.79  ? 86  ARG B CG    1 
ATOM   3723 C CD    . ARG D 2 86  ? 5.929   102.692 24.713  1.00 59.88  ? 86  ARG B CD    1 
ATOM   3724 N NE    . ARG D 2 86  ? 6.618   102.710 25.989  1.00 60.28  ? 86  ARG B NE    1 
ATOM   3725 C CZ    . ARG D 2 86  ? 7.356   103.735 26.400  1.00 61.57  ? 86  ARG B CZ    1 
ATOM   3726 N NH1   . ARG D 2 86  ? 7.495   104.802 25.629  1.00 62.18  ? 86  ARG B NH1   1 
ATOM   3727 N NH2   . ARG D 2 86  ? 7.952   103.704 27.578  1.00 62.71  ? 86  ARG B NH2   1 
ATOM   3728 N N     . ALA D 2 87  ? 2.415   101.596 22.572  1.00 61.49  ? 87  ALA B N     1 
ATOM   3729 C CA    . ALA D 2 87  ? 2.228   102.312 21.323  1.00 63.65  ? 87  ALA B CA    1 
ATOM   3730 C C     . ALA D 2 87  ? 1.192   103.434 21.512  1.00 65.46  ? 87  ALA B C     1 
ATOM   3731 O O     . ALA D 2 87  ? 1.374   104.552 21.010  1.00 65.08  ? 87  ALA B O     1 
ATOM   3732 C CB    . ALA D 2 87  ? 1.776   101.357 20.234  1.00 63.25  ? 87  ALA B CB    1 
ATOM   3733 N N     . ASP D 2 88  ? 0.108   103.139 22.236  1.00 67.00  ? 88  ASP B N     1 
ATOM   3734 C CA    . ASP D 2 88  ? -0.926  104.141 22.481  1.00 68.47  ? 88  ASP B CA    1 
ATOM   3735 C C     . ASP D 2 88  ? -0.298  105.296 23.230  1.00 68.63  ? 88  ASP B C     1 
ATOM   3736 O O     . ASP D 2 88  ? -0.570  106.460 22.953  1.00 69.21  ? 88  ASP B O     1 
ATOM   3737 C CB    . ASP D 2 88  ? -2.082  103.573 23.314  1.00 70.02  ? 88  ASP B CB    1 
ATOM   3738 C CG    . ASP D 2 88  ? -2.915  102.546 22.549  1.00 72.30  ? 88  ASP B CG    1 
ATOM   3739 O OD1   . ASP D 2 88  ? -3.115  102.744 21.325  1.00 73.26  ? 88  ASP B OD1   1 
ATOM   3740 O OD2   . ASP D 2 88  ? -3.379  101.551 23.172  1.00 72.76  ? 88  ASP B OD2   1 
ATOM   3741 N N     . GLN D 2 89  ? 0.560   104.960 24.178  1.00 68.46  ? 89  GLN B N     1 
ATOM   3742 C CA    . GLN D 2 89  ? 1.241   105.951 24.986  1.00 68.64  ? 89  GLN B CA    1 
ATOM   3743 C C     . GLN D 2 89  ? 2.215   106.813 24.175  1.00 68.89  ? 89  GLN B C     1 
ATOM   3744 O O     . GLN D 2 89  ? 2.599   107.897 24.612  1.00 69.25  ? 89  GLN B O     1 
ATOM   3745 C CB    . GLN D 2 89  ? 1.971   105.237 26.113  1.00 69.07  ? 89  GLN B CB    1 
ATOM   3746 C CG    . GLN D 2 89  ? 2.687   106.140 27.072  1.00 70.81  ? 89  GLN B CG    1 
ATOM   3747 C CD    . GLN D 2 89  ? 3.351   105.361 28.193  1.00 72.36  ? 89  GLN B CD    1 
ATOM   3748 O OE1   . GLN D 2 89  ? 3.921   105.946 29.119  1.00 73.63  ? 89  GLN B OE1   1 
ATOM   3749 N NE2   . GLN D 2 89  ? 3.282   104.033 28.116  1.00 72.51  ? 89  GLN B NE2   1 
ATOM   3750 N N     . LEU D 2 90  ? 2.619   106.342 22.997  1.00 68.66  ? 90  LEU B N     1 
ATOM   3751 C CA    . LEU D 2 90  ? 3.548   107.100 22.162  1.00 68.34  ? 90  LEU B CA    1 
ATOM   3752 C C     . LEU D 2 90  ? 2.839   107.690 20.949  1.00 68.10  ? 90  LEU B C     1 
ATOM   3753 O O     . LEU D 2 90  ? 3.475   108.232 20.050  1.00 67.74  ? 90  LEU B O     1 
ATOM   3754 C CB    . LEU D 2 90  ? 4.695   106.208 21.682  1.00 68.41  ? 90  LEU B CB    1 
ATOM   3755 C CG    . LEU D 2 90  ? 5.690   105.670 22.708  1.00 68.26  ? 90  LEU B CG    1 
ATOM   3756 C CD1   . LEU D 2 90  ? 6.717   104.810 22.001  1.00 68.39  ? 90  LEU B CD1   1 
ATOM   3757 C CD2   . LEU D 2 90  ? 6.372   106.815 23.422  1.00 68.16  ? 90  LEU B CD2   1 
ATOM   3758 N N     . GLY D 2 91  ? 1.518   107.570 20.928  1.00 67.59  ? 91  GLY B N     1 
ATOM   3759 C CA    . GLY D 2 91  ? 0.761   108.096 19.817  1.00 67.13  ? 91  GLY B CA    1 
ATOM   3760 C C     . GLY D 2 91  ? 1.009   107.299 18.557  1.00 67.11  ? 91  GLY B C     1 
ATOM   3761 O O     . GLY D 2 91  ? 0.865   107.807 17.444  1.00 67.33  ? 91  GLY B O     1 
ATOM   3762 N N     . ALA D 2 92  ? 1.393   106.040 18.729  1.00 66.80  ? 92  ALA B N     1 
ATOM   3763 C CA    . ALA D 2 92  ? 1.647   105.169 17.593  1.00 65.75  ? 92  ALA B CA    1 
ATOM   3764 C C     . ALA D 2 92  ? 0.487   104.209 17.449  1.00 65.07  ? 92  ALA B C     1 
ATOM   3765 O O     . ALA D 2 92  ? -0.121  103.810 18.432  1.00 65.09  ? 92  ALA B O     1 
ATOM   3766 C CB    . ALA D 2 92  ? 2.933   104.402 17.798  1.00 66.25  ? 92  ALA B CB    1 
ATOM   3767 N N     . SER D 2 93  ? 0.188   103.837 16.216  1.00 64.54  ? 93  SER B N     1 
ATOM   3768 C CA    . SER D 2 93  ? -0.907  102.929 15.939  1.00 64.43  ? 93  SER B CA    1 
ATOM   3769 C C     . SER D 2 93  ? -0.360  101.511 15.808  1.00 64.03  ? 93  SER B C     1 
ATOM   3770 O O     . SER D 2 93  ? 0.819   101.335 15.517  1.00 64.68  ? 93  SER B O     1 
ATOM   3771 C CB    . SER D 2 93  ? -1.586  103.359 14.644  1.00 65.09  ? 93  SER B CB    1 
ATOM   3772 O OG    . SER D 2 93  ? -2.686  102.527 14.343  1.00 67.45  ? 93  SER B OG    1 
ATOM   3773 N N     . VAL D 2 94  ? -1.202  100.502 16.014  1.00 62.98  ? 94  VAL B N     1 
ATOM   3774 C CA    . VAL D 2 94  ? -0.748  99.121  15.915  1.00 62.25  ? 94  VAL B CA    1 
ATOM   3775 C C     . VAL D 2 94  ? -1.746  98.166  15.288  1.00 62.11  ? 94  VAL B C     1 
ATOM   3776 O O     . VAL D 2 94  ? -2.863  98.021  15.773  1.00 62.63  ? 94  VAL B O     1 
ATOM   3777 C CB    . VAL D 2 94  ? -0.392  98.544  17.304  1.00 62.28  ? 94  VAL B CB    1 
ATOM   3778 C CG1   . VAL D 2 94  ? -0.066  97.069  17.185  1.00 61.92  ? 94  VAL B CG1   1 
ATOM   3779 C CG2   . VAL D 2 94  ? 0.784   99.287  17.897  1.00 62.09  ? 94  VAL B CG2   1 
ATOM   3780 N N     . VAL D 2 95  ? -1.340  97.508  14.213  1.00 61.83  ? 95  VAL B N     1 
ATOM   3781 C CA    . VAL D 2 95  ? -2.194  96.524  13.558  1.00 62.22  ? 95  VAL B CA    1 
ATOM   3782 C C     . VAL D 2 95  ? -1.491  95.183  13.767  1.00 62.53  ? 95  VAL B C     1 
ATOM   3783 O O     . VAL D 2 95  ? -0.269  95.114  13.669  1.00 62.63  ? 95  VAL B O     1 
ATOM   3784 C CB    . VAL D 2 95  ? -2.352  96.818  12.044  1.00 62.14  ? 95  VAL B CB    1 
ATOM   3785 C CG1   . VAL D 2 95  ? -1.018  97.212  11.442  1.00 62.35  ? 95  VAL B CG1   1 
ATOM   3786 C CG2   . VAL D 2 95  ? -2.905  95.594  11.330  1.00 62.00  ? 95  VAL B CG2   1 
ATOM   3787 N N     . VAL D 2 96  ? -2.234  94.124  14.073  1.00 62.53  ? 96  VAL B N     1 
ATOM   3788 C CA    . VAL D 2 96  ? -1.585  92.843  14.305  1.00 63.22  ? 96  VAL B CA    1 
ATOM   3789 C C     . VAL D 2 96  ? -2.157  91.699  13.497  1.00 64.21  ? 96  VAL B C     1 
ATOM   3790 O O     . VAL D 2 96  ? -3.366  91.528  13.414  1.00 64.35  ? 96  VAL B O     1 
ATOM   3791 C CB    . VAL D 2 96  ? -1.599  92.438  15.819  1.00 62.71  ? 96  VAL B CB    1 
ATOM   3792 C CG1   . VAL D 2 96  ? -1.801  93.664  16.690  1.00 62.70  ? 96  VAL B CG1   1 
ATOM   3793 C CG2   . VAL D 2 96  ? -2.651  91.382  16.085  1.00 62.48  ? 96  VAL B CG2   1 
ATOM   3794 N N     . SER D 2 97  ? -1.265  90.912  12.908  1.00 65.35  ? 97  SER B N     1 
ATOM   3795 C CA    . SER D 2 97  ? -1.663  89.772  12.108  1.00 66.72  ? 97  SER B CA    1 
ATOM   3796 C C     . SER D 2 97  ? -1.313  88.530  12.906  1.00 67.69  ? 97  SER B C     1 
ATOM   3797 O O     . SER D 2 97  ? -0.150  88.283  13.215  1.00 67.95  ? 97  SER B O     1 
ATOM   3798 C CB    . SER D 2 97  ? -0.915  89.782  10.777  1.00 66.62  ? 97  SER B CB    1 
ATOM   3799 O OG    . SER D 2 97  ? -1.459  88.833  9.881   1.00 67.56  ? 97  SER B OG    1 
ATOM   3800 N N     . MET D 2 98  ? -2.329  87.755  13.250  1.00 68.94  ? 98  MET B N     1 
ATOM   3801 C CA    . MET D 2 98  ? -2.126  86.558  14.041  1.00 70.53  ? 98  MET B CA    1 
ATOM   3802 C C     . MET D 2 98  ? -1.868  85.360  13.144  1.00 71.94  ? 98  MET B C     1 
ATOM   3803 O O     . MET D 2 98  ? -2.625  85.099  12.213  1.00 72.23  ? 98  MET B O     1 
ATOM   3804 C CB    . MET D 2 98  ? -3.357  86.315  14.916  1.00 70.48  ? 98  MET B CB    1 
ATOM   3805 C CG    . MET D 2 98  ? -3.151  85.319  16.035  1.00 70.66  ? 98  MET B CG    1 
ATOM   3806 S SD    . MET D 2 98  ? -4.581  85.188  17.128  1.00 70.78  ? 98  MET B SD    1 
ATOM   3807 C CE    . MET D 2 98  ? -5.452  83.796  16.377  1.00 69.67  ? 98  MET B CE    1 
ATOM   3808 N N     . VAL D 2 99  ? -0.788  84.638  13.419  1.00 73.54  ? 99  VAL B N     1 
ATOM   3809 C CA    . VAL D 2 99  ? -0.442  83.463  12.637  1.00 75.55  ? 99  VAL B CA    1 
ATOM   3810 C C     . VAL D 2 99  ? -0.834  82.214  13.414  1.00 77.46  ? 99  VAL B C     1 
ATOM   3811 O O     . VAL D 2 99  ? -0.342  81.994  14.517  1.00 77.86  ? 99  VAL B O     1 
ATOM   3812 C CB    . VAL D 2 99  ? 1.062   83.406  12.369  1.00 75.27  ? 99  VAL B CB    1 
ATOM   3813 C CG1   . VAL D 2 99  ? 1.377   82.230  11.465  1.00 75.52  ? 99  VAL B CG1   1 
ATOM   3814 C CG2   . VAL D 2 99  ? 1.529   84.700  11.756  1.00 74.81  ? 99  VAL B CG2   1 
ATOM   3815 N N     . GLU D 2 100 ? -1.721  81.401  12.848  1.00 79.76  ? 100 GLU B N     1 
ATOM   3816 C CA    . GLU D 2 100 ? -2.155  80.180  13.521  1.00 82.09  ? 100 GLU B CA    1 
ATOM   3817 C C     . GLU D 2 100 ? -1.526  78.947  12.896  1.00 83.35  ? 100 GLU B C     1 
ATOM   3818 O O     . GLU D 2 100 ? -1.013  78.077  13.602  1.00 83.47  ? 100 GLU B O     1 
ATOM   3819 C CB    . GLU D 2 100 ? -3.674  80.052  13.476  1.00 82.83  ? 100 GLU B CB    1 
ATOM   3820 C CG    . GLU D 2 100 ? -4.400  81.018  14.382  1.00 84.10  ? 100 GLU B CG    1 
ATOM   3821 C CD    . GLU D 2 100 ? -5.903  80.949  14.198  1.00 85.06  ? 100 GLU B CD    1 
ATOM   3822 O OE1   . GLU D 2 100 ? -6.367  81.186  13.056  1.00 85.21  ? 100 GLU B OE1   1 
ATOM   3823 O OE2   . GLU D 2 100 ? -6.612  80.658  15.192  1.00 85.50  ? 100 GLU B OE2   1 
ATOM   3824 N N     . ARG D 2 101 ? -1.573  78.865  11.570  1.00 84.76  ? 101 ARG B N     1 
ATOM   3825 C CA    . ARG D 2 101 ? -0.977  77.729  10.881  1.00 86.05  ? 101 ARG B CA    1 
ATOM   3826 C C     . ARG D 2 101 ? 0.510   77.716  11.239  1.00 86.24  ? 101 ARG B C     1 
ATOM   3827 O O     . ARG D 2 101 ? 1.141   78.768  11.355  1.00 86.61  ? 101 ARG B O     1 
ATOM   3828 C CB    . ARG D 2 101 ? -1.155  77.868  9.363   1.00 87.07  ? 101 ARG B CB    1 
ATOM   3829 C CG    . ARG D 2 101 ? -2.608  77.927  8.909   1.00 88.95  ? 101 ARG B CG    1 
ATOM   3830 C CD    . ARG D 2 101 ? -2.724  78.272  7.427   1.00 90.31  ? 101 ARG B CD    1 
ATOM   3831 N NE    . ARG D 2 101 ? -2.079  79.547  7.115   1.00 92.21  ? 101 ARG B NE    1 
ATOM   3832 C CZ    . ARG D 2 101 ? -2.162  80.170  5.939   1.00 93.13  ? 101 ARG B CZ    1 
ATOM   3833 N NH1   . ARG D 2 101 ? -2.870  79.638  4.948   1.00 93.60  ? 101 ARG B NH1   1 
ATOM   3834 N NH2   . ARG D 2 101 ? -1.535  81.328  5.754   1.00 93.34  ? 101 ARG B NH2   1 
ATOM   3835 N N     . SER D 2 102 ? 1.060   76.527  11.447  1.00 86.17  ? 102 SER B N     1 
ATOM   3836 C CA    . SER D 2 102 ? 2.473   76.408  11.768  1.00 85.65  ? 102 SER B CA    1 
ATOM   3837 C C     . SER D 2 102 ? 3.244   76.440  10.453  1.00 85.02  ? 102 SER B C     1 
ATOM   3838 O O     . SER D 2 102 ? 2.836   75.809  9.477   1.00 85.09  ? 102 SER B O     1 
ATOM   3839 C CB    . SER D 2 102 ? 2.739   75.089  12.492  1.00 86.10  ? 102 SER B CB    1 
ATOM   3840 O OG    . SER D 2 102 ? 4.131   74.877  12.662  1.00 86.91  ? 102 SER B OG    1 
ATOM   3841 N N     . GLY D 2 103 ? 4.346   77.177  10.418  1.00 84.11  ? 103 GLY B N     1 
ATOM   3842 C CA    . GLY D 2 103 ? 5.122   77.240  9.197   1.00 83.44  ? 103 GLY B CA    1 
ATOM   3843 C C     . GLY D 2 103 ? 5.587   78.629  8.821   1.00 82.85  ? 103 GLY B C     1 
ATOM   3844 O O     . GLY D 2 103 ? 5.009   79.628  9.249   1.00 83.10  ? 103 GLY B O     1 
ATOM   3845 N N     . VAL D 2 104 ? 6.635   78.680  8.007   1.00 82.05  ? 104 VAL B N     1 
ATOM   3846 C CA    . VAL D 2 104 ? 7.221   79.935  7.550   1.00 81.43  ? 104 VAL B CA    1 
ATOM   3847 C C     . VAL D 2 104 ? 6.354   80.623  6.509   1.00 80.88  ? 104 VAL B C     1 
ATOM   3848 O O     . VAL D 2 104 ? 6.382   81.848  6.380   1.00 80.88  ? 104 VAL B O     1 
ATOM   3849 C CB    . VAL D 2 104 ? 8.601   79.693  6.932   1.00 81.52  ? 104 VAL B CB    1 
ATOM   3850 C CG1   . VAL D 2 104 ? 9.315   81.022  6.689   1.00 81.71  ? 104 VAL B CG1   1 
ATOM   3851 C CG2   . VAL D 2 104 ? 9.400   78.792  7.842   1.00 81.79  ? 104 VAL B CG2   1 
ATOM   3852 N N     . GLU D 2 105 ? 5.601   79.832  5.752   1.00 80.12  ? 105 GLU B N     1 
ATOM   3853 C CA    . GLU D 2 105 ? 4.727   80.390  4.735   1.00 79.17  ? 105 GLU B CA    1 
ATOM   3854 C C     . GLU D 2 105 ? 3.637   81.194  5.423   1.00 77.96  ? 105 GLU B C     1 
ATOM   3855 O O     . GLU D 2 105 ? 3.313   82.309  5.008   1.00 77.60  ? 105 GLU B O     1 
ATOM   3856 C CB    . GLU D 2 105 ? 4.134   79.268  3.880   1.00 80.09  ? 105 GLU B CB    1 
ATOM   3857 C CG    . GLU D 2 105 ? 5.158   78.665  2.933   1.00 81.61  ? 105 GLU B CG    1 
ATOM   3858 C CD    . GLU D 2 105 ? 5.758   79.710  1.991   1.00 82.76  ? 105 GLU B CD    1 
ATOM   3859 O OE1   . GLU D 2 105 ? 5.071   80.112  1.020   1.00 83.51  ? 105 GLU B OE1   1 
ATOM   3860 O OE2   . GLU D 2 105 ? 6.910   80.145  2.227   1.00 82.79  ? 105 GLU B OE2   1 
ATOM   3861 N N     . ALA D 2 106 ? 3.093   80.629  6.496   1.00 76.46  ? 106 ALA B N     1 
ATOM   3862 C CA    . ALA D 2 106 ? 2.050   81.291  7.264   1.00 74.94  ? 106 ALA B CA    1 
ATOM   3863 C C     . ALA D 2 106 ? 2.569   82.623  7.784   1.00 73.96  ? 106 ALA B C     1 
ATOM   3864 O O     . ALA D 2 106 ? 1.891   83.644  7.690   1.00 73.86  ? 106 ALA B O     1 
ATOM   3865 C CB    . ALA D 2 106 ? 1.627   80.411  8.420   1.00 74.92  ? 106 ALA B CB    1 
ATOM   3866 N N     . CYS D 2 107 ? 3.780   82.607  8.328   1.00 72.72  ? 107 CYS B N     1 
ATOM   3867 C CA    . CYS D 2 107 ? 4.374   83.817  8.863   1.00 71.84  ? 107 CYS B CA    1 
ATOM   3868 C C     . CYS D 2 107 ? 4.656   84.801  7.743   1.00 71.52  ? 107 CYS B C     1 
ATOM   3869 O O     . CYS D 2 107 ? 4.584   86.014  7.935   1.00 71.49  ? 107 CYS B O     1 
ATOM   3870 C CB    . CYS D 2 107 ? 5.669   83.496  9.616   1.00 71.34  ? 107 CYS B CB    1 
ATOM   3871 S SG    . CYS D 2 107 ? 6.402   84.928  10.453  1.00 69.80  ? 107 CYS B SG    1 
ATOM   3872 N N     . LYS D 2 108 ? 4.991   84.283  6.569   1.00 71.57  ? 108 LYS B N     1 
ATOM   3873 C CA    . LYS D 2 108 ? 5.258   85.153  5.433   1.00 71.57  ? 108 LYS B CA    1 
ATOM   3874 C C     . LYS D 2 108 ? 3.942   85.774  4.974   1.00 71.18  ? 108 LYS B C     1 
ATOM   3875 O O     . LYS D 2 108 ? 3.891   86.959  4.643   1.00 71.06  ? 108 LYS B O     1 
ATOM   3876 C CB    . LYS D 2 108 ? 5.915   84.370  4.295   1.00 72.26  ? 108 LYS B CB    1 
ATOM   3877 C CG    . LYS D 2 108 ? 7.380   84.041  4.535   1.00 72.94  ? 108 LYS B CG    1 
ATOM   3878 C CD    . LYS D 2 108 ? 8.003   83.400  3.303   1.00 74.04  ? 108 LYS B CD    1 
ATOM   3879 C CE    . LYS D 2 108 ? 9.493   83.158  3.491   1.00 74.77  ? 108 LYS B CE    1 
ATOM   3880 N NZ    . LYS D 2 108 ? 10.131  82.608  2.256   1.00 75.33  ? 108 LYS B NZ    1 
ATOM   3881 N N     . THR D 2 109 ? 2.879   84.973  4.966   1.00 70.87  ? 109 THR B N     1 
ATOM   3882 C CA    . THR D 2 109 ? 1.560   85.462  4.582   1.00 70.75  ? 109 THR B CA    1 
ATOM   3883 C C     . THR D 2 109 ? 1.229   86.637  5.496   1.00 70.90  ? 109 THR B C     1 
ATOM   3884 O O     . THR D 2 109 ? 0.794   87.695  5.045   1.00 70.89  ? 109 THR B O     1 
ATOM   3885 C CB    . THR D 2 109 ? 0.474   84.385  4.779   1.00 70.81  ? 109 THR B CB    1 
ATOM   3886 O OG1   . THR D 2 109 ? 0.753   83.256  3.947   1.00 70.77  ? 109 THR B OG1   1 
ATOM   3887 C CG2   . THR D 2 109 ? -0.892  84.935  4.422   1.00 70.45  ? 109 THR B CG2   1 
ATOM   3888 N N     . ALA D 2 110 ? 1.448   86.435  6.789   1.00 70.99  ? 110 ALA B N     1 
ATOM   3889 C CA    . ALA D 2 110 ? 1.177   87.459  7.781   1.00 71.27  ? 110 ALA B CA    1 
ATOM   3890 C C     . ALA D 2 110 ? 1.972   88.725  7.508   1.00 71.81  ? 110 ALA B C     1 
ATOM   3891 O O     . ALA D 2 110 ? 1.435   89.824  7.569   1.00 72.26  ? 110 ALA B O     1 
ATOM   3892 C CB    . ALA D 2 110 ? 1.493   86.931  9.159   1.00 70.64  ? 110 ALA B CB    1 
ATOM   3893 N N     . VAL D 2 111 ? 3.256   88.580  7.212   1.00 72.76  ? 111 VAL B N     1 
ATOM   3894 C CA    . VAL D 2 111 ? 4.089   89.743  6.933   1.00 73.51  ? 111 VAL B CA    1 
ATOM   3895 C C     . VAL D 2 111 ? 3.616   90.431  5.655   1.00 74.12  ? 111 VAL B C     1 
ATOM   3896 O O     . VAL D 2 111 ? 3.687   91.651  5.537   1.00 74.09  ? 111 VAL B O     1 
ATOM   3897 C CB    . VAL D 2 111 ? 5.580   89.343  6.790   1.00 73.33  ? 111 VAL B CB    1 
ATOM   3898 C CG1   . VAL D 2 111 ? 6.420   90.546  6.357   1.00 73.16  ? 111 VAL B CG1   1 
ATOM   3899 C CG2   . VAL D 2 111 ? 6.089   88.808  8.111   1.00 73.02  ? 111 VAL B CG2   1 
ATOM   3900 N N     . HIS D 2 112 ? 3.128   89.643  4.703   1.00 75.14  ? 112 HIS B N     1 
ATOM   3901 C CA    . HIS D 2 112 ? 2.643   90.185  3.440   1.00 76.30  ? 112 HIS B CA    1 
ATOM   3902 C C     . HIS D 2 112 ? 1.524   91.190  3.709   1.00 76.10  ? 112 HIS B C     1 
ATOM   3903 O O     . HIS D 2 112 ? 1.597   92.342  3.276   1.00 75.89  ? 112 HIS B O     1 
ATOM   3904 C CB    . HIS D 2 112 ? 2.127   89.054  2.544   1.00 77.99  ? 112 HIS B CB    1 
ATOM   3905 C CG    . HIS D 2 112 ? 1.750   89.495  1.163   1.00 80.41  ? 112 HIS B CG    1 
ATOM   3906 N ND1   . HIS D 2 112 ? 1.167   88.645  0.245   1.00 81.66  ? 112 HIS B ND1   1 
ATOM   3907 C CD2   . HIS D 2 112 ? 1.884   90.690  0.535   1.00 81.34  ? 112 HIS B CD2   1 
ATOM   3908 C CE1   . HIS D 2 112 ? 0.959   89.297  -0.887  1.00 81.92  ? 112 HIS B CE1   1 
ATOM   3909 N NE2   . HIS D 2 112 ? 1.385   90.540  -0.737  1.00 81.87  ? 112 HIS B NE2   1 
ATOM   3910 N N     . ASN D 2 113 ? 0.497   90.748  4.436   1.00 75.88  ? 113 ASN B N     1 
ATOM   3911 C CA    . ASN D 2 113 ? -0.638  91.602  4.772   1.00 75.65  ? 113 ASN B CA    1 
ATOM   3912 C C     . ASN D 2 113 ? -0.216  92.847  5.548   1.00 75.41  ? 113 ASN B C     1 
ATOM   3913 O O     . ASN D 2 113 ? -0.666  93.954  5.253   1.00 75.69  ? 113 ASN B O     1 
ATOM   3914 C CB    . ASN D 2 113 ? -1.665  90.824  5.588   1.00 75.87  ? 113 ASN B CB    1 
ATOM   3915 C CG    . ASN D 2 113 ? -2.183  89.603  4.856   1.00 76.53  ? 113 ASN B CG    1 
ATOM   3916 O OD1   . ASN D 2 113 ? -2.340  89.619  3.632   1.00 76.78  ? 113 ASN B OD1   1 
ATOM   3917 N ND2   . ASN D 2 113 ? -2.470  88.540  5.604   1.00 76.49  ? 113 ASN B ND2   1 
ATOM   3918 N N     . LEU D 2 114 ? 0.642   92.666  6.544   1.00 74.76  ? 114 LEU B N     1 
ATOM   3919 C CA    . LEU D 2 114 ? 1.111   93.792  7.335   1.00 74.38  ? 114 LEU B CA    1 
ATOM   3920 C C     . LEU D 2 114 ? 1.783   94.818  6.429   1.00 74.19  ? 114 LEU B C     1 
ATOM   3921 O O     . LEU D 2 114 ? 1.688   96.022  6.657   1.00 73.74  ? 114 LEU B O     1 
ATOM   3922 C CB    . LEU D 2 114 ? 2.088   93.306  8.409   1.00 74.09  ? 114 LEU B CB    1 
ATOM   3923 C CG    . LEU D 2 114 ? 1.607   93.239  9.861   1.00 73.93  ? 114 LEU B CG    1 
ATOM   3924 C CD1   . LEU D 2 114 ? 0.227   92.653  9.944   1.00 74.18  ? 114 LEU B CD1   1 
ATOM   3925 C CD2   . LEU D 2 114 ? 2.577   92.399  10.661  1.00 74.02  ? 114 LEU B CD2   1 
ATOM   3926 N N     . LEU D 2 115 ? 2.464   94.327  5.399   1.00 74.41  ? 115 LEU B N     1 
ATOM   3927 C CA    . LEU D 2 115 ? 3.154   95.189  4.445   1.00 74.67  ? 115 LEU B CA    1 
ATOM   3928 C C     . LEU D 2 115 ? 2.127   95.905  3.568   1.00 74.57  ? 115 LEU B C     1 
ATOM   3929 O O     . LEU D 2 115 ? 2.284   97.079  3.234   1.00 74.35  ? 115 LEU B O     1 
ATOM   3930 C CB    . LEU D 2 115 ? 4.106   94.352  3.584   1.00 74.89  ? 115 LEU B CB    1 
ATOM   3931 C CG    . LEU D 2 115 ? 5.625   94.445  3.822   1.00 75.02  ? 115 LEU B CG    1 
ATOM   3932 C CD1   . LEU D 2 115 ? 5.948   94.622  5.288   1.00 74.95  ? 115 LEU B CD1   1 
ATOM   3933 C CD2   . LEU D 2 115 ? 6.283   93.187  3.287   1.00 74.98  ? 115 LEU B CD2   1 
ATOM   3934 N N     . ALA D 2 116 ? 1.070   95.185  3.210   1.00 74.26  ? 116 ALA B N     1 
ATOM   3935 C CA    . ALA D 2 116 ? 0.007   95.739  2.395   1.00 73.88  ? 116 ALA B CA    1 
ATOM   3936 C C     . ALA D 2 116 ? -0.594  96.953  3.088   1.00 73.87  ? 116 ALA B C     1 
ATOM   3937 O O     . ALA D 2 116 ? -0.995  97.913  2.433   1.00 74.65  ? 116 ALA B O     1 
ATOM   3938 C CB    . ALA D 2 116 ? -1.060  94.693  2.164   1.00 73.42  ? 116 ALA B CB    1 
ATOM   3939 N N     . GLN D 2 117 ? -0.655  96.913  4.415   1.00 73.28  ? 117 GLN B N     1 
ATOM   3940 C CA    . GLN D 2 117 ? -1.213  98.021  5.180   1.00 72.38  ? 117 GLN B CA    1 
ATOM   3941 C C     . GLN D 2 117 ? -0.188  99.124  5.346   1.00 71.56  ? 117 GLN B C     1 
ATOM   3942 O O     . GLN D 2 117 ? -0.383  100.067 6.106   1.00 71.45  ? 117 GLN B O     1 
ATOM   3943 C CB    . GLN D 2 117 ? -1.687  97.531  6.542   1.00 72.93  ? 117 GLN B CB    1 
ATOM   3944 C CG    . GLN D 2 117 ? -2.749  96.456  6.452   1.00 73.98  ? 117 GLN B CG    1 
ATOM   3945 C CD    . GLN D 2 117 ? -3.220  96.004  7.811   1.00 74.90  ? 117 GLN B CD    1 
ATOM   3946 O OE1   . GLN D 2 117 ? -3.759  96.796  8.588   1.00 75.91  ? 117 GLN B OE1   1 
ATOM   3947 N NE2   . GLN D 2 117 ? -3.021  94.725  8.112   1.00 75.01  ? 117 GLN B NE2   1 
ATOM   3948 N N     . ARG D 2 118 ? 0.911   98.992  4.618   1.00 71.00  ? 118 ARG B N     1 
ATOM   3949 C CA    . ARG D 2 118 ? 1.988   99.973  4.644   1.00 70.42  ? 118 ARG B CA    1 
ATOM   3950 C C     . ARG D 2 118 ? 2.429   100.389 6.043   1.00 69.44  ? 118 ARG B C     1 
ATOM   3951 O O     . ARG D 2 118 ? 2.455   101.572 6.371   1.00 69.49  ? 118 ARG B O     1 
ATOM   3952 C CB    . ARG D 2 118 ? 1.583   101.209 3.830   1.00 71.16  ? 118 ARG B CB    1 
ATOM   3953 C CG    . ARG D 2 118 ? 1.434   100.935 2.333   1.00 71.74  ? 118 ARG B CG    1 
ATOM   3954 C CD    . ARG D 2 118 ? 2.779   100.587 1.699   1.00 72.54  ? 118 ARG B CD    1 
ATOM   3955 N NE    . ARG D 2 118 ? 2.673   100.236 0.282   1.00 73.34  ? 118 ARG B NE    1 
ATOM   3956 C CZ    . ARG D 2 118 ? 2.115   99.121  -0.184  1.00 73.85  ? 118 ARG B CZ    1 
ATOM   3957 N NH1   . ARG D 2 118 ? 1.604   98.225  0.650   1.00 74.82  ? 118 ARG B NH1   1 
ATOM   3958 N NH2   . ARG D 2 118 ? 2.063   98.901  -1.491  1.00 73.81  ? 118 ARG B NH2   1 
ATOM   3959 N N     . VAL D 2 119 ? 2.780   99.408  6.866   1.00 68.26  ? 119 VAL B N     1 
ATOM   3960 C CA    . VAL D 2 119 ? 3.245   99.681  8.219   1.00 67.13  ? 119 VAL B CA    1 
ATOM   3961 C C     . VAL D 2 119 ? 4.643   100.283 8.119   1.00 66.57  ? 119 VAL B C     1 
ATOM   3962 O O     . VAL D 2 119 ? 5.350   100.056 7.138   1.00 66.38  ? 119 VAL B O     1 
ATOM   3963 C CB    . VAL D 2 119 ? 3.329   98.392  9.050   1.00 67.06  ? 119 VAL B CB    1 
ATOM   3964 C CG1   . VAL D 2 119 ? 1.955   97.779  9.209   1.00 66.56  ? 119 VAL B CG1   1 
ATOM   3965 C CG2   . VAL D 2 119 ? 4.273   97.409  8.372   1.00 67.49  ? 119 VAL B CG2   1 
ATOM   3966 N N     . SER D 2 120 ? 5.050   101.045 9.124   1.00 65.49  ? 120 SER B N     1 
ATOM   3967 C CA    . SER D 2 120 ? 6.368   101.653 9.084   1.00 65.23  ? 120 SER B CA    1 
ATOM   3968 C C     . SER D 2 120 ? 7.418   100.772 9.756   1.00 64.89  ? 120 SER B C     1 
ATOM   3969 O O     . SER D 2 120 ? 8.590   101.140 9.845   1.00 64.85  ? 120 SER B O     1 
ATOM   3970 C CB    . SER D 2 120 ? 6.331   103.025 9.753   1.00 65.67  ? 120 SER B CB    1 
ATOM   3971 O OG    . SER D 2 120 ? 5.947   102.920 11.107  1.00 65.98  ? 120 SER B OG    1 
ATOM   3972 N N     . GLY D 2 121 ? 6.985   99.605  10.224  1.00 63.99  ? 121 GLY B N     1 
ATOM   3973 C CA    . GLY D 2 121 ? 7.886   98.676  10.883  1.00 62.94  ? 121 GLY B CA    1 
ATOM   3974 C C     . GLY D 2 121 ? 7.174   97.410  11.336  1.00 62.20  ? 121 GLY B C     1 
ATOM   3975 O O     . GLY D 2 121 ? 5.962   97.419  11.553  1.00 62.29  ? 121 GLY B O     1 
ATOM   3976 N N     . LEU D 2 122 ? 7.914   96.315  11.476  1.00 61.00  ? 122 LEU B N     1 
ATOM   3977 C CA    . LEU D 2 122 ? 7.319   95.060  11.911  1.00 59.95  ? 122 LEU B CA    1 
ATOM   3978 C C     . LEU D 2 122 ? 7.938   94.499  13.186  1.00 59.34  ? 122 LEU B C     1 
ATOM   3979 O O     . LEU D 2 122 ? 9.134   94.664  13.444  1.00 59.36  ? 122 LEU B O     1 
ATOM   3980 C CB    . LEU D 2 122 ? 7.443   93.987  10.826  1.00 60.03  ? 122 LEU B CB    1 
ATOM   3981 C CG    . LEU D 2 122 ? 6.670   94.120  9.517   1.00 60.68  ? 122 LEU B CG    1 
ATOM   3982 C CD1   . LEU D 2 122 ? 6.553   92.754  8.864   1.00 60.77  ? 122 LEU B CD1   1 
ATOM   3983 C CD2   . LEU D 2 122 ? 5.282   94.639  9.786   1.00 61.51  ? 122 LEU B CD2   1 
ATOM   3984 N N     . ILE D 2 123 ? 7.101   93.852  13.989  1.00 57.91  ? 123 ILE B N     1 
ATOM   3985 C CA    . ILE D 2 123 ? 7.543   93.186  15.203  1.00 56.07  ? 123 ILE B CA    1 
ATOM   3986 C C     . ILE D 2 123 ? 7.061   91.763  14.975  1.00 55.71  ? 123 ILE B C     1 
ATOM   3987 O O     . ILE D 2 123 ? 5.864   91.511  14.893  1.00 55.39  ? 123 ILE B O     1 
ATOM   3988 C CB    . ILE D 2 123 ? 6.899   93.765  16.481  1.00 54.95  ? 123 ILE B CB    1 
ATOM   3989 C CG1   . ILE D 2 123 ? 7.499   95.136  16.782  1.00 54.35  ? 123 ILE B CG1   1 
ATOM   3990 C CG2   . ILE D 2 123 ? 7.163   92.842  17.663  1.00 53.85  ? 123 ILE B CG2   1 
ATOM   3991 C CD1   . ILE D 2 123 ? 7.005   95.756  18.068  1.00 53.44  ? 123 ILE B CD1   1 
ATOM   3992 N N     . ILE D 2 124 ? 8.003   90.845  14.819  1.00 55.25  ? 124 ILE B N     1 
ATOM   3993 C CA    . ILE D 2 124 ? 7.660   89.459  14.574  1.00 55.37  ? 124 ILE B CA    1 
ATOM   3994 C C     . ILE D 2 124 ? 7.826   88.668  15.866  1.00 55.93  ? 124 ILE B C     1 
ATOM   3995 O O     . ILE D 2 124 ? 8.941   88.488  16.354  1.00 56.48  ? 124 ILE B O     1 
ATOM   3996 C CB    . ILE D 2 124 ? 8.582   88.829  13.495  1.00 55.07  ? 124 ILE B CB    1 
ATOM   3997 C CG1   . ILE D 2 124 ? 8.754   89.780  12.301  1.00 54.55  ? 124 ILE B CG1   1 
ATOM   3998 C CG2   . ILE D 2 124 ? 7.998   87.498  13.034  1.00 54.14  ? 124 ILE B CG2   1 
ATOM   3999 C CD1   . ILE D 2 124 ? 7.543   89.875  11.409  1.00 54.67  ? 124 ILE B CD1   1 
ATOM   4000 N N     . ASN D 2 125 ? 6.712   88.224  16.435  1.00 55.85  ? 125 ASN B N     1 
ATOM   4001 C CA    . ASN D 2 125 ? 6.749   87.427  17.643  1.00 56.21  ? 125 ASN B CA    1 
ATOM   4002 C C     . ASN D 2 125 ? 6.221   86.074  17.215  1.00 56.28  ? 125 ASN B C     1 
ATOM   4003 O O     . ASN D 2 125 ? 5.085   85.691  17.529  1.00 56.41  ? 125 ASN B O     1 
ATOM   4004 C CB    . ASN D 2 125 ? 5.850   88.010  18.722  1.00 56.94  ? 125 ASN B CB    1 
ATOM   4005 C CG    . ASN D 2 125 ? 5.834   87.159  19.980  1.00 57.68  ? 125 ASN B CG    1 
ATOM   4006 O OD1   . ASN D 2 125 ? 5.022   87.380  20.872  1.00 59.17  ? 125 ASN B OD1   1 
ATOM   4007 N ND2   . ASN D 2 125 ? 6.734   86.185  20.056  1.00 57.57  ? 125 ASN B ND2   1 
ATOM   4008 N N     . TYR D 2 126 ? 7.059   85.362  16.476  1.00 55.75  ? 126 TYR B N     1 
ATOM   4009 C CA    . TYR D 2 126 ? 6.710   84.058  15.957  1.00 55.65  ? 126 TYR B CA    1 
ATOM   4010 C C     . TYR D 2 126 ? 7.988   83.232  15.855  1.00 54.99  ? 126 TYR B C     1 
ATOM   4011 O O     . TYR D 2 126 ? 8.999   83.714  15.356  1.00 55.84  ? 126 TYR B O     1 
ATOM   4012 C CB    . TYR D 2 126 ? 6.058   84.243  14.590  1.00 56.01  ? 126 TYR B CB    1 
ATOM   4013 C CG    . TYR D 2 126 ? 5.530   82.979  13.987  1.00 57.09  ? 126 TYR B CG    1 
ATOM   4014 C CD1   . TYR D 2 126 ? 6.344   82.175  13.198  1.00 57.59  ? 126 TYR B CD1   1 
ATOM   4015 C CD2   . TYR D 2 126 ? 4.222   82.569  14.223  1.00 57.09  ? 126 TYR B CD2   1 
ATOM   4016 C CE1   . TYR D 2 126 ? 5.873   80.989  12.658  1.00 58.12  ? 126 TYR B CE1   1 
ATOM   4017 C CE2   . TYR D 2 126 ? 3.739   81.387  13.690  1.00 58.06  ? 126 TYR B CE2   1 
ATOM   4018 C CZ    . TYR D 2 126 ? 4.569   80.600  12.909  1.00 58.68  ? 126 TYR B CZ    1 
ATOM   4019 O OH    . TYR D 2 126 ? 4.094   79.418  12.389  1.00 60.10  ? 126 TYR B OH    1 
ATOM   4020 N N     . PRO D 2 127 ? 7.963   81.979  16.334  1.00 54.01  ? 127 PRO B N     1 
ATOM   4021 C CA    . PRO D 2 127 ? 9.141   81.103  16.290  1.00 53.60  ? 127 PRO B CA    1 
ATOM   4022 C C     . PRO D 2 127 ? 9.728   80.933  14.879  1.00 53.49  ? 127 PRO B C     1 
ATOM   4023 O O     . PRO D 2 127 ? 9.106   80.353  13.986  1.00 53.35  ? 127 PRO B O     1 
ATOM   4024 C CB    . PRO D 2 127 ? 8.612   79.797  16.880  1.00 53.03  ? 127 PRO B CB    1 
ATOM   4025 C CG    . PRO D 2 127 ? 7.192   79.796  16.445  1.00 52.89  ? 127 PRO B CG    1 
ATOM   4026 C CD    . PRO D 2 127 ? 6.766   81.217  16.720  1.00 53.27  ? 127 PRO B CD    1 
ATOM   4027 N N     . LEU D 2 128 ? 10.945  81.420  14.692  1.00 53.30  ? 128 LEU B N     1 
ATOM   4028 C CA    . LEU D 2 128 ? 11.597  81.344  13.391  1.00 53.24  ? 128 LEU B CA    1 
ATOM   4029 C C     . LEU D 2 128 ? 13.040  80.826  13.434  1.00 53.33  ? 128 LEU B C     1 
ATOM   4030 O O     . LEU D 2 128 ? 13.869  81.368  14.174  1.00 52.84  ? 128 LEU B O     1 
ATOM   4031 C CB    . LEU D 2 128 ? 11.588  82.739  12.772  1.00 52.68  ? 128 LEU B CB    1 
ATOM   4032 C CG    . LEU D 2 128 ? 10.725  83.062  11.556  1.00 52.42  ? 128 LEU B CG    1 
ATOM   4033 C CD1   . LEU D 2 128 ? 9.502   82.196  11.490  1.00 51.88  ? 128 LEU B CD1   1 
ATOM   4034 C CD2   . LEU D 2 128 ? 10.368  84.533  11.635  1.00 52.79  ? 128 LEU B CD2   1 
ATOM   4035 N N     . ASP D 2 129 ? 13.343  79.784  12.655  1.00 53.44  ? 129 ASP B N     1 
ATOM   4036 C CA    . ASP D 2 129 ? 14.718  79.286  12.593  1.00 53.78  ? 129 ASP B CA    1 
ATOM   4037 C C     . ASP D 2 129 ? 15.510  80.380  11.870  1.00 53.90  ? 129 ASP B C     1 
ATOM   4038 O O     . ASP D 2 129 ? 14.923  81.215  11.173  1.00 53.86  ? 129 ASP B O     1 
ATOM   4039 C CB    . ASP D 2 129 ? 14.804  77.970  11.817  1.00 54.68  ? 129 ASP B CB    1 
ATOM   4040 C CG    . ASP D 2 129 ? 14.405  76.751  12.659  1.00 57.00  ? 129 ASP B CG    1 
ATOM   4041 O OD1   . ASP D 2 129 ? 14.465  75.605  12.137  1.00 56.80  ? 129 ASP B OD1   1 
ATOM   4042 O OD2   . ASP D 2 129 ? 14.028  76.932  13.844  1.00 58.36  ? 129 ASP B OD2   1 
ATOM   4043 N N     . ASP D 2 130 ? 16.831  80.380  12.034  1.00 54.24  ? 130 ASP B N     1 
ATOM   4044 C CA    . ASP D 2 130 ? 17.703  81.392  11.427  1.00 54.79  ? 130 ASP B CA    1 
ATOM   4045 C C     . ASP D 2 130 ? 17.481  81.786  9.958   1.00 54.93  ? 130 ASP B C     1 
ATOM   4046 O O     . ASP D 2 130 ? 17.346  82.970  9.638   1.00 54.22  ? 130 ASP B O     1 
ATOM   4047 C CB    . ASP D 2 130 ? 19.168  80.988  11.602  1.00 55.44  ? 130 ASP B CB    1 
ATOM   4048 C CG    . ASP D 2 130 ? 19.634  81.100  13.037  1.00 56.49  ? 130 ASP B CG    1 
ATOM   4049 O OD1   . ASP D 2 130 ? 20.848  80.948  13.300  1.00 56.88  ? 130 ASP B OD1   1 
ATOM   4050 O OD2   . ASP D 2 130 ? 18.781  81.338  13.912  1.00 57.93  ? 130 ASP B OD2   1 
ATOM   4051 N N     . GLN D 2 131 ? 17.458  80.821  9.052   1.00 55.35  ? 131 GLN B N     1 
ATOM   4052 C CA    . GLN D 2 131 ? 17.283  81.193  7.660   1.00 56.41  ? 131 GLN B CA    1 
ATOM   4053 C C     . GLN D 2 131 ? 15.877  81.685  7.368   1.00 56.11  ? 131 GLN B C     1 
ATOM   4054 O O     . GLN D 2 131 ? 15.685  82.605  6.568   1.00 55.92  ? 131 GLN B O     1 
ATOM   4055 C CB    . GLN D 2 131 ? 17.713  80.037  6.753   1.00 57.05  ? 131 GLN B CB    1 
ATOM   4056 C CG    . GLN D 2 131 ? 19.227  79.768  6.910   1.00 58.62  ? 131 GLN B CG    1 
ATOM   4057 C CD    . GLN D 2 131 ? 19.759  78.663  6.021   1.00 59.73  ? 131 GLN B CD    1 
ATOM   4058 O OE1   . GLN D 2 131 ? 19.795  78.809  4.799   1.00 60.85  ? 131 GLN B OE1   1 
ATOM   4059 N NE2   . GLN D 2 131 ? 20.176  77.547  6.628   1.00 59.45  ? 131 GLN B NE2   1 
ATOM   4060 N N     . ASP D 2 132 ? 14.894  81.100  8.043   1.00 56.14  ? 132 ASP B N     1 
ATOM   4061 C CA    . ASP D 2 132 ? 13.512  81.535  7.874   1.00 55.67  ? 132 ASP B CA    1 
ATOM   4062 C C     . ASP D 2 132 ? 13.395  82.985  8.357   1.00 54.97  ? 132 ASP B C     1 
ATOM   4063 O O     . ASP D 2 132 ? 12.798  83.824  7.689   1.00 54.32  ? 132 ASP B O     1 
ATOM   4064 C CB    . ASP D 2 132 ? 12.591  80.613  8.659   1.00 55.98  ? 132 ASP B CB    1 
ATOM   4065 C CG    . ASP D 2 132 ? 12.422  79.272  7.983   1.00 56.77  ? 132 ASP B CG    1 
ATOM   4066 O OD1   . ASP D 2 132 ? 12.177  78.266  8.677   1.00 57.57  ? 132 ASP B OD1   1 
ATOM   4067 O OD2   . ASP D 2 132 ? 12.525  79.223  6.740   1.00 57.54  ? 132 ASP B OD2   1 
ATOM   4068 N N     . ALA D 2 133 ? 13.990  83.277  9.508   1.00 54.39  ? 133 ALA B N     1 
ATOM   4069 C CA    . ALA D 2 133 ? 13.966  84.628  10.037  1.00 54.34  ? 133 ALA B CA    1 
ATOM   4070 C C     . ALA D 2 133 ? 14.619  85.596  9.044   1.00 54.80  ? 133 ALA B C     1 
ATOM   4071 O O     . ALA D 2 133 ? 14.088  86.674  8.769   1.00 54.59  ? 133 ALA B O     1 
ATOM   4072 C CB    . ALA D 2 133 ? 14.691  84.676  11.366  1.00 53.78  ? 133 ALA B CB    1 
ATOM   4073 N N     . ILE D 2 134 ? 15.776  85.211  8.512   1.00 55.57  ? 134 ILE B N     1 
ATOM   4074 C CA    . ILE D 2 134 ? 16.498  86.042  7.546   1.00 55.86  ? 134 ILE B CA    1 
ATOM   4075 C C     . ILE D 2 134 ? 15.651  86.252  6.290   1.00 55.80  ? 134 ILE B C     1 
ATOM   4076 O O     . ILE D 2 134 ? 15.656  87.324  5.698   1.00 55.07  ? 134 ILE B O     1 
ATOM   4077 C CB    . ILE D 2 134 ? 17.849  85.390  7.158   1.00 56.29  ? 134 ILE B CB    1 
ATOM   4078 C CG1   . ILE D 2 134 ? 18.786  85.397  8.368   1.00 56.22  ? 134 ILE B CG1   1 
ATOM   4079 C CG2   . ILE D 2 134 ? 18.479  86.135  5.991   1.00 55.66  ? 134 ILE B CG2   1 
ATOM   4080 C CD1   . ILE D 2 134 ? 20.107  84.722  8.128   1.00 55.56  ? 134 ILE B CD1   1 
ATOM   4081 N N     . ALA D 2 135 ? 14.925  85.215  5.896   1.00 56.30  ? 135 ALA B N     1 
ATOM   4082 C CA    . ALA D 2 135 ? 14.055  85.298  4.739   1.00 57.82  ? 135 ALA B CA    1 
ATOM   4083 C C     . ALA D 2 135 ? 12.962  86.337  5.015   1.00 59.62  ? 135 ALA B C     1 
ATOM   4084 O O     . ALA D 2 135 ? 12.777  87.269  4.231   1.00 59.81  ? 135 ALA B O     1 
ATOM   4085 C CB    . ALA D 2 135 ? 13.433  83.938  4.458   1.00 56.87  ? 135 ALA B CB    1 
ATOM   4086 N N     . VAL D 2 136 ? 12.245  86.169  6.130   1.00 60.93  ? 136 VAL B N     1 
ATOM   4087 C CA    . VAL D 2 136 ? 11.183  87.090  6.517   1.00 62.41  ? 136 VAL B CA    1 
ATOM   4088 C C     . VAL D 2 136 ? 11.738  88.509  6.556   1.00 63.85  ? 136 VAL B C     1 
ATOM   4089 O O     . VAL D 2 136 ? 11.155  89.440  5.995   1.00 63.73  ? 136 VAL B O     1 
ATOM   4090 C CB    . VAL D 2 136 ? 10.610  86.734  7.909   1.00 62.13  ? 136 VAL B CB    1 
ATOM   4091 C CG1   . VAL D 2 136 ? 9.765   87.879  8.437   1.00 62.23  ? 136 VAL B CG1   1 
ATOM   4092 C CG2   . VAL D 2 136 ? 9.780   85.470  7.818   1.00 61.69  ? 136 VAL B CG2   1 
ATOM   4093 N N     . GLU D 2 137 ? 12.870  88.660  7.226   1.00 65.12  ? 137 GLU B N     1 
ATOM   4094 C CA    . GLU D 2 137 ? 13.522  89.951  7.335   1.00 67.06  ? 137 GLU B CA    1 
ATOM   4095 C C     . GLU D 2 137 ? 13.714  90.547  5.947   1.00 67.68  ? 137 GLU B C     1 
ATOM   4096 O O     . GLU D 2 137 ? 13.542  91.742  5.741   1.00 67.34  ? 137 GLU B O     1 
ATOM   4097 C CB    . GLU D 2 137 ? 14.868  89.768  8.030   1.00 68.18  ? 137 GLU B CB    1 
ATOM   4098 C CG    . GLU D 2 137 ? 15.950  90.708  7.576   1.00 70.59  ? 137 GLU B CG    1 
ATOM   4099 C CD    . GLU D 2 137 ? 15.720  92.109  8.049   1.00 72.62  ? 137 GLU B CD    1 
ATOM   4100 O OE1   . GLU D 2 137 ? 15.710  92.321  9.285   1.00 74.20  ? 137 GLU B OE1   1 
ATOM   4101 O OE2   . GLU D 2 137 ? 15.545  92.998  7.186   1.00 74.12  ? 137 GLU B OE2   1 
ATOM   4102 N N     . ALA D 2 138 ? 14.060  89.697  4.991   1.00 69.03  ? 138 ALA B N     1 
ATOM   4103 C CA    . ALA D 2 138 ? 14.286  90.148  3.623   1.00 70.36  ? 138 ALA B CA    1 
ATOM   4104 C C     . ALA D 2 138 ? 12.998  90.601  2.936   1.00 71.04  ? 138 ALA B C     1 
ATOM   4105 O O     . ALA D 2 138 ? 13.002  91.575  2.189   1.00 71.07  ? 138 ALA B O     1 
ATOM   4106 C CB    . ALA D 2 138 ? 14.952  89.038  2.813   1.00 69.70  ? 138 ALA B CB    1 
ATOM   4107 N N     . ALA D 2 139 ? 11.904  89.893  3.192   1.00 72.17  ? 139 ALA B N     1 
ATOM   4108 C CA    . ALA D 2 139 ? 10.613  90.218  2.594   1.00 73.31  ? 139 ALA B CA    1 
ATOM   4109 C C     . ALA D 2 139 ? 10.095  91.580  3.048   1.00 74.47  ? 139 ALA B C     1 
ATOM   4110 O O     . ALA D 2 139 ? 9.277   92.198  2.368   1.00 74.51  ? 139 ALA B O     1 
ATOM   4111 C CB    . ALA D 2 139 ? 9.600   89.138  2.937   1.00 73.00  ? 139 ALA B CB    1 
ATOM   4112 N N     . CYS D 2 140 ? 10.573  92.043  4.198   1.00 75.80  ? 140 CYS B N     1 
ATOM   4113 C CA    . CYS D 2 140 ? 10.148  93.323  4.738   1.00 77.32  ? 140 CYS B CA    1 
ATOM   4114 C C     . CYS D 2 140 ? 10.700  94.464  3.906   1.00 77.95  ? 140 CYS B C     1 
ATOM   4115 O O     . CYS D 2 140 ? 11.578  95.215  4.331   1.00 77.72  ? 140 CYS B O     1 
ATOM   4116 C CB    . CYS D 2 140 ? 10.582  93.451  6.196   1.00 77.63  ? 140 CYS B CB    1 
ATOM   4117 S SG    . CYS D 2 140 ? 9.759   92.243  7.270   1.00 80.11  ? 140 CYS B SG    1 
ATOM   4118 N N     . THR D 2 141 ? 10.146  94.577  2.708   1.00 78.90  ? 141 THR B N     1 
ATOM   4119 C CA    . THR D 2 141 ? 10.529  95.593  1.742   1.00 79.51  ? 141 THR B CA    1 
ATOM   4120 C C     . THR D 2 141 ? 10.798  96.982  2.332   1.00 79.22  ? 141 THR B C     1 
ATOM   4121 O O     . THR D 2 141 ? 9.858   97.748  2.576   1.00 79.69  ? 141 THR B O     1 
ATOM   4122 C CB    . THR D 2 141 ? 9.439   95.743  0.654   1.00 79.93  ? 141 THR B CB    1 
ATOM   4123 O OG1   . THR D 2 141 ? 8.974   94.447  0.250   1.00 80.34  ? 141 THR B OG1   1 
ATOM   4124 C CG2   . THR D 2 141 ? 10.008  96.469  -0.561  1.00 80.52  ? 141 THR B CG2   1 
ATOM   4125 N N     . ASN D 2 142 ? 12.073  97.298  2.567   1.00 78.45  ? 142 ASN B N     1 
ATOM   4126 C CA    . ASN D 2 142 ? 12.471  98.620  3.070   1.00 77.12  ? 142 ASN B CA    1 
ATOM   4127 C C     . ASN D 2 142 ? 12.146  98.950  4.537   1.00 74.99  ? 142 ASN B C     1 
ATOM   4128 O O     . ASN D 2 142 ? 12.781  99.828  5.126   1.00 74.98  ? 142 ASN B O     1 
ATOM   4129 C CB    . ASN D 2 142 ? 11.864  99.703  2.155   1.00 78.69  ? 142 ASN B CB    1 
ATOM   4130 C CG    . ASN D 2 142 ? 12.537  101.062 2.309   1.00 80.42  ? 142 ASN B CG    1 
ATOM   4131 O OD1   . ASN D 2 142 ? 12.488  101.684 3.375   1.00 81.86  ? 142 ASN B OD1   1 
ATOM   4132 N ND2   . ASN D 2 142 ? 13.168  101.532 1.235   1.00 80.75  ? 142 ASN B ND2   1 
ATOM   4133 N N     . VAL D 2 143 ? 11.174  98.260  5.132   1.00 72.19  ? 143 VAL B N     1 
ATOM   4134 C CA    . VAL D 2 143 ? 10.799  98.534  6.521   1.00 68.78  ? 143 VAL B CA    1 
ATOM   4135 C C     . VAL D 2 143 ? 11.544  97.689  7.543   1.00 66.26  ? 143 VAL B C     1 
ATOM   4136 O O     . VAL D 2 143 ? 11.776  96.499  7.330   1.00 66.03  ? 143 VAL B O     1 
ATOM   4137 C CB    . VAL D 2 143 ? 9.294   98.333  6.739   1.00 68.77  ? 143 VAL B CB    1 
ATOM   4138 C CG1   . VAL D 2 143 ? 8.525   99.395  5.991   1.00 68.83  ? 143 VAL B CG1   1 
ATOM   4139 C CG2   . VAL D 2 143 ? 8.881   96.955  6.259   1.00 68.95  ? 143 VAL B CG2   1 
ATOM   4140 N N     . PRO D 2 144 ? 11.931  98.299  8.675   1.00 63.60  ? 144 PRO B N     1 
ATOM   4141 C CA    . PRO D 2 144 ? 12.653  97.592  9.737   1.00 61.52  ? 144 PRO B CA    1 
ATOM   4142 C C     . PRO D 2 144 ? 11.842  96.492  10.408  1.00 59.47  ? 144 PRO B C     1 
ATOM   4143 O O     . PRO D 2 144 ? 10.635  96.605  10.561  1.00 59.39  ? 144 PRO B O     1 
ATOM   4144 C CB    . PRO D 2 144 ? 13.034  98.712  10.704  1.00 61.69  ? 144 PRO B CB    1 
ATOM   4145 C CG    . PRO D 2 144 ? 11.971  99.730  10.490  1.00 62.27  ? 144 PRO B CG    1 
ATOM   4146 C CD    . PRO D 2 144 ? 11.782  99.724  9.003   1.00 62.38  ? 144 PRO B CD    1 
ATOM   4147 N N     . ALA D 2 145 ? 12.519  95.416  10.787  1.00 57.57  ? 145 ALA B N     1 
ATOM   4148 C CA    . ALA D 2 145 ? 11.872  94.296  11.458  1.00 55.05  ? 145 ALA B CA    1 
ATOM   4149 C C     . ALA D 2 145 ? 12.615  93.970  12.759  1.00 53.49  ? 145 ALA B C     1 
ATOM   4150 O O     . ALA D 2 145 ? 13.848  94.019  12.821  1.00 52.91  ? 145 ALA B O     1 
ATOM   4151 C CB    . ALA D 2 145 ? 11.844  93.093  10.545  1.00 54.51  ? 145 ALA B CB    1 
ATOM   4152 N N     . LEU D 2 146 ? 11.850  93.671  13.803  1.00 51.81  ? 146 LEU B N     1 
ATOM   4153 C CA    . LEU D 2 146 ? 12.404  93.328  15.108  1.00 49.79  ? 146 LEU B CA    1 
ATOM   4154 C C     . LEU D 2 146 ? 11.830  91.959  15.450  1.00 48.43  ? 146 LEU B C     1 
ATOM   4155 O O     . LEU D 2 146 ? 10.622  91.747  15.312  1.00 48.28  ? 146 LEU B O     1 
ATOM   4156 C CB    . LEU D 2 146 ? 11.979  94.368  16.143  1.00 49.98  ? 146 LEU B CB    1 
ATOM   4157 C CG    . LEU D 2 146 ? 12.628  94.247  17.517  1.00 50.43  ? 146 LEU B CG    1 
ATOM   4158 C CD1   . LEU D 2 146 ? 14.131  94.176  17.351  1.00 49.58  ? 146 LEU B CD1   1 
ATOM   4159 C CD2   . LEU D 2 146 ? 12.244  95.444  18.378  1.00 49.89  ? 146 LEU B CD2   1 
ATOM   4160 N N     . PHE D 2 147 ? 12.687  91.026  15.869  1.00 46.48  ? 147 PHE B N     1 
ATOM   4161 C CA    . PHE D 2 147 ? 12.233  89.670  16.186  1.00 44.64  ? 147 PHE B CA    1 
ATOM   4162 C C     . PHE D 2 147 ? 12.262  89.374  17.682  1.00 44.82  ? 147 PHE B C     1 
ATOM   4163 O O     . PHE D 2 147 ? 13.176  89.805  18.387  1.00 44.55  ? 147 PHE B O     1 
ATOM   4164 C CB    . PHE D 2 147 ? 13.080  88.637  15.416  1.00 42.55  ? 147 PHE B CB    1 
ATOM   4165 C CG    . PHE D 2 147 ? 12.930  88.719  13.909  1.00 39.26  ? 147 PHE B CG    1 
ATOM   4166 C CD1   . PHE D 2 147 ? 13.466  89.787  13.196  1.00 37.20  ? 147 PHE B CD1   1 
ATOM   4167 C CD2   . PHE D 2 147 ? 12.203  87.750  13.212  1.00 38.11  ? 147 PHE B CD2   1 
ATOM   4168 C CE1   . PHE D 2 147 ? 13.273  89.892  11.809  1.00 36.07  ? 147 PHE B CE1   1 
ATOM   4169 C CE2   . PHE D 2 147 ? 12.002  87.845  11.820  1.00 36.83  ? 147 PHE B CE2   1 
ATOM   4170 C CZ    . PHE D 2 147 ? 12.537  88.917  11.122  1.00 35.45  ? 147 PHE B CZ    1 
ATOM   4171 N N     . LEU D 2 148 ? 11.253  88.648  18.163  1.00 45.33  ? 148 LEU B N     1 
ATOM   4172 C CA    . LEU D 2 148 ? 11.158  88.304  19.580  1.00 46.00  ? 148 LEU B CA    1 
ATOM   4173 C C     . LEU D 2 148 ? 11.200  86.797  19.842  1.00 46.98  ? 148 LEU B C     1 
ATOM   4174 O O     . LEU D 2 148 ? 11.258  86.368  20.991  1.00 47.36  ? 148 LEU B O     1 
ATOM   4175 C CB    . LEU D 2 148 ? 9.880   88.884  20.192  1.00 45.69  ? 148 LEU B CB    1 
ATOM   4176 C CG    . LEU D 2 148 ? 9.591   90.377  20.017  1.00 45.19  ? 148 LEU B CG    1 
ATOM   4177 C CD1   . LEU D 2 148 ? 8.439   90.778  20.913  1.00 44.70  ? 148 LEU B CD1   1 
ATOM   4178 C CD2   . LEU D 2 148 ? 10.801  91.190  20.374  1.00 45.44  ? 148 LEU B CD2   1 
ATOM   4179 N N     . ASP D 2 149 ? 11.159  85.986  18.793  1.00 47.37  ? 149 ASP B N     1 
ATOM   4180 C CA    . ASP D 2 149 ? 11.225  84.547  18.996  1.00 47.83  ? 149 ASP B CA    1 
ATOM   4181 C C     . ASP D 2 149 ? 12.249  83.880  18.059  1.00 47.12  ? 149 ASP B C     1 
ATOM   4182 O O     . ASP D 2 149 ? 11.925  82.996  17.259  1.00 45.94  ? 149 ASP B O     1 
ATOM   4183 C CB    . ASP D 2 149 ? 9.843   83.901  18.842  1.00 49.43  ? 149 ASP B CB    1 
ATOM   4184 C CG    . ASP D 2 149 ? 9.786   82.499  19.446  1.00 51.72  ? 149 ASP B CG    1 
ATOM   4185 O OD1   . ASP D 2 149 ? 10.819  82.041  19.985  1.00 53.32  ? 149 ASP B OD1   1 
ATOM   4186 O OD2   . ASP D 2 149 ? 8.717   81.851  19.394  1.00 53.35  ? 149 ASP B OD2   1 
ATOM   4187 N N     . VAL D 2 150 ? 13.488  84.347  18.169  1.00 46.25  ? 150 VAL B N     1 
ATOM   4188 C CA    . VAL D 2 150 ? 14.597  83.804  17.415  1.00 46.32  ? 150 VAL B CA    1 
ATOM   4189 C C     . VAL D 2 150 ? 15.730  83.597  18.412  1.00 46.64  ? 150 VAL B C     1 
ATOM   4190 O O     . VAL D 2 150 ? 15.630  83.993  19.576  1.00 46.52  ? 150 VAL B O     1 
ATOM   4191 C CB    . VAL D 2 150 ? 15.091  84.765  16.292  1.00 45.56  ? 150 VAL B CB    1 
ATOM   4192 C CG1   . VAL D 2 150 ? 14.026  84.901  15.215  1.00 43.60  ? 150 VAL B CG1   1 
ATOM   4193 C CG2   . VAL D 2 150 ? 15.485  86.112  16.889  1.00 45.42  ? 150 VAL B CG2   1 
ATOM   4194 N N     . SER D 2 151 ? 16.799  82.964  17.952  1.00 47.08  ? 151 SER B N     1 
ATOM   4195 C CA    . SER D 2 151 ? 17.957  82.723  18.787  1.00 47.45  ? 151 SER B CA    1 
ATOM   4196 C C     . SER D 2 151 ? 18.737  84.019  18.880  1.00 47.91  ? 151 SER B C     1 
ATOM   4197 O O     . SER D 2 151 ? 18.607  84.887  18.020  1.00 47.62  ? 151 SER B O     1 
ATOM   4198 C CB    . SER D 2 151 ? 18.855  81.652  18.161  1.00 47.50  ? 151 SER B CB    1 
ATOM   4199 O OG    . SER D 2 151 ? 20.130  81.620  18.798  1.00 48.09  ? 151 SER B OG    1 
ATOM   4200 N N     . ASP D 2 152 ? 19.532  84.149  19.934  1.00 48.35  ? 152 ASP B N     1 
ATOM   4201 C CA    . ASP D 2 152 ? 20.375  85.318  20.112  1.00 50.25  ? 152 ASP B CA    1 
ATOM   4202 C C     . ASP D 2 152 ? 21.461  85.266  19.039  1.00 50.40  ? 152 ASP B C     1 
ATOM   4203 O O     . ASP D 2 152 ? 22.145  86.248  18.788  1.00 50.86  ? 152 ASP B O     1 
ATOM   4204 C CB    . ASP D 2 152 ? 21.030  85.289  21.495  1.00 51.58  ? 152 ASP B CB    1 
ATOM   4205 C CG    . ASP D 2 152 ? 21.521  83.892  21.887  1.00 53.14  ? 152 ASP B CG    1 
ATOM   4206 O OD1   . ASP D 2 152 ? 22.223  83.777  22.907  1.00 54.74  ? 152 ASP B OD1   1 
ATOM   4207 O OD2   . ASP D 2 152 ? 21.199  82.900  21.193  1.00 54.25  ? 152 ASP B OD2   1 
ATOM   4208 N N     . GLN D 2 153 ? 21.611  84.102  18.416  1.00 50.60  ? 153 GLN B N     1 
ATOM   4209 C CA    . GLN D 2 153 ? 22.604  83.894  17.373  1.00 50.68  ? 153 GLN B CA    1 
ATOM   4210 C C     . GLN D 2 153 ? 22.088  84.237  15.981  1.00 50.60  ? 153 GLN B C     1 
ATOM   4211 O O     . GLN D 2 153 ? 22.819  84.094  14.998  1.00 51.78  ? 153 GLN B O     1 
ATOM   4212 C CB    . GLN D 2 153 ? 23.051  82.437  17.355  1.00 50.26  ? 153 GLN B CB    1 
ATOM   4213 C CG    . GLN D 2 153 ? 23.774  81.965  18.594  1.00 50.52  ? 153 GLN B CG    1 
ATOM   4214 C CD    . GLN D 2 153 ? 23.879  80.444  18.632  1.00 50.61  ? 153 GLN B CD    1 
ATOM   4215 O OE1   . GLN D 2 153 ? 24.573  79.889  19.479  1.00 50.88  ? 153 GLN B OE1   1 
ATOM   4216 N NE2   . GLN D 2 153 ? 23.178  79.763  17.711  1.00 48.95  ? 153 GLN B NE2   1 
ATOM   4217 N N     . THR D 2 154 ? 20.833  84.660  15.868  1.00 49.80  ? 154 THR B N     1 
ATOM   4218 C CA    . THR D 2 154 ? 20.306  84.981  14.549  1.00 49.33  ? 154 THR B CA    1 
ATOM   4219 C C     . THR D 2 154 ? 20.819  86.348  14.148  1.00 49.08  ? 154 THR B C     1 
ATOM   4220 O O     . THR D 2 154 ? 20.826  87.272  14.955  1.00 49.28  ? 154 THR B O     1 
ATOM   4221 C CB    . THR D 2 154 ? 18.794  84.943  14.557  1.00 48.81  ? 154 THR B CB    1 
ATOM   4222 O OG1   . THR D 2 154 ? 18.380  83.731  15.196  1.00 48.52  ? 154 THR B OG1   1 
ATOM   4223 C CG2   . THR D 2 154 ? 18.251  84.952  13.143  1.00 48.11  ? 154 THR B CG2   1 
ATOM   4224 N N     . PRO D 2 155 ? 21.300  86.484  12.903  1.00 49.16  ? 155 PRO B N     1 
ATOM   4225 C CA    . PRO D 2 155 ? 21.821  87.776  12.445  1.00 48.94  ? 155 PRO B CA    1 
ATOM   4226 C C     . PRO D 2 155 ? 20.737  88.757  11.999  1.00 48.88  ? 155 PRO B C     1 
ATOM   4227 O O     . PRO D 2 155 ? 20.610  89.055  10.810  1.00 49.84  ? 155 PRO B O     1 
ATOM   4228 C CB    . PRO D 2 155 ? 22.753  87.373  11.309  1.00 48.91  ? 155 PRO B CB    1 
ATOM   4229 C CG    . PRO D 2 155 ? 21.985  86.220  10.670  1.00 49.42  ? 155 PRO B CG    1 
ATOM   4230 C CD    . PRO D 2 155 ? 21.508  85.428  11.888  1.00 49.12  ? 155 PRO B CD    1 
ATOM   4231 N N     . ILE D 2 156 ? 19.957  89.254  12.955  1.00 48.40  ? 156 ILE B N     1 
ATOM   4232 C CA    . ILE D 2 156 ? 18.878  90.216  12.687  1.00 47.16  ? 156 ILE B CA    1 
ATOM   4233 C C     . ILE D 2 156 ? 18.575  90.990  13.953  1.00 46.24  ? 156 ILE B C     1 
ATOM   4234 O O     . ILE D 2 156 ? 19.103  90.673  15.010  1.00 45.95  ? 156 ILE B O     1 
ATOM   4235 C CB    . ILE D 2 156 ? 17.576  89.528  12.274  1.00 46.79  ? 156 ILE B CB    1 
ATOM   4236 C CG1   . ILE D 2 156 ? 17.257  88.423  13.270  1.00 46.19  ? 156 ILE B CG1   1 
ATOM   4237 C CG2   . ILE D 2 156 ? 17.666  89.033  10.849  1.00 45.95  ? 156 ILE B CG2   1 
ATOM   4238 C CD1   . ILE D 2 156 ? 16.079  87.588  12.841  1.00 47.73  ? 156 ILE B CD1   1 
ATOM   4239 N N     . ASN D 2 157 ? 17.724  92.006  13.848  1.00 45.75  ? 157 ASN B N     1 
ATOM   4240 C CA    . ASN D 2 157 ? 17.354  92.787  15.029  1.00 44.80  ? 157 ASN B CA    1 
ATOM   4241 C C     . ASN D 2 157 ? 16.423  91.960  15.890  1.00 42.98  ? 157 ASN B C     1 
ATOM   4242 O O     . ASN D 2 157 ? 15.446  91.393  15.403  1.00 42.24  ? 157 ASN B O     1 
ATOM   4243 C CB    . ASN D 2 157 ? 16.689  94.089  14.615  1.00 45.92  ? 157 ASN B CB    1 
ATOM   4244 C CG    . ASN D 2 157 ? 17.603  94.940  13.764  1.00 46.46  ? 157 ASN B CG    1 
ATOM   4245 O OD1   . ASN D 2 157 ? 18.775  95.138  14.097  1.00 46.38  ? 157 ASN B OD1   1 
ATOM   4246 N ND2   . ASN D 2 157 ? 17.077  95.441  12.659  1.00 46.49  ? 157 ASN B ND2   1 
ATOM   4247 N N     . SER D 2 158 ? 16.741  91.867  17.170  1.00 41.43  ? 158 SER B N     1 
ATOM   4248 C CA    . SER D 2 158 ? 15.920  91.060  18.040  1.00 41.78  ? 158 SER B CA    1 
ATOM   4249 C C     . SER D 2 158 ? 15.987  91.471  19.503  1.00 41.72  ? 158 SER B C     1 
ATOM   4250 O O     . SER D 2 158 ? 16.905  92.177  19.923  1.00 40.91  ? 158 SER B O     1 
ATOM   4251 C CB    . SER D 2 158 ? 16.337  89.585  17.900  1.00 42.12  ? 158 SER B CB    1 
ATOM   4252 O OG    . SER D 2 158 ? 17.664  89.381  18.365  1.00 41.12  ? 158 SER B OG    1 
ATOM   4253 N N     . ILE D 2 159 ? 14.985  91.042  20.263  1.00 42.04  ? 159 ILE B N     1 
ATOM   4254 C CA    . ILE D 2 159 ? 14.949  91.294  21.696  1.00 42.89  ? 159 ILE B CA    1 
ATOM   4255 C C     . ILE D 2 159 ? 14.386  90.042  22.335  1.00 42.75  ? 159 ILE B C     1 
ATOM   4256 O O     . ILE D 2 159 ? 13.284  89.599  21.990  1.00 43.19  ? 159 ILE B O     1 
ATOM   4257 C CB    . ILE D 2 159 ? 14.040  92.461  22.102  1.00 43.30  ? 159 ILE B CB    1 
ATOM   4258 C CG1   . ILE D 2 159 ? 14.375  93.706  21.291  1.00 44.73  ? 159 ILE B CG1   1 
ATOM   4259 C CG2   . ILE D 2 159 ? 14.267  92.783  23.577  1.00 43.42  ? 159 ILE B CG2   1 
ATOM   4260 C CD1   . ILE D 2 159 ? 13.746  94.979  21.839  1.00 44.76  ? 159 ILE B CD1   1 
ATOM   4261 N N     . ILE D 2 160 ? 15.153  89.455  23.244  1.00 42.29  ? 160 ILE B N     1 
ATOM   4262 C CA    . ILE D 2 160 ? 14.703  88.254  23.926  1.00 42.14  ? 160 ILE B CA    1 
ATOM   4263 C C     . ILE D 2 160 ? 15.178  88.272  25.351  1.00 41.94  ? 160 ILE B C     1 
ATOM   4264 O O     . ILE D 2 160 ? 16.076  89.019  25.707  1.00 41.97  ? 160 ILE B O     1 
ATOM   4265 C CB    . ILE D 2 160 ? 15.233  86.978  23.251  1.00 41.69  ? 160 ILE B CB    1 
ATOM   4266 C CG1   . ILE D 2 160 ? 16.762  86.947  23.314  1.00 41.83  ? 160 ILE B CG1   1 
ATOM   4267 C CG2   . ILE D 2 160 ? 14.767  86.927  21.813  1.00 41.20  ? 160 ILE B CG2   1 
ATOM   4268 C CD1   . ILE D 2 160 ? 17.366  85.711  22.686  1.00 41.26  ? 160 ILE B CD1   1 
ATOM   4269 N N     . PHE D 2 161 ? 14.558  87.458  26.182  1.00 42.88  ? 161 PHE B N     1 
ATOM   4270 C CA    . PHE D 2 161 ? 14.984  87.393  27.556  1.00 43.68  ? 161 PHE B CA    1 
ATOM   4271 C C     . PHE D 2 161 ? 16.254  86.560  27.586  1.00 44.38  ? 161 PHE B C     1 
ATOM   4272 O O     . PHE D 2 161 ? 16.458  85.672  26.751  1.00 44.29  ? 161 PHE B O     1 
ATOM   4273 C CB    . PHE D 2 161 ? 13.891  86.774  28.419  1.00 43.82  ? 161 PHE B CB    1 
ATOM   4274 C CG    . PHE D 2 161 ? 12.768  87.719  28.719  1.00 44.59  ? 161 PHE B CG    1 
ATOM   4275 C CD1   . PHE D 2 161 ? 11.530  87.565  28.113  1.00 44.04  ? 161 PHE B CD1   1 
ATOM   4276 C CD2   . PHE D 2 161 ? 12.968  88.802  29.582  1.00 45.26  ? 161 PHE B CD2   1 
ATOM   4277 C CE1   . PHE D 2 161 ? 10.503  88.475  28.352  1.00 44.25  ? 161 PHE B CE1   1 
ATOM   4278 C CE2   . PHE D 2 161 ? 11.945  89.714  29.826  1.00 44.76  ? 161 PHE B CE2   1 
ATOM   4279 C CZ    . PHE D 2 161 ? 10.707  89.545  29.207  1.00 44.07  ? 161 PHE B CZ    1 
ATOM   4280 N N     . SER D 2 162 ? 17.126  86.870  28.530  1.00 45.17  ? 162 SER B N     1 
ATOM   4281 C CA    . SER D 2 162 ? 18.370  86.139  28.656  1.00 46.02  ? 162 SER B CA    1 
ATOM   4282 C C     . SER D 2 162 ? 18.134  84.718  29.160  1.00 45.93  ? 162 SER B C     1 
ATOM   4283 O O     . SER D 2 162 ? 18.104  84.481  30.355  1.00 45.36  ? 162 SER B O     1 
ATOM   4284 C CB    . SER D 2 162 ? 19.303  86.883  29.601  1.00 45.61  ? 162 SER B CB    1 
ATOM   4285 O OG    . SER D 2 162 ? 20.482  86.144  29.798  1.00 46.95  ? 162 SER B OG    1 
ATOM   4286 N N     . HIS D 2 163 ? 17.960  83.778  28.238  1.00 47.38  ? 163 HIS B N     1 
ATOM   4287 C CA    . HIS D 2 163 ? 17.744  82.380  28.599  1.00 49.01  ? 163 HIS B CA    1 
ATOM   4288 C C     . HIS D 2 163 ? 18.976  81.881  29.329  1.00 49.39  ? 163 HIS B C     1 
ATOM   4289 O O     . HIS D 2 163 ? 18.896  81.016  30.197  1.00 48.91  ? 163 HIS B O     1 
ATOM   4290 C CB    . HIS D 2 163 ? 17.506  81.546  27.351  1.00 50.00  ? 163 HIS B CB    1 
ATOM   4291 C CG    . HIS D 2 163 ? 18.546  81.739  26.297  1.00 53.11  ? 163 HIS B CG    1 
ATOM   4292 N ND1   . HIS D 2 163 ? 19.612  80.880  26.129  1.00 54.38  ? 163 HIS B ND1   1 
ATOM   4293 C CD2   . HIS D 2 163 ? 18.696  82.710  25.366  1.00 54.31  ? 163 HIS B CD2   1 
ATOM   4294 C CE1   . HIS D 2 163 ? 20.374  81.313  25.141  1.00 55.08  ? 163 HIS B CE1   1 
ATOM   4295 N NE2   . HIS D 2 163 ? 19.839  82.422  24.661  1.00 55.92  ? 163 HIS B NE2   1 
ATOM   4296 N N     . GLU D 2 164 ? 20.116  82.451  28.970  1.00 50.04  ? 164 GLU B N     1 
ATOM   4297 C CA    . GLU D 2 164 ? 21.367  82.091  29.592  1.00 51.03  ? 164 GLU B CA    1 
ATOM   4298 C C     . GLU D 2 164 ? 21.244  82.339  31.101  1.00 50.29  ? 164 GLU B C     1 
ATOM   4299 O O     . GLU D 2 164 ? 21.581  81.479  31.915  1.00 49.88  ? 164 GLU B O     1 
ATOM   4300 C CB    . GLU D 2 164 ? 22.481  82.947  29.007  1.00 52.89  ? 164 GLU B CB    1 
ATOM   4301 C CG    . GLU D 2 164 ? 23.825  82.274  28.995  1.00 57.06  ? 164 GLU B CG    1 
ATOM   4302 C CD    . GLU D 2 164 ? 24.022  81.382  27.790  1.00 58.94  ? 164 GLU B CD    1 
ATOM   4303 O OE1   . GLU D 2 164 ? 24.901  80.494  27.845  1.00 61.31  ? 164 GLU B OE1   1 
ATOM   4304 O OE2   . GLU D 2 164 ? 23.315  81.576  26.783  1.00 60.05  ? 164 GLU B OE2   1 
ATOM   4305 N N     . ASP D 2 165 ? 20.750  83.518  31.469  1.00 49.63  ? 165 ASP B N     1 
ATOM   4306 C CA    . ASP D 2 165 ? 20.586  83.870  32.875  1.00 49.07  ? 165 ASP B CA    1 
ATOM   4307 C C     . ASP D 2 165 ? 19.494  83.068  33.572  1.00 48.51  ? 165 ASP B C     1 
ATOM   4308 O O     . ASP D 2 165 ? 19.649  82.675  34.730  1.00 48.20  ? 165 ASP B O     1 
ATOM   4309 C CB    . ASP D 2 165 ? 20.277  85.354  33.026  1.00 49.85  ? 165 ASP B CB    1 
ATOM   4310 C CG    . ASP D 2 165 ? 21.486  86.223  32.802  1.00 51.14  ? 165 ASP B CG    1 
ATOM   4311 O OD1   . ASP D 2 165 ? 22.503  86.019  33.493  1.00 52.57  ? 165 ASP B OD1   1 
ATOM   4312 O OD2   . ASP D 2 165 ? 21.420  87.122  31.940  1.00 53.11  ? 165 ASP B OD2   1 
ATOM   4313 N N     . GLY D 2 166 ? 18.397  82.821  32.865  1.00 47.30  ? 166 GLY B N     1 
ATOM   4314 C CA    . GLY D 2 166 ? 17.293  82.085  33.447  1.00 46.74  ? 166 GLY B CA    1 
ATOM   4315 C C     . GLY D 2 166 ? 17.603  80.649  33.801  1.00 46.35  ? 166 GLY B C     1 
ATOM   4316 O O     . GLY D 2 166 ? 17.298  80.178  34.896  1.00 46.30  ? 166 GLY B O     1 
ATOM   4317 N N     . THR D 2 167 ? 18.197  79.940  32.855  1.00 46.34  ? 167 THR B N     1 
ATOM   4318 C CA    . THR D 2 167 ? 18.550  78.546  33.052  1.00 45.57  ? 167 THR B CA    1 
ATOM   4319 C C     . THR D 2 167 ? 19.672  78.420  34.072  1.00 46.11  ? 167 THR B C     1 
ATOM   4320 O O     . THR D 2 167 ? 19.691  77.496  34.870  1.00 46.67  ? 167 THR B O     1 
ATOM   4321 C CB    . THR D 2 167 ? 18.985  77.928  31.734  1.00 44.88  ? 167 THR B CB    1 
ATOM   4322 O OG1   . THR D 2 167 ? 20.026  78.730  31.167  1.00 42.73  ? 167 THR B OG1   1 
ATOM   4323 C CG2   . THR D 2 167 ? 17.807  77.866  30.766  1.00 43.33  ? 167 THR B CG2   1 
ATOM   4324 N N     . ARG D 2 168 ? 20.613  79.347  34.057  1.00 46.78  ? 168 ARG B N     1 
ATOM   4325 C CA    . ARG D 2 168 ? 21.695  79.281  35.022  1.00 47.21  ? 168 ARG B CA    1 
ATOM   4326 C C     . ARG D 2 168 ? 21.097  79.441  36.419  1.00 46.90  ? 168 ARG B C     1 
ATOM   4327 O O     . ARG D 2 168 ? 21.388  78.651  37.320  1.00 47.74  ? 168 ARG B O     1 
ATOM   4328 C CB    . ARG D 2 168 ? 22.712  80.387  34.762  1.00 47.41  ? 168 ARG B CB    1 
ATOM   4329 C CG    . ARG D 2 168 ? 23.911  80.298  35.662  1.00 49.37  ? 168 ARG B CG    1 
ATOM   4330 C CD    . ARG D 2 168 ? 24.577  81.631  35.759  1.00 51.22  ? 168 ARG B CD    1 
ATOM   4331 N NE    . ARG D 2 168 ? 23.669  82.586  36.374  1.00 54.61  ? 168 ARG B NE    1 
ATOM   4332 C CZ    . ARG D 2 168 ? 23.783  83.894  36.227  1.00 55.30  ? 168 ARG B CZ    1 
ATOM   4333 N NH1   . ARG D 2 168 ? 24.777  84.358  35.495  1.00 58.66  ? 168 ARG B NH1   1 
ATOM   4334 N NH2   . ARG D 2 168 ? 22.902  84.723  36.764  1.00 54.86  ? 168 ARG B NH2   1 
ATOM   4335 N N     . LEU D 2 169 ? 20.266  80.469  36.588  1.00 45.94  ? 169 LEU B N     1 
ATOM   4336 C CA    . LEU D 2 169 ? 19.604  80.745  37.860  1.00 45.21  ? 169 LEU B CA    1 
ATOM   4337 C C     . LEU D 2 169 ? 18.894  79.493  38.352  1.00 44.60  ? 169 LEU B C     1 
ATOM   4338 O O     . LEU D 2 169 ? 19.020  79.107  39.509  1.00 44.39  ? 169 LEU B O     1 
ATOM   4339 C CB    . LEU D 2 169 ? 18.581  81.872  37.688  1.00 45.07  ? 169 LEU B CB    1 
ATOM   4340 C CG    . LEU D 2 169 ? 18.792  83.248  38.331  1.00 45.47  ? 169 LEU B CG    1 
ATOM   4341 C CD1   . LEU D 2 169 ? 20.240  83.512  38.665  1.00 43.94  ? 169 LEU B CD1   1 
ATOM   4342 C CD2   . LEU D 2 169 ? 18.255  84.300  37.344  1.00 45.10  ? 169 LEU B CD2   1 
ATOM   4343 N N     . GLY D 2 170 ? 18.147  78.862  37.461  1.00 43.87  ? 170 GLY B N     1 
ATOM   4344 C CA    . GLY D 2 170 ? 17.438  77.660  37.826  1.00 44.53  ? 170 GLY B CA    1 
ATOM   4345 C C     . GLY D 2 170 ? 18.384  76.561  38.262  1.00 45.49  ? 170 GLY B C     1 
ATOM   4346 O O     . GLY D 2 170 ? 18.257  76.036  39.372  1.00 45.80  ? 170 GLY B O     1 
ATOM   4347 N N     . VAL D 2 171 ? 19.337  76.220  37.395  1.00 45.44  ? 171 VAL B N     1 
ATOM   4348 C CA    . VAL D 2 171 ? 20.302  75.177  37.685  1.00 45.74  ? 171 VAL B CA    1 
ATOM   4349 C C     . VAL D 2 171 ? 21.105  75.465  38.948  1.00 46.36  ? 171 VAL B C     1 
ATOM   4350 O O     . VAL D 2 171 ? 21.222  74.610  39.824  1.00 46.35  ? 171 VAL B O     1 
ATOM   4351 C CB    . VAL D 2 171 ? 21.279  74.967  36.493  1.00 46.19  ? 171 VAL B CB    1 
ATOM   4352 C CG1   . VAL D 2 171 ? 22.427  74.046  36.902  1.00 45.50  ? 171 VAL B CG1   1 
ATOM   4353 C CG2   . VAL D 2 171 ? 20.529  74.378  35.300  1.00 45.14  ? 171 VAL B CG2   1 
ATOM   4354 N N     . GLU D 2 172 ? 21.653  76.665  39.059  1.00 46.54  ? 172 GLU B N     1 
ATOM   4355 C CA    . GLU D 2 172 ? 22.440  76.977  40.232  1.00 47.53  ? 172 GLU B CA    1 
ATOM   4356 C C     . GLU D 2 172 ? 21.626  76.903  41.506  1.00 47.77  ? 172 GLU B C     1 
ATOM   4357 O O     . GLU D 2 172 ? 22.146  76.563  42.556  1.00 48.93  ? 172 GLU B O     1 
ATOM   4358 C CB    . GLU D 2 172 ? 23.108  78.344  40.074  1.00 47.81  ? 172 GLU B CB    1 
ATOM   4359 C CG    . GLU D 2 172 ? 24.212  78.295  39.027  1.00 50.73  ? 172 GLU B CG    1 
ATOM   4360 C CD    . GLU D 2 172 ? 24.977  79.599  38.834  1.00 52.64  ? 172 GLU B CD    1 
ATOM   4361 O OE1   . GLU D 2 172 ? 26.017  79.575  38.129  1.00 53.51  ? 172 GLU B OE1   1 
ATOM   4362 O OE2   . GLU D 2 172 ? 24.557  80.648  39.370  1.00 54.10  ? 172 GLU B OE2   1 
ATOM   4363 N N     . HIS D 2 173 ? 20.339  77.201  41.417  1.00 48.17  ? 173 HIS B N     1 
ATOM   4364 C CA    . HIS D 2 173 ? 19.484  77.148  42.595  1.00 47.99  ? 173 HIS B CA    1 
ATOM   4365 C C     . HIS D 2 173 ? 19.309  75.699  43.049  1.00 47.90  ? 173 HIS B C     1 
ATOM   4366 O O     . HIS D 2 173 ? 19.446  75.383  44.227  1.00 47.18  ? 173 HIS B O     1 
ATOM   4367 C CB    . HIS D 2 173 ? 18.119  77.758  42.283  1.00 47.54  ? 173 HIS B CB    1 
ATOM   4368 C CG    . HIS D 2 173 ? 17.185  77.787  43.452  1.00 46.55  ? 173 HIS B CG    1 
ATOM   4369 N ND1   . HIS D 2 173 ? 17.409  78.566  44.567  1.00 46.43  ? 173 HIS B ND1   1 
ATOM   4370 C CD2   . HIS D 2 173 ? 16.006  77.154  43.665  1.00 45.92  ? 173 HIS B CD2   1 
ATOM   4371 C CE1   . HIS D 2 173 ? 16.407  78.415  45.415  1.00 46.23  ? 173 HIS B CE1   1 
ATOM   4372 N NE2   . HIS D 2 173 ? 15.542  77.564  44.892  1.00 46.17  ? 173 HIS B NE2   1 
ATOM   4373 N N     . LEU D 2 174 ? 18.998  74.821  42.106  1.00 47.77  ? 174 LEU B N     1 
ATOM   4374 C CA    . LEU D 2 174 ? 18.809  73.424  42.438  1.00 48.32  ? 174 LEU B CA    1 
ATOM   4375 C C     . LEU D 2 174 ? 20.097  72.830  42.986  1.00 49.24  ? 174 LEU B C     1 
ATOM   4376 O O     . LEU D 2 174 ? 20.066  72.061  43.951  1.00 49.49  ? 174 LEU B O     1 
ATOM   4377 C CB    . LEU D 2 174 ? 18.335  72.638  41.214  1.00 47.25  ? 174 LEU B CB    1 
ATOM   4378 C CG    . LEU D 2 174 ? 16.900  72.940  40.773  1.00 46.47  ? 174 LEU B CG    1 
ATOM   4379 C CD1   . LEU D 2 174 ? 16.530  72.007  39.637  1.00 45.89  ? 174 LEU B CD1   1 
ATOM   4380 C CD2   . LEU D 2 174 ? 15.939  72.773  41.961  1.00 45.49  ? 174 LEU B CD2   1 
ATOM   4381 N N     . VAL D 2 175 ? 21.225  73.207  42.382  1.00 49.58  ? 175 VAL B N     1 
ATOM   4382 C CA    . VAL D 2 175 ? 22.530  72.719  42.816  1.00 49.12  ? 175 VAL B CA    1 
ATOM   4383 C C     . VAL D 2 175 ? 22.853  73.186  44.232  1.00 49.41  ? 175 VAL B C     1 
ATOM   4384 O O     . VAL D 2 175 ? 23.249  72.390  45.076  1.00 50.20  ? 175 VAL B O     1 
ATOM   4385 C CB    . VAL D 2 175 ? 23.661  73.177  41.852  1.00 49.12  ? 175 VAL B CB    1 
ATOM   4386 C CG1   . VAL D 2 175 ? 25.022  72.974  42.503  1.00 47.64  ? 175 VAL B CG1   1 
ATOM   4387 C CG2   . VAL D 2 175 ? 23.580  72.386  40.545  1.00 47.90  ? 175 VAL B CG2   1 
ATOM   4388 N N     . ALA D 2 176 ? 22.687  74.469  44.505  1.00 49.08  ? 176 ALA B N     1 
ATOM   4389 C CA    . ALA D 2 176 ? 22.977  74.947  45.846  1.00 49.39  ? 176 ALA B CA    1 
ATOM   4390 C C     . ALA D 2 176 ? 22.113  74.199  46.873  1.00 49.75  ? 176 ALA B C     1 
ATOM   4391 O O     . ALA D 2 176 ? 22.493  74.074  48.030  1.00 49.88  ? 176 ALA B O     1 
ATOM   4392 C CB    . ALA D 2 176 ? 22.740  76.442  45.936  1.00 48.41  ? 176 ALA B CB    1 
ATOM   4393 N N     . LEU D 2 177 ? 20.957  73.699  46.448  1.00 49.79  ? 177 LEU B N     1 
ATOM   4394 C CA    . LEU D 2 177 ? 20.080  72.975  47.354  1.00 50.54  ? 177 LEU B CA    1 
ATOM   4395 C C     . LEU D 2 177 ? 20.543  71.528  47.465  1.00 51.46  ? 177 LEU B C     1 
ATOM   4396 O O     . LEU D 2 177 ? 19.949  70.725  48.180  1.00 50.57  ? 177 LEU B O     1 
ATOM   4397 C CB    . LEU D 2 177 ? 18.642  73.027  46.846  1.00 50.74  ? 177 LEU B CB    1 
ATOM   4398 C CG    . LEU D 2 177 ? 17.627  73.970  47.502  1.00 50.35  ? 177 LEU B CG    1 
ATOM   4399 C CD1   . LEU D 2 177 ? 18.313  75.014  48.348  1.00 50.21  ? 177 LEU B CD1   1 
ATOM   4400 C CD2   . LEU D 2 177 ? 16.790  74.613  46.403  1.00 50.32  ? 177 LEU B CD2   1 
ATOM   4401 N N     . GLY D 2 178 ? 21.603  71.201  46.730  1.00 52.00  ? 178 GLY B N     1 
ATOM   4402 C CA    . GLY D 2 178 ? 22.154  69.861  46.760  1.00 51.95  ? 178 GLY B CA    1 
ATOM   4403 C C     . GLY D 2 178 ? 21.537  68.833  45.832  1.00 52.69  ? 178 GLY B C     1 
ATOM   4404 O O     . GLY D 2 178 ? 21.772  67.642  45.997  1.00 52.81  ? 178 GLY B O     1 
ATOM   4405 N N     . HIS D 2 179 ? 20.762  69.258  44.849  1.00 53.25  ? 179 HIS B N     1 
ATOM   4406 C CA    . HIS D 2 179 ? 20.149  68.298  43.938  1.00 54.68  ? 179 HIS B CA    1 
ATOM   4407 C C     . HIS D 2 179 ? 21.142  67.766  42.903  1.00 55.50  ? 179 HIS B C     1 
ATOM   4408 O O     . HIS D 2 179 ? 22.001  68.497  42.420  1.00 55.30  ? 179 HIS B O     1 
ATOM   4409 C CB    . HIS D 2 179 ? 18.944  68.931  43.227  1.00 54.85  ? 179 HIS B CB    1 
ATOM   4410 C CG    . HIS D 2 179 ? 17.798  69.238  44.139  1.00 55.33  ? 179 HIS B CG    1 
ATOM   4411 N ND1   . HIS D 2 179 ? 16.900  68.279  44.554  1.00 55.32  ? 179 HIS B ND1   1 
ATOM   4412 C CD2   . HIS D 2 179 ? 17.420  70.392  44.738  1.00 55.18  ? 179 HIS B CD2   1 
ATOM   4413 C CE1   . HIS D 2 179 ? 16.019  68.829  45.369  1.00 55.64  ? 179 HIS B CE1   1 
ATOM   4414 N NE2   . HIS D 2 179 ? 16.314  70.110  45.498  1.00 55.31  ? 179 HIS B NE2   1 
ATOM   4415 N N     . GLN D 2 180 ? 21.023  66.485  42.570  1.00 56.66  ? 180 GLN B N     1 
ATOM   4416 C CA    . GLN D 2 180 ? 21.899  65.873  41.583  1.00 57.55  ? 180 GLN B CA    1 
ATOM   4417 C C     . GLN D 2 180 ? 21.082  65.061  40.596  1.00 57.22  ? 180 GLN B C     1 
ATOM   4418 O O     . GLN D 2 180 ? 21.466  64.907  39.448  1.00 56.74  ? 180 GLN B O     1 
ATOM   4419 C CB    . GLN D 2 180 ? 22.928  64.992  42.273  1.00 59.67  ? 180 GLN B CB    1 
ATOM   4420 C CG    . GLN D 2 180 ? 23.778  65.755  43.269  1.00 63.30  ? 180 GLN B CG    1 
ATOM   4421 C CD    . GLN D 2 180 ? 24.875  64.900  43.880  1.00 66.15  ? 180 GLN B CD    1 
ATOM   4422 O OE1   . GLN D 2 180 ? 24.609  63.857  44.503  1.00 67.57  ? 180 GLN B OE1   1 
ATOM   4423 N NE2   . GLN D 2 180 ? 26.122  65.335  43.706  1.00 66.77  ? 180 GLN B NE2   1 
ATOM   4424 N N     . GLN D 2 181 ? 19.950  64.540  41.055  1.00 57.41  ? 181 GLN B N     1 
ATOM   4425 C CA    . GLN D 2 181 ? 19.042  63.770  40.203  1.00 57.38  ? 181 GLN B CA    1 
ATOM   4426 C C     . GLN D 2 181 ? 17.999  64.774  39.703  1.00 56.35  ? 181 GLN B C     1 
ATOM   4427 O O     . GLN D 2 181 ? 16.981  65.016  40.361  1.00 57.13  ? 181 GLN B O     1 
ATOM   4428 C CB    . GLN D 2 181 ? 18.362  62.672  41.024  1.00 59.78  ? 181 GLN B CB    1 
ATOM   4429 C CG    . GLN D 2 181 ? 19.326  61.640  41.595  1.00 62.25  ? 181 GLN B CG    1 
ATOM   4430 C CD    . GLN D 2 181 ? 20.008  60.855  40.495  1.00 64.42  ? 181 GLN B CD    1 
ATOM   4431 O OE1   . GLN D 2 181 ? 19.376  60.034  39.813  1.00 66.01  ? 181 GLN B OE1   1 
ATOM   4432 N NE2   . GLN D 2 181 ? 21.299  61.113  40.295  1.00 64.38  ? 181 GLN B NE2   1 
ATOM   4433 N N     . ILE D 2 182 ? 18.258  65.347  38.534  1.00 54.36  ? 182 ILE B N     1 
ATOM   4434 C CA    . ILE D 2 182 ? 17.407  66.368  37.949  1.00 52.10  ? 182 ILE B CA    1 
ATOM   4435 C C     . ILE D 2 182 ? 16.806  65.988  36.603  1.00 51.28  ? 182 ILE B C     1 
ATOM   4436 O O     . ILE D 2 182 ? 17.520  65.538  35.718  1.00 51.68  ? 182 ILE B O     1 
ATOM   4437 C CB    . ILE D 2 182 ? 18.226  67.656  37.765  1.00 51.80  ? 182 ILE B CB    1 
ATOM   4438 C CG1   . ILE D 2 182 ? 18.786  68.093  39.112  1.00 51.40  ? 182 ILE B CG1   1 
ATOM   4439 C CG2   . ILE D 2 182 ? 17.377  68.747  37.146  1.00 51.71  ? 182 ILE B CG2   1 
ATOM   4440 C CD1   . ILE D 2 182 ? 19.660  69.305  39.037  1.00 51.75  ? 182 ILE B CD1   1 
ATOM   4441 N N     . ALA D 2 183 ? 15.496  66.181  36.444  1.00 50.02  ? 183 ALA B N     1 
ATOM   4442 C CA    . ALA D 2 183 ? 14.826  65.875  35.179  1.00 48.76  ? 183 ALA B CA    1 
ATOM   4443 C C     . ALA D 2 183 ? 14.503  67.186  34.473  1.00 48.16  ? 183 ALA B C     1 
ATOM   4444 O O     . ALA D 2 183 ? 14.378  68.219  35.110  1.00 47.98  ? 183 ALA B O     1 
ATOM   4445 C CB    . ALA D 2 183 ? 13.559  65.100  35.424  1.00 47.91  ? 183 ALA B CB    1 
ATOM   4446 N N     . LEU D 2 184 ? 14.373  67.149  33.156  1.00 47.44  ? 184 LEU B N     1 
ATOM   4447 C CA    . LEU D 2 184 ? 14.070  68.349  32.402  1.00 46.91  ? 184 LEU B CA    1 
ATOM   4448 C C     . LEU D 2 184 ? 12.795  68.174  31.599  1.00 46.75  ? 184 LEU B C     1 
ATOM   4449 O O     . LEU D 2 184 ? 12.618  67.183  30.891  1.00 46.42  ? 184 LEU B O     1 
ATOM   4450 C CB    . LEU D 2 184 ? 15.209  68.696  31.443  1.00 47.14  ? 184 LEU B CB    1 
ATOM   4451 C CG    . LEU D 2 184 ? 16.639  68.833  31.972  1.00 47.28  ? 184 LEU B CG    1 
ATOM   4452 C CD1   . LEU D 2 184 ? 17.533  69.205  30.814  1.00 46.90  ? 184 LEU B CD1   1 
ATOM   4453 C CD2   . LEU D 2 184 ? 16.729  69.881  33.068  1.00 47.02  ? 184 LEU B CD2   1 
ATOM   4454 N N     . LEU D 2 185 ? 11.904  69.151  31.717  1.00 46.62  ? 185 LEU B N     1 
ATOM   4455 C CA    . LEU D 2 185 ? 10.642  69.143  30.995  1.00 46.37  ? 185 LEU B CA    1 
ATOM   4456 C C     . LEU D 2 185 ? 10.675  70.400  30.148  1.00 45.74  ? 185 LEU B C     1 
ATOM   4457 O O     . LEU D 2 185 ? 10.497  71.508  30.650  1.00 46.33  ? 185 LEU B O     1 
ATOM   4458 C CB    . LEU D 2 185 ? 9.477   69.167  31.985  1.00 46.56  ? 185 LEU B CB    1 
ATOM   4459 C CG    . LEU D 2 185 ? 8.067   69.178  31.405  1.00 47.16  ? 185 LEU B CG    1 
ATOM   4460 C CD1   . LEU D 2 185 ? 7.945   68.167  30.271  1.00 46.97  ? 185 LEU B CD1   1 
ATOM   4461 C CD2   . LEU D 2 185 ? 7.086   68.872  32.536  1.00 47.66  ? 185 LEU B CD2   1 
ATOM   4462 N N     . ALA D 2 186 ? 10.913  70.223  28.857  1.00 45.37  ? 186 ALA B N     1 
ATOM   4463 C CA    . ALA D 2 186 ? 11.026  71.351  27.934  1.00 44.69  ? 186 ALA B CA    1 
ATOM   4464 C C     . ALA D 2 186 ? 9.775   71.667  27.162  1.00 43.85  ? 186 ALA B C     1 
ATOM   4465 O O     . ALA D 2 186 ? 8.860   70.851  27.067  1.00 43.13  ? 186 ALA B O     1 
ATOM   4466 C CB    . ALA D 2 186 ? 12.166  71.094  26.947  1.00 44.80  ? 186 ALA B CB    1 
ATOM   4467 N N     . GLY D 2 187 ? 9.758   72.865  26.591  1.00 43.74  ? 187 GLY B N     1 
ATOM   4468 C CA    . GLY D 2 187 ? 8.629   73.294  25.795  1.00 43.78  ? 187 GLY B CA    1 
ATOM   4469 C C     . GLY D 2 187 ? 8.697   72.564  24.473  1.00 44.16  ? 187 GLY B C     1 
ATOM   4470 O O     . GLY D 2 187 ? 9.600   71.772  24.251  1.00 43.66  ? 187 GLY B O     1 
ATOM   4471 N N     . PRO D 2 188 ? 7.756   72.812  23.564  1.00 45.10  ? 188 PRO B N     1 
ATOM   4472 C CA    . PRO D 2 188 ? 7.804   72.112  22.276  1.00 45.37  ? 188 PRO B CA    1 
ATOM   4473 C C     . PRO D 2 188 ? 9.055   72.500  21.483  1.00 46.13  ? 188 PRO B C     1 
ATOM   4474 O O     . PRO D 2 188 ? 9.371   73.685  21.344  1.00 45.66  ? 188 PRO B O     1 
ATOM   4475 C CB    . PRO D 2 188 ? 6.507   72.558  21.602  1.00 44.79  ? 188 PRO B CB    1 
ATOM   4476 C CG    . PRO D 2 188 ? 6.329   73.957  22.139  1.00 44.45  ? 188 PRO B CG    1 
ATOM   4477 C CD    . PRO D 2 188 ? 6.671   73.812  23.598  1.00 44.27  ? 188 PRO B CD    1 
ATOM   4478 N N     . LEU D 2 189 ? 9.768   71.498  20.968  1.00 47.52  ? 189 LEU B N     1 
ATOM   4479 C CA    . LEU D 2 189 ? 10.989  71.739  20.196  1.00 48.15  ? 189 LEU B CA    1 
ATOM   4480 C C     . LEU D 2 189 ? 10.786  72.628  18.969  1.00 48.26  ? 189 LEU B C     1 
ATOM   4481 O O     . LEU D 2 189 ? 11.745  73.217  18.460  1.00 48.97  ? 189 LEU B O     1 
ATOM   4482 C CB    . LEU D 2 189 ? 11.621  70.413  19.786  1.00 49.08  ? 189 LEU B CB    1 
ATOM   4483 C CG    . LEU D 2 189 ? 12.749  69.888  20.697  1.00 50.40  ? 189 LEU B CG    1 
ATOM   4484 C CD1   . LEU D 2 189 ? 12.673  70.475  22.113  1.00 48.89  ? 189 LEU B CD1   1 
ATOM   4485 C CD2   . LEU D 2 189 ? 12.676  68.361  20.708  1.00 50.01  ? 189 LEU B CD2   1 
ATOM   4486 N N     . SER D 2 190 ? 9.548   72.747  18.498  1.00 47.38  ? 190 SER B N     1 
ATOM   4487 C CA    . SER D 2 190 ? 9.265   73.605  17.356  1.00 46.87  ? 190 SER B CA    1 
ATOM   4488 C C     . SER D 2 190 ? 9.389   75.070  17.766  1.00 46.92  ? 190 SER B C     1 
ATOM   4489 O O     . SER D 2 190 ? 9.318   75.958  16.932  1.00 47.67  ? 190 SER B O     1 
ATOM   4490 C CB    . SER D 2 190 ? 7.859   73.357  16.851  1.00 46.86  ? 190 SER B CB    1 
ATOM   4491 O OG    . SER D 2 190 ? 6.922   73.666  17.867  1.00 48.83  ? 190 SER B OG    1 
ATOM   4492 N N     . SER D 2 191 ? 9.567   75.316  19.061  1.00 46.49  ? 191 SER B N     1 
ATOM   4493 C CA    . SER D 2 191 ? 9.701   76.665  19.594  1.00 45.53  ? 191 SER B CA    1 
ATOM   4494 C C     . SER D 2 191 ? 11.161  77.037  19.849  1.00 45.03  ? 191 SER B C     1 
ATOM   4495 O O     . SER D 2 191 ? 11.871  76.355  20.595  1.00 45.31  ? 191 SER B O     1 
ATOM   4496 C CB    . SER D 2 191 ? 8.914   76.785  20.907  1.00 45.80  ? 191 SER B CB    1 
ATOM   4497 O OG    . SER D 2 191 ? 9.253   77.971  21.611  1.00 46.85  ? 191 SER B OG    1 
ATOM   4498 N N     . VAL D 2 192 ? 11.601  78.133  19.249  1.00 43.95  ? 192 VAL B N     1 
ATOM   4499 C CA    . VAL D 2 192 ? 12.968  78.583  19.426  1.00 43.32  ? 192 VAL B CA    1 
ATOM   4500 C C     . VAL D 2 192 ? 13.242  78.825  20.903  1.00 43.65  ? 192 VAL B C     1 
ATOM   4501 O O     . VAL D 2 192 ? 14.246  78.359  21.452  1.00 43.78  ? 192 VAL B O     1 
ATOM   4502 C CB    . VAL D 2 192 ? 13.227  79.884  18.624  1.00 42.62  ? 192 VAL B CB    1 
ATOM   4503 C CG1   . VAL D 2 192 ? 14.634  80.397  18.879  1.00 41.94  ? 192 VAL B CG1   1 
ATOM   4504 C CG2   . VAL D 2 192 ? 13.018  79.619  17.141  1.00 40.96  ? 192 VAL B CG2   1 
ATOM   4505 N N     . SER D 2 193 ? 12.332  79.544  21.545  1.00 43.72  ? 193 SER B N     1 
ATOM   4506 C CA    . SER D 2 193 ? 12.472  79.878  22.953  1.00 43.68  ? 193 SER B CA    1 
ATOM   4507 C C     . SER D 2 193 ? 12.603  78.630  23.806  1.00 43.71  ? 193 SER B C     1 
ATOM   4508 O O     . SER D 2 193 ? 13.390  78.592  24.748  1.00 43.22  ? 193 SER B O     1 
ATOM   4509 C CB    . SER D 2 193 ? 11.275  80.690  23.407  1.00 43.91  ? 193 SER B CB    1 
ATOM   4510 O OG    . SER D 2 193 ? 11.568  81.321  24.627  1.00 45.32  ? 193 SER B OG    1 
ATOM   4511 N N     . ALA D 2 194 ? 11.821  77.607  23.478  1.00 43.82  ? 194 ALA B N     1 
ATOM   4512 C CA    . ALA D 2 194 ? 11.886  76.345  24.212  1.00 43.80  ? 194 ALA B CA    1 
ATOM   4513 C C     . ALA D 2 194 ? 13.293  75.744  24.065  1.00 44.12  ? 194 ALA B C     1 
ATOM   4514 O O     . ALA D 2 194 ? 13.923  75.346  25.051  1.00 43.49  ? 194 ALA B O     1 
ATOM   4515 C CB    . ALA D 2 194 ? 10.851  75.378  23.667  1.00 43.68  ? 194 ALA B CB    1 
ATOM   4516 N N     . ARG D 2 195 ? 13.778  75.692  22.821  1.00 43.84  ? 195 ARG B N     1 
ATOM   4517 C CA    . ARG D 2 195 ? 15.092  75.144  22.546  1.00 42.84  ? 195 ARG B CA    1 
ATOM   4518 C C     . ARG D 2 195 ? 16.181  75.927  23.253  1.00 42.96  ? 195 ARG B C     1 
ATOM   4519 O O     . ARG D 2 195 ? 17.126  75.337  23.767  1.00 43.71  ? 195 ARG B O     1 
ATOM   4520 C CB    . ARG D 2 195 ? 15.353  75.122  21.046  1.00 42.52  ? 195 ARG B CB    1 
ATOM   4521 C CG    . ARG D 2 195 ? 14.364  74.276  20.275  1.00 42.88  ? 195 ARG B CG    1 
ATOM   4522 C CD    . ARG D 2 195 ? 14.862  74.009  18.861  1.00 42.83  ? 195 ARG B CD    1 
ATOM   4523 N NE    . ARG D 2 195 ? 15.148  75.233  18.114  1.00 42.61  ? 195 ARG B NE    1 
ATOM   4524 C CZ    . ARG D 2 195 ? 14.305  75.802  17.259  1.00 42.27  ? 195 ARG B CZ    1 
ATOM   4525 N NH1   . ARG D 2 195 ? 13.111  75.258  17.046  1.00 42.53  ? 195 ARG B NH1   1 
ATOM   4526 N NH2   . ARG D 2 195 ? 14.668  76.896  16.599  1.00 41.77  ? 195 ARG B NH2   1 
ATOM   4527 N N     . LEU D 2 196 ? 16.061  77.248  23.296  1.00 42.53  ? 196 LEU B N     1 
ATOM   4528 C CA    . LEU D 2 196 ? 17.082  78.041  23.960  1.00 42.80  ? 196 LEU B CA    1 
ATOM   4529 C C     . LEU D 2 196 ? 17.161  77.691  25.435  1.00 43.43  ? 196 LEU B C     1 
ATOM   4530 O O     . LEU D 2 196 ? 18.242  77.645  26.003  1.00 43.58  ? 196 LEU B O     1 
ATOM   4531 C CB    . LEU D 2 196 ? 16.799  79.533  23.811  1.00 42.68  ? 196 LEU B CB    1 
ATOM   4532 C CG    . LEU D 2 196 ? 16.862  80.095  22.393  1.00 43.55  ? 196 LEU B CG    1 
ATOM   4533 C CD1   . LEU D 2 196 ? 16.480  81.571  22.416  1.00 42.89  ? 196 LEU B CD1   1 
ATOM   4534 C CD2   . LEU D 2 196 ? 18.272  79.927  21.840  1.00 43.07  ? 196 LEU B CD2   1 
ATOM   4535 N N     . ARG D 2 197 ? 16.013  77.447  26.061  1.00 44.18  ? 197 ARG B N     1 
ATOM   4536 C CA    . ARG D 2 197 ? 15.994  77.112  27.475  1.00 44.18  ? 197 ARG B CA    1 
ATOM   4537 C C     . ARG D 2 197 ? 16.559  75.720  27.667  1.00 43.78  ? 197 ARG B C     1 
ATOM   4538 O O     . ARG D 2 197 ? 17.318  75.484  28.595  1.00 43.76  ? 197 ARG B O     1 
ATOM   4539 C CB    . ARG D 2 197 ? 14.569  77.198  28.029  1.00 45.48  ? 197 ARG B CB    1 
ATOM   4540 C CG    . ARG D 2 197 ? 14.011  78.614  28.010  1.00 47.23  ? 197 ARG B CG    1 
ATOM   4541 C CD    . ARG D 2 197 ? 12.546  78.670  28.392  1.00 48.27  ? 197 ARG B CD    1 
ATOM   4542 N NE    . ARG D 2 197 ? 11.944  79.906  27.903  1.00 49.17  ? 197 ARG B NE    1 
ATOM   4543 C CZ    . ARG D 2 197 ? 10.647  80.189  27.970  1.00 49.61  ? 197 ARG B CZ    1 
ATOM   4544 N NH1   . ARG D 2 197 ? 9.805   79.323  28.511  1.00 49.55  ? 197 ARG B NH1   1 
ATOM   4545 N NH2   . ARG D 2 197 ? 10.189  81.336  27.483  1.00 49.95  ? 197 ARG B NH2   1 
ATOM   4546 N N     . LEU D 2 198 ? 16.192  74.797  26.788  1.00 43.26  ? 198 LEU B N     1 
ATOM   4547 C CA    . LEU D 2 198 ? 16.704  73.435  26.887  1.00 43.24  ? 198 LEU B CA    1 
ATOM   4548 C C     . LEU D 2 198 ? 18.237  73.502  26.860  1.00 43.48  ? 198 LEU B C     1 
ATOM   4549 O O     . LEU D 2 198 ? 18.916  72.931  27.720  1.00 43.21  ? 198 LEU B O     1 
ATOM   4550 C CB    . LEU D 2 198 ? 16.223  72.583  25.711  1.00 41.56  ? 198 LEU B CB    1 
ATOM   4551 C CG    . LEU D 2 198 ? 15.852  71.145  26.066  1.00 40.61  ? 198 LEU B CG    1 
ATOM   4552 C CD1   . LEU D 2 198 ? 15.791  70.305  24.809  1.00 38.75  ? 198 LEU B CD1   1 
ATOM   4553 C CD2   . LEU D 2 198 ? 16.850  70.588  27.043  1.00 40.46  ? 198 LEU B CD2   1 
ATOM   4554 N N     . ALA D 2 199 ? 18.762  74.218  25.867  1.00 43.19  ? 199 ALA B N     1 
ATOM   4555 C CA    . ALA D 2 199 ? 20.198  74.379  25.704  1.00 43.09  ? 199 ALA B CA    1 
ATOM   4556 C C     . ALA D 2 199 ? 20.815  74.986  26.942  1.00 42.76  ? 199 ALA B C     1 
ATOM   4557 O O     . ALA D 2 199 ? 21.856  74.544  27.414  1.00 43.62  ? 199 ALA B O     1 
ATOM   4558 C CB    . ALA D 2 199 ? 20.490  75.249  24.497  1.00 42.82  ? 199 ALA B CB    1 
ATOM   4559 N N     . GLY D 2 200 ? 20.165  76.003  27.476  1.00 42.66  ? 200 GLY B N     1 
ATOM   4560 C CA    . GLY D 2 200 ? 20.691  76.650  28.658  1.00 42.84  ? 200 GLY B CA    1 
ATOM   4561 C C     . GLY D 2 200 ? 20.833  75.707  29.838  1.00 43.01  ? 200 GLY B C     1 
ATOM   4562 O O     . GLY D 2 200 ? 21.810  75.773  30.583  1.00 42.40  ? 200 GLY B O     1 
ATOM   4563 N N     . TRP D 2 201 ? 19.850  74.835  30.022  1.00 43.10  ? 201 TRP B N     1 
ATOM   4564 C CA    . TRP D 2 201 ? 19.910  73.906  31.128  1.00 44.22  ? 201 TRP B CA    1 
ATOM   4565 C C     . TRP D 2 201 ? 21.077  72.953  30.939  1.00 44.59  ? 201 TRP B C     1 
ATOM   4566 O O     . TRP D 2 201 ? 21.856  72.717  31.869  1.00 44.59  ? 201 TRP B O     1 
ATOM   4567 C CB    . TRP D 2 201 ? 18.615  73.098  31.252  1.00 43.74  ? 201 TRP B CB    1 
ATOM   4568 C CG    . TRP D 2 201 ? 17.424  73.886  31.719  1.00 44.37  ? 201 TRP B CG    1 
ATOM   4569 C CD1   . TRP D 2 201 ? 17.408  74.927  32.621  1.00 44.01  ? 201 TRP B CD1   1 
ATOM   4570 C CD2   . TRP D 2 201 ? 16.065  73.650  31.359  1.00 43.63  ? 201 TRP B CD2   1 
ATOM   4571 N NE1   . TRP D 2 201 ? 16.117  75.345  32.837  1.00 43.44  ? 201 TRP B NE1   1 
ATOM   4572 C CE2   . TRP D 2 201 ? 15.272  74.580  32.077  1.00 43.91  ? 201 TRP B CE2   1 
ATOM   4573 C CE3   . TRP D 2 201 ? 15.433  72.741  30.502  1.00 43.72  ? 201 TRP B CE3   1 
ATOM   4574 C CZ2   . TRP D 2 201 ? 13.871  74.623  31.963  1.00 43.49  ? 201 TRP B CZ2   1 
ATOM   4575 C CZ3   . TRP D 2 201 ? 14.027  72.783  30.389  1.00 44.59  ? 201 TRP B CZ3   1 
ATOM   4576 C CH2   . TRP D 2 201 ? 13.271  73.719  31.118  1.00 43.08  ? 201 TRP B CH2   1 
ATOM   4577 N N     . HIS D 2 202 ? 21.195  72.401  29.736  1.00 44.41  ? 202 HIS B N     1 
ATOM   4578 C CA    . HIS D 2 202 ? 22.275  71.467  29.455  1.00 44.51  ? 202 HIS B CA    1 
ATOM   4579 C C     . HIS D 2 202 ? 23.607  72.170  29.691  1.00 44.71  ? 202 HIS B C     1 
ATOM   4580 O O     . HIS D 2 202 ? 24.500  71.652  30.357  1.00 44.77  ? 202 HIS B O     1 
ATOM   4581 C CB    . HIS D 2 202 ? 22.156  70.939  28.023  1.00 43.02  ? 202 HIS B CB    1 
ATOM   4582 C CG    . HIS D 2 202 ? 21.172  69.820  27.880  1.00 42.83  ? 202 HIS B CG    1 
ATOM   4583 N ND1   . HIS D 2 202 ? 20.313  69.712  26.807  1.00 43.41  ? 202 HIS B ND1   1 
ATOM   4584 C CD2   . HIS D 2 202 ? 20.891  68.769  28.691  1.00 42.95  ? 202 HIS B CD2   1 
ATOM   4585 C CE1   . HIS D 2 202 ? 19.541  68.649  26.964  1.00 42.68  ? 202 HIS B CE1   1 
ATOM   4586 N NE2   . HIS D 2 202 ? 19.872  68.059  28.101  1.00 42.62  ? 202 HIS B NE2   1 
ATOM   4587 N N     . LYS D 2 203 ? 23.730  73.378  29.179  1.00 45.02  ? 203 LYS B N     1 
ATOM   4588 C CA    . LYS D 2 203 ? 24.964  74.085  29.379  1.00 45.37  ? 203 LYS B CA    1 
ATOM   4589 C C     . LYS D 2 203 ? 25.339  74.169  30.849  1.00 46.10  ? 203 LYS B C     1 
ATOM   4590 O O     . LYS D 2 203 ? 26.405  73.706  31.240  1.00 47.36  ? 203 LYS B O     1 
ATOM   4591 C CB    . LYS D 2 203 ? 24.889  75.483  28.785  1.00 44.77  ? 203 LYS B CB    1 
ATOM   4592 C CG    . LYS D 2 203 ? 26.042  76.347  29.216  1.00 44.31  ? 203 LYS B CG    1 
ATOM   4593 C CD    . LYS D 2 203 ? 26.024  77.680  28.528  1.00 44.75  ? 203 LYS B CD    1 
ATOM   4594 C CE    . LYS D 2 203 ? 27.141  78.522  29.078  1.00 47.03  ? 203 LYS B CE    1 
ATOM   4595 N NZ    . LYS D 2 203 ? 27.244  79.872  28.446  1.00 49.11  ? 203 LYS B NZ    1 
ATOM   4596 N N     . TYR D 2 204 ? 24.471  74.732  31.679  1.00 46.47  ? 204 TYR B N     1 
ATOM   4597 C CA    . TYR D 2 204 ? 24.828  74.879  33.082  1.00 46.87  ? 204 TYR B CA    1 
ATOM   4598 C C     . TYR D 2 204 ? 24.809  73.615  33.914  1.00 47.34  ? 204 TYR B C     1 
ATOM   4599 O O     . TYR D 2 204 ? 25.482  73.549  34.941  1.00 47.43  ? 204 TYR B O     1 
ATOM   4600 C CB    . TYR D 2 204 ? 23.987  75.982  33.732  1.00 46.24  ? 204 TYR B CB    1 
ATOM   4601 C CG    . TYR D 2 204 ? 24.284  77.320  33.108  1.00 45.99  ? 204 TYR B CG    1 
ATOM   4602 C CD1   . TYR D 2 204 ? 23.563  77.764  32.004  1.00 45.35  ? 204 TYR B CD1   1 
ATOM   4603 C CD2   . TYR D 2 204 ? 25.372  78.091  33.542  1.00 45.86  ? 204 TYR B CD2   1 
ATOM   4604 C CE1   . TYR D 2 204 ? 23.916  78.920  31.345  1.00 45.53  ? 204 TYR B CE1   1 
ATOM   4605 C CE2   . TYR D 2 204 ? 25.735  79.258  32.880  1.00 44.96  ? 204 TYR B CE2   1 
ATOM   4606 C CZ    . TYR D 2 204 ? 25.001  79.655  31.781  1.00 45.51  ? 204 TYR B CZ    1 
ATOM   4607 O OH    . TYR D 2 204 ? 25.363  80.753  31.063  1.00 46.53  ? 204 TYR B OH    1 
ATOM   4608 N N     . LEU D 2 205 ? 24.050  72.611  33.493  1.00 47.94  ? 205 LEU B N     1 
ATOM   4609 C CA    . LEU D 2 205 ? 24.053  71.369  34.245  1.00 49.55  ? 205 LEU B CA    1 
ATOM   4610 C C     . LEU D 2 205 ? 25.431  70.737  34.006  1.00 50.71  ? 205 LEU B C     1 
ATOM   4611 O O     . LEU D 2 205 ? 26.045  70.197  34.935  1.00 50.69  ? 205 LEU B O     1 
ATOM   4612 C CB    . LEU D 2 205 ? 22.928  70.439  33.784  1.00 49.10  ? 205 LEU B CB    1 
ATOM   4613 C CG    . LEU D 2 205 ? 21.534  70.726  34.350  1.00 49.02  ? 205 LEU B CG    1 
ATOM   4614 C CD1   . LEU D 2 205 ? 20.536  69.809  33.688  1.00 48.66  ? 205 LEU B CD1   1 
ATOM   4615 C CD2   . LEU D 2 205 ? 21.523  70.536  35.862  1.00 48.36  ? 205 LEU B CD2   1 
ATOM   4616 N N     . THR D 2 206 ? 25.913  70.831  32.762  1.00 51.22  ? 206 THR B N     1 
ATOM   4617 C CA    . THR D 2 206 ? 27.222  70.302  32.388  1.00 51.85  ? 206 THR B CA    1 
ATOM   4618 C C     . THR D 2 206 ? 28.329  70.975  33.195  1.00 52.38  ? 206 THR B C     1 
ATOM   4619 O O     . THR D 2 206 ? 29.223  70.313  33.689  1.00 52.49  ? 206 THR B O     1 
ATOM   4620 C CB    . THR D 2 206 ? 27.510  70.512  30.892  1.00 52.07  ? 206 THR B CB    1 
ATOM   4621 O OG1   . THR D 2 206 ? 26.759  69.573  30.120  1.00 51.59  ? 206 THR B OG1   1 
ATOM   4622 C CG2   . THR D 2 206 ? 28.979  70.330  30.602  1.00 51.19  ? 206 THR B CG2   1 
ATOM   4623 N N     . ARG D 2 207 ? 28.271  72.291  33.336  1.00 52.92  ? 207 ARG B N     1 
ATOM   4624 C CA    . ARG D 2 207 ? 29.282  72.987  34.112  1.00 53.49  ? 207 ARG B CA    1 
ATOM   4625 C C     . ARG D 2 207 ? 29.266  72.591  35.575  1.00 53.95  ? 207 ARG B C     1 
ATOM   4626 O O     . ARG D 2 207 ? 30.123  73.022  36.338  1.00 53.98  ? 207 ARG B O     1 
ATOM   4627 C CB    . ARG D 2 207 ? 29.094  74.496  34.036  1.00 54.19  ? 207 ARG B CB    1 
ATOM   4628 C CG    . ARG D 2 207 ? 29.438  75.100  32.705  1.00 55.15  ? 207 ARG B CG    1 
ATOM   4629 C CD    . ARG D 2 207 ? 29.623  76.598  32.838  1.00 55.64  ? 207 ARG B CD    1 
ATOM   4630 N NE    . ARG D 2 207 ? 29.887  77.214  31.547  1.00 56.94  ? 207 ARG B NE    1 
ATOM   4631 C CZ    . ARG D 2 207 ? 29.947  78.524  31.349  1.00 58.21  ? 207 ARG B CZ    1 
ATOM   4632 N NH1   . ARG D 2 207 ? 29.766  79.353  32.369  1.00 58.20  ? 207 ARG B NH1   1 
ATOM   4633 N NH2   . ARG D 2 207 ? 30.165  78.995  30.126  1.00 58.92  ? 207 ARG B NH2   1 
ATOM   4634 N N     . ASN D 2 208 ? 28.281  71.803  35.983  1.00 54.79  ? 208 ASN B N     1 
ATOM   4635 C CA    . ASN D 2 208 ? 28.209  71.376  37.371  1.00 55.92  ? 208 ASN B CA    1 
ATOM   4636 C C     . ASN D 2 208 ? 28.322  69.868  37.415  1.00 57.19  ? 208 ASN B C     1 
ATOM   4637 O O     . ASN D 2 208 ? 27.982  69.234  38.409  1.00 57.59  ? 208 ASN B O     1 
ATOM   4638 C CB    . ASN D 2 208 ? 26.901  71.838  38.025  1.00 55.02  ? 208 ASN B CB    1 
ATOM   4639 C CG    . ASN D 2 208 ? 26.871  73.335  38.273  1.00 54.16  ? 208 ASN B CG    1 
ATOM   4640 O OD1   . ASN D 2 208 ? 26.615  74.123  37.361  1.00 53.93  ? 208 ASN B OD1   1 
ATOM   4641 N ND2   . ASN D 2 208 ? 27.146  73.737  39.508  1.00 53.02  ? 208 ASN B ND2   1 
ATOM   4642 N N     . GLN D 2 209 ? 28.794  69.306  36.308  1.00 58.57  ? 209 GLN B N     1 
ATOM   4643 C CA    . GLN D 2 209 ? 28.991  67.871  36.180  1.00 59.97  ? 209 GLN B CA    1 
ATOM   4644 C C     . GLN D 2 209 ? 27.754  67.078  36.555  1.00 59.63  ? 209 GLN B C     1 
ATOM   4645 O O     . GLN D 2 209 ? 27.815  66.129  37.332  1.00 59.60  ? 209 GLN B O     1 
ATOM   4646 C CB    . GLN D 2 209 ? 30.178  67.443  37.038  1.00 61.79  ? 209 GLN B CB    1 
ATOM   4647 C CG    . GLN D 2 209 ? 31.432  68.238  36.727  1.00 65.12  ? 209 GLN B CG    1 
ATOM   4648 C CD    . GLN D 2 209 ? 32.072  68.805  37.976  1.00 67.85  ? 209 GLN B CD    1 
ATOM   4649 O OE1   . GLN D 2 209 ? 32.704  68.074  38.758  1.00 68.91  ? 209 GLN B OE1   1 
ATOM   4650 N NE2   . GLN D 2 209 ? 31.899  70.116  38.187  1.00 68.57  ? 209 GLN B NE2   1 
ATOM   4651 N N     . ILE D 2 210 ? 26.627  67.486  35.995  1.00 59.32  ? 210 ILE B N     1 
ATOM   4652 C CA    . ILE D 2 210 ? 25.368  66.814  36.233  1.00 58.92  ? 210 ILE B CA    1 
ATOM   4653 C C     . ILE D 2 210 ? 24.761  66.436  34.885  1.00 59.20  ? 210 ILE B C     1 
ATOM   4654 O O     . ILE D 2 210 ? 24.890  67.166  33.907  1.00 58.36  ? 210 ILE B O     1 
ATOM   4655 C CB    . ILE D 2 210 ? 24.390  67.729  36.992  1.00 58.52  ? 210 ILE B CB    1 
ATOM   4656 C CG1   . ILE D 2 210 ? 24.968  68.075  38.358  1.00 58.11  ? 210 ILE B CG1   1 
ATOM   4657 C CG2   . ILE D 2 210 ? 23.038  67.051  37.139  1.00 58.48  ? 210 ILE B CG2   1 
ATOM   4658 C CD1   . ILE D 2 210 ? 24.062  68.932  39.215  1.00 58.49  ? 210 ILE B CD1   1 
ATOM   4659 N N     . GLN D 2 211 ? 24.124  65.278  34.826  1.00 60.10  ? 211 GLN B N     1 
ATOM   4660 C CA    . GLN D 2 211 ? 23.479  64.846  33.600  1.00 61.14  ? 211 GLN B CA    1 
ATOM   4661 C C     . GLN D 2 211 ? 22.033  64.589  33.939  1.00 60.45  ? 211 GLN B C     1 
ATOM   4662 O O     . GLN D 2 211 ? 21.728  63.778  34.807  1.00 60.87  ? 211 GLN B O     1 
ATOM   4663 C CB    . GLN D 2 211 ? 24.094  63.563  33.073  1.00 63.28  ? 211 GLN B CB    1 
ATOM   4664 C CG    . GLN D 2 211 ? 25.520  63.701  32.618  1.00 67.55  ? 211 GLN B CG    1 
ATOM   4665 C CD    . GLN D 2 211 ? 26.077  62.376  32.140  1.00 70.16  ? 211 GLN B CD    1 
ATOM   4666 O OE1   . GLN D 2 211 ? 25.574  61.792  31.166  1.00 71.51  ? 211 GLN B OE1   1 
ATOM   4667 N NE2   . GLN D 2 211 ? 27.113  61.882  32.828  1.00 70.66  ? 211 GLN B NE2   1 
ATOM   4668 N N     . PRO D 2 212 ? 21.114  65.273  33.258  1.00 59.54  ? 212 PRO B N     1 
ATOM   4669 C CA    . PRO D 2 212 ? 19.712  65.029  33.585  1.00 58.92  ? 212 PRO B CA    1 
ATOM   4670 C C     . PRO D 2 212 ? 19.362  63.545  33.539  1.00 58.06  ? 212 PRO B C     1 
ATOM   4671 O O     . PRO D 2 212 ? 19.755  62.849  32.610  1.00 57.56  ? 212 PRO B O     1 
ATOM   4672 C CB    . PRO D 2 212 ? 18.969  65.856  32.530  1.00 59.23  ? 212 PRO B CB    1 
ATOM   4673 C CG    . PRO D 2 212 ? 19.944  65.927  31.382  1.00 58.98  ? 212 PRO B CG    1 
ATOM   4674 C CD    . PRO D 2 212 ? 21.243  66.158  32.089  1.00 59.00  ? 212 PRO B CD    1 
ATOM   4675 N N     . ILE D 2 213 ? 18.642  63.053  34.543  1.00 57.40  ? 213 ILE B N     1 
ATOM   4676 C CA    . ILE D 2 213 ? 18.260  61.650  34.524  1.00 57.23  ? 213 ILE B CA    1 
ATOM   4677 C C     . ILE D 2 213 ? 17.029  61.441  33.660  1.00 56.67  ? 213 ILE B C     1 
ATOM   4678 O O     . ILE D 2 213 ? 16.561  60.322  33.517  1.00 57.30  ? 213 ILE B O     1 
ATOM   4679 C CB    . ILE D 2 213 ? 17.961  61.090  35.930  1.00 57.57  ? 213 ILE B CB    1 
ATOM   4680 C CG1   . ILE D 2 213 ? 16.687  61.709  36.483  1.00 57.97  ? 213 ILE B CG1   1 
ATOM   4681 C CG2   . ILE D 2 213 ? 19.123  61.366  36.857  1.00 58.01  ? 213 ILE B CG2   1 
ATOM   4682 C CD1   . ILE D 2 213 ? 16.321  61.159  37.852  1.00 59.05  ? 213 ILE B CD1   1 
ATOM   4683 N N     . ALA D 2 214 ? 16.499  62.519  33.092  1.00 56.08  ? 214 ALA B N     1 
ATOM   4684 C CA    . ALA D 2 214 ? 15.323  62.445  32.219  1.00 55.55  ? 214 ALA B CA    1 
ATOM   4685 C C     . ALA D 2 214 ? 15.186  63.759  31.478  1.00 55.43  ? 214 ALA B C     1 
ATOM   4686 O O     . ALA D 2 214 ? 15.654  64.796  31.947  1.00 55.36  ? 214 ALA B O     1 
ATOM   4687 C CB    . ALA D 2 214 ? 14.059  62.165  33.026  1.00 55.44  ? 214 ALA B CB    1 
ATOM   4688 N N     . GLU D 2 215 ? 14.538  63.717  30.324  1.00 55.26  ? 215 GLU B N     1 
ATOM   4689 C CA    . GLU D 2 215 ? 14.377  64.909  29.516  1.00 56.22  ? 215 GLU B CA    1 
ATOM   4690 C C     . GLU D 2 215 ? 13.178  64.729  28.592  1.00 56.19  ? 215 GLU B C     1 
ATOM   4691 O O     . GLU D 2 215 ? 13.265  64.037  27.592  1.00 56.30  ? 215 GLU B O     1 
ATOM   4692 C CB    . GLU D 2 215 ? 15.669  65.138  28.729  1.00 57.25  ? 215 GLU B CB    1 
ATOM   4693 C CG    . GLU D 2 215 ? 15.572  66.061  27.526  1.00 59.88  ? 215 GLU B CG    1 
ATOM   4694 C CD    . GLU D 2 215 ? 16.946  66.466  27.000  1.00 61.08  ? 215 GLU B CD    1 
ATOM   4695 O OE1   . GLU D 2 215 ? 17.016  67.095  25.916  1.00 61.44  ? 215 GLU B OE1   1 
ATOM   4696 O OE2   . GLU D 2 215 ? 17.956  66.161  27.682  1.00 62.47  ? 215 GLU B OE2   1 
ATOM   4697 N N     . ARG D 2 216 ? 12.053  65.351  28.941  1.00 56.47  ? 216 ARG B N     1 
ATOM   4698 C CA    . ARG D 2 216 ? 10.834  65.225  28.148  1.00 56.25  ? 216 ARG B CA    1 
ATOM   4699 C C     . ARG D 2 216 ? 10.424  66.535  27.485  1.00 55.12  ? 216 ARG B C     1 
ATOM   4700 O O     . ARG D 2 216 ? 10.899  67.605  27.840  1.00 54.71  ? 216 ARG B O     1 
ATOM   4701 C CB    . ARG D 2 216 ? 9.687   64.745  29.032  1.00 57.95  ? 216 ARG B CB    1 
ATOM   4702 C CG    . ARG D 2 216 ? 10.137  63.946  30.225  1.00 59.98  ? 216 ARG B CG    1 
ATOM   4703 C CD    . ARG D 2 216 ? 10.436  62.514  29.859  1.00 62.53  ? 216 ARG B CD    1 
ATOM   4704 N NE    . ARG D 2 216 ? 9.221   61.770  29.545  1.00 64.33  ? 216 ARG B NE    1 
ATOM   4705 C CZ    . ARG D 2 216 ? 9.101   60.457  29.715  1.00 65.71  ? 216 ARG B CZ    1 
ATOM   4706 N NH1   . ARG D 2 216 ? 10.125  59.754  30.202  1.00 65.62  ? 216 ARG B NH1   1 
ATOM   4707 N NH2   . ARG D 2 216 ? 7.964   59.846  29.395  1.00 65.84  ? 216 ARG B NH2   1 
ATOM   4708 N N     . GLU D 2 217 ? 9.512   66.433  26.532  1.00 54.42  ? 217 GLU B N     1 
ATOM   4709 C CA    . GLU D 2 217 ? 9.036   67.590  25.797  1.00 54.30  ? 217 GLU B CA    1 
ATOM   4710 C C     . GLU D 2 217 ? 7.519   67.753  25.929  1.00 53.59  ? 217 GLU B C     1 
ATOM   4711 O O     . GLU D 2 217 ? 6.754   66.818  25.697  1.00 53.67  ? 217 GLU B O     1 
ATOM   4712 C CB    . GLU D 2 217 ? 9.408   67.436  24.325  1.00 55.36  ? 217 GLU B CB    1 
ATOM   4713 C CG    . GLU D 2 217 ? 9.058   68.622  23.447  1.00 58.36  ? 217 GLU B CG    1 
ATOM   4714 C CD    . GLU D 2 217 ? 9.235   68.327  21.954  1.00 59.77  ? 217 GLU B CD    1 
ATOM   4715 O OE1   . GLU D 2 217 ? 10.021  67.409  21.621  1.00 61.56  ? 217 GLU B OE1   1 
ATOM   4716 O OE2   . GLU D 2 217 ? 8.601   69.017  21.118  1.00 59.53  ? 217 GLU B OE2   1 
ATOM   4717 N N     . GLY D 2 218 ? 7.087   68.944  26.320  1.00 52.53  ? 218 GLY B N     1 
ATOM   4718 C CA    . GLY D 2 218 ? 5.669   69.205  26.434  1.00 51.13  ? 218 GLY B CA    1 
ATOM   4719 C C     . GLY D 2 218 ? 5.285   70.163  25.316  1.00 50.49  ? 218 GLY B C     1 
ATOM   4720 O O     . GLY D 2 218 ? 6.036   70.329  24.343  1.00 50.69  ? 218 GLY B O     1 
ATOM   4721 N N     . ASP D 2 219 ? 4.127   70.803  25.447  1.00 49.04  ? 219 ASP B N     1 
ATOM   4722 C CA    . ASP D 2 219 ? 3.674   71.748  24.435  1.00 47.51  ? 219 ASP B CA    1 
ATOM   4723 C C     . ASP D 2 219 ? 3.233   73.066  25.058  1.00 46.00  ? 219 ASP B C     1 
ATOM   4724 O O     . ASP D 2 219 ? 2.476   73.811  24.455  1.00 45.34  ? 219 ASP B O     1 
ATOM   4725 C CB    . ASP D 2 219 ? 2.522   71.154  23.632  1.00 47.67  ? 219 ASP B CB    1 
ATOM   4726 C CG    . ASP D 2 219 ? 1.321   70.858  24.490  1.00 49.18  ? 219 ASP B CG    1 
ATOM   4727 O OD1   . ASP D 2 219 ? 0.390   70.192  23.988  1.00 49.83  ? 219 ASP B OD1   1 
ATOM   4728 O OD2   . ASP D 2 219 ? 1.308   71.288  25.668  1.00 49.10  ? 219 ASP B OD2   1 
ATOM   4729 N N     . TRP D 2 220 ? 3.706   73.331  26.271  1.00 44.57  ? 220 TRP B N     1 
ATOM   4730 C CA    . TRP D 2 220 ? 3.408   74.569  26.989  1.00 43.40  ? 220 TRP B CA    1 
ATOM   4731 C C     . TRP D 2 220 ? 2.200   74.449  27.900  1.00 42.95  ? 220 TRP B C     1 
ATOM   4732 O O     . TRP D 2 220 ? 2.072   75.188  28.865  1.00 43.20  ? 220 TRP B O     1 
ATOM   4733 C CB    . TRP D 2 220 ? 3.176   75.721  26.011  1.00 41.44  ? 220 TRP B CB    1 
ATOM   4734 C CG    . TRP D 2 220 ? 4.370   76.167  25.237  1.00 40.56  ? 220 TRP B CG    1 
ATOM   4735 C CD1   . TRP D 2 220 ? 4.398   76.490  23.916  1.00 40.39  ? 220 TRP B CD1   1 
ATOM   4736 C CD2   . TRP D 2 220 ? 5.659   76.523  25.762  1.00 39.96  ? 220 TRP B CD2   1 
ATOM   4737 N NE1   . TRP D 2 220 ? 5.612   77.043  23.585  1.00 40.32  ? 220 TRP B NE1   1 
ATOM   4738 C CE2   . TRP D 2 220 ? 6.405   77.073  24.700  1.00 39.77  ? 220 TRP B CE2   1 
ATOM   4739 C CE3   . TRP D 2 220 ? 6.252   76.436  27.028  1.00 40.20  ? 220 TRP B CE3   1 
ATOM   4740 C CZ2   . TRP D 2 220 ? 7.714   77.540  24.862  1.00 39.48  ? 220 TRP B CZ2   1 
ATOM   4741 C CZ3   . TRP D 2 220 ? 7.559   76.906  27.195  1.00 40.08  ? 220 TRP B CZ3   1 
ATOM   4742 C CH2   . TRP D 2 220 ? 8.272   77.450  26.113  1.00 39.90  ? 220 TRP B CH2   1 
ATOM   4743 N N     . SER D 2 221 ? 1.321   73.508  27.593  1.00 42.85  ? 221 SER B N     1 
ATOM   4744 C CA    . SER D 2 221 ? 0.114   73.302  28.375  1.00 42.08  ? 221 SER B CA    1 
ATOM   4745 C C     . SER D 2 221 ? 0.356   72.494  29.642  1.00 43.26  ? 221 SER B C     1 
ATOM   4746 O O     . SER D 2 221 ? 1.217   71.622  29.684  1.00 43.49  ? 221 SER B O     1 
ATOM   4747 C CB    . SER D 2 221 ? -0.910  72.574  27.533  1.00 41.26  ? 221 SER B CB    1 
ATOM   4748 O OG    . SER D 2 221 ? -0.723  71.179  27.654  1.00 42.17  ? 221 SER B OG    1 
ATOM   4749 N N     . ALA D 2 222 ? -0.428  72.777  30.676  1.00 44.89  ? 222 ALA B N     1 
ATOM   4750 C CA    . ALA D 2 222 ? -0.320  72.073  31.956  1.00 45.39  ? 222 ALA B CA    1 
ATOM   4751 C C     . ALA D 2 222 ? -0.597  70.580  31.787  1.00 46.31  ? 222 ALA B C     1 
ATOM   4752 O O     . ALA D 2 222 ? -0.030  69.749  32.493  1.00 45.65  ? 222 ALA B O     1 
ATOM   4753 C CB    . ALA D 2 222 ? -1.311  72.658  32.956  1.00 44.70  ? 222 ALA B CB    1 
ATOM   4754 N N     . MET D 2 223 ? -1.485  70.243  30.860  1.00 48.04  ? 223 MET B N     1 
ATOM   4755 C CA    . MET D 2 223 ? -1.828  68.846  30.647  1.00 49.93  ? 223 MET B CA    1 
ATOM   4756 C C     . MET D 2 223 ? -0.593  68.101  30.151  1.00 50.37  ? 223 MET B C     1 
ATOM   4757 O O     . MET D 2 223 ? -0.333  66.967  30.571  1.00 50.04  ? 223 MET B O     1 
ATOM   4758 C CB    . MET D 2 223 ? -2.969  68.717  29.637  1.00 51.31  ? 223 MET B CB    1 
ATOM   4759 C CG    . MET D 2 223 ? -3.622  67.353  29.623  1.00 54.65  ? 223 MET B CG    1 
ATOM   4760 S SD    . MET D 2 223 ? -4.237  66.889  31.281  1.00 60.18  ? 223 MET B SD    1 
ATOM   4761 C CE    . MET D 2 223 ? -3.810  65.127  31.316  1.00 58.36  ? 223 MET B CE    1 
ATOM   4762 N N     . SER D 2 224 ? 0.174   68.738  29.263  1.00 50.01  ? 224 SER B N     1 
ATOM   4763 C CA    . SER D 2 224 ? 1.378   68.098  28.754  1.00 49.44  ? 224 SER B CA    1 
ATOM   4764 C C     . SER D 2 224 ? 2.341   67.920  29.932  1.00 49.49  ? 224 SER B C     1 
ATOM   4765 O O     . SER D 2 224 ? 2.961   66.874  30.081  1.00 49.79  ? 224 SER B O     1 
ATOM   4766 C CB    . SER D 2 224 ? 2.014   68.929  27.626  1.00 48.68  ? 224 SER B CB    1 
ATOM   4767 O OG    . SER D 2 224 ? 2.586   70.135  28.096  1.00 48.81  ? 224 SER B OG    1 
ATOM   4768 N N     . GLY D 2 225 ? 2.434   68.927  30.792  1.00 49.51  ? 225 GLY B N     1 
ATOM   4769 C CA    . GLY D 2 225 ? 3.313   68.820  31.940  1.00 50.15  ? 225 GLY B CA    1 
ATOM   4770 C C     . GLY D 2 225 ? 2.893   67.662  32.827  1.00 50.89  ? 225 GLY B C     1 
ATOM   4771 O O     . GLY D 2 225 ? 3.725   66.956  33.378  1.00 51.67  ? 225 GLY B O     1 
ATOM   4772 N N     . PHE D 2 226 ? 1.588   67.459  32.955  1.00 51.32  ? 226 PHE B N     1 
ATOM   4773 C CA    . PHE D 2 226 ? 1.054   66.389  33.784  1.00 51.10  ? 226 PHE B CA    1 
ATOM   4774 C C     . PHE D 2 226 ? 1.350   65.019  33.178  1.00 52.36  ? 226 PHE B C     1 
ATOM   4775 O O     . PHE D 2 226 ? 1.852   64.119  33.855  1.00 51.92  ? 226 PHE B O     1 
ATOM   4776 C CB    . PHE D 2 226 ? -0.458  66.552  33.937  1.00 48.99  ? 226 PHE B CB    1 
ATOM   4777 C CG    . PHE D 2 226 ? -1.115  65.421  34.677  1.00 46.74  ? 226 PHE B CG    1 
ATOM   4778 C CD1   . PHE D 2 226 ? -0.948  65.277  36.050  1.00 45.48  ? 226 PHE B CD1   1 
ATOM   4779 C CD2   . PHE D 2 226 ? -1.882  64.485  33.998  1.00 45.22  ? 226 PHE B CD2   1 
ATOM   4780 C CE1   . PHE D 2 226 ? -1.542  64.209  36.736  1.00 44.81  ? 226 PHE B CE1   1 
ATOM   4781 C CE2   . PHE D 2 226 ? -2.475  63.421  34.680  1.00 44.35  ? 226 PHE B CE2   1 
ATOM   4782 C CZ    . PHE D 2 226 ? -2.304  63.286  36.050  1.00 43.39  ? 226 PHE B CZ    1 
ATOM   4783 N N     . GLN D 2 227 ? 1.021   64.872  31.900  1.00 53.77  ? 227 GLN B N     1 
ATOM   4784 C CA    . GLN D 2 227 ? 1.234   63.626  31.184  1.00 55.32  ? 227 GLN B CA    1 
ATOM   4785 C C     . GLN D 2 227 ? 2.696   63.231  31.103  1.00 55.25  ? 227 GLN B C     1 
ATOM   4786 O O     . GLN D 2 227 ? 3.048   62.096  31.398  1.00 55.12  ? 227 GLN B O     1 
ATOM   4787 C CB    . GLN D 2 227 ? 0.647   63.737  29.786  1.00 57.08  ? 227 GLN B CB    1 
ATOM   4788 C CG    . GLN D 2 227 ? -0.865  63.607  29.767  1.00 61.06  ? 227 GLN B CG    1 
ATOM   4789 C CD    . GLN D 2 227 ? -1.479  64.153  28.489  1.00 63.96  ? 227 GLN B CD    1 
ATOM   4790 O OE1   . GLN D 2 227 ? -2.671  63.954  28.227  1.00 66.40  ? 227 GLN B OE1   1 
ATOM   4791 N NE2   . GLN D 2 227 ? -0.673  64.857  27.689  1.00 64.83  ? 227 GLN B NE2   1 
ATOM   4792 N N     . GLN D 2 228 ? 3.552   64.167  30.708  1.00 55.24  ? 228 GLN B N     1 
ATOM   4793 C CA    . GLN D 2 228 ? 4.971   63.873  30.602  1.00 54.72  ? 228 GLN B CA    1 
ATOM   4794 C C     . GLN D 2 228 ? 5.544   63.455  31.943  1.00 54.81  ? 228 GLN B C     1 
ATOM   4795 O O     . GLN D 2 228 ? 6.274   62.470  32.021  1.00 54.89  ? 228 GLN B O     1 
ATOM   4796 C CB    . GLN D 2 228 ? 5.744   65.081  30.076  1.00 54.22  ? 228 GLN B CB    1 
ATOM   4797 C CG    . GLN D 2 228 ? 5.525   65.364  28.613  1.00 53.98  ? 228 GLN B CG    1 
ATOM   4798 C CD    . GLN D 2 228 ? 5.880   64.184  27.737  1.00 54.40  ? 228 GLN B CD    1 
ATOM   4799 O OE1   . GLN D 2 228 ? 6.963   63.598  27.861  1.00 55.14  ? 228 GLN B OE1   1 
ATOM   4800 N NE2   . GLN D 2 228 ? 4.977   63.832  26.838  1.00 53.92  ? 228 GLN B NE2   1 
ATOM   4801 N N     . THR D 2 229 ? 5.215   64.187  33.001  1.00 54.74  ? 229 THR B N     1 
ATOM   4802 C CA    . THR D 2 229 ? 5.747   63.843  34.310  1.00 55.41  ? 229 THR B CA    1 
ATOM   4803 C C     . THR D 2 229 ? 5.169   62.536  34.834  1.00 56.93  ? 229 THR B C     1 
ATOM   4804 O O     . THR D 2 229 ? 5.768   61.898  35.697  1.00 57.08  ? 229 THR B O     1 
ATOM   4805 C CB    . THR D 2 229 ? 5.501   64.966  35.331  1.00 54.54  ? 229 THR B CB    1 
ATOM   4806 O OG1   . THR D 2 229 ? 6.143   66.161  34.879  1.00 54.77  ? 229 THR B OG1   1 
ATOM   4807 C CG2   . THR D 2 229 ? 6.070   64.594  36.696  1.00 53.32  ? 229 THR B CG2   1 
ATOM   4808 N N     . MET D 2 230 ? 4.008   62.134  34.324  1.00 58.56  ? 230 MET B N     1 
ATOM   4809 C CA    . MET D 2 230 ? 3.404   60.879  34.758  1.00 60.21  ? 230 MET B CA    1 
ATOM   4810 C C     . MET D 2 230 ? 4.128   59.725  34.082  1.00 60.39  ? 230 MET B C     1 
ATOM   4811 O O     . MET D 2 230 ? 4.463   58.738  34.734  1.00 59.98  ? 230 MET B O     1 
ATOM   4812 C CB    . MET D 2 230 ? 1.909   60.819  34.404  1.00 62.28  ? 230 MET B CB    1 
ATOM   4813 C CG    . MET D 2 230 ? 0.994   61.399  35.473  1.00 64.97  ? 230 MET B CG    1 
ATOM   4814 S SD    . MET D 2 230 ? 1.147   60.519  37.057  1.00 68.23  ? 230 MET B SD    1 
ATOM   4815 C CE    . MET D 2 230 ? 0.049   59.096  36.698  1.00 68.44  ? 230 MET B CE    1 
ATOM   4816 N N     . GLN D 2 231 ? 4.358   59.850  32.775  1.00 60.95  ? 231 GLN B N     1 
ATOM   4817 C CA    . GLN D 2 231 ? 5.061   58.815  32.017  1.00 61.79  ? 231 GLN B CA    1 
ATOM   4818 C C     . GLN D 2 231 ? 6.435   58.609  32.646  1.00 61.80  ? 231 GLN B C     1 
ATOM   4819 O O     . GLN D 2 231 ? 6.870   57.473  32.862  1.00 62.23  ? 231 GLN B O     1 
ATOM   4820 C CB    . GLN D 2 231 ? 5.230   59.226  30.557  1.00 62.34  ? 231 GLN B CB    1 
ATOM   4821 C CG    . GLN D 2 231 ? 3.933   59.309  29.781  1.00 64.88  ? 231 GLN B CG    1 
ATOM   4822 C CD    . GLN D 2 231 ? 4.115   59.922  28.390  1.00 66.63  ? 231 GLN B CD    1 
ATOM   4823 O OE1   . GLN D 2 231 ? 3.137   60.173  27.670  1.00 67.31  ? 231 GLN B OE1   1 
ATOM   4824 N NE2   . GLN D 2 231 ? 5.369   60.166  28.007  1.00 67.33  ? 231 GLN B NE2   1 
ATOM   4825 N N     . MET D 2 232 ? 7.105   59.714  32.953  1.00 60.93  ? 232 MET B N     1 
ATOM   4826 C CA    . MET D 2 232 ? 8.419   59.657  33.566  1.00 60.18  ? 232 MET B CA    1 
ATOM   4827 C C     . MET D 2 232 ? 8.392   58.863  34.868  1.00 60.77  ? 232 MET B C     1 
ATOM   4828 O O     . MET D 2 232 ? 9.214   57.963  35.075  1.00 61.38  ? 232 MET B O     1 
ATOM   4829 C CB    . MET D 2 232 ? 8.942   61.067  33.836  1.00 58.84  ? 232 MET B CB    1 
ATOM   4830 C CG    . MET D 2 232 ? 10.196  61.074  34.666  1.00 57.64  ? 232 MET B CG    1 
ATOM   4831 S SD    . MET D 2 232 ? 10.826  62.704  34.998  1.00 56.55  ? 232 MET B SD    1 
ATOM   4832 C CE    . MET D 2 232 ? 9.953   63.121  36.522  1.00 56.79  ? 232 MET B CE    1 
ATOM   4833 N N     . LEU D 2 233 ? 7.454   59.198  35.750  1.00 61.01  ? 233 LEU B N     1 
ATOM   4834 C CA    . LEU D 2 233 ? 7.336   58.515  37.032  1.00 61.07  ? 233 LEU B CA    1 
ATOM   4835 C C     . LEU D 2 233 ? 6.896   57.065  36.863  1.00 61.89  ? 233 LEU B C     1 
ATOM   4836 O O     . LEU D 2 233 ? 7.291   56.193  37.639  1.00 61.51  ? 233 LEU B O     1 
ATOM   4837 C CB    . LEU D 2 233 ? 6.349   59.255  37.934  1.00 60.20  ? 233 LEU B CB    1 
ATOM   4838 C CG    . LEU D 2 233 ? 6.799   60.626  38.433  1.00 59.85  ? 233 LEU B CG    1 
ATOM   4839 C CD1   . LEU D 2 233 ? 5.655   61.301  39.165  1.00 59.37  ? 233 LEU B CD1   1 
ATOM   4840 C CD2   . LEU D 2 233 ? 8.003   60.473  39.353  1.00 59.62  ? 233 LEU B CD2   1 
ATOM   4841 N N     . ASN D 2 234 ? 6.084   56.798  35.847  1.00 62.73  ? 234 ASN B N     1 
ATOM   4842 C CA    . ASN D 2 234 ? 5.626   55.435  35.627  1.00 64.19  ? 234 ASN B CA    1 
ATOM   4843 C C     . ASN D 2 234 ? 6.765   54.557  35.126  1.00 64.72  ? 234 ASN B C     1 
ATOM   4844 O O     . ASN D 2 234 ? 6.724   53.339  35.263  1.00 65.30  ? 234 ASN B O     1 
ATOM   4845 C CB    . ASN D 2 234 ? 4.460   55.400  34.636  1.00 64.49  ? 234 ASN B CB    1 
ATOM   4846 C CG    . ASN D 2 234 ? 3.187   55.975  35.222  1.00 65.30  ? 234 ASN B CG    1 
ATOM   4847 O OD1   . ASN D 2 234 ? 2.882   55.766  36.402  1.00 65.05  ? 234 ASN B OD1   1 
ATOM   4848 N ND2   . ASN D 2 234 ? 2.427   56.694  34.398  1.00 65.72  ? 234 ASN B ND2   1 
ATOM   4849 N N     . GLU D 2 235 ? 7.780   55.176  34.540  1.00 64.77  ? 235 GLU B N     1 
ATOM   4850 C CA    . GLU D 2 235 ? 8.925   54.432  34.051  1.00 64.72  ? 235 GLU B CA    1 
ATOM   4851 C C     . GLU D 2 235 ? 9.897   54.217  35.193  1.00 63.84  ? 235 GLU B C     1 
ATOM   4852 O O     . GLU D 2 235 ? 11.023  53.788  34.969  1.00 64.55  ? 235 GLU B O     1 
ATOM   4853 C CB    . GLU D 2 235 ? 9.646   55.195  32.941  1.00 66.23  ? 235 GLU B CB    1 
ATOM   4854 C CG    . GLU D 2 235 ? 8.880   55.318  31.647  1.00 68.68  ? 235 GLU B CG    1 
ATOM   4855 C CD    . GLU D 2 235 ? 9.599   56.208  30.652  1.00 70.66  ? 235 GLU B CD    1 
ATOM   4856 O OE1   . GLU D 2 235 ? 9.022   56.485  29.574  1.00 71.82  ? 235 GLU B OE1   1 
ATOM   4857 O OE2   . GLU D 2 235 ? 10.743  56.635  30.950  1.00 71.74  ? 235 GLU B OE2   1 
ATOM   4858 N N     . GLY D 2 236 ? 9.479   54.534  36.413  1.00 62.39  ? 236 GLY B N     1 
ATOM   4859 C CA    . GLY D 2 236 ? 10.361  54.345  37.551  1.00 61.10  ? 236 GLY B CA    1 
ATOM   4860 C C     . GLY D 2 236 ? 11.424  55.413  37.738  1.00 60.26  ? 236 GLY B C     1 
ATOM   4861 O O     . GLY D 2 236 ? 12.163  55.382  38.722  1.00 60.21  ? 236 GLY B O     1 
ATOM   4862 N N     . ILE D 2 237 ? 11.516  56.355  36.802  1.00 59.43  ? 237 ILE B N     1 
ATOM   4863 C CA    . ILE D 2 237 ? 12.492  57.438  36.908  1.00 58.34  ? 237 ILE B CA    1 
ATOM   4864 C C     . ILE D 2 237 ? 11.936  58.513  37.844  1.00 57.67  ? 237 ILE B C     1 
ATOM   4865 O O     . ILE D 2 237 ? 11.047  59.269  37.464  1.00 58.21  ? 237 ILE B O     1 
ATOM   4866 C CB    . ILE D 2 237 ? 12.755  58.096  35.542  1.00 58.49  ? 237 ILE B CB    1 
ATOM   4867 C CG1   . ILE D 2 237 ? 13.231  57.045  34.542  1.00 58.36  ? 237 ILE B CG1   1 
ATOM   4868 C CG2   . ILE D 2 237 ? 13.771  59.223  35.690  1.00 57.58  ? 237 ILE B CG2   1 
ATOM   4869 C CD1   . ILE D 2 237 ? 13.393  57.587  33.135  1.00 58.87  ? 237 ILE B CD1   1 
ATOM   4870 N N     . VAL D 2 238 ? 12.447  58.589  39.061  1.00 56.28  ? 238 VAL B N     1 
ATOM   4871 C CA    . VAL D 2 238 ? 11.953  59.585  39.990  1.00 55.60  ? 238 VAL B CA    1 
ATOM   4872 C C     . VAL D 2 238 ? 13.079  60.495  40.493  1.00 54.60  ? 238 VAL B C     1 
ATOM   4873 O O     . VAL D 2 238 ? 13.827  60.134  41.402  1.00 54.86  ? 238 VAL B O     1 
ATOM   4874 C CB    . VAL D 2 238 ? 11.209  58.893  41.171  1.00 55.63  ? 238 VAL B CB    1 
ATOM   4875 C CG1   . VAL D 2 238 ? 12.013  57.734  41.669  1.00 56.32  ? 238 VAL B CG1   1 
ATOM   4876 C CG2   . VAL D 2 238 ? 10.957  59.877  42.301  1.00 55.24  ? 238 VAL B CG2   1 
ATOM   4877 N N     . PRO D 2 239 ? 13.200  61.701  39.902  1.00 53.43  ? 239 PRO B N     1 
ATOM   4878 C CA    . PRO D 2 239 ? 14.221  62.696  40.254  1.00 52.71  ? 239 PRO B CA    1 
ATOM   4879 C C     . PRO D 2 239 ? 13.918  63.366  41.579  1.00 51.82  ? 239 PRO B C     1 
ATOM   4880 O O     . PRO D 2 239 ? 12.904  63.073  42.198  1.00 51.65  ? 239 PRO B O     1 
ATOM   4881 C CB    . PRO D 2 239 ? 14.139  63.685  39.102  1.00 52.05  ? 239 PRO B CB    1 
ATOM   4882 C CG    . PRO D 2 239 ? 12.683  63.721  38.840  1.00 52.07  ? 239 PRO B CG    1 
ATOM   4883 C CD    . PRO D 2 239 ? 12.299  62.246  38.870  1.00 52.79  ? 239 PRO B CD    1 
ATOM   4884 N N     . THR D 2 240 ? 14.794  64.265  42.010  1.00 50.78  ? 240 THR B N     1 
ATOM   4885 C CA    . THR D 2 240 ? 14.564  64.979  43.255  1.00 50.12  ? 240 THR B CA    1 
ATOM   4886 C C     . THR D 2 240 ? 14.269  66.440  42.940  1.00 49.55  ? 240 THR B C     1 
ATOM   4887 O O     . THR D 2 240 ? 14.024  67.239  43.842  1.00 49.36  ? 240 THR B O     1 
ATOM   4888 C CB    . THR D 2 240 ? 15.783  64.935  44.176  1.00 50.44  ? 240 THR B CB    1 
ATOM   4889 O OG1   . THR D 2 240 ? 16.868  65.635  43.558  1.00 51.35  ? 240 THR B OG1   1 
ATOM   4890 C CG2   . THR D 2 240 ? 16.186  63.509  44.449  1.00 49.49  ? 240 THR B CG2   1 
ATOM   4891 N N     . ALA D 2 241 ? 14.314  66.787  41.656  1.00 48.28  ? 241 ALA B N     1 
ATOM   4892 C CA    . ALA D 2 241 ? 14.046  68.146  41.230  1.00 47.16  ? 241 ALA B CA    1 
ATOM   4893 C C     . ALA D 2 241 ? 13.796  68.181  39.737  1.00 46.69  ? 241 ALA B C     1 
ATOM   4894 O O     . ALA D 2 241 ? 14.337  67.370  38.994  1.00 46.70  ? 241 ALA B O     1 
ATOM   4895 C CB    . ALA D 2 241 ? 15.207  69.039  41.591  1.00 46.75  ? 241 ALA B CB    1 
ATOM   4896 N N     . MET D 2 242 ? 12.959  69.117  39.301  1.00 46.13  ? 242 MET B N     1 
ATOM   4897 C CA    . MET D 2 242 ? 12.643  69.266  37.882  1.00 45.60  ? 242 MET B CA    1 
ATOM   4898 C C     . MET D 2 242 ? 12.733  70.727  37.438  1.00 45.02  ? 242 MET B C     1 
ATOM   4899 O O     . MET D 2 242 ? 12.334  71.633  38.176  1.00 45.20  ? 242 MET B O     1 
ATOM   4900 C CB    . MET D 2 242 ? 11.225  68.769  37.581  1.00 45.06  ? 242 MET B CB    1 
ATOM   4901 C CG    . MET D 2 242 ? 11.013  67.288  37.714  1.00 45.13  ? 242 MET B CG    1 
ATOM   4902 S SD    . MET D 2 242 ? 9.271   66.861  37.438  1.00 45.41  ? 242 MET B SD    1 
ATOM   4903 C CE    . MET D 2 242 ? 9.135   67.010  35.631  1.00 43.68  ? 242 MET B CE    1 
ATOM   4904 N N     . LEU D 2 243 ? 13.271  70.945  36.241  1.00 43.90  ? 243 LEU B N     1 
ATOM   4905 C CA    . LEU D 2 243 ? 13.353  72.281  35.656  1.00 43.18  ? 243 LEU B CA    1 
ATOM   4906 C C     . LEU D 2 243 ? 12.311  72.189  34.551  1.00 42.70  ? 243 LEU B C     1 
ATOM   4907 O O     . LEU D 2 243 ? 12.385  71.301  33.696  1.00 42.29  ? 243 LEU B O     1 
ATOM   4908 C CB    . LEU D 2 243 ? 14.740  72.552  35.074  1.00 42.50  ? 243 LEU B CB    1 
ATOM   4909 C CG    . LEU D 2 243 ? 15.841  72.736  36.117  1.00 42.80  ? 243 LEU B CG    1 
ATOM   4910 C CD1   . LEU D 2 243 ? 17.215  72.484  35.474  1.00 43.08  ? 243 LEU B CD1   1 
ATOM   4911 C CD2   . LEU D 2 243 ? 15.763  74.120  36.710  1.00 41.43  ? 243 LEU B CD2   1 
ATOM   4912 N N     . VAL D 2 244 ? 11.319  73.078  34.590  1.00 42.01  ? 244 VAL B N     1 
ATOM   4913 C CA    . VAL D 2 244 ? 10.234  73.060  33.605  1.00 40.39  ? 244 VAL B CA    1 
ATOM   4914 C C     . VAL D 2 244 ? 10.264  74.348  32.796  1.00 39.69  ? 244 VAL B C     1 
ATOM   4915 O O     . VAL D 2 244 ? 10.525  75.420  33.336  1.00 39.03  ? 244 VAL B O     1 
ATOM   4916 C CB    . VAL D 2 244 ? 8.883   72.870  34.323  1.00 40.08  ? 244 VAL B CB    1 
ATOM   4917 C CG1   . VAL D 2 244 ? 7.831   72.401  33.351  1.00 39.24  ? 244 VAL B CG1   1 
ATOM   4918 C CG2   . VAL D 2 244 ? 9.050   71.850  35.439  1.00 38.73  ? 244 VAL B CG2   1 
ATOM   4919 N N     . ALA D 2 245 ? 10.017  74.224  31.494  1.00 39.79  ? 245 ALA B N     1 
ATOM   4920 C CA    . ALA D 2 245 ? 10.071  75.357  30.564  1.00 39.67  ? 245 ALA B CA    1 
ATOM   4921 C C     . ALA D 2 245 ? 9.112   76.521  30.821  1.00 40.12  ? 245 ALA B C     1 
ATOM   4922 O O     . ALA D 2 245 ? 9.346   77.619  30.323  1.00 40.26  ? 245 ALA B O     1 
ATOM   4923 C CB    . ALA D 2 245 ? 9.901   74.863  29.155  1.00 39.09  ? 245 ALA B CB    1 
ATOM   4924 N N     . ASN D 2 246 ? 8.029   76.285  31.559  1.00 39.48  ? 246 ASN B N     1 
ATOM   4925 C CA    . ASN D 2 246 ? 7.092   77.359  31.887  1.00 39.31  ? 246 ASN B CA    1 
ATOM   4926 C C     . ASN D 2 246 ? 6.216   76.983  33.075  1.00 39.23  ? 246 ASN B C     1 
ATOM   4927 O O     . ASN D 2 246 ? 6.105   75.811  33.425  1.00 38.91  ? 246 ASN B O     1 
ATOM   4928 C CB    . ASN D 2 246 ? 6.222   77.728  30.678  1.00 38.67  ? 246 ASN B CB    1 
ATOM   4929 C CG    . ASN D 2 246 ? 5.120   76.735  30.413  1.00 38.75  ? 246 ASN B CG    1 
ATOM   4930 O OD1   . ASN D 2 246 ? 5.151   75.611  30.905  1.00 39.46  ? 246 ASN B OD1   1 
ATOM   4931 N ND2   . ASN D 2 246 ? 4.133   77.145  29.611  1.00 38.13  ? 246 ASN B ND2   1 
ATOM   4932 N N     . ASP D 2 247 ? 5.607   77.988  33.699  1.00 39.39  ? 247 ASP B N     1 
ATOM   4933 C CA    . ASP D 2 247 ? 4.755   77.779  34.867  1.00 38.69  ? 247 ASP B CA    1 
ATOM   4934 C C     . ASP D 2 247 ? 3.574   76.852  34.617  1.00 38.04  ? 247 ASP B C     1 
ATOM   4935 O O     . ASP D 2 247 ? 3.225   76.045  35.467  1.00 38.59  ? 247 ASP B O     1 
ATOM   4936 C CB    . ASP D 2 247 ? 4.254   79.119  35.381  1.00 38.45  ? 247 ASP B CB    1 
ATOM   4937 C CG    . ASP D 2 247 ? 5.374   79.998  35.885  1.00 39.86  ? 247 ASP B CG    1 
ATOM   4938 O OD1   . ASP D 2 247 ? 5.125   81.213  36.049  1.00 39.97  ? 247 ASP B OD1   1 
ATOM   4939 O OD2   . ASP D 2 247 ? 6.501   79.482  36.124  1.00 39.09  ? 247 ASP B OD2   1 
ATOM   4940 N N     . GLN D 2 248 ? 2.951   76.941  33.458  1.00 37.51  ? 248 GLN B N     1 
ATOM   4941 C CA    . GLN D 2 248 ? 1.832   76.057  33.221  1.00 38.32  ? 248 GLN B CA    1 
ATOM   4942 C C     . GLN D 2 248 ? 2.211   74.584  33.216  1.00 38.77  ? 248 GLN B C     1 
ATOM   4943 O O     . GLN D 2 248 ? 1.491   73.769  33.798  1.00 38.58  ? 248 GLN B O     1 
ATOM   4944 C CB    . GLN D 2 248 ? 1.127   76.452  31.935  1.00 38.84  ? 248 GLN B CB    1 
ATOM   4945 C CG    . GLN D 2 248 ? 0.360   77.736  32.129  1.00 40.29  ? 248 GLN B CG    1 
ATOM   4946 C CD    . GLN D 2 248 ? 0.067   78.456  30.843  1.00 40.75  ? 248 GLN B CD    1 
ATOM   4947 O OE1   . GLN D 2 248 ? 0.898   79.223  30.329  1.00 41.37  ? 248 GLN B OE1   1 
ATOM   4948 N NE2   . GLN D 2 248 ? -1.117  78.214  30.304  1.00 40.24  ? 248 GLN B NE2   1 
ATOM   4949 N N     . MET D 2 249 ? 3.325   74.220  32.575  1.00 39.23  ? 249 MET B N     1 
ATOM   4950 C CA    . MET D 2 249 ? 3.722   72.813  32.593  1.00 39.38  ? 249 MET B CA    1 
ATOM   4951 C C     . MET D 2 249 ? 4.153   72.451  34.015  1.00 38.89  ? 249 MET B C     1 
ATOM   4952 O O     . MET D 2 249 ? 3.885   71.353  34.496  1.00 38.32  ? 249 MET B O     1 
ATOM   4953 C CB    . MET D 2 249 ? 4.843   72.522  31.594  1.00 39.03  ? 249 MET B CB    1 
ATOM   4954 C CG    . MET D 2 249 ? 4.391   72.694  30.160  1.00 40.45  ? 249 MET B CG    1 
ATOM   4955 S SD    . MET D 2 249 ? 5.556   72.077  28.906  1.00 41.50  ? 249 MET B SD    1 
ATOM   4956 C CE    . MET D 2 249 ? 6.989   73.219  29.165  1.00 38.70  ? 249 MET B CE    1 
ATOM   4957 N N     . ALA D 2 250 ? 4.789   73.383  34.707  1.00 38.97  ? 250 ALA B N     1 
ATOM   4958 C CA    . ALA D 2 250 ? 5.200   73.100  36.074  1.00 40.74  ? 250 ALA B CA    1 
ATOM   4959 C C     . ALA D 2 250 ? 3.961   72.708  36.870  1.00 42.18  ? 250 ALA B C     1 
ATOM   4960 O O     . ALA D 2 250 ? 4.020   71.811  37.716  1.00 42.79  ? 250 ALA B O     1 
ATOM   4961 C CB    . ALA D 2 250 ? 5.856   74.311  36.695  1.00 40.48  ? 250 ALA B CB    1 
ATOM   4962 N N     . LEU D 2 251 ? 2.841   73.385  36.595  1.00 42.91  ? 251 LEU B N     1 
ATOM   4963 C CA    . LEU D 2 251 ? 1.584   73.095  37.277  1.00 43.16  ? 251 LEU B CA    1 
ATOM   4964 C C     . LEU D 2 251 ? 1.219   71.643  37.035  1.00 43.51  ? 251 LEU B C     1 
ATOM   4965 O O     . LEU D 2 251 ? 0.917   70.908  37.967  1.00 43.58  ? 251 LEU B O     1 
ATOM   4966 C CB    . LEU D 2 251 ? 0.449   73.988  36.757  1.00 43.82  ? 251 LEU B CB    1 
ATOM   4967 C CG    . LEU D 2 251 ? -0.931  73.746  37.403  1.00 42.99  ? 251 LEU B CG    1 
ATOM   4968 C CD1   . LEU D 2 251 ? -0.911  74.255  38.828  1.00 43.45  ? 251 LEU B CD1   1 
ATOM   4969 C CD2   . LEU D 2 251 ? -2.007  74.455  36.625  1.00 42.88  ? 251 LEU B CD2   1 
ATOM   4970 N N     . GLY D 2 252 ? 1.241   71.230  35.775  1.00 43.71  ? 252 GLY B N     1 
ATOM   4971 C CA    . GLY D 2 252 ? 0.921   69.849  35.469  1.00 44.39  ? 252 GLY B CA    1 
ATOM   4972 C C     . GLY D 2 252 ? 1.889   68.885  36.152  1.00 45.18  ? 252 GLY B C     1 
ATOM   4973 O O     . GLY D 2 252 ? 1.480   67.821  36.631  1.00 45.20  ? 252 GLY B O     1 
ATOM   4974 N N     . ALA D 2 253 ? 3.170   69.251  36.202  1.00 44.83  ? 253 ALA B N     1 
ATOM   4975 C CA    . ALA D 2 253 ? 4.162   68.391  36.822  1.00 45.21  ? 253 ALA B CA    1 
ATOM   4976 C C     . ALA D 2 253 ? 3.806   68.225  38.281  1.00 45.63  ? 253 ALA B C     1 
ATOM   4977 O O     . ALA D 2 253 ? 3.761   67.108  38.798  1.00 45.63  ? 253 ALA B O     1 
ATOM   4978 C CB    . ALA D 2 253 ? 5.551   68.989  36.691  1.00 44.80  ? 253 ALA B CB    1 
ATOM   4979 N N     . MET D 2 254 ? 3.545   69.346  38.944  1.00 46.20  ? 254 MET B N     1 
ATOM   4980 C CA    . MET D 2 254 ? 3.187   69.326  40.357  1.00 46.12  ? 254 MET B CA    1 
ATOM   4981 C C     . MET D 2 254 ? 1.959   68.441  40.602  1.00 46.64  ? 254 MET B C     1 
ATOM   4982 O O     . MET D 2 254 ? 1.894   67.719  41.601  1.00 46.79  ? 254 MET B O     1 
ATOM   4983 C CB    . MET D 2 254 ? 2.931   70.744  40.832  1.00 45.82  ? 254 MET B CB    1 
ATOM   4984 C CG    . MET D 2 254 ? 4.164   71.613  40.780  1.00 46.95  ? 254 MET B CG    1 
ATOM   4985 S SD    . MET D 2 254 ? 3.787   73.363  41.036  1.00 47.42  ? 254 MET B SD    1 
ATOM   4986 C CE    . MET D 2 254 ? 3.324   73.359  42.751  1.00 47.15  ? 254 MET B CE    1 
ATOM   4987 N N     . ARG D 2 255 ? 0.995   68.471  39.688  1.00 46.35  ? 255 ARG B N     1 
ATOM   4988 C CA    . ARG D 2 255 ? -0.185  67.640  39.862  1.00 47.34  ? 255 ARG B CA    1 
ATOM   4989 C C     . ARG D 2 255 ? 0.240   66.182  39.851  1.00 48.25  ? 255 ARG B C     1 
ATOM   4990 O O     . ARG D 2 255 ? -0.125  65.415  40.746  1.00 48.91  ? 255 ARG B O     1 
ATOM   4991 C CB    . ARG D 2 255 ? -1.200  67.877  38.742  1.00 47.56  ? 255 ARG B CB    1 
ATOM   4992 C CG    . ARG D 2 255 ? -2.639  67.699  39.198  1.00 47.92  ? 255 ARG B CG    1 
ATOM   4993 C CD    . ARG D 2 255 ? -3.318  66.430  38.722  1.00 48.28  ? 255 ARG B CD    1 
ATOM   4994 N NE    . ARG D 2 255 ? -3.988  66.598  37.439  1.00 47.88  ? 255 ARG B NE    1 
ATOM   4995 C CZ    . ARG D 2 255 ? -4.776  65.682  36.892  1.00 48.38  ? 255 ARG B CZ    1 
ATOM   4996 N NH1   . ARG D 2 255 ? -4.999  64.546  37.529  1.00 47.85  ? 255 ARG B NH1   1 
ATOM   4997 N NH2   . ARG D 2 255 ? -5.306  65.889  35.693  1.00 48.93  ? 255 ARG B NH2   1 
ATOM   4998 N N     . ALA D 2 256 ? 1.019   65.811  38.835  1.00 48.42  ? 256 ALA B N     1 
ATOM   4999 C CA    . ALA D 2 256 ? 1.500   64.445  38.685  1.00 48.55  ? 256 ALA B CA    1 
ATOM   5000 C C     . ALA D 2 256 ? 2.296   64.023  39.916  1.00 48.78  ? 256 ALA B C     1 
ATOM   5001 O O     . ALA D 2 256 ? 2.072   62.959  40.484  1.00 49.45  ? 256 ALA B O     1 
ATOM   5002 C CB    . ALA D 2 256 ? 2.358   64.332  37.432  1.00 48.66  ? 256 ALA B CB    1 
ATOM   5003 N N     . ILE D 2 257 ? 3.220   64.860  40.344  1.00 48.52  ? 257 ILE B N     1 
ATOM   5004 C CA    . ILE D 2 257 ? 4.004   64.526  41.510  1.00 49.04  ? 257 ILE B CA    1 
ATOM   5005 C C     . ILE D 2 257 ? 3.096   64.241  42.693  1.00 50.34  ? 257 ILE B C     1 
ATOM   5006 O O     . ILE D 2 257 ? 3.216   63.216  43.353  1.00 50.96  ? 257 ILE B O     1 
ATOM   5007 C CB    . ILE D 2 257 ? 4.946   65.677  41.882  1.00 48.16  ? 257 ILE B CB    1 
ATOM   5008 C CG1   . ILE D 2 257 ? 5.997   65.860  40.790  1.00 47.93  ? 257 ILE B CG1   1 
ATOM   5009 C CG2   . ILE D 2 257 ? 5.582   65.416  43.221  1.00 47.24  ? 257 ILE B CG2   1 
ATOM   5010 C CD1   . ILE D 2 257 ? 6.959   66.997  41.059  1.00 48.37  ? 257 ILE B CD1   1 
ATOM   5011 N N     . THR D 2 258 ? 2.174   65.159  42.950  1.00 52.37  ? 258 THR B N     1 
ATOM   5012 C CA    . THR D 2 258 ? 1.260   65.042  44.077  1.00 53.11  ? 258 THR B CA    1 
ATOM   5013 C C     . THR D 2 258 ? 0.333   63.849  43.995  1.00 53.86  ? 258 THR B C     1 
ATOM   5014 O O     . THR D 2 258 ? 0.167   63.137  44.975  1.00 53.95  ? 258 THR B O     1 
ATOM   5015 C CB    . THR D 2 258 ? 0.429   66.314  44.235  1.00 52.93  ? 258 THR B CB    1 
ATOM   5016 O OG1   . THR D 2 258 ? 1.314   67.431  44.380  1.00 53.23  ? 258 THR B OG1   1 
ATOM   5017 C CG2   . THR D 2 258 ? -0.437  66.230  45.476  1.00 52.35  ? 258 THR B CG2   1 
ATOM   5018 N N     . GLU D 2 259 ? -0.271  63.624  42.836  1.00 54.68  ? 259 GLU B N     1 
ATOM   5019 C CA    . GLU D 2 259 ? -1.163  62.489  42.692  1.00 56.15  ? 259 GLU B CA    1 
ATOM   5020 C C     . GLU D 2 259 ? -0.404  61.169  42.708  1.00 57.51  ? 259 GLU B C     1 
ATOM   5021 O O     . GLU D 2 259 ? -1.002  60.108  42.571  1.00 58.39  ? 259 GLU B O     1 
ATOM   5022 C CB    . GLU D 2 259 ? -1.982  62.615  41.409  1.00 56.03  ? 259 GLU B CB    1 
ATOM   5023 C CG    . GLU D 2 259 ? -2.972  63.774  41.463  1.00 56.86  ? 259 GLU B CG    1 
ATOM   5024 C CD    . GLU D 2 259 ? -3.922  63.808  40.285  1.00 56.99  ? 259 GLU B CD    1 
ATOM   5025 O OE1   . GLU D 2 259 ? -4.787  64.712  40.246  1.00 56.61  ? 259 GLU B OE1   1 
ATOM   5026 O OE2   . GLU D 2 259 ? -3.801  62.929  39.401  1.00 57.35  ? 259 GLU B OE2   1 
ATOM   5027 N N     . SER D 2 260 ? 0.914   61.239  42.877  1.00 58.30  ? 260 SER B N     1 
ATOM   5028 C CA    . SER D 2 260 ? 1.756   60.044  42.930  1.00 58.45  ? 260 SER B CA    1 
ATOM   5029 C C     . SER D 2 260 ? 2.159   59.714  44.365  1.00 58.68  ? 260 SER B C     1 
ATOM   5030 O O     . SER D 2 260 ? 2.852   58.732  44.605  1.00 59.35  ? 260 SER B O     1 
ATOM   5031 C CB    . SER D 2 260 ? 3.026   60.226  42.087  1.00 58.35  ? 260 SER B CB    1 
ATOM   5032 O OG    . SER D 2 260 ? 2.725   60.211  40.703  1.00 59.46  ? 260 SER B OG    1 
ATOM   5033 N N     . GLY D 2 261 ? 1.736   60.533  45.319  1.00 58.33  ? 261 GLY B N     1 
ATOM   5034 C CA    . GLY D 2 261 ? 2.075   60.266  46.702  1.00 57.83  ? 261 GLY B CA    1 
ATOM   5035 C C     . GLY D 2 261 ? 3.330   60.983  47.143  1.00 58.40  ? 261 GLY B C     1 
ATOM   5036 O O     . GLY D 2 261 ? 3.771   60.847  48.289  1.00 58.36  ? 261 GLY B O     1 
ATOM   5037 N N     . LEU D 2 262 ? 3.909   61.765  46.236  1.00 58.57  ? 262 LEU B N     1 
ATOM   5038 C CA    . LEU D 2 262 ? 5.121   62.507  46.554  1.00 58.05  ? 262 LEU B CA    1 
ATOM   5039 C C     . LEU D 2 262 ? 4.784   63.954  46.855  1.00 57.65  ? 262 LEU B C     1 
ATOM   5040 O O     . LEU D 2 262 ? 3.802   64.478  46.343  1.00 57.98  ? 262 LEU B O     1 
ATOM   5041 C CB    . LEU D 2 262 ? 6.101   62.420  45.387  1.00 57.99  ? 262 LEU B CB    1 
ATOM   5042 C CG    . LEU D 2 262 ? 6.540   61.000  45.035  1.00 57.69  ? 262 LEU B CG    1 
ATOM   5043 C CD1   . LEU D 2 262 ? 7.616   61.045  43.961  1.00 57.61  ? 262 LEU B CD1   1 
ATOM   5044 C CD2   . LEU D 2 262 ? 7.074   60.325  46.280  1.00 57.06  ? 262 LEU B CD2   1 
ATOM   5045 N N     . ARG D 2 263 ? 5.601   64.589  47.688  1.00 57.33  ? 263 ARG B N     1 
ATOM   5046 C CA    . ARG D 2 263 ? 5.401   65.981  48.073  1.00 57.16  ? 263 ARG B CA    1 
ATOM   5047 C C     . ARG D 2 263 ? 6.237   66.953  47.247  1.00 56.83  ? 263 ARG B C     1 
ATOM   5048 O O     . ARG D 2 263 ? 7.473   66.911  47.290  1.00 56.43  ? 263 ARG B O     1 
ATOM   5049 C CB    . ARG D 2 263 ? 5.769   66.178  49.541  1.00 58.57  ? 263 ARG B CB    1 
ATOM   5050 C CG    . ARG D 2 263 ? 5.164   65.161  50.471  1.00 60.35  ? 263 ARG B CG    1 
ATOM   5051 C CD    . ARG D 2 263 ? 5.339   65.579  51.917  1.00 62.44  ? 263 ARG B CD    1 
ATOM   5052 N NE    . ARG D 2 263 ? 6.735   65.622  52.350  1.00 64.31  ? 263 ARG B NE    1 
ATOM   5053 C CZ    . ARG D 2 263 ? 7.575   64.595  52.269  1.00 65.35  ? 263 ARG B CZ    1 
ATOM   5054 N NH1   . ARG D 2 263 ? 7.163   63.444  51.758  1.00 66.18  ? 263 ARG B NH1   1 
ATOM   5055 N NH2   . ARG D 2 263 ? 8.815   64.704  52.733  1.00 65.49  ? 263 ARG B NH2   1 
ATOM   5056 N N     . VAL D 2 264 ? 5.573   67.834  46.503  1.00 56.08  ? 264 VAL B N     1 
ATOM   5057 C CA    . VAL D 2 264 ? 6.302   68.815  45.721  1.00 55.08  ? 264 VAL B CA    1 
ATOM   5058 C C     . VAL D 2 264 ? 7.144   69.606  46.709  1.00 55.51  ? 264 VAL B C     1 
ATOM   5059 O O     . VAL D 2 264 ? 6.653   70.058  47.740  1.00 55.47  ? 264 VAL B O     1 
ATOM   5060 C CB    . VAL D 2 264 ? 5.371   69.767  44.982  1.00 54.17  ? 264 VAL B CB    1 
ATOM   5061 C CG1   . VAL D 2 264 ? 6.178   70.900  44.375  1.00 53.57  ? 264 VAL B CG1   1 
ATOM   5062 C CG2   . VAL D 2 264 ? 4.623   69.017  43.898  1.00 53.72  ? 264 VAL B CG2   1 
ATOM   5063 N N     . GLY D 2 265 ? 8.424   69.752  46.399  1.00 56.15  ? 265 GLY B N     1 
ATOM   5064 C CA    . GLY D 2 265 ? 9.318   70.466  47.285  1.00 56.49  ? 265 GLY B CA    1 
ATOM   5065 C C     . GLY D 2 265 ? 10.128  69.471  48.095  1.00 57.17  ? 265 GLY B C     1 
ATOM   5066 O O     . GLY D 2 265 ? 11.289  69.200  47.786  1.00 57.49  ? 265 GLY B O     1 
ATOM   5067 N N     . ALA D 2 266 ? 9.501   68.905  49.122  1.00 57.12  ? 266 ALA B N     1 
ATOM   5068 C CA    . ALA D 2 266 ? 10.152  67.940  49.996  1.00 56.30  ? 266 ALA B CA    1 
ATOM   5069 C C     . ALA D 2 266 ? 10.656  66.688  49.280  1.00 55.58  ? 266 ALA B C     1 
ATOM   5070 O O     . ALA D 2 266 ? 11.741  66.222  49.569  1.00 55.74  ? 266 ALA B O     1 
ATOM   5071 C CB    . ALA D 2 266 ? 9.204   67.551  51.125  1.00 56.84  ? 266 ALA B CB    1 
ATOM   5072 N N     . ASP D 2 267 ? 9.884   66.130  48.357  1.00 55.01  ? 267 ASP B N     1 
ATOM   5073 C CA    . ASP D 2 267 ? 10.346  64.934  47.659  1.00 54.69  ? 267 ASP B CA    1 
ATOM   5074 C C     . ASP D 2 267 ? 10.902  65.281  46.282  1.00 54.01  ? 267 ASP B C     1 
ATOM   5075 O O     . ASP D 2 267 ? 12.010  64.871  45.925  1.00 53.85  ? 267 ASP B O     1 
ATOM   5076 C CB    . ASP D 2 267 ? 9.221   63.908  47.528  1.00 55.93  ? 267 ASP B CB    1 
ATOM   5077 C CG    . ASP D 2 267 ? 8.598   63.551  48.870  1.00 58.12  ? 267 ASP B CG    1 
ATOM   5078 O OD1   . ASP D 2 267 ? 9.333   63.517  49.889  1.00 59.07  ? 267 ASP B OD1   1 
ATOM   5079 O OD2   . ASP D 2 267 ? 7.373   63.293  48.906  1.00 58.60  ? 267 ASP B OD2   1 
ATOM   5080 N N     . ILE D 2 268 ? 10.132  66.035  45.504  1.00 52.45  ? 268 ILE B N     1 
ATOM   5081 C CA    . ILE D 2 268 ? 10.588  66.452  44.190  1.00 50.41  ? 268 ILE B CA    1 
ATOM   5082 C C     . ILE D 2 268 ? 10.420  67.958  44.042  1.00 49.37  ? 268 ILE B C     1 
ATOM   5083 O O     . ILE D 2 268 ? 9.302   68.448  43.932  1.00 50.28  ? 268 ILE B O     1 
ATOM   5084 C CB    . ILE D 2 268 ? 9.797   65.781  43.067  1.00 49.86  ? 268 ILE B CB    1 
ATOM   5085 C CG1   . ILE D 2 268 ? 9.909   64.268  43.174  1.00 48.92  ? 268 ILE B CG1   1 
ATOM   5086 C CG2   . ILE D 2 268 ? 10.330  66.246  41.729  1.00 49.74  ? 268 ILE B CG2   1 
ATOM   5087 C CD1   . ILE D 2 268 ? 9.234   63.552  42.037  1.00 48.73  ? 268 ILE B CD1   1 
ATOM   5088 N N     . SER D 2 269 ? 11.525  68.692  44.053  1.00 47.35  ? 269 SER B N     1 
ATOM   5089 C CA    . SER D 2 269 ? 11.476  70.135  43.887  1.00 45.39  ? 269 SER B CA    1 
ATOM   5090 C C     . SER D 2 269 ? 11.108  70.463  42.449  1.00 44.54  ? 269 SER B C     1 
ATOM   5091 O O     . SER D 2 269 ? 11.304  69.650  41.549  1.00 44.12  ? 269 SER B O     1 
ATOM   5092 C CB    . SER D 2 269 ? 12.824  70.762  44.212  1.00 44.60  ? 269 SER B CB    1 
ATOM   5093 O OG    . SER D 2 269 ? 13.085  70.725  45.598  1.00 45.13  ? 269 SER B OG    1 
ATOM   5094 N N     . VAL D 2 270 ? 10.559  71.650  42.229  1.00 43.61  ? 270 VAL B N     1 
ATOM   5095 C CA    . VAL D 2 270 ? 10.178  72.052  40.880  1.00 42.53  ? 270 VAL B CA    1 
ATOM   5096 C C     . VAL D 2 270 ? 10.473  73.521  40.648  1.00 41.96  ? 270 VAL B C     1 
ATOM   5097 O O     . VAL D 2 270 ? 10.327  74.344  41.550  1.00 41.55  ? 270 VAL B O     1 
ATOM   5098 C CB    . VAL D 2 270 ? 8.681   71.824  40.617  1.00 42.23  ? 270 VAL B CB    1 
ATOM   5099 C CG1   . VAL D 2 270 ? 8.334   72.302  39.222  1.00 41.73  ? 270 VAL B CG1   1 
ATOM   5100 C CG2   . VAL D 2 270 ? 8.334   70.351  40.781  1.00 42.16  ? 270 VAL B CG2   1 
ATOM   5101 N N     . VAL D 2 271 ? 10.914  73.840  39.438  1.00 41.61  ? 271 VAL B N     1 
ATOM   5102 C CA    . VAL D 2 271 ? 11.208  75.217  39.076  1.00 40.95  ? 271 VAL B CA    1 
ATOM   5103 C C     . VAL D 2 271 ? 10.500  75.468  37.762  1.00 41.22  ? 271 VAL B C     1 
ATOM   5104 O O     . VAL D 2 271 ? 10.574  74.648  36.853  1.00 41.95  ? 271 VAL B O     1 
ATOM   5105 C CB    . VAL D 2 271 ? 12.715  75.457  38.909  1.00 40.27  ? 271 VAL B CB    1 
ATOM   5106 C CG1   . VAL D 2 271 ? 12.969  76.900  38.520  1.00 40.90  ? 271 VAL B CG1   1 
ATOM   5107 C CG2   . VAL D 2 271 ? 13.429  75.158  40.200  1.00 39.39  ? 271 VAL B CG2   1 
ATOM   5108 N N     . GLY D 2 272 ? 9.791   76.586  37.672  1.00 41.48  ? 272 GLY B N     1 
ATOM   5109 C CA    . GLY D 2 272 ? 9.074   76.895  36.450  1.00 42.06  ? 272 GLY B CA    1 
ATOM   5110 C C     . GLY D 2 272 ? 9.723   78.028  35.689  1.00 42.96  ? 272 GLY B C     1 
ATOM   5111 O O     . GLY D 2 272 ? 10.845  78.438  35.994  1.00 42.44  ? 272 GLY B O     1 
ATOM   5112 N N     . TYR D 2 273 ? 9.004   78.561  34.712  1.00 44.20  ? 273 TYR B N     1 
ATOM   5113 C CA    . TYR D 2 273 ? 9.539   79.645  33.897  1.00 45.09  ? 273 TYR B CA    1 
ATOM   5114 C C     . TYR D 2 273 ? 8.391   80.577  33.466  1.00 45.21  ? 273 TYR B C     1 
ATOM   5115 O O     . TYR D 2 273 ? 7.362   80.091  32.979  1.00 44.48  ? 273 TYR B O     1 
ATOM   5116 C CB    . TYR D 2 273 ? 10.240  79.020  32.679  1.00 45.44  ? 273 TYR B CB    1 
ATOM   5117 C CG    . TYR D 2 273 ? 11.502  79.718  32.241  1.00 45.97  ? 273 TYR B CG    1 
ATOM   5118 C CD1   . TYR D 2 273 ? 11.448  80.876  31.466  1.00 46.22  ? 273 TYR B CD1   1 
ATOM   5119 C CD2   . TYR D 2 273 ? 12.757  79.233  32.620  1.00 46.05  ? 273 TYR B CD2   1 
ATOM   5120 C CE1   . TYR D 2 273 ? 12.608  81.535  31.082  1.00 46.72  ? 273 TYR B CE1   1 
ATOM   5121 C CE2   . TYR D 2 273 ? 13.930  79.893  32.242  1.00 46.28  ? 273 TYR B CE2   1 
ATOM   5122 C CZ    . TYR D 2 273 ? 13.844  81.042  31.474  1.00 46.41  ? 273 TYR B CZ    1 
ATOM   5123 O OH    . TYR D 2 273 ? 14.974  81.729  31.105  1.00 46.50  ? 273 TYR B OH    1 
ATOM   5124 N N     . ASP D 2 274 ? 8.586   81.891  33.667  1.00 45.49  ? 274 ASP B N     1 
ATOM   5125 C CA    . ASP D 2 274 ? 7.628   82.970  33.322  1.00 46.15  ? 274 ASP B CA    1 
ATOM   5126 C C     . ASP D 2 274 ? 7.317   83.881  34.491  1.00 46.20  ? 274 ASP B C     1 
ATOM   5127 O O     . ASP D 2 274 ? 7.398   85.101  34.391  1.00 46.42  ? 274 ASP B O     1 
ATOM   5128 C CB    . ASP D 2 274 ? 6.252   82.455  32.881  1.00 46.99  ? 274 ASP B CB    1 
ATOM   5129 C CG    . ASP D 2 274 ? 6.215   81.957  31.448  1.00 48.29  ? 274 ASP B CG    1 
ATOM   5130 O OD1   . ASP D 2 274 ? 7.165   82.243  30.669  1.00 48.31  ? 274 ASP B OD1   1 
ATOM   5131 O OD2   . ASP D 2 274 ? 5.202   81.281  31.119  1.00 47.38  ? 274 ASP B OD2   1 
ATOM   5132 N N     . ASP D 2 275 ? 6.944   83.247  35.597  1.00 46.23  ? 275 ASP B N     1 
ATOM   5133 C CA    . ASP D 2 275 ? 6.492   83.903  36.815  1.00 45.63  ? 275 ASP B CA    1 
ATOM   5134 C C     . ASP D 2 275 ? 5.135   84.519  36.490  1.00 45.10  ? 275 ASP B C     1 
ATOM   5135 O O     . ASP D 2 275 ? 4.936   85.703  36.701  1.00 44.04  ? 275 ASP B O     1 
ATOM   5136 C CB    . ASP D 2 275 ? 7.422   85.008  37.321  1.00 45.27  ? 275 ASP B CB    1 
ATOM   5137 C CG    . ASP D 2 275 ? 6.863   85.676  38.605  1.00 46.51  ? 275 ASP B CG    1 
ATOM   5138 O OD1   . ASP D 2 275 ? 6.026   85.028  39.281  1.00 45.40  ? 275 ASP B OD1   1 
ATOM   5139 O OD2   . ASP D 2 275 ? 7.241   86.822  38.955  1.00 46.61  ? 275 ASP B OD2   1 
ATOM   5140 N N     . THR D 2 276 ? 4.220   83.718  35.949  1.00 44.90  ? 276 THR B N     1 
ATOM   5141 C CA    . THR D 2 276 ? 2.888   84.199  35.617  1.00 45.87  ? 276 THR B CA    1 
ATOM   5142 C C     . THR D 2 276 ? 2.187   84.595  36.901  1.00 47.07  ? 276 THR B C     1 
ATOM   5143 O O     . THR D 2 276 ? 2.606   84.190  37.984  1.00 47.49  ? 276 THR B O     1 
ATOM   5144 C CB    . THR D 2 276 ? 2.018   83.119  34.970  1.00 45.56  ? 276 THR B CB    1 
ATOM   5145 O OG1   . THR D 2 276 ? 1.870   82.030  35.889  1.00 46.40  ? 276 THR B OG1   1 
ATOM   5146 C CG2   . THR D 2 276 ? 2.627   82.632  33.678  1.00 44.65  ? 276 THR B CG2   1 
ATOM   5147 N N     . GLU D 2 277 ? 1.119   85.382  36.776  1.00 48.46  ? 277 GLU B N     1 
ATOM   5148 C CA    . GLU D 2 277 ? 0.335   85.835  37.928  1.00 49.21  ? 277 GLU B CA    1 
ATOM   5149 C C     . GLU D 2 277 ? -0.148  84.676  38.786  1.00 48.05  ? 277 GLU B C     1 
ATOM   5150 O O     . GLU D 2 277 ? 0.004   84.704  40.005  1.00 47.72  ? 277 GLU B O     1 
ATOM   5151 C CB    . GLU D 2 277 ? -0.856  86.656  37.452  1.00 51.47  ? 277 GLU B CB    1 
ATOM   5152 C CG    . GLU D 2 277 ? -0.490  88.064  37.050  1.00 55.81  ? 277 GLU B CG    1 
ATOM   5153 C CD    . GLU D 2 277 ? -0.250  88.957  38.252  1.00 59.58  ? 277 GLU B CD    1 
ATOM   5154 O OE1   . GLU D 2 277 ? -1.255  89.318  38.922  1.00 62.69  ? 277 GLU B OE1   1 
ATOM   5155 O OE2   . GLU D 2 277 ? 0.931   89.297  38.538  1.00 60.33  ? 277 GLU B OE2   1 
ATOM   5156 N N     . ASP D 2 278 ? -0.711  83.655  38.149  1.00 47.25  ? 278 ASP B N     1 
ATOM   5157 C CA    . ASP D 2 278 ? -1.204  82.484  38.870  1.00 47.73  ? 278 ASP B CA    1 
ATOM   5158 C C     . ASP D 2 278 ? -0.132  81.694  39.647  1.00 47.73  ? 278 ASP B C     1 
ATOM   5159 O O     . ASP D 2 278 ? -0.426  81.121  40.696  1.00 47.31  ? 278 ASP B O     1 
ATOM   5160 C CB    . ASP D 2 278 ? -1.900  81.509  37.907  1.00 48.15  ? 278 ASP B CB    1 
ATOM   5161 C CG    . ASP D 2 278 ? -3.166  82.089  37.265  1.00 50.04  ? 278 ASP B CG    1 
ATOM   5162 O OD1   . ASP D 2 278 ? -3.562  83.235  37.576  1.00 50.70  ? 278 ASP B OD1   1 
ATOM   5163 O OD2   . ASP D 2 278 ? -3.780  81.385  36.436  1.00 50.84  ? 278 ASP B OD2   1 
ATOM   5164 N N     . SER D 2 279 ? 1.099   81.658  39.138  1.00 47.29  ? 279 SER B N     1 
ATOM   5165 C CA    . SER D 2 279 ? 2.145   80.885  39.786  1.00 47.17  ? 279 SER B CA    1 
ATOM   5166 C C     . SER D 2 279 ? 2.318   81.158  41.273  1.00 46.56  ? 279 SER B C     1 
ATOM   5167 O O     . SER D 2 279 ? 2.716   80.269  42.021  1.00 46.24  ? 279 SER B O     1 
ATOM   5168 C CB    . SER D 2 279 ? 3.490   81.040  39.047  1.00 47.29  ? 279 SER B CB    1 
ATOM   5169 O OG    . SER D 2 279 ? 4.030   82.336  39.153  1.00 47.79  ? 279 SER B OG    1 
ATOM   5170 N N     . SER D 2 280 ? 1.996   82.363  41.718  1.00 46.08  ? 280 SER B N     1 
ATOM   5171 C CA    . SER D 2 280 ? 2.139   82.671  43.141  1.00 46.39  ? 280 SER B CA    1 
ATOM   5172 C C     . SER D 2 280 ? 1.060   81.991  43.996  1.00 45.57  ? 280 SER B C     1 
ATOM   5173 O O     . SER D 2 280 ? 1.124   82.036  45.221  1.00 44.53  ? 280 SER B O     1 
ATOM   5174 C CB    . SER D 2 280 ? 2.066   84.174  43.374  1.00 46.66  ? 280 SER B CB    1 
ATOM   5175 O OG    . SER D 2 280 ? 0.738   84.626  43.135  1.00 49.61  ? 280 SER B OG    1 
ATOM   5176 N N     . CYS D 2 281 ? 0.074   81.375  43.353  1.00 45.44  ? 281 CYS B N     1 
ATOM   5177 C CA    . CYS D 2 281 ? -0.994  80.703  44.080  1.00 46.55  ? 281 CYS B CA    1 
ATOM   5178 C C     . CYS D 2 281 ? -1.151  79.218  43.781  1.00 47.39  ? 281 CYS B C     1 
ATOM   5179 O O     . CYS D 2 281 ? -2.231  78.655  43.994  1.00 48.20  ? 281 CYS B O     1 
ATOM   5180 C CB    . CYS D 2 281 ? -2.339  81.405  43.845  1.00 47.03  ? 281 CYS B CB    1 
ATOM   5181 S SG    . CYS D 2 281 ? -2.467  83.056  44.607  1.00 49.61  ? 281 CYS B SG    1 
ATOM   5182 N N     . TYR D 2 282 ? -0.094  78.580  43.277  1.00 47.68  ? 282 TYR B N     1 
ATOM   5183 C CA    . TYR D 2 282 ? -0.139  77.147  43.017  1.00 47.42  ? 282 TYR B CA    1 
ATOM   5184 C C     . TYR D 2 282 ? 0.023   76.474  44.386  1.00 47.32  ? 282 TYR B C     1 
ATOM   5185 O O     . TYR D 2 282 ? 0.411   77.130  45.365  1.00 46.17  ? 282 TYR B O     1 
ATOM   5186 C CB    . TYR D 2 282 ? 1.013   76.721  42.112  1.00 48.92  ? 282 TYR B CB    1 
ATOM   5187 C CG    . TYR D 2 282 ? 0.873   77.090  40.649  1.00 50.11  ? 282 TYR B CG    1 
ATOM   5188 C CD1   . TYR D 2 282 ? -0.300  77.676  40.156  1.00 50.67  ? 282 TYR B CD1   1 
ATOM   5189 C CD2   . TYR D 2 282 ? 1.900   76.792  39.739  1.00 50.10  ? 282 TYR B CD2   1 
ATOM   5190 C CE1   . TYR D 2 282 ? -0.454  77.949  38.789  1.00 50.63  ? 282 TYR B CE1   1 
ATOM   5191 C CE2   . TYR D 2 282 ? 1.757   77.058  38.372  1.00 50.44  ? 282 TYR B CE2   1 
ATOM   5192 C CZ    . TYR D 2 282 ? 0.577   77.629  37.906  1.00 50.96  ? 282 TYR B CZ    1 
ATOM   5193 O OH    . TYR D 2 282 ? 0.400   77.826  36.562  1.00 50.84  ? 282 TYR B OH    1 
ATOM   5194 N N     . ILE D 2 283 ? -0.277  75.176  44.456  1.00 47.12  ? 283 ILE B N     1 
ATOM   5195 C CA    . ILE D 2 283 ? -0.162  74.435  45.711  1.00 47.68  ? 283 ILE B CA    1 
ATOM   5196 C C     . ILE D 2 283 ? 1.018   73.465  45.648  1.00 46.93  ? 283 ILE B C     1 
ATOM   5197 O O     . ILE D 2 283 ? 0.887   72.362  45.109  1.00 47.44  ? 283 ILE B O     1 
ATOM   5198 C CB    . ILE D 2 283 ? -1.410  73.558  46.016  1.00 48.48  ? 283 ILE B CB    1 
ATOM   5199 C CG1   . ILE D 2 283 ? -2.707  74.269  45.624  1.00 49.49  ? 283 ILE B CG1   1 
ATOM   5200 C CG2   . ILE D 2 283 ? -1.436  73.226  47.501  1.00 48.14  ? 283 ILE B CG2   1 
ATOM   5201 C CD1   . ILE D 2 283 ? -3.044  75.438  46.503  1.00 50.70  ? 283 ILE B CD1   1 
ATOM   5202 N N     . PRO D 2 284 ? 2.180   73.847  46.194  1.00 45.88  ? 284 PRO B N     1 
ATOM   5203 C CA    . PRO D 2 284 ? 2.523   75.102  46.869  1.00 45.47  ? 284 PRO B CA    1 
ATOM   5204 C C     . PRO D 2 284 ? 3.043   76.141  45.880  1.00 45.41  ? 284 PRO B C     1 
ATOM   5205 O O     . PRO D 2 284 ? 3.377   75.809  44.731  1.00 45.15  ? 284 PRO B O     1 
ATOM   5206 C CB    . PRO D 2 284 ? 3.606   74.674  47.844  1.00 44.83  ? 284 PRO B CB    1 
ATOM   5207 C CG    . PRO D 2 284 ? 4.339   73.644  47.061  1.00 45.47  ? 284 PRO B CG    1 
ATOM   5208 C CD    . PRO D 2 284 ? 3.228   72.834  46.413  1.00 45.39  ? 284 PRO B CD    1 
ATOM   5209 N N     . PRO D 2 285 ? 3.123   77.416  46.313  1.00 45.13  ? 285 PRO B N     1 
ATOM   5210 C CA    . PRO D 2 285 ? 3.611   78.503  45.454  1.00 45.00  ? 285 PRO B CA    1 
ATOM   5211 C C     . PRO D 2 285 ? 4.881   78.084  44.686  1.00 44.22  ? 285 PRO B C     1 
ATOM   5212 O O     . PRO D 2 285 ? 5.854   77.625  45.275  1.00 43.37  ? 285 PRO B O     1 
ATOM   5213 C CB    . PRO D 2 285 ? 3.855   79.633  46.452  1.00 44.55  ? 285 PRO B CB    1 
ATOM   5214 C CG    . PRO D 2 285 ? 2.771   79.425  47.426  1.00 44.01  ? 285 PRO B CG    1 
ATOM   5215 C CD    . PRO D 2 285 ? 2.804   77.931  47.655  1.00 44.62  ? 285 PRO B CD    1 
ATOM   5216 N N     . LEU D 2 286 ? 4.834   78.263  43.369  1.00 43.37  ? 286 LEU B N     1 
ATOM   5217 C CA    . LEU D 2 286 ? 5.895   77.898  42.447  1.00 42.04  ? 286 LEU B CA    1 
ATOM   5218 C C     . LEU D 2 286 ? 7.118   78.799  42.342  1.00 42.38  ? 286 LEU B C     1 
ATOM   5219 O O     . LEU D 2 286 ? 7.005   79.985  42.036  1.00 41.91  ? 286 LEU B O     1 
ATOM   5220 C CB    . LEU D 2 286 ? 5.296   77.755  41.056  1.00 41.51  ? 286 LEU B CB    1 
ATOM   5221 C CG    . LEU D 2 286 ? 6.273   77.425  39.930  1.00 41.93  ? 286 LEU B CG    1 
ATOM   5222 C CD1   . LEU D 2 286 ? 6.978   76.090  40.252  1.00 41.01  ? 286 LEU B CD1   1 
ATOM   5223 C CD2   . LEU D 2 286 ? 5.517   77.344  38.597  1.00 40.60  ? 286 LEU B CD2   1 
ATOM   5224 N N     . THR D 2 287 ? 8.292   78.221  42.590  1.00 42.27  ? 287 THR B N     1 
ATOM   5225 C CA    . THR D 2 287 ? 9.553   78.937  42.443  1.00 41.76  ? 287 THR B CA    1 
ATOM   5226 C C     . THR D 2 287 ? 9.701   79.019  40.924  1.00 41.53  ? 287 THR B C     1 
ATOM   5227 O O     . THR D 2 287 ? 9.491   78.029  40.217  1.00 41.15  ? 287 THR B O     1 
ATOM   5228 C CB    . THR D 2 287 ? 10.697  78.140  43.056  1.00 42.38  ? 287 THR B CB    1 
ATOM   5229 O OG1   . THR D 2 287 ? 10.521  78.112  44.478  1.00 42.08  ? 287 THR B OG1   1 
ATOM   5230 C CG2   . THR D 2 287 ? 12.042  78.763  42.715  1.00 41.88  ? 287 THR B CG2   1 
ATOM   5231 N N     . THR D 2 288 ? 10.052  80.187  40.411  1.00 40.97  ? 288 THR B N     1 
ATOM   5232 C CA    . THR D 2 288 ? 10.107  80.333  38.968  1.00 41.14  ? 288 THR B CA    1 
ATOM   5233 C C     . THR D 2 288 ? 11.070  81.426  38.490  1.00 41.59  ? 288 THR B C     1 
ATOM   5234 O O     . THR D 2 288 ? 11.693  82.135  39.290  1.00 42.48  ? 288 THR B O     1 
ATOM   5235 C CB    . THR D 2 288 ? 8.670   80.626  38.459  1.00 41.00  ? 288 THR B CB    1 
ATOM   5236 O OG1   . THR D 2 288 ? 8.638   80.654  37.032  1.00 41.02  ? 288 THR B OG1   1 
ATOM   5237 C CG2   . THR D 2 288 ? 8.187   81.967  39.001  1.00 40.47  ? 288 THR B CG2   1 
ATOM   5238 N N     . ILE D 2 289 ? 11.202  81.545  37.178  1.00 40.86  ? 289 ILE B N     1 
ATOM   5239 C CA    . ILE D 2 289 ? 12.068  82.552  36.602  1.00 41.53  ? 289 ILE B CA    1 
ATOM   5240 C C     . ILE D 2 289 ? 11.148  83.621  36.049  1.00 42.20  ? 289 ILE B C     1 
ATOM   5241 O O     . ILE D 2 289 ? 10.288  83.346  35.213  1.00 42.04  ? 289 ILE B O     1 
ATOM   5242 C CB    . ILE D 2 289 ? 12.928  81.986  35.437  1.00 40.69  ? 289 ILE B CB    1 
ATOM   5243 C CG1   . ILE D 2 289 ? 13.754  80.785  35.918  1.00 39.74  ? 289 ILE B CG1   1 
ATOM   5244 C CG2   . ILE D 2 289 ? 13.799  83.091  34.867  1.00 39.14  ? 289 ILE B CG2   1 
ATOM   5245 C CD1   . ILE D 2 289 ? 14.733  81.098  37.041  1.00 38.93  ? 289 ILE B CD1   1 
ATOM   5246 N N     . LYS D 2 290 ? 11.339  84.844  36.515  1.00 43.30  ? 290 LYS B N     1 
ATOM   5247 C CA    . LYS D 2 290 ? 10.509  85.954  36.086  1.00 44.63  ? 290 LYS B CA    1 
ATOM   5248 C C     . LYS D 2 290 ? 10.877  86.572  34.740  1.00 44.90  ? 290 LYS B C     1 
ATOM   5249 O O     . LYS D 2 290 ? 12.000  87.019  34.529  1.00 44.22  ? 290 LYS B O     1 
ATOM   5250 C CB    . LYS D 2 290 ? 10.525  87.044  37.162  1.00 45.25  ? 290 LYS B CB    1 
ATOM   5251 C CG    . LYS D 2 290 ? 9.699   88.248  36.833  1.00 46.22  ? 290 LYS B CG    1 
ATOM   5252 C CD    . LYS D 2 290 ? 9.847   89.286  37.903  1.00 48.20  ? 290 LYS B CD    1 
ATOM   5253 C CE    . LYS D 2 290 ? 9.021   90.507  37.575  1.00 50.20  ? 290 LYS B CE    1 
ATOM   5254 N NZ    . LYS D 2 290 ? 9.314   91.598  38.545  1.00 51.86  ? 290 LYS B NZ    1 
ATOM   5255 N N     . GLN D 2 291 ? 9.902   86.584  33.835  1.00 45.98  ? 291 GLN B N     1 
ATOM   5256 C CA    . GLN D 2 291 ? 10.051  87.202  32.524  1.00 47.31  ? 291 GLN B CA    1 
ATOM   5257 C C     . GLN D 2 291 ? 9.035   88.330  32.454  1.00 46.96  ? 291 GLN B C     1 
ATOM   5258 O O     . GLN D 2 291 ? 7.843   88.087  32.286  1.00 47.03  ? 291 GLN B O     1 
ATOM   5259 C CB    . GLN D 2 291 ? 9.768   86.207  31.415  1.00 48.18  ? 291 GLN B CB    1 
ATOM   5260 C CG    . GLN D 2 291 ? 10.775  85.098  31.336  1.00 50.29  ? 291 GLN B CG    1 
ATOM   5261 C CD    . GLN D 2 291 ? 10.654  84.367  30.040  1.00 51.65  ? 291 GLN B CD    1 
ATOM   5262 O OE1   . GLN D 2 291 ? 11.539  84.442  29.191  1.00 53.46  ? 291 GLN B OE1   1 
ATOM   5263 N NE2   . GLN D 2 291 ? 9.536   83.671  29.856  1.00 52.34  ? 291 GLN B NE2   1 
ATOM   5264 N N     . ASP D 2 292 ? 9.515   89.558  32.600  1.00 47.01  ? 292 ASP B N     1 
ATOM   5265 C CA    . ASP D 2 292 ? 8.669   90.741  32.572  1.00 46.98  ? 292 ASP B CA    1 
ATOM   5266 C C     . ASP D 2 292 ? 8.155   91.074  31.176  1.00 46.76  ? 292 ASP B C     1 
ATOM   5267 O O     . ASP D 2 292 ? 8.770   91.855  30.439  1.00 45.26  ? 292 ASP B O     1 
ATOM   5268 C CB    . ASP D 2 292 ? 9.437   91.929  33.138  1.00 47.91  ? 292 ASP B CB    1 
ATOM   5269 C CG    . ASP D 2 292 ? 8.567   93.143  33.336  1.00 49.14  ? 292 ASP B CG    1 
ATOM   5270 O OD1   . ASP D 2 292 ? 9.053   94.098  33.981  1.00 49.40  ? 292 ASP B OD1   1 
ATOM   5271 O OD2   . ASP D 2 292 ? 7.407   93.144  32.846  1.00 49.55  ? 292 ASP B OD2   1 
ATOM   5272 N N     . PHE D 2 293 ? 7.008   90.499  30.831  1.00 46.90  ? 293 PHE B N     1 
ATOM   5273 C CA    . PHE D 2 293 ? 6.424   90.721  29.522  1.00 48.26  ? 293 PHE B CA    1 
ATOM   5274 C C     . PHE D 2 293 ? 6.094   92.184  29.226  1.00 49.44  ? 293 PHE B C     1 
ATOM   5275 O O     . PHE D 2 293 ? 6.194   92.619  28.078  1.00 49.07  ? 293 PHE B O     1 
ATOM   5276 C CB    . PHE D 2 293 ? 5.178   89.866  29.355  1.00 48.64  ? 293 PHE B CB    1 
ATOM   5277 C CG    . PHE D 2 293 ? 5.432   88.399  29.492  1.00 49.12  ? 293 PHE B CG    1 
ATOM   5278 C CD1   . PHE D 2 293 ? 4.820   87.669  30.499  1.00 49.12  ? 293 PHE B CD1   1 
ATOM   5279 C CD2   . PHE D 2 293 ? 6.282   87.744  28.617  1.00 49.43  ? 293 PHE B CD2   1 
ATOM   5280 C CE1   . PHE D 2 293 ? 5.047   86.313  30.636  1.00 49.63  ? 293 PHE B CE1   1 
ATOM   5281 C CE2   . PHE D 2 293 ? 6.513   86.387  28.749  1.00 50.37  ? 293 PHE B CE2   1 
ATOM   5282 C CZ    . PHE D 2 293 ? 5.895   85.672  29.762  1.00 50.29  ? 293 PHE B CZ    1 
ATOM   5283 N N     . ARG D 2 294 ? 5.700   92.948  30.245  1.00 50.57  ? 294 ARG B N     1 
ATOM   5284 C CA    . ARG D 2 294 ? 5.398   94.357  30.020  1.00 51.71  ? 294 ARG B CA    1 
ATOM   5285 C C     . ARG D 2 294 ? 6.654   95.009  29.450  1.00 50.69  ? 294 ARG B C     1 
ATOM   5286 O O     . ARG D 2 294 ? 6.592   95.737  28.459  1.00 49.95  ? 294 ARG B O     1 
ATOM   5287 C CB    . ARG D 2 294 ? 5.020   95.086  31.327  1.00 54.37  ? 294 ARG B CB    1 
ATOM   5288 C CG    . ARG D 2 294 ? 3.701   94.695  31.982  1.00 57.62  ? 294 ARG B CG    1 
ATOM   5289 C CD    . ARG D 2 294 ? 2.476   95.005  31.134  1.00 60.98  ? 294 ARG B CD    1 
ATOM   5290 N NE    . ARG D 2 294 ? 2.230   96.409  30.901  1.00 63.52  ? 294 ARG B NE    1 
ATOM   5291 C CZ    . ARG D 2 294 ? 1.351   96.953  30.056  1.00 64.40  ? 294 ARG B CZ    1 
ATOM   5292 N NH1   . ARG D 2 294 ? 1.305   98.275  30.025  1.00 64.10  ? 294 ARG B NH1   1 
ATOM   5293 N NH2   . ARG D 2 294 ? 0.548   96.235  29.258  1.00 64.22  ? 294 ARG B NH2   1 
ATOM   5294 N N     . LEU D 2 295 ? 7.788   94.740  30.097  1.00 49.88  ? 295 LEU B N     1 
ATOM   5295 C CA    . LEU D 2 295 ? 9.071   95.293  29.684  1.00 49.12  ? 295 LEU B CA    1 
ATOM   5296 C C     . LEU D 2 295 ? 9.418   94.891  28.248  1.00 48.60  ? 295 LEU B C     1 
ATOM   5297 O O     . LEU D 2 295 ? 9.882   95.708  27.463  1.00 48.13  ? 295 LEU B O     1 
ATOM   5298 C CB    . LEU D 2 295 ? 10.164  94.831  30.647  1.00 48.94  ? 295 LEU B CB    1 
ATOM   5299 C CG    . LEU D 2 295 ? 11.579  95.314  30.330  1.00 49.41  ? 295 LEU B CG    1 
ATOM   5300 C CD1   . LEU D 2 295 ? 11.641  96.804  30.459  1.00 48.58  ? 295 LEU B CD1   1 
ATOM   5301 C CD2   . LEU D 2 295 ? 12.568  94.671  31.276  1.00 49.64  ? 295 LEU B CD2   1 
ATOM   5302 N N     . LEU D 2 296 ? 9.180   93.637  27.896  1.00 48.43  ? 296 LEU B N     1 
ATOM   5303 C CA    . LEU D 2 296 ? 9.488   93.195  26.551  1.00 49.04  ? 296 LEU B CA    1 
ATOM   5304 C C     . LEU D 2 296 ? 8.682   93.992  25.520  1.00 49.76  ? 296 LEU B C     1 
ATOM   5305 O O     . LEU D 2 296 ? 9.250   94.504  24.557  1.00 50.02  ? 296 LEU B O     1 
ATOM   5306 C CB    . LEU D 2 296 ? 9.223   91.692  26.398  1.00 47.44  ? 296 LEU B CB    1 
ATOM   5307 C CG    . LEU D 2 296 ? 9.376   91.147  24.975  1.00 46.71  ? 296 LEU B CG    1 
ATOM   5308 C CD1   . LEU D 2 296 ? 10.800  91.375  24.499  1.00 45.53  ? 296 LEU B CD1   1 
ATOM   5309 C CD2   . LEU D 2 296 ? 9.003   89.665  24.931  1.00 45.33  ? 296 LEU B CD2   1 
ATOM   5310 N N     . GLY D 2 297 ? 7.369   94.097  25.722  1.00 50.52  ? 297 GLY B N     1 
ATOM   5311 C CA    . GLY D 2 297 ? 6.520   94.852  24.807  1.00 51.13  ? 297 GLY B CA    1 
ATOM   5312 C C     . GLY D 2 297 ? 6.869   96.339  24.783  1.00 52.07  ? 297 GLY B C     1 
ATOM   5313 O O     . GLY D 2 297 ? 6.926   96.956  23.730  1.00 51.79  ? 297 GLY B O     1 
ATOM   5314 N N     . GLN D 2 298 ? 7.111   96.925  25.949  1.00 53.29  ? 298 GLN B N     1 
ATOM   5315 C CA    . GLN D 2 298 ? 7.470   98.337  26.033  1.00 54.38  ? 298 GLN B CA    1 
ATOM   5316 C C     . GLN D 2 298 ? 8.750   98.599  25.243  1.00 54.65  ? 298 GLN B C     1 
ATOM   5317 O O     . GLN D 2 298 ? 8.818   99.511  24.411  1.00 54.03  ? 298 GLN B O     1 
ATOM   5318 C CB    . GLN D 2 298 ? 7.658   98.737  27.501  1.00 55.47  ? 298 GLN B CB    1 
ATOM   5319 C CG    . GLN D 2 298 ? 8.165   100.152 27.706  1.00 58.52  ? 298 GLN B CG    1 
ATOM   5320 C CD    . GLN D 2 298 ? 9.687   100.231 27.713  1.00 61.12  ? 298 GLN B CD    1 
ATOM   5321 O OE1   . GLN D 2 298 ? 10.338  99.787  28.665  1.00 62.15  ? 298 GLN B OE1   1 
ATOM   5322 N NE2   . GLN D 2 298 ? 10.264  100.786 26.647  1.00 61.82  ? 298 GLN B NE2   1 
ATOM   5323 N N     . THR D 2 299 ? 9.760   97.780  25.511  1.00 55.30  ? 299 THR B N     1 
ATOM   5324 C CA    . THR D 2 299 ? 11.048  97.886  24.844  1.00 55.24  ? 299 THR B CA    1 
ATOM   5325 C C     . THR D 2 299 ? 10.926  97.631  23.349  1.00 55.50  ? 299 THR B C     1 
ATOM   5326 O O     . THR D 2 299 ? 11.544  98.325  22.555  1.00 55.52  ? 299 THR B O     1 
ATOM   5327 C CB    . THR D 2 299 ? 12.046  96.888  25.432  1.00 55.02  ? 299 THR B CB    1 
ATOM   5328 O OG1   . THR D 2 299 ? 12.149  97.102  26.844  1.00 54.72  ? 299 THR B OG1   1 
ATOM   5329 C CG2   . THR D 2 299 ? 13.412  97.077  24.804  1.00 55.90  ? 299 THR B CG2   1 
ATOM   5330 N N     . SER D 2 300 ? 10.134  96.639  22.961  1.00 55.92  ? 300 SER B N     1 
ATOM   5331 C CA    . SER D 2 300 ? 9.964   96.339  21.546  1.00 57.43  ? 300 SER B CA    1 
ATOM   5332 C C     . SER D 2 300 ? 9.485   97.535  20.740  1.00 58.33  ? 300 SER B C     1 
ATOM   5333 O O     . SER D 2 300 ? 9.994   97.803  19.654  1.00 58.66  ? 300 SER B O     1 
ATOM   5334 C CB    . SER D 2 300 ? 8.975   95.201  21.356  1.00 57.77  ? 300 SER B CB    1 
ATOM   5335 O OG    . SER D 2 300 ? 9.471   94.025  21.957  1.00 60.49  ? 300 SER B OG    1 
ATOM   5336 N N     . VAL D 2 301 ? 8.492   98.246  21.262  1.00 59.25  ? 301 VAL B N     1 
ATOM   5337 C CA    . VAL D 2 301 ? 7.959   99.405  20.564  1.00 59.60  ? 301 VAL B CA    1 
ATOM   5338 C C     . VAL D 2 301 ? 9.011   100.503 20.477  1.00 60.03  ? 301 VAL B C     1 
ATOM   5339 O O     . VAL D 2 301 ? 9.308   100.991 19.393  1.00 59.85  ? 301 VAL B O     1 
ATOM   5340 C CB    . VAL D 2 301 ? 6.676   99.924  21.258  1.00 59.54  ? 301 VAL B CB    1 
ATOM   5341 C CG1   . VAL D 2 301 ? 6.271   101.273 20.684  1.00 59.53  ? 301 VAL B CG1   1 
ATOM   5342 C CG2   . VAL D 2 301 ? 5.546   98.919  21.049  1.00 58.91  ? 301 VAL B CG2   1 
ATOM   5343 N N     . ASP D 2 302 ? 9.582   100.880 21.613  1.00 60.83  ? 302 ASP B N     1 
ATOM   5344 C CA    . ASP D 2 302 ? 10.606  101.915 21.636  1.00 62.09  ? 302 ASP B CA    1 
ATOM   5345 C C     . ASP D 2 302 ? 11.702  101.600 20.630  1.00 62.83  ? 302 ASP B C     1 
ATOM   5346 O O     . ASP D 2 302 ? 12.155  102.464 19.882  1.00 63.13  ? 302 ASP B O     1 
ATOM   5347 C CB    . ASP D 2 302 ? 11.204  102.015 23.035  1.00 62.40  ? 302 ASP B CB    1 
ATOM   5348 C CG    . ASP D 2 302 ? 10.229  102.597 24.038  1.00 63.96  ? 302 ASP B CG    1 
ATOM   5349 O OD1   . ASP D 2 302 ? 9.010   102.594 23.757  1.00 64.71  ? 302 ASP B OD1   1 
ATOM   5350 O OD2   . ASP D 2 302 ? 10.678  103.053 25.111  1.00 64.26  ? 302 ASP B OD2   1 
ATOM   5351 N N     . ARG D 2 303 ? 12.110  100.340 20.610  1.00 63.26  ? 303 ARG B N     1 
ATOM   5352 C CA    . ARG D 2 303 ? 13.156  99.874  19.724  1.00 63.40  ? 303 ARG B CA    1 
ATOM   5353 C C     . ARG D 2 303 ? 12.769  99.908  18.248  1.00 63.15  ? 303 ARG B C     1 
ATOM   5354 O O     . ARG D 2 303 ? 13.568  100.310 17.405  1.00 62.39  ? 303 ARG B O     1 
ATOM   5355 C CB    . ARG D 2 303 ? 13.530  98.455  20.112  1.00 64.56  ? 303 ARG B CB    1 
ATOM   5356 C CG    . ARG D 2 303 ? 14.598  97.881  19.276  1.00 65.15  ? 303 ARG B CG    1 
ATOM   5357 C CD    . ARG D 2 303 ? 15.950  98.066  19.911  1.00 65.66  ? 303 ARG B CD    1 
ATOM   5358 N NE    . ARG D 2 303 ? 16.778  97.192  19.136  1.00 67.71  ? 303 ARG B NE    1 
ATOM   5359 C CZ    . ARG D 2 303 ? 17.205  95.967  19.422  1.00 68.19  ? 303 ARG B CZ    1 
ATOM   5360 N NH1   . ARG D 2 303 ? 17.911  95.377  18.477  1.00 67.07  ? 303 ARG B NH1   1 
ATOM   5361 N NH2   . ARG D 2 303 ? 17.028  95.363  20.599  1.00 68.06  ? 303 ARG B NH2   1 
ATOM   5362 N N     . LEU D 2 304 ? 11.557  99.465  17.930  1.00 63.06  ? 304 LEU B N     1 
ATOM   5363 C CA    . LEU D 2 304 ? 11.127  99.473  16.543  1.00 63.58  ? 304 LEU B CA    1 
ATOM   5364 C C     . LEU D 2 304 ? 11.059  100.897 16.028  1.00 64.63  ? 304 LEU B C     1 
ATOM   5365 O O     . LEU D 2 304 ? 11.336  101.147 14.865  1.00 64.88  ? 304 LEU B O     1 
ATOM   5366 C CB    . LEU D 2 304 ? 9.767   98.818  16.374  1.00 62.35  ? 304 LEU B CB    1 
ATOM   5367 C CG    . LEU D 2 304 ? 9.362   98.731  14.905  1.00 61.95  ? 304 LEU B CG    1 
ATOM   5368 C CD1   . LEU D 2 304 ? 10.265  97.754  14.173  1.00 61.83  ? 304 LEU B CD1   1 
ATOM   5369 C CD2   . LEU D 2 304 ? 7.926   98.286  14.800  1.00 61.95  ? 304 LEU B CD2   1 
ATOM   5370 N N     . LEU D 2 305 ? 10.697  101.835 16.894  1.00 65.85  ? 305 LEU B N     1 
ATOM   5371 C CA    . LEU D 2 305 ? 10.618  103.224 16.478  1.00 67.51  ? 305 LEU B CA    1 
ATOM   5372 C C     . LEU D 2 305 ? 12.013  103.786 16.239  1.00 68.44  ? 305 LEU B C     1 
ATOM   5373 O O     . LEU D 2 305 ? 12.233  104.490 15.255  1.00 68.75  ? 305 LEU B O     1 
ATOM   5374 C CB    . LEU D 2 305 ? 9.863   104.061 17.519  1.00 67.41  ? 305 LEU B CB    1 
ATOM   5375 C CG    . LEU D 2 305 ? 8.386   103.677 17.712  1.00 67.80  ? 305 LEU B CG    1 
ATOM   5376 C CD1   . LEU D 2 305 ? 7.781   104.536 18.810  1.00 67.39  ? 305 LEU B CD1   1 
ATOM   5377 C CD2   . LEU D 2 305 ? 7.608   103.839 16.414  1.00 67.09  ? 305 LEU B CD2   1 
ATOM   5378 N N     . GLN D 2 306 ? 12.954  103.475 17.129  1.00 69.71  ? 306 GLN B N     1 
ATOM   5379 C CA    . GLN D 2 306 ? 14.329  103.950 16.973  1.00 71.31  ? 306 GLN B CA    1 
ATOM   5380 C C     . GLN D 2 306 ? 14.862  103.473 15.626  1.00 71.91  ? 306 GLN B C     1 
ATOM   5381 O O     . GLN D 2 306 ? 15.448  104.246 14.872  1.00 71.92  ? 306 GLN B O     1 
ATOM   5382 C CB    . GLN D 2 306 ? 15.229  103.403 18.085  1.00 71.96  ? 306 GLN B CB    1 
ATOM   5383 C CG    . GLN D 2 306 ? 14.889  103.880 19.482  1.00 73.34  ? 306 GLN B CG    1 
ATOM   5384 C CD    . GLN D 2 306 ? 15.548  103.037 20.575  1.00 74.67  ? 306 GLN B CD    1 
ATOM   5385 O OE1   . GLN D 2 306 ? 15.299  103.245 21.769  1.00 74.89  ? 306 GLN B OE1   1 
ATOM   5386 N NE2   . GLN D 2 306 ? 16.389  102.079 20.173  1.00 74.77  ? 306 GLN B NE2   1 
ATOM   5387 N N     . LEU D 2 307 ? 14.652  102.193 15.332  1.00 72.79  ? 307 LEU B N     1 
ATOM   5388 C CA    . LEU D 2 307 ? 15.100  101.613 14.077  1.00 73.91  ? 307 LEU B CA    1 
ATOM   5389 C C     . LEU D 2 307 ? 14.474  102.355 12.918  1.00 74.93  ? 307 LEU B C     1 
ATOM   5390 O O     . LEU D 2 307 ? 15.151  102.685 11.952  1.00 75.04  ? 307 LEU B O     1 
ATOM   5391 C CB    . LEU D 2 307 ? 14.709  100.139 13.993  1.00 73.41  ? 307 LEU B CB    1 
ATOM   5392 C CG    . LEU D 2 307 ? 15.479  99.189  14.905  1.00 73.44  ? 307 LEU B CG    1 
ATOM   5393 C CD1   . LEU D 2 307 ? 14.865  97.806  14.830  1.00 73.17  ? 307 LEU B CD1   1 
ATOM   5394 C CD2   . LEU D 2 307 ? 16.937  99.164  14.498  1.00 73.10  ? 307 LEU B CD2   1 
ATOM   5395 N N     . SER D 2 308 ? 13.176  102.616 13.024  1.00 76.25  ? 308 SER B N     1 
ATOM   5396 C CA    . SER D 2 308 ? 12.439  103.316 11.984  1.00 77.26  ? 308 SER B CA    1 
ATOM   5397 C C     . SER D 2 308 ? 13.095  104.662 11.707  1.00 77.84  ? 308 SER B C     1 
ATOM   5398 O O     . SER D 2 308 ? 13.035  105.174 10.594  1.00 77.66  ? 308 SER B O     1 
ATOM   5399 C CB    . SER D 2 308 ? 10.991  103.515 12.419  1.00 77.51  ? 308 SER B CB    1 
ATOM   5400 O OG    . SER D 2 308 ? 10.138  103.577 11.292  1.00 78.78  ? 308 SER B OG    1 
ATOM   5401 N N     . GLN D 2 309 ? 13.728  105.223 12.727  1.00 78.79  ? 309 GLN B N     1 
ATOM   5402 C CA    . GLN D 2 309 ? 14.414  106.501 12.607  1.00 80.08  ? 309 GLN B CA    1 
ATOM   5403 C C     . GLN D 2 309 ? 15.896  106.322 12.311  1.00 80.43  ? 309 GLN B C     1 
ATOM   5404 O O     . GLN D 2 309 ? 16.708  107.176 12.668  1.00 80.57  ? 309 GLN B O     1 
ATOM   5405 C CB    . GLN D 2 309 ? 14.275  107.293 13.897  1.00 81.07  ? 309 GLN B CB    1 
ATOM   5406 C CG    . GLN D 2 309 ? 12.921  107.919 14.101  1.00 83.02  ? 309 GLN B CG    1 
ATOM   5407 C CD    . GLN D 2 309 ? 12.802  108.548 15.472  1.00 84.58  ? 309 GLN B CD    1 
ATOM   5408 O OE1   . GLN D 2 309 ? 13.814  108.889 16.096  1.00 85.30  ? 309 GLN B OE1   1 
ATOM   5409 N NE2   . GLN D 2 309 ? 11.567  108.715 15.950  1.00 85.16  ? 309 GLN B NE2   1 
ATOM   5410 N N     . GLY D 2 310 ? 16.247  105.208 11.677  1.00 80.66  ? 310 GLY B N     1 
ATOM   5411 C CA    . GLY D 2 310 ? 17.637  104.944 11.345  1.00 80.76  ? 310 GLY B CA    1 
ATOM   5412 C C     . GLY D 2 310 ? 18.623  105.093 12.491  1.00 80.92  ? 310 GLY B C     1 
ATOM   5413 O O     . GLY D 2 310 ? 19.801  105.352 12.270  1.00 81.22  ? 310 GLY B O     1 
ATOM   5414 N N     . GLN D 2 311 ? 18.151  104.937 13.721  1.00 81.15  ? 311 GLN B N     1 
ATOM   5415 C CA    . GLN D 2 311 ? 19.023  105.043 14.886  1.00 81.26  ? 311 GLN B CA    1 
ATOM   5416 C C     . GLN D 2 311 ? 19.915  103.793 14.902  1.00 80.70  ? 311 GLN B C     1 
ATOM   5417 O O     . GLN D 2 311 ? 19.441  102.684 14.639  1.00 80.98  ? 311 GLN B O     1 
ATOM   5418 C CB    . GLN D 2 311 ? 18.172  105.113 16.154  1.00 82.23  ? 311 GLN B CB    1 
ATOM   5419 C CG    . GLN D 2 311 ? 18.848  105.745 17.353  1.00 83.99  ? 311 GLN B CG    1 
ATOM   5420 C CD    . GLN D 2 311 ? 17.862  106.020 18.490  1.00 85.40  ? 311 GLN B CD    1 
ATOM   5421 O OE1   . GLN D 2 311 ? 16.823  106.658 18.288  1.00 85.11  ? 311 GLN B OE1   1 
ATOM   5422 N NE2   . GLN D 2 311 ? 18.187  105.539 19.692  1.00 86.40  ? 311 GLN B NE2   1 
ATOM   5423 N N     . ALA D 2 312 ? 21.204  103.969 15.194  1.00 79.51  ? 312 ALA B N     1 
ATOM   5424 C CA    . ALA D 2 312 ? 22.147  102.844 15.218  1.00 77.85  ? 312 ALA B CA    1 
ATOM   5425 C C     . ALA D 2 312 ? 21.983  101.950 16.444  1.00 76.60  ? 312 ALA B C     1 
ATOM   5426 O O     . ALA D 2 312 ? 22.754  102.052 17.405  1.00 76.77  ? 312 ALA B O     1 
ATOM   5427 C CB    . ALA D 2 312 ? 23.584  103.359 15.149  1.00 78.02  ? 312 ALA B CB    1 
ATOM   5428 N N     . VAL D 2 313 ? 20.985  101.068 16.394  1.00 74.53  ? 313 VAL B N     1 
ATOM   5429 C CA    . VAL D 2 313 ? 20.694  100.138 17.486  1.00 72.27  ? 313 VAL B CA    1 
ATOM   5430 C C     . VAL D 2 313 ? 20.379  98.743  16.951  1.00 70.23  ? 313 VAL B C     1 
ATOM   5431 O O     . VAL D 2 313 ? 19.561  98.026  17.512  1.00 69.56  ? 313 VAL B O     1 
ATOM   5432 C CB    . VAL D 2 313 ? 19.494  100.625 18.296  1.00 72.61  ? 313 VAL B CB    1 
ATOM   5433 C CG1   . VAL D 2 313 ? 19.870  101.871 19.063  1.00 72.88  ? 313 VAL B CG1   1 
ATOM   5434 C CG2   . VAL D 2 313 ? 18.325  100.929 17.358  1.00 72.63  ? 313 VAL B CG2   1 
ATOM   5435 N N     . LYS D 2 314 ? 21.041  98.380  15.857  1.00 68.45  ? 314 LYS B N     1 
ATOM   5436 C CA    . LYS D 2 314 ? 20.857  97.090  15.197  1.00 66.16  ? 314 LYS B CA    1 
ATOM   5437 C C     . LYS D 2 314 ? 21.403  95.938  16.034  1.00 63.91  ? 314 LYS B C     1 
ATOM   5438 O O     . LYS D 2 314 ? 22.225  96.144  16.926  1.00 63.31  ? 314 LYS B O     1 
ATOM   5439 C CB    . LYS D 2 314 ? 21.562  97.103  13.830  1.00 66.95  ? 314 LYS B CB    1 
ATOM   5440 C CG    . LYS D 2 314 ? 20.902  97.976  12.743  1.00 68.02  ? 314 LYS B CG    1 
ATOM   5441 C CD    . LYS D 2 314 ? 19.612  97.332  12.225  1.00 69.15  ? 314 LYS B CD    1 
ATOM   5442 C CE    . LYS D 2 314 ? 19.044  98.048  10.994  1.00 70.11  ? 314 LYS B CE    1 
ATOM   5443 N NZ    . LYS D 2 314 ? 17.676  97.546  10.586  1.00 69.38  ? 314 LYS B NZ    1 
ATOM   5444 N N     . GLY D 2 315 ? 20.935  94.726  15.755  1.00 61.50  ? 315 GLY B N     1 
ATOM   5445 C CA    . GLY D 2 315 ? 21.434  93.577  16.486  1.00 59.42  ? 315 GLY B CA    1 
ATOM   5446 C C     . GLY D 2 315 ? 20.491  92.852  17.425  1.00 58.28  ? 315 GLY B C     1 
ATOM   5447 O O     . GLY D 2 315 ? 19.273  92.884  17.264  1.00 58.80  ? 315 GLY B O     1 
ATOM   5448 N N     . ASN D 2 316 ? 21.071  92.175  18.408  1.00 56.66  ? 316 ASN B N     1 
ATOM   5449 C CA    . ASN D 2 316 ? 20.297  91.429  19.388  1.00 54.99  ? 316 ASN B CA    1 
ATOM   5450 C C     . ASN D 2 316 ? 20.433  92.029  20.766  1.00 53.68  ? 316 ASN B C     1 
ATOM   5451 O O     . ASN D 2 316 ? 21.525  92.407  21.181  1.00 52.39  ? 316 ASN B O     1 
ATOM   5452 C CB    . ASN D 2 316 ? 20.739  89.963  19.450  1.00 54.64  ? 316 ASN B CB    1 
ATOM   5453 C CG    . ASN D 2 316 ? 20.260  89.264  20.729  1.00 54.85  ? 316 ASN B CG    1 
ATOM   5454 O OD1   . ASN D 2 316 ? 20.949  89.265  21.750  1.00 53.84  ? 316 ASN B OD1   1 
ATOM   5455 N ND2   . ASN D 2 316 ? 19.065  88.692  20.679  1.00 54.02  ? 316 ASN B ND2   1 
ATOM   5456 N N     . GLN D 2 317 ? 19.311  92.103  21.473  1.00 53.01  ? 317 GLN B N     1 
ATOM   5457 C CA    . GLN D 2 317 ? 19.281  92.646  22.821  1.00 52.63  ? 317 GLN B CA    1 
ATOM   5458 C C     . GLN D 2 317 ? 18.757  91.579  23.770  1.00 50.77  ? 317 GLN B C     1 
ATOM   5459 O O     . GLN D 2 317 ? 17.837  90.832  23.444  1.00 49.15  ? 317 GLN B O     1 
ATOM   5460 C CB    . GLN D 2 317 ? 18.380  93.879  22.885  1.00 55.10  ? 317 GLN B CB    1 
ATOM   5461 C CG    . GLN D 2 317 ? 18.467  94.645  24.201  1.00 59.22  ? 317 GLN B CG    1 
ATOM   5462 C CD    . GLN D 2 317 ? 17.519  95.842  24.245  1.00 61.74  ? 317 GLN B CD    1 
ATOM   5463 O OE1   . GLN D 2 317 ? 17.090  96.351  23.192  1.00 62.89  ? 317 GLN B OE1   1 
ATOM   5464 N NE2   . GLN D 2 317 ? 17.201  96.310  25.463  1.00 61.73  ? 317 GLN B NE2   1 
ATOM   5465 N N     . LEU D 2 318 ? 19.360  91.514  24.946  1.00 49.22  ? 318 LEU B N     1 
ATOM   5466 C CA    . LEU D 2 318 ? 18.963  90.546  25.952  1.00 48.42  ? 318 LEU B CA    1 
ATOM   5467 C C     . LEU D 2 318 ? 18.305  91.272  27.110  1.00 48.01  ? 318 LEU B C     1 
ATOM   5468 O O     . LEU D 2 318 ? 18.841  92.255  27.620  1.00 48.52  ? 318 LEU B O     1 
ATOM   5469 C CB    . LEU D 2 318 ? 20.194  89.783  26.449  1.00 47.76  ? 318 LEU B CB    1 
ATOM   5470 C CG    . LEU D 2 318 ? 20.532  88.395  25.893  1.00 46.87  ? 318 LEU B CG    1 
ATOM   5471 C CD1   . LEU D 2 318 ? 20.135  88.238  24.456  1.00 47.47  ? 318 LEU B CD1   1 
ATOM   5472 C CD2   . LEU D 2 318 ? 21.997  88.183  26.064  1.00 45.98  ? 318 LEU B CD2   1 
ATOM   5473 N N     . LEU D 2 319 ? 17.133  90.801  27.519  1.00 47.39  ? 319 LEU B N     1 
ATOM   5474 C CA    . LEU D 2 319 ? 16.414  91.412  28.636  1.00 46.71  ? 319 LEU B CA    1 
ATOM   5475 C C     . LEU D 2 319 ? 16.691  90.620  29.902  1.00 46.12  ? 319 LEU B C     1 
ATOM   5476 O O     . LEU D 2 319 ? 16.782  89.395  29.877  1.00 46.51  ? 319 LEU B O     1 
ATOM   5477 C CB    . LEU D 2 319 ? 14.915  91.422  28.355  1.00 47.29  ? 319 LEU B CB    1 
ATOM   5478 C CG    . LEU D 2 319 ? 14.264  92.699  27.826  1.00 47.58  ? 319 LEU B CG    1 
ATOM   5479 C CD1   . LEU D 2 319 ? 15.221  93.522  27.019  1.00 47.82  ? 319 LEU B CD1   1 
ATOM   5480 C CD2   . LEU D 2 319 ? 13.059  92.307  27.007  1.00 47.95  ? 319 LEU B CD2   1 
ATOM   5481 N N     . PRO D 2 320 ? 16.820  91.305  31.033  1.00 45.33  ? 320 PRO B N     1 
ATOM   5482 C CA    . PRO D 2 320 ? 17.090  90.586  32.274  1.00 45.18  ? 320 PRO B CA    1 
ATOM   5483 C C     . PRO D 2 320 ? 15.942  89.717  32.757  1.00 44.89  ? 320 PRO B C     1 
ATOM   5484 O O     . PRO D 2 320 ? 14.801  89.888  32.345  1.00 44.59  ? 320 PRO B O     1 
ATOM   5485 C CB    . PRO D 2 320 ? 17.420  91.705  33.249  1.00 45.24  ? 320 PRO B CB    1 
ATOM   5486 C CG    . PRO D 2 320 ? 16.572  92.817  32.767  1.00 45.62  ? 320 PRO B CG    1 
ATOM   5487 C CD    . PRO D 2 320 ? 16.728  92.753  31.268  1.00 45.48  ? 320 PRO B CD    1 
ATOM   5488 N N     . VAL D 2 321 ? 16.271  88.763  33.620  1.00 44.67  ? 321 VAL B N     1 
ATOM   5489 C CA    . VAL D 2 321 ? 15.295  87.866  34.217  1.00 43.73  ? 321 VAL B CA    1 
ATOM   5490 C C     . VAL D 2 321 ? 15.770  87.693  35.648  1.00 43.67  ? 321 VAL B C     1 
ATOM   5491 O O     . VAL D 2 321 ? 16.843  88.162  36.004  1.00 43.73  ? 321 VAL B O     1 
ATOM   5492 C CB    . VAL D 2 321 ? 15.275  86.489  33.523  1.00 43.80  ? 321 VAL B CB    1 
ATOM   5493 C CG1   . VAL D 2 321 ? 14.867  86.641  32.069  1.00 42.99  ? 321 VAL B CG1   1 
ATOM   5494 C CG2   . VAL D 2 321 ? 16.635  85.829  33.637  1.00 43.22  ? 321 VAL B CG2   1 
ATOM   5495 N N     . SER D 2 322 ? 14.995  87.023  36.479  1.00 43.65  ? 322 SER B N     1 
ATOM   5496 C CA    . SER D 2 322 ? 15.426  86.849  37.853  1.00 44.23  ? 322 SER B CA    1 
ATOM   5497 C C     . SER D 2 322 ? 14.755  85.636  38.458  1.00 44.90  ? 322 SER B C     1 
ATOM   5498 O O     . SER D 2 322 ? 13.744  85.153  37.939  1.00 44.72  ? 322 SER B O     1 
ATOM   5499 C CB    . SER D 2 322 ? 15.082  88.091  38.667  1.00 43.81  ? 322 SER B CB    1 
ATOM   5500 O OG    . SER D 2 322 ? 13.688  88.329  38.633  1.00 44.72  ? 322 SER B OG    1 
ATOM   5501 N N     . LEU D 2 323 ? 15.326  85.133  39.547  1.00 44.94  ? 323 LEU B N     1 
ATOM   5502 C CA    . LEU D 2 323 ? 14.760  83.974  40.205  1.00 45.94  ? 323 LEU B CA    1 
ATOM   5503 C C     . LEU D 2 323 ? 13.763  84.410  41.273  1.00 45.84  ? 323 LEU B C     1 
ATOM   5504 O O     . LEU D 2 323 ? 14.053  85.285  42.091  1.00 45.74  ? 323 LEU B O     1 
ATOM   5505 C CB    . LEU D 2 323 ? 15.870  83.130  40.847  1.00 46.70  ? 323 LEU B CB    1 
ATOM   5506 C CG    . LEU D 2 323 ? 15.402  81.984  41.762  1.00 47.70  ? 323 LEU B CG    1 
ATOM   5507 C CD1   . LEU D 2 323 ? 14.663  80.938  40.950  1.00 47.57  ? 323 LEU B CD1   1 
ATOM   5508 C CD2   . LEU D 2 323 ? 16.597  81.349  42.459  1.00 48.26  ? 323 LEU B CD2   1 
ATOM   5509 N N     . VAL D 2 324 ? 12.582  83.810  41.256  1.00 45.76  ? 324 VAL B N     1 
ATOM   5510 C CA    . VAL D 2 324 ? 11.571  84.120  42.254  1.00 46.13  ? 324 VAL B CA    1 
ATOM   5511 C C     . VAL D 2 324 ? 11.430  82.891  43.153  1.00 46.31  ? 324 VAL B C     1 
ATOM   5512 O O     . VAL D 2 324 ? 10.812  81.908  42.766  1.00 45.17  ? 324 VAL B O     1 
ATOM   5513 C CB    . VAL D 2 324 ? 10.202  84.443  41.586  1.00 46.50  ? 324 VAL B CB    1 
ATOM   5514 C CG1   . VAL D 2 324 ? 9.189   84.894  42.632  1.00 45.21  ? 324 VAL B CG1   1 
ATOM   5515 C CG2   . VAL D 2 324 ? 10.374  85.527  40.554  1.00 45.92  ? 324 VAL B CG2   1 
ATOM   5516 N N     . LYS D 2 325 ? 12.022  82.946  44.340  1.00 47.66  ? 325 LYS B N     1 
ATOM   5517 C CA    . LYS D 2 325 ? 11.958  81.829  45.273  1.00 49.39  ? 325 LYS B CA    1 
ATOM   5518 C C     . LYS D 2 325 ? 10.610  81.706  45.938  1.00 49.12  ? 325 LYS B C     1 
ATOM   5519 O O     . LYS D 2 325 ? 10.130  82.632  46.575  1.00 48.62  ? 325 LYS B O     1 
ATOM   5520 C CB    . LYS D 2 325 ? 13.002  81.971  46.367  1.00 51.28  ? 325 LYS B CB    1 
ATOM   5521 C CG    . LYS D 2 325 ? 14.384  81.663  45.926  1.00 56.38  ? 325 LYS B CG    1 
ATOM   5522 C CD    . LYS D 2 325 ? 15.274  81.547  47.138  1.00 60.42  ? 325 LYS B CD    1 
ATOM   5523 C CE    . LYS D 2 325 ? 15.219  82.821  47.998  1.00 62.48  ? 325 LYS B CE    1 
ATOM   5524 N NZ    . LYS D 2 325 ? 16.171  82.764  49.159  1.00 64.50  ? 325 LYS B NZ    1 
ATOM   5525 N N     . ARG D 2 326 ? 9.994   80.551  45.795  1.00 49.29  ? 326 ARG B N     1 
ATOM   5526 C CA    . ARG D 2 326 ? 8.717   80.336  46.425  1.00 49.02  ? 326 ARG B CA    1 
ATOM   5527 C C     . ARG D 2 326 ? 8.774   79.068  47.304  1.00 49.37  ? 326 ARG B C     1 
ATOM   5528 O O     . ARG D 2 326 ? 9.704   78.920  48.095  1.00 49.12  ? 326 ARG B O     1 
ATOM   5529 C CB    . ARG D 2 326 ? 7.624   80.273  45.362  1.00 48.39  ? 326 ARG B CB    1 
ATOM   5530 C CG    . ARG D 2 326 ? 6.570   81.349  45.551  1.00 48.93  ? 326 ARG B CG    1 
ATOM   5531 C CD    . ARG D 2 326 ? 6.709   82.591  44.670  1.00 47.24  ? 326 ARG B CD    1 
ATOM   5532 N NE    . ARG D 2 326 ? 6.163   82.327  43.346  1.00 48.23  ? 326 ARG B NE    1 
ATOM   5533 C CZ    . ARG D 2 326 ? 5.770   83.244  42.463  1.00 47.13  ? 326 ARG B CZ    1 
ATOM   5534 N NH1   . ARG D 2 326 ? 5.837   84.542  42.729  1.00 46.09  ? 326 ARG B NH1   1 
ATOM   5535 N NH2   . ARG D 2 326 ? 5.319   82.843  41.286  1.00 47.06  ? 326 ARG B NH2   1 
ATOM   5536 N N     . LYS D 2 327 ? 7.825   78.151  47.170  1.00 49.65  ? 327 LYS B N     1 
ATOM   5537 C CA    . LYS D 2 327 ? 7.828   76.961  48.018  1.00 50.86  ? 327 LYS B CA    1 
ATOM   5538 C C     . LYS D 2 327 ? 8.097   75.625  47.343  1.00 51.41  ? 327 LYS B C     1 
ATOM   5539 O O     . LYS D 2 327 ? 8.236   74.620  48.024  1.00 52.14  ? 327 LYS B O     1 
ATOM   5540 C CB    . LYS D 2 327 ? 6.490   76.849  48.751  1.00 51.73  ? 327 LYS B CB    1 
ATOM   5541 C CG    . LYS D 2 327 ? 6.126   78.059  49.586  1.00 52.94  ? 327 LYS B CG    1 
ATOM   5542 C CD    . LYS D 2 327 ? 7.151   78.292  50.676  1.00 54.84  ? 327 LYS B CD    1 
ATOM   5543 C CE    . LYS D 2 327 ? 6.772   79.484  51.550  1.00 56.39  ? 327 LYS B CE    1 
ATOM   5544 N NZ    . LYS D 2 327 ? 7.851   79.766  52.552  1.00 58.84  ? 327 LYS B NZ    1 
ATOM   5545 N N     . THR D 2 328 ? 8.171   75.592  46.020  1.00 51.70  ? 328 THR B N     1 
ATOM   5546 C CA    . THR D 2 328 ? 8.380   74.326  45.331  1.00 51.94  ? 328 THR B CA    1 
ATOM   5547 C C     . THR D 2 328 ? 9.804   73.773  45.358  1.00 52.58  ? 328 THR B C     1 
ATOM   5548 O O     . THR D 2 328 ? 10.058  72.692  44.855  1.00 51.93  ? 328 THR B O     1 
ATOM   5549 C CB    . THR D 2 328 ? 7.895   74.410  43.882  1.00 51.58  ? 328 THR B CB    1 
ATOM   5550 O OG1   . THR D 2 328 ? 8.420   75.589  43.276  1.00 51.10  ? 328 THR B OG1   1 
ATOM   5551 C CG2   . THR D 2 328 ? 6.380   74.446  43.835  1.00 51.41  ? 328 THR B CG2   1 
ATOM   5552 N N     . THR D 2 329 ? 10.731  74.521  45.941  1.00 53.65  ? 329 THR B N     1 
ATOM   5553 C CA    . THR D 2 329 ? 12.103  74.061  46.050  1.00 55.35  ? 329 THR B CA    1 
ATOM   5554 C C     . THR D 2 329 ? 12.517  74.212  47.518  1.00 57.86  ? 329 THR B C     1 
ATOM   5555 O O     . THR D 2 329 ? 13.596  74.686  47.840  1.00 58.32  ? 329 THR B O     1 
ATOM   5556 C CB    . THR D 2 329 ? 13.087  74.870  45.125  1.00 53.91  ? 329 THR B CB    1 
ATOM   5557 O OG1   . THR D 2 329 ? 13.127  76.245  45.520  1.00 52.59  ? 329 THR B OG1   1 
ATOM   5558 C CG2   . THR D 2 329 ? 12.665  74.773  43.666  1.00 53.14  ? 329 THR B CG2   1 
ATOM   5559 N N     . LEU D 2 330 ? 11.607  73.859  48.422  1.00 61.04  ? 330 LEU B N     1 
ATOM   5560 C CA    . LEU D 2 330 ? 11.883  73.973  49.855  1.00 63.41  ? 330 LEU B CA    1 
ATOM   5561 C C     . LEU D 2 330 ? 12.027  72.643  50.565  1.00 64.42  ? 330 LEU B C     1 
ATOM   5562 O O     . LEU D 2 330 ? 11.378  71.658  50.201  1.00 63.78  ? 330 LEU B O     1 
ATOM   5563 C CB    . LEU D 2 330 ? 10.813  74.816  50.563  1.00 64.63  ? 330 LEU B CB    1 
ATOM   5564 C CG    . LEU D 2 330 ? 11.092  76.326  50.673  1.00 65.80  ? 330 LEU B CG    1 
ATOM   5565 C CD1   . LEU D 2 330 ? 9.987   76.991  51.468  1.00 66.07  ? 330 LEU B CD1   1 
ATOM   5566 C CD2   . LEU D 2 330 ? 12.448  76.582  51.326  1.00 66.37  ? 330 LEU B CD2   1 
ATOM   5567 N N     . ALA D 2 331 ? 12.877  72.653  51.595  1.00 65.95  ? 331 ALA B N     1 
ATOM   5568 C CA    . ALA D 2 331 ? 13.208  71.474  52.411  1.00 66.91  ? 331 ALA B CA    1 
ATOM   5569 C C     . ALA D 2 331 ? 14.108  70.645  51.513  1.00 67.80  ? 331 ALA B C     1 
ATOM   5570 O O     . ALA D 2 331 ? 14.320  71.015  50.335  1.00 69.32  ? 331 ALA B O     1 
ATOM   5571 C CB    . ALA D 2 331 ? 11.959  70.679  52.800  1.00 66.19  ? 331 ALA B CB    1 
ATOM   5572 N N     . ASN E 2 46  ? 75.001  52.203  74.536  1.00 112.16 ? 46  ASN C N     1 
ATOM   5573 C CA    . ASN E 2 46  ? 73.885  53.122  74.347  1.00 111.93 ? 46  ASN C CA    1 
ATOM   5574 C C     . ASN E 2 46  ? 74.407  54.465  73.846  1.00 111.53 ? 46  ASN C C     1 
ATOM   5575 O O     . ASN E 2 46  ? 74.364  55.476  74.556  1.00 111.31 ? 46  ASN C O     1 
ATOM   5576 C CB    . ASN E 2 46  ? 73.130  53.308  75.665  1.00 112.30 ? 46  ASN C CB    1 
ATOM   5577 C CG    . ASN E 2 46  ? 71.950  54.252  75.532  1.00 112.70 ? 46  ASN C CG    1 
ATOM   5578 O OD1   . ASN E 2 46  ? 71.050  54.033  74.715  1.00 112.85 ? 46  ASN C OD1   1 
ATOM   5579 N ND2   . ASN E 2 46  ? 71.946  55.308  76.339  1.00 112.56 ? 46  ASN C ND2   1 
ATOM   5580 N N     . TYR E 2 47  ? 74.902  54.463  72.613  1.00 110.90 ? 47  TYR C N     1 
ATOM   5581 C CA    . TYR E 2 47  ? 75.453  55.667  72.005  1.00 110.09 ? 47  TYR C CA    1 
ATOM   5582 C C     . TYR E 2 47  ? 74.423  56.464  71.208  1.00 109.40 ? 47  TYR C C     1 
ATOM   5583 O O     . TYR E 2 47  ? 73.710  55.921  70.358  1.00 109.21 ? 47  TYR C O     1 
ATOM   5584 C CB    . TYR E 2 47  ? 76.639  55.299  71.098  1.00 110.08 ? 47  TYR C CB    1 
ATOM   5585 C CG    . TYR E 2 47  ? 77.164  56.450  70.261  1.00 109.92 ? 47  TYR C CG    1 
ATOM   5586 C CD1   . TYR E 2 47  ? 77.751  57.570  70.862  1.00 109.53 ? 47  TYR C CD1   1 
ATOM   5587 C CD2   . TYR E 2 47  ? 77.048  56.431  68.865  1.00 109.70 ? 47  TYR C CD2   1 
ATOM   5588 C CE1   . TYR E 2 47  ? 78.205  58.641  70.093  1.00 109.52 ? 47  TYR C CE1   1 
ATOM   5589 C CE2   . TYR E 2 47  ? 77.497  57.495  68.089  1.00 109.49 ? 47  TYR C CE2   1 
ATOM   5590 C CZ    . TYR E 2 47  ? 78.072  58.596  68.708  1.00 109.56 ? 47  TYR C CZ    1 
ATOM   5591 O OH    . TYR E 2 47  ? 78.503  59.655  67.944  1.00 109.48 ? 47  TYR C OH    1 
ATOM   5592 N N     . ILE E 2 48  ? 74.357  57.761  71.499  1.00 108.51 ? 48  ILE C N     1 
ATOM   5593 C CA    . ILE E 2 48  ? 73.449  58.669  70.813  1.00 107.44 ? 48  ILE C CA    1 
ATOM   5594 C C     . ILE E 2 48  ? 74.266  59.859  70.326  1.00 106.57 ? 48  ILE C C     1 
ATOM   5595 O O     . ILE E 2 48  ? 74.745  60.664  71.123  1.00 106.07 ? 48  ILE C O     1 
ATOM   5596 C CB    . ILE E 2 48  ? 72.326  59.164  71.750  1.00 107.52 ? 48  ILE C CB    1 
ATOM   5597 C CG1   . ILE E 2 48  ? 71.514  57.969  72.257  1.00 107.36 ? 48  ILE C CG1   1 
ATOM   5598 C CG2   . ILE E 2 48  ? 71.414  60.133  71.004  1.00 107.44 ? 48  ILE C CG2   1 
ATOM   5599 C CD1   . ILE E 2 48  ? 70.422  58.335  73.231  1.00 107.30 ? 48  ILE C CD1   1 
ATOM   5600 N N     . PRO E 2 49  ? 74.447  59.970  69.002  1.00 105.93 ? 49  PRO C N     1 
ATOM   5601 C CA    . PRO E 2 49  ? 75.208  61.048  68.362  1.00 105.52 ? 49  PRO C CA    1 
ATOM   5602 C C     . PRO E 2 49  ? 74.782  62.452  68.794  1.00 105.02 ? 49  PRO C C     1 
ATOM   5603 O O     . PRO E 2 49  ? 73.635  62.850  68.585  1.00 104.97 ? 49  PRO C O     1 
ATOM   5604 C CB    . PRO E 2 49  ? 74.954  60.805  66.878  1.00 105.53 ? 49  PRO C CB    1 
ATOM   5605 C CG    . PRO E 2 49  ? 74.828  59.318  66.809  1.00 105.60 ? 49  PRO C CG    1 
ATOM   5606 C CD    . PRO E 2 49  ? 73.941  59.024  67.991  1.00 105.60 ? 49  PRO C CD    1 
ATOM   5607 N N     . ASN E 2 50  ? 75.713  63.195  69.390  1.00 104.24 ? 50  ASN C N     1 
ATOM   5608 C CA    . ASN E 2 50  ? 75.448  64.559  69.842  1.00 103.55 ? 50  ASN C CA    1 
ATOM   5609 C C     . ASN E 2 50  ? 75.204  65.480  68.641  1.00 103.47 ? 50  ASN C C     1 
ATOM   5610 O O     . ASN E 2 50  ? 76.129  66.118  68.140  1.00 103.65 ? 50  ASN C O     1 
ATOM   5611 C CB    . ASN E 2 50  ? 76.638  65.078  70.658  1.00 102.86 ? 50  ASN C CB    1 
ATOM   5612 C CG    . ASN E 2 50  ? 76.397  66.463  71.233  1.00 102.41 ? 50  ASN C CG    1 
ATOM   5613 O OD1   . ASN E 2 50  ? 76.032  67.393  70.514  1.00 101.89 ? 50  ASN C OD1   1 
ATOM   5614 N ND2   . ASN E 2 50  ? 76.610  66.607  72.537  1.00 101.85 ? 50  ASN C ND2   1 
ATOM   5615 N N     . ARG E 2 51  ? 73.955  65.542  68.183  1.00 103.28 ? 51  ARG C N     1 
ATOM   5616 C CA    . ARG E 2 51  ? 73.584  66.378  67.043  1.00 103.09 ? 51  ARG C CA    1 
ATOM   5617 C C     . ARG E 2 51  ? 74.177  67.786  67.104  1.00 102.85 ? 51  ARG C C     1 
ATOM   5618 O O     . ARG E 2 51  ? 74.499  68.371  66.067  1.00 102.52 ? 51  ARG C O     1 
ATOM   5619 C CB    . ARG E 2 51  ? 72.059  66.489  66.935  1.00 103.21 ? 51  ARG C CB    1 
ATOM   5620 C CG    . ARG E 2 51  ? 71.364  65.333  66.234  1.00 103.50 ? 51  ARG C CG    1 
ATOM   5621 C CD    . ARG E 2 51  ? 69.853  65.555  66.247  1.00 104.05 ? 51  ARG C CD    1 
ATOM   5622 N NE    . ARG E 2 51  ? 69.133  64.694  65.312  1.00 104.53 ? 51  ARG C NE    1 
ATOM   5623 C CZ    . ARG E 2 51  ? 69.114  63.366  65.368  1.00 105.10 ? 51  ARG C CZ    1 
ATOM   5624 N NH1   . ARG E 2 51  ? 69.781  62.727  66.321  1.00 105.33 ? 51  ARG C NH1   1 
ATOM   5625 N NH2   . ARG E 2 51  ? 68.426  62.670  64.469  1.00 105.23 ? 51  ARG C NH2   1 
ATOM   5626 N N     . VAL E 2 52  ? 74.308  68.331  68.312  1.00 102.67 ? 52  VAL C N     1 
ATOM   5627 C CA    . VAL E 2 52  ? 74.853  69.677  68.483  1.00 102.67 ? 52  VAL C CA    1 
ATOM   5628 C C     . VAL E 2 52  ? 76.240  69.757  67.856  1.00 102.83 ? 52  VAL C C     1 
ATOM   5629 O O     . VAL E 2 52  ? 76.564  70.704  67.132  1.00 102.70 ? 52  VAL C O     1 
ATOM   5630 C CB    . VAL E 2 52  ? 74.958  70.056  69.979  1.00 102.55 ? 52  VAL C CB    1 
ATOM   5631 C CG1   . VAL E 2 52  ? 75.424  71.501  70.120  1.00 102.25 ? 52  VAL C CG1   1 
ATOM   5632 C CG2   . VAL E 2 52  ? 73.612  69.847  70.665  1.00 102.21 ? 52  VAL C CG2   1 
ATOM   5633 N N     . ALA E 2 53  ? 77.054  68.747  68.139  1.00 103.00 ? 53  ALA C N     1 
ATOM   5634 C CA    . ALA E 2 53  ? 78.403  68.680  67.608  1.00 102.91 ? 53  ALA C CA    1 
ATOM   5635 C C     . ALA E 2 53  ? 78.360  68.384  66.111  1.00 103.01 ? 53  ALA C C     1 
ATOM   5636 O O     . ALA E 2 53  ? 79.125  68.961  65.341  1.00 103.18 ? 53  ALA C O     1 
ATOM   5637 C CB    . ALA E 2 53  ? 79.189  67.607  68.337  1.00 102.74 ? 53  ALA C CB    1 
ATOM   5638 N N     . GLN E 2 54  ? 77.463  67.490  65.703  1.00 103.15 ? 54  GLN C N     1 
ATOM   5639 C CA    . GLN E 2 54  ? 77.331  67.128  64.292  1.00 103.52 ? 54  GLN C CA    1 
ATOM   5640 C C     . GLN E 2 54  ? 77.036  68.339  63.407  1.00 103.83 ? 54  GLN C C     1 
ATOM   5641 O O     . GLN E 2 54  ? 77.624  68.497  62.333  1.00 103.81 ? 54  GLN C O     1 
ATOM   5642 C CB    . GLN E 2 54  ? 76.222  66.091  64.107  1.00 103.55 ? 54  GLN C CB    1 
ATOM   5643 C CG    . GLN E 2 54  ? 76.527  64.726  64.690  1.00 103.70 ? 54  GLN C CG    1 
ATOM   5644 C CD    . GLN E 2 54  ? 75.429  63.720  64.398  1.00 103.90 ? 54  GLN C CD    1 
ATOM   5645 O OE1   . GLN E 2 54  ? 74.325  63.811  64.939  1.00 103.99 ? 54  GLN C OE1   1 
ATOM   5646 N NE2   . GLN E 2 54  ? 75.723  62.759  63.527  1.00 104.04 ? 54  GLN C NE2   1 
ATOM   5647 N N     . GLN E 2 55  ? 76.115  69.187  63.856  1.00 104.01 ? 55  GLN C N     1 
ATOM   5648 C CA    . GLN E 2 55  ? 75.757  70.375  63.094  1.00 104.09 ? 55  GLN C CA    1 
ATOM   5649 C C     . GLN E 2 55  ? 76.967  71.307  62.975  1.00 103.97 ? 55  GLN C C     1 
ATOM   5650 O O     . GLN E 2 55  ? 77.339  71.716  61.869  1.00 103.78 ? 55  GLN C O     1 
ATOM   5651 C CB    . GLN E 2 55  ? 74.577  71.093  63.767  1.00 104.33 ? 55  GLN C CB    1 
ATOM   5652 C CG    . GLN E 2 55  ? 74.216  72.437  63.139  1.00 105.06 ? 55  GLN C CG    1 
ATOM   5653 C CD    . GLN E 2 55  ? 72.845  72.948  63.563  1.00 105.47 ? 55  GLN C CD    1 
ATOM   5654 O OE1   . GLN E 2 55  ? 72.474  72.882  64.741  1.00 105.79 ? 55  GLN C OE1   1 
ATOM   5655 N NE2   . GLN E 2 55  ? 72.090  73.474  62.601  1.00 105.24 ? 55  GLN C NE2   1 
ATOM   5656 N N     . LEU E 2 56  ? 77.584  71.618  64.116  1.00 103.63 ? 56  LEU C N     1 
ATOM   5657 C CA    . LEU E 2 56  ? 78.752  72.498  64.160  1.00 103.20 ? 56  LEU C CA    1 
ATOM   5658 C C     . LEU E 2 56  ? 79.869  71.979  63.256  1.00 103.09 ? 56  LEU C C     1 
ATOM   5659 O O     . LEU E 2 56  ? 80.509  72.745  62.532  1.00 103.23 ? 56  LEU C O     1 
ATOM   5660 C CB    . LEU E 2 56  ? 79.270  72.618  65.598  1.00 102.68 ? 56  LEU C CB    1 
ATOM   5661 C CG    . LEU E 2 56  ? 80.272  73.741  65.881  1.00 102.31 ? 56  LEU C CG    1 
ATOM   5662 C CD1   . LEU E 2 56  ? 79.578  75.089  65.713  1.00 101.78 ? 56  LEU C CD1   1 
ATOM   5663 C CD2   . LEU E 2 56  ? 80.821  73.606  67.295  1.00 101.92 ? 56  LEU C CD2   1 
ATOM   5664 N N     . ALA E 2 57  ? 80.097  70.670  63.301  1.00 102.90 ? 57  ALA C N     1 
ATOM   5665 C CA    . ALA E 2 57  ? 81.137  70.046  62.492  1.00 102.75 ? 57  ALA C CA    1 
ATOM   5666 C C     . ALA E 2 57  ? 80.874  70.206  60.996  1.00 102.60 ? 57  ALA C C     1 
ATOM   5667 O O     . ALA E 2 57  ? 81.740  69.900  60.176  1.00 102.53 ? 57  ALA C O     1 
ATOM   5668 C CB    . ALA E 2 57  ? 81.258  68.568  62.849  1.00 102.71 ? 57  ALA C CB    1 
ATOM   5669 N N     . GLY E 2 58  ? 79.678  70.669  60.642  1.00 102.40 ? 58  GLY C N     1 
ATOM   5670 C CA    . GLY E 2 58  ? 79.360  70.869  59.239  1.00 102.27 ? 58  GLY C CA    1 
ATOM   5671 C C     . GLY E 2 58  ? 78.346  69.919  58.625  1.00 102.23 ? 58  GLY C C     1 
ATOM   5672 O O     . GLY E 2 58  ? 77.988  70.072  57.454  1.00 102.12 ? 58  GLY C O     1 
ATOM   5673 N N     . LYS E 2 59  ? 77.878  68.941  59.397  1.00 102.20 ? 59  LYS C N     1 
ATOM   5674 C CA    . LYS E 2 59  ? 76.896  67.982  58.888  1.00 102.01 ? 59  LYS C CA    1 
ATOM   5675 C C     . LYS E 2 59  ? 75.725  68.734  58.259  1.00 101.52 ? 59  LYS C C     1 
ATOM   5676 O O     . LYS E 2 59  ? 74.983  69.438  58.952  1.00 101.70 ? 59  LYS C O     1 
ATOM   5677 C CB    . LYS E 2 59  ? 76.402  67.069  60.021  1.00 102.29 ? 59  LYS C CB    1 
ATOM   5678 C CG    . LYS E 2 59  ? 75.301  66.085  59.628  1.00 102.47 ? 59  LYS C CG    1 
ATOM   5679 C CD    . LYS E 2 59  ? 75.163  64.985  60.683  1.00 102.79 ? 59  LYS C CD    1 
ATOM   5680 C CE    . LYS E 2 59  ? 73.862  64.195  60.542  1.00 102.97 ? 59  LYS C CE    1 
ATOM   5681 N NZ    . LYS E 2 59  ? 72.672  64.981  60.996  1.00 103.08 ? 59  LYS C NZ    1 
ATOM   5682 N N     . GLN E 2 60  ? 75.575  68.589  56.943  1.00 100.59 ? 60  GLN C N     1 
ATOM   5683 C CA    . GLN E 2 60  ? 74.508  69.264  56.210  1.00 99.54  ? 60  GLN C CA    1 
ATOM   5684 C C     . GLN E 2 60  ? 73.129  68.676  56.535  1.00 98.15  ? 60  GLN C C     1 
ATOM   5685 O O     . GLN E 2 60  ? 72.686  67.705  55.912  1.00 98.41  ? 60  GLN C O     1 
ATOM   5686 C CB    . GLN E 2 60  ? 74.770  69.183  54.698  1.00 100.18 ? 60  GLN C CB    1 
ATOM   5687 C CG    . GLN E 2 60  ? 73.957  70.184  53.871  1.00 100.91 ? 60  GLN C CG    1 
ATOM   5688 C CD    . GLN E 2 60  ? 74.305  71.636  54.190  1.00 101.38 ? 60  GLN C CD    1 
ATOM   5689 O OE1   . GLN E 2 60  ? 74.177  72.085  55.334  1.00 101.75 ? 60  GLN C OE1   1 
ATOM   5690 N NE2   . GLN E 2 60  ? 74.745  72.376  53.175  1.00 101.26 ? 60  GLN C NE2   1 
ATOM   5691 N N     . SER E 2 61  ? 72.460  69.272  57.518  1.00 95.93  ? 61  SER C N     1 
ATOM   5692 C CA    . SER E 2 61  ? 71.135  68.827  57.932  1.00 93.43  ? 61  SER C CA    1 
ATOM   5693 C C     . SER E 2 61  ? 70.143  69.960  57.706  1.00 91.41  ? 61  SER C C     1 
ATOM   5694 O O     . SER E 2 61  ? 70.199  70.994  58.375  1.00 91.33  ? 61  SER C O     1 
ATOM   5695 C CB    . SER E 2 61  ? 71.141  68.435  59.413  1.00 93.80  ? 61  SER C CB    1 
ATOM   5696 O OG    . SER E 2 61  ? 72.051  67.375  59.659  1.00 94.23  ? 61  SER C OG    1 
ATOM   5697 N N     . LEU E 2 62  ? 69.253  69.772  56.741  1.00 88.42  ? 62  LEU C N     1 
ATOM   5698 C CA    . LEU E 2 62  ? 68.246  70.773  56.437  1.00 85.32  ? 62  LEU C CA    1 
ATOM   5699 C C     . LEU E 2 62  ? 67.363  70.995  57.668  1.00 82.84  ? 62  LEU C C     1 
ATOM   5700 O O     . LEU E 2 62  ? 66.478  70.198  57.975  1.00 82.92  ? 62  LEU C O     1 
ATOM   5701 C CB    . LEU E 2 62  ? 67.423  70.326  55.218  1.00 85.66  ? 62  LEU C CB    1 
ATOM   5702 C CG    . LEU E 2 62  ? 66.721  68.958  55.164  1.00 86.10  ? 62  LEU C CG    1 
ATOM   5703 C CD1   . LEU E 2 62  ? 66.449  68.619  53.692  1.00 86.17  ? 62  LEU C CD1   1 
ATOM   5704 C CD2   . LEU E 2 62  ? 67.576  67.854  55.789  1.00 86.14  ? 62  LEU C CD2   1 
ATOM   5705 N N     . LEU E 2 63  ? 67.638  72.087  58.378  1.00 79.68  ? 63  LEU C N     1 
ATOM   5706 C CA    . LEU E 2 63  ? 66.909  72.455  59.586  1.00 76.18  ? 63  LEU C CA    1 
ATOM   5707 C C     . LEU E 2 63  ? 65.985  73.663  59.336  1.00 74.16  ? 63  LEU C C     1 
ATOM   5708 O O     . LEU E 2 63  ? 66.439  74.808  59.179  1.00 73.62  ? 63  LEU C O     1 
ATOM   5709 C CB    . LEU E 2 63  ? 67.917  72.754  60.702  1.00 75.59  ? 63  LEU C CB    1 
ATOM   5710 C CG    . LEU E 2 63  ? 67.479  72.990  62.150  1.00 75.47  ? 63  LEU C CG    1 
ATOM   5711 C CD1   . LEU E 2 63  ? 67.648  74.451  62.491  1.00 75.25  ? 63  LEU C CD1   1 
ATOM   5712 C CD2   . LEU E 2 63  ? 66.041  72.529  62.365  1.00 75.86  ? 63  LEU C CD2   1 
ATOM   5713 N N     . ILE E 2 64  ? 64.683  73.379  59.305  1.00 71.15  ? 64  ILE C N     1 
ATOM   5714 C CA    . ILE E 2 64  ? 63.642  74.377  59.069  1.00 67.75  ? 64  ILE C CA    1 
ATOM   5715 C C     . ILE E 2 64  ? 63.194  75.087  60.340  1.00 65.58  ? 64  ILE C C     1 
ATOM   5716 O O     . ILE E 2 64  ? 62.861  74.445  61.327  1.00 65.74  ? 64  ILE C O     1 
ATOM   5717 C CB    . ILE E 2 64  ? 62.411  73.714  58.442  1.00 67.07  ? 64  ILE C CB    1 
ATOM   5718 C CG1   . ILE E 2 64  ? 62.784  73.109  57.091  1.00 66.40  ? 64  ILE C CG1   1 
ATOM   5719 C CG2   . ILE E 2 64  ? 61.297  74.713  58.305  1.00 67.09  ? 64  ILE C CG2   1 
ATOM   5720 C CD1   . ILE E 2 64  ? 61.704  72.229  56.507  1.00 66.04  ? 64  ILE C CD1   1 
ATOM   5721 N N     . GLY E 2 65  ? 63.189  76.413  60.308  1.00 63.45  ? 65  GLY C N     1 
ATOM   5722 C CA    . GLY E 2 65  ? 62.748  77.188  61.457  1.00 61.17  ? 65  GLY C CA    1 
ATOM   5723 C C     . GLY E 2 65  ? 61.305  77.615  61.233  1.00 59.87  ? 65  GLY C C     1 
ATOM   5724 O O     . GLY E 2 65  ? 60.890  77.811  60.087  1.00 60.14  ? 65  GLY C O     1 
ATOM   5725 N N     . VAL E 2 66  ? 60.527  77.753  62.305  1.00 58.02  ? 66  VAL C N     1 
ATOM   5726 C CA    . VAL E 2 66  ? 59.134  78.151  62.170  1.00 55.60  ? 66  VAL C CA    1 
ATOM   5727 C C     . VAL E 2 66  ? 58.694  79.146  63.223  1.00 54.65  ? 66  VAL C C     1 
ATOM   5728 O O     . VAL E 2 66  ? 58.728  78.859  64.412  1.00 54.03  ? 66  VAL C O     1 
ATOM   5729 C CB    . VAL E 2 66  ? 58.192  76.937  62.237  1.00 55.33  ? 66  VAL C CB    1 
ATOM   5730 C CG1   . VAL E 2 66  ? 56.749  77.395  62.213  1.00 55.60  ? 66  VAL C CG1   1 
ATOM   5731 C CG2   . VAL E 2 66  ? 58.447  76.019  61.066  1.00 55.27  ? 66  VAL C CG2   1 
ATOM   5732 N N     . ALA E 2 67  ? 58.299  80.331  62.773  1.00 53.72  ? 67  ALA C N     1 
ATOM   5733 C CA    . ALA E 2 67  ? 57.799  81.367  63.669  1.00 52.63  ? 67  ALA C CA    1 
ATOM   5734 C C     . ALA E 2 67  ? 56.289  81.259  63.472  1.00 51.91  ? 67  ALA C C     1 
ATOM   5735 O O     . ALA E 2 67  ? 55.798  81.336  62.346  1.00 51.52  ? 67  ALA C O     1 
ATOM   5736 C CB    . ALA E 2 67  ? 58.315  82.735  63.248  1.00 52.23  ? 67  ALA C CB    1 
ATOM   5737 N N     . THR E 2 68  ? 55.554  81.069  64.559  1.00 51.16  ? 68  THR C N     1 
ATOM   5738 C CA    . THR E 2 68  ? 54.118  80.878  64.450  1.00 50.44  ? 68  THR C CA    1 
ATOM   5739 C C     . THR E 2 68  ? 53.298  81.554  65.535  1.00 50.03  ? 68  THR C C     1 
ATOM   5740 O O     . THR E 2 68  ? 53.813  81.937  66.589  1.00 48.97  ? 68  THR C O     1 
ATOM   5741 C CB    . THR E 2 68  ? 53.783  79.363  64.491  1.00 50.94  ? 68  THR C CB    1 
ATOM   5742 O OG1   . THR E 2 68  ? 52.371  79.168  64.374  1.00 51.11  ? 68  THR C OG1   1 
ATOM   5743 C CG2   . THR E 2 68  ? 54.241  78.757  65.817  1.00 50.52  ? 68  THR C CG2   1 
ATOM   5744 N N     . SER E 2 69  ? 52.007  81.703  65.246  1.00 49.91  ? 69  SER C N     1 
ATOM   5745 C CA    . SER E 2 69  ? 51.062  82.267  66.200  1.00 49.69  ? 69  SER C CA    1 
ATOM   5746 C C     . SER E 2 69  ? 50.867  81.138  67.221  1.00 49.62  ? 69  SER C C     1 
ATOM   5747 O O     . SER E 2 69  ? 51.218  79.977  66.961  1.00 48.60  ? 69  SER C O     1 
ATOM   5748 C CB    . SER E 2 69  ? 49.708  82.560  65.535  1.00 49.82  ? 69  SER C CB    1 
ATOM   5749 O OG    . SER E 2 69  ? 49.838  83.382  64.390  1.00 50.37  ? 69  SER C OG    1 
ATOM   5750 N N     . SER E 2 70  ? 50.295  81.479  68.367  1.00 49.27  ? 70  SER C N     1 
ATOM   5751 C CA    . SER E 2 70  ? 50.057  80.512  69.419  1.00 48.82  ? 70  SER C CA    1 
ATOM   5752 C C     . SER E 2 70  ? 49.489  79.205  68.900  1.00 48.38  ? 70  SER C C     1 
ATOM   5753 O O     . SER E 2 70  ? 48.543  79.197  68.101  1.00 48.13  ? 70  SER C O     1 
ATOM   5754 C CB    . SER E 2 70  ? 49.095  81.080  70.448  1.00 48.95  ? 70  SER C CB    1 
ATOM   5755 O OG    . SER E 2 70  ? 48.899  80.137  71.477  1.00 51.02  ? 70  SER C OG    1 
ATOM   5756 N N     . LEU E 2 71  ? 50.068  78.099  69.367  1.00 47.49  ? 71  LEU C N     1 
ATOM   5757 C CA    . LEU E 2 71  ? 49.612  76.772  68.960  1.00 46.63  ? 71  LEU C CA    1 
ATOM   5758 C C     . LEU E 2 71  ? 48.301  76.458  69.646  1.00 45.58  ? 71  LEU C C     1 
ATOM   5759 O O     . LEU E 2 71  ? 47.690  75.436  69.386  1.00 45.80  ? 71  LEU C O     1 
ATOM   5760 C CB    . LEU E 2 71  ? 50.654  75.710  69.304  1.00 46.85  ? 71  LEU C CB    1 
ATOM   5761 C CG    . LEU E 2 71  ? 51.947  75.952  68.516  1.00 47.39  ? 71  LEU C CG    1 
ATOM   5762 C CD1   . LEU E 2 71  ? 53.047  75.022  69.020  1.00 46.47  ? 71  LEU C CD1   1 
ATOM   5763 C CD2   . LEU E 2 71  ? 51.668  75.764  67.020  1.00 46.20  ? 71  LEU C CD2   1 
ATOM   5764 N N     . ALA E 2 72  ? 47.867  77.345  70.528  1.00 44.55  ? 72  ALA C N     1 
ATOM   5765 C CA    . ALA E 2 72  ? 46.601  77.136  71.187  1.00 44.36  ? 72  ALA C CA    1 
ATOM   5766 C C     . ALA E 2 72  ? 45.485  77.424  70.185  1.00 44.09  ? 72  ALA C C     1 
ATOM   5767 O O     . ALA E 2 72  ? 44.323  77.158  70.455  1.00 45.29  ? 72  ALA C O     1 
ATOM   5768 C CB    . ALA E 2 72  ? 46.477  78.048  72.386  1.00 43.81  ? 72  ALA C CB    1 
ATOM   5769 N N     . LEU E 2 73  ? 45.834  77.962  69.024  1.00 43.32  ? 73  LEU C N     1 
ATOM   5770 C CA    . LEU E 2 73  ? 44.837  78.284  68.014  1.00 42.83  ? 73  LEU C CA    1 
ATOM   5771 C C     . LEU E 2 73  ? 44.722  77.138  67.027  1.00 42.02  ? 73  LEU C C     1 
ATOM   5772 O O     . LEU E 2 73  ? 45.721  76.510  66.658  1.00 41.36  ? 73  LEU C O     1 
ATOM   5773 C CB    . LEU E 2 73  ? 45.230  79.580  67.289  1.00 44.25  ? 73  LEU C CB    1 
ATOM   5774 C CG    . LEU E 2 73  ? 45.262  80.828  68.180  1.00 44.39  ? 73  LEU C CG    1 
ATOM   5775 C CD1   . LEU E 2 73  ? 46.144  81.895  67.542  1.00 45.06  ? 73  LEU C CD1   1 
ATOM   5776 C CD2   . LEU E 2 73  ? 43.845  81.322  68.412  1.00 43.51  ? 73  LEU C CD2   1 
ATOM   5777 N N     . HIS E 2 74  ? 43.504  76.887  66.567  1.00 41.53  ? 74  HIS C N     1 
ATOM   5778 C CA    . HIS E 2 74  ? 43.274  75.781  65.665  1.00 41.97  ? 74  HIS C CA    1 
ATOM   5779 C C     . HIS E 2 74  ? 44.166  75.657  64.434  1.00 42.22  ? 74  HIS C C     1 
ATOM   5780 O O     . HIS E 2 74  ? 45.001  74.756  64.368  1.00 42.54  ? 74  HIS C O     1 
ATOM   5781 C CB    . HIS E 2 74  ? 41.819  75.748  65.227  1.00 42.88  ? 74  HIS C CB    1 
ATOM   5782 C CG    . HIS E 2 74  ? 41.465  74.508  64.470  1.00 45.34  ? 74  HIS C CG    1 
ATOM   5783 N ND1   . HIS E 2 74  ? 41.397  73.268  65.075  1.00 45.02  ? 74  HIS C ND1   1 
ATOM   5784 C CD2   . HIS E 2 74  ? 41.222  74.300  63.152  1.00 45.37  ? 74  HIS C CD2   1 
ATOM   5785 C CE1   . HIS E 2 74  ? 41.128  72.351  64.163  1.00 45.60  ? 74  HIS C CE1   1 
ATOM   5786 N NE2   . HIS E 2 74  ? 41.018  72.950  62.988  1.00 46.36  ? 74  HIS C NE2   1 
ATOM   5787 N N     . ALA E 2 75  ? 43.999  76.548  63.457  1.00 42.51  ? 75  ALA C N     1 
ATOM   5788 C CA    . ALA E 2 75  ? 44.784  76.463  62.225  1.00 42.42  ? 75  ALA C CA    1 
ATOM   5789 C C     . ALA E 2 75  ? 46.295  76.376  62.454  1.00 41.92  ? 75  ALA C C     1 
ATOM   5790 O O     . ALA E 2 75  ? 46.973  75.538  61.862  1.00 41.72  ? 75  ALA C O     1 
ATOM   5791 C CB    . ALA E 2 75  ? 44.448  77.630  61.291  1.00 41.54  ? 75  ALA C CB    1 
ATOM   5792 N N     . PRO E 2 76  ? 46.844  77.242  63.306  1.00 41.33  ? 76  PRO C N     1 
ATOM   5793 C CA    . PRO E 2 76  ? 48.289  77.171  63.541  1.00 42.04  ? 76  PRO C CA    1 
ATOM   5794 C C     . PRO E 2 76  ? 48.730  75.775  64.014  1.00 43.19  ? 76  PRO C C     1 
ATOM   5795 O O     . PRO E 2 76  ? 49.702  75.209  63.493  1.00 44.41  ? 76  PRO C O     1 
ATOM   5796 C CB    . PRO E 2 76  ? 48.524  78.235  64.606  1.00 41.60  ? 76  PRO C CB    1 
ATOM   5797 C CG    . PRO E 2 76  ? 47.436  79.221  64.338  1.00 41.80  ? 76  PRO C CG    1 
ATOM   5798 C CD    . PRO E 2 76  ? 46.233  78.360  64.035  1.00 40.80  ? 76  PRO C CD    1 
ATOM   5799 N N     . SER E 2 77  ? 48.024  75.207  64.993  1.00 43.36  ? 77  SER C N     1 
ATOM   5800 C CA    . SER E 2 77  ? 48.399  73.877  65.478  1.00 43.93  ? 77  SER C CA    1 
ATOM   5801 C C     . SER E 2 77  ? 48.282  72.857  64.340  1.00 43.58  ? 77  SER C C     1 
ATOM   5802 O O     . SER E 2 77  ? 49.150  72.006  64.178  1.00 44.14  ? 77  SER C O     1 
ATOM   5803 C CB    . SER E 2 77  ? 47.527  73.450  66.665  1.00 43.90  ? 77  SER C CB    1 
ATOM   5804 O OG    . SER E 2 77  ? 46.215  73.133  66.237  1.00 45.84  ? 77  SER C OG    1 
ATOM   5805 N N     . GLN E 2 78  ? 47.228  72.941  63.537  1.00 43.13  ? 78  GLN C N     1 
ATOM   5806 C CA    . GLN E 2 78  ? 47.085  72.001  62.429  1.00 43.13  ? 78  GLN C CA    1 
ATOM   5807 C C     . GLN E 2 78  ? 48.239  72.152  61.443  1.00 43.50  ? 78  GLN C C     1 
ATOM   5808 O O     . GLN E 2 78  ? 48.752  71.166  60.914  1.00 43.59  ? 78  GLN C O     1 
ATOM   5809 C CB    . GLN E 2 78  ? 45.781  72.241  61.685  1.00 43.50  ? 78  GLN C CB    1 
ATOM   5810 C CG    . GLN E 2 78  ? 44.553  72.171  62.560  1.00 45.34  ? 78  GLN C CG    1 
ATOM   5811 C CD    . GLN E 2 78  ? 44.423  70.830  63.221  1.00 45.99  ? 78  GLN C CD    1 
ATOM   5812 O OE1   . GLN E 2 78  ? 44.295  69.812  62.548  1.00 47.95  ? 78  GLN C OE1   1 
ATOM   5813 N NE2   . GLN E 2 78  ? 44.467  70.814  64.543  1.00 46.34  ? 78  GLN C NE2   1 
ATOM   5814 N N     . ILE E 2 79  ? 48.650  73.396  61.205  1.00 43.31  ? 79  ILE C N     1 
ATOM   5815 C CA    . ILE E 2 79  ? 49.718  73.686  60.260  1.00 42.73  ? 79  ILE C CA    1 
ATOM   5816 C C     . ILE E 2 79  ? 51.076  73.236  60.763  1.00 42.93  ? 79  ILE C C     1 
ATOM   5817 O O     . ILE E 2 79  ? 51.829  72.613  60.023  1.00 42.92  ? 79  ILE C O     1 
ATOM   5818 C CB    . ILE E 2 79  ? 49.729  75.210  59.887  1.00 42.67  ? 79  ILE C CB    1 
ATOM   5819 C CG1   . ILE E 2 79  ? 48.526  75.510  58.985  1.00 41.77  ? 79  ILE C CG1   1 
ATOM   5820 C CG2   . ILE E 2 79  ? 51.039  75.604  59.193  1.00 40.73  ? 79  ILE C CG2   1 
ATOM   5821 C CD1   . ILE E 2 79  ? 48.081  76.951  59.014  1.00 41.35  ? 79  ILE C CD1   1 
ATOM   5822 N N     . VAL E 2 80  ? 51.410  73.546  62.006  1.00 43.12  ? 80  VAL C N     1 
ATOM   5823 C CA    . VAL E 2 80  ? 52.696  73.096  62.522  1.00 44.33  ? 80  VAL C CA    1 
ATOM   5824 C C     . VAL E 2 80  ? 52.769  71.560  62.455  1.00 44.28  ? 80  VAL C C     1 
ATOM   5825 O O     . VAL E 2 80  ? 53.798  70.992  62.097  1.00 43.29  ? 80  VAL C O     1 
ATOM   5826 C CB    . VAL E 2 80  ? 52.898  73.542  63.977  1.00 44.85  ? 80  VAL C CB    1 
ATOM   5827 C CG1   . VAL E 2 80  ? 53.889  72.634  64.659  1.00 45.18  ? 80  VAL C CG1   1 
ATOM   5828 C CG2   . VAL E 2 80  ? 53.408  74.955  64.008  1.00 45.07  ? 80  VAL C CG2   1 
ATOM   5829 N N     . ALA E 2 81  ? 51.658  70.901  62.783  1.00 44.72  ? 81  ALA C N     1 
ATOM   5830 C CA    . ALA E 2 81  ? 51.597  69.443  62.764  1.00 45.27  ? 81  ALA C CA    1 
ATOM   5831 C C     . ALA E 2 81  ? 51.928  68.911  61.384  1.00 45.96  ? 81  ALA C C     1 
ATOM   5832 O O     . ALA E 2 81  ? 52.759  68.016  61.242  1.00 46.79  ? 81  ALA C O     1 
ATOM   5833 C CB    . ALA E 2 81  ? 50.225  68.963  63.189  1.00 44.61  ? 81  ALA C CB    1 
ATOM   5834 N N     . ALA E 2 82  ? 51.289  69.459  60.357  1.00 46.23  ? 82  ALA C N     1 
ATOM   5835 C CA    . ALA E 2 82  ? 51.558  69.003  59.002  1.00 46.71  ? 82  ALA C CA    1 
ATOM   5836 C C     . ALA E 2 82  ? 52.985  69.368  58.585  1.00 47.36  ? 82  ALA C C     1 
ATOM   5837 O O     . ALA E 2 82  ? 53.586  68.688  57.757  1.00 47.57  ? 82  ALA C O     1 
ATOM   5838 C CB    . ALA E 2 82  ? 50.546  69.599  58.033  1.00 46.15  ? 82  ALA C CB    1 
ATOM   5839 N N     . ILE E 2 83  ? 53.534  70.434  59.154  1.00 48.00  ? 83  ILE C N     1 
ATOM   5840 C CA    . ILE E 2 83  ? 54.894  70.829  58.809  1.00 49.36  ? 83  ILE C CA    1 
ATOM   5841 C C     . ILE E 2 83  ? 55.857  69.791  59.383  1.00 50.83  ? 83  ILE C C     1 
ATOM   5842 O O     . ILE E 2 83  ? 56.631  69.178  58.637  1.00 50.98  ? 83  ILE C O     1 
ATOM   5843 C CB    . ILE E 2 83  ? 55.250  72.246  59.358  1.00 48.64  ? 83  ILE C CB    1 
ATOM   5844 C CG1   . ILE E 2 83  ? 54.510  73.319  58.563  1.00 48.40  ? 83  ILE C CG1   1 
ATOM   5845 C CG2   . ILE E 2 83  ? 56.745  72.509  59.252  1.00 47.90  ? 83  ILE C CG2   1 
ATOM   5846 C CD1   . ILE E 2 83  ? 54.769  74.714  59.075  1.00 47.40  ? 83  ILE C CD1   1 
ATOM   5847 N N     . LYS E 2 84  ? 55.798  69.584  60.700  1.00 52.04  ? 84  LYS C N     1 
ATOM   5848 C CA    . LYS E 2 84  ? 56.659  68.599  61.357  1.00 53.45  ? 84  LYS C CA    1 
ATOM   5849 C C     . LYS E 2 84  ? 56.478  67.233  60.704  1.00 53.98  ? 84  LYS C C     1 
ATOM   5850 O O     . LYS E 2 84  ? 57.443  66.523  60.441  1.00 53.96  ? 84  LYS C O     1 
ATOM   5851 C CB    . LYS E 2 84  ? 56.342  68.507  62.851  1.00 53.33  ? 84  LYS C CB    1 
ATOM   5852 C CG    . LYS E 2 84  ? 56.593  69.802  63.585  1.00 54.56  ? 84  LYS C CG    1 
ATOM   5853 C CD    . LYS E 2 84  ? 56.559  69.614  65.082  1.00 56.03  ? 84  LYS C CD    1 
ATOM   5854 C CE    . LYS E 2 84  ? 57.946  69.319  65.641  1.00 57.11  ? 84  LYS C CE    1 
ATOM   5855 N NZ    . LYS E 2 84  ? 58.746  70.577  65.834  1.00 58.42  ? 84  LYS C NZ    1 
ATOM   5856 N N     . SER E 2 85  ? 55.239  66.877  60.419  1.00 54.66  ? 85  SER C N     1 
ATOM   5857 C CA    . SER E 2 85  ? 54.970  65.604  59.787  1.00 56.53  ? 85  SER C CA    1 
ATOM   5858 C C     . SER E 2 85  ? 55.722  65.464  58.468  1.00 58.12  ? 85  SER C C     1 
ATOM   5859 O O     . SER E 2 85  ? 56.488  64.519  58.276  1.00 59.31  ? 85  SER C O     1 
ATOM   5860 C CB    . SER E 2 85  ? 53.472  65.454  59.548  1.00 56.44  ? 85  SER C CB    1 
ATOM   5861 O OG    . SER E 2 85  ? 53.205  64.314  58.763  1.00 56.66  ? 85  SER C OG    1 
ATOM   5862 N N     . ARG E 2 86  ? 55.515  66.405  57.556  1.00 59.65  ? 86  ARG C N     1 
ATOM   5863 C CA    . ARG E 2 86  ? 56.174  66.355  56.253  1.00 60.70  ? 86  ARG C CA    1 
ATOM   5864 C C     . ARG E 2 86  ? 57.695  66.482  56.355  1.00 61.48  ? 86  ARG C C     1 
ATOM   5865 O O     . ARG E 2 86  ? 58.423  65.876  55.574  1.00 61.23  ? 86  ARG C O     1 
ATOM   5866 C CB    . ARG E 2 86  ? 55.581  67.436  55.335  1.00 60.80  ? 86  ARG C CB    1 
ATOM   5867 C CG    . ARG E 2 86  ? 56.468  67.907  54.199  1.00 60.52  ? 86  ARG C CG    1 
ATOM   5868 C CD    . ARG E 2 86  ? 56.909  66.805  53.275  1.00 60.80  ? 86  ARG C CD    1 
ATOM   5869 N NE    . ARG E 2 86  ? 55.864  66.342  52.380  1.00 60.87  ? 86  ARG C NE    1 
ATOM   5870 C CZ    . ARG E 2 86  ? 56.116  65.726  51.228  1.00 61.53  ? 86  ARG C CZ    1 
ATOM   5871 N NH1   . ARG E 2 86  ? 57.368  65.516  50.851  1.00 61.45  ? 86  ARG C NH1   1 
ATOM   5872 N NH2   . ARG E 2 86  ? 55.124  65.315  50.455  1.00 62.38  ? 86  ARG C NH2   1 
ATOM   5873 N N     . ALA E 2 87  ? 58.180  67.252  57.321  1.00 62.73  ? 87  ALA C N     1 
ATOM   5874 C CA    . ALA E 2 87  ? 59.622  67.403  57.492  1.00 64.58  ? 87  ALA C CA    1 
ATOM   5875 C C     . ALA E 2 87  ? 60.248  66.080  57.946  1.00 66.27  ? 87  ALA C C     1 
ATOM   5876 O O     . ALA E 2 87  ? 61.335  65.710  57.490  1.00 66.22  ? 87  ALA C O     1 
ATOM   5877 C CB    . ALA E 2 87  ? 59.920  68.492  58.504  1.00 64.02  ? 87  ALA C CB    1 
ATOM   5878 N N     . ASP E 2 88  ? 59.565  65.373  58.848  1.00 68.07  ? 88  ASP C N     1 
ATOM   5879 C CA    . ASP E 2 88  ? 60.061  64.087  59.336  1.00 69.51  ? 88  ASP C CA    1 
ATOM   5880 C C     . ASP E 2 88  ? 60.138  63.136  58.155  1.00 69.76  ? 88  ASP C C     1 
ATOM   5881 O O     . ASP E 2 88  ? 61.096  62.375  58.007  1.00 70.37  ? 88  ASP C O     1 
ATOM   5882 C CB    . ASP E 2 88  ? 59.129  63.493  60.406  1.00 70.89  ? 88  ASP C CB    1 
ATOM   5883 C CG    . ASP E 2 88  ? 59.189  64.258  61.733  1.00 73.23  ? 88  ASP C CG    1 
ATOM   5884 O OD1   . ASP E 2 88  ? 60.300  64.732  62.087  1.00 74.19  ? 88  ASP C OD1   1 
ATOM   5885 O OD2   . ASP E 2 88  ? 58.138  64.376  62.426  1.00 73.60  ? 88  ASP C OD2   1 
ATOM   5886 N N     . GLN E 2 89  ? 59.123  63.204  57.306  1.00 69.45  ? 89  GLN C N     1 
ATOM   5887 C CA    . GLN E 2 89  ? 59.041  62.355  56.133  1.00 69.46  ? 89  GLN C CA    1 
ATOM   5888 C C     . GLN E 2 89  ? 60.124  62.658  55.096  1.00 69.46  ? 89  GLN C C     1 
ATOM   5889 O O     . GLN E 2 89  ? 60.390  61.837  54.217  1.00 69.48  ? 89  GLN C O     1 
ATOM   5890 C CB    . GLN E 2 89  ? 57.660  62.509  55.507  1.00 69.96  ? 89  GLN C CB    1 
ATOM   5891 C CG    . GLN E 2 89  ? 57.411  61.646  54.297  1.00 70.76  ? 89  GLN C CG    1 
ATOM   5892 C CD    . GLN E 2 89  ? 56.000  61.810  53.768  1.00 72.07  ? 89  GLN C CD    1 
ATOM   5893 O OE1   . GLN E 2 89  ? 55.583  61.101  52.852  1.00 73.16  ? 89  GLN C OE1   1 
ATOM   5894 N NE2   . GLN E 2 89  ? 55.252  62.752  54.344  1.00 72.77  ? 89  GLN C NE2   1 
ATOM   5895 N N     . LEU E 2 90  ? 60.743  63.832  55.187  1.00 69.06  ? 90  LEU C N     1 
ATOM   5896 C CA    . LEU E 2 90  ? 61.790  64.206  54.238  1.00 68.88  ? 90  LEU C CA    1 
ATOM   5897 C C     . LEU E 2 90  ? 63.144  64.191  54.916  1.00 68.66  ? 90  LEU C C     1 
ATOM   5898 O O     . LEU E 2 90  ? 64.139  64.631  54.343  1.00 68.88  ? 90  LEU C O     1 
ATOM   5899 C CB    . LEU E 2 90  ? 61.542  65.604  53.662  1.00 68.62  ? 90  LEU C CB    1 
ATOM   5900 C CG    . LEU E 2 90  ? 60.321  65.798  52.762  1.00 68.96  ? 90  LEU C CG    1 
ATOM   5901 C CD1   . LEU E 2 90  ? 60.256  67.255  52.316  1.00 69.13  ? 90  LEU C CD1   1 
ATOM   5902 C CD2   . LEU E 2 90  ? 60.402  64.879  51.561  1.00 68.03  ? 90  LEU C CD2   1 
ATOM   5903 N N     . GLY E 2 91  ? 63.175  63.690  56.143  1.00 68.10  ? 91  GLY C N     1 
ATOM   5904 C CA    . GLY E 2 91  ? 64.425  63.633  56.867  1.00 67.38  ? 91  GLY C CA    1 
ATOM   5905 C C     . GLY E 2 91  ? 64.911  65.017  57.221  1.00 67.10  ? 91  GLY C C     1 
ATOM   5906 O O     . GLY E 2 91  ? 66.109  65.234  57.397  1.00 67.34  ? 91  GLY C O     1 
ATOM   5907 N N     . ALA E 2 92  ? 63.980  65.961  57.319  1.00 66.70  ? 92  ALA C N     1 
ATOM   5908 C CA    . ALA E 2 92  ? 64.323  67.335  57.677  1.00 66.04  ? 92  ALA C CA    1 
ATOM   5909 C C     . ALA E 2 92  ? 63.945  67.583  59.130  1.00 65.48  ? 92  ALA C C     1 
ATOM   5910 O O     . ALA E 2 92  ? 62.963  67.044  59.629  1.00 65.67  ? 92  ALA C O     1 
ATOM   5911 C CB    . ALA E 2 92  ? 63.591  68.319  56.769  1.00 66.26  ? 92  ALA C CB    1 
ATOM   5912 N N     . SER E 2 93  ? 64.728  68.406  59.804  1.00 64.91  ? 93  SER C N     1 
ATOM   5913 C CA    . SER E 2 93  ? 64.476  68.716  61.197  1.00 64.78  ? 93  SER C CA    1 
ATOM   5914 C C     . SER E 2 93  ? 63.669  70.010  61.292  1.00 64.68  ? 93  SER C C     1 
ATOM   5915 O O     . SER E 2 93  ? 63.711  70.829  60.376  1.00 65.40  ? 93  SER C O     1 
ATOM   5916 C CB    . SER E 2 93  ? 65.809  68.870  61.917  1.00 65.23  ? 93  SER C CB    1 
ATOM   5917 O OG    . SER E 2 93  ? 65.615  69.109  63.292  1.00 66.69  ? 93  SER C OG    1 
ATOM   5918 N N     . VAL E 2 94  ? 62.950  70.207  62.394  1.00 63.79  ? 94  VAL C N     1 
ATOM   5919 C CA    . VAL E 2 94  ? 62.133  71.407  62.555  1.00 62.75  ? 94  VAL C CA    1 
ATOM   5920 C C     . VAL E 2 94  ? 62.122  71.986  63.961  1.00 62.92  ? 94  VAL C C     1 
ATOM   5921 O O     . VAL E 2 94  ? 61.722  71.321  64.911  1.00 63.56  ? 94  VAL C O     1 
ATOM   5922 C CB    . VAL E 2 94  ? 60.658  71.136  62.173  1.00 62.21  ? 94  VAL C CB    1 
ATOM   5923 C CG1   . VAL E 2 94  ? 59.814  72.344  62.498  1.00 62.16  ? 94  VAL C CG1   1 
ATOM   5924 C CG2   . VAL E 2 94  ? 60.540  70.795  60.702  1.00 61.78  ? 94  VAL C CG2   1 
ATOM   5925 N N     . VAL E 2 95  ? 62.550  73.232  64.092  1.00 62.70  ? 95  VAL C N     1 
ATOM   5926 C CA    . VAL E 2 95  ? 62.534  73.903  65.387  1.00 63.07  ? 95  VAL C CA    1 
ATOM   5927 C C     . VAL E 2 95  ? 61.490  75.011  65.228  1.00 63.54  ? 95  VAL C C     1 
ATOM   5928 O O     . VAL E 2 95  ? 61.442  75.648  64.176  1.00 63.87  ? 95  VAL C O     1 
ATOM   5929 C CB    . VAL E 2 95  ? 63.912  74.509  65.717  1.00 62.57  ? 95  VAL C CB    1 
ATOM   5930 C CG1   . VAL E 2 95  ? 64.473  75.188  64.494  1.00 62.84  ? 95  VAL C CG1   1 
ATOM   5931 C CG2   . VAL E 2 95  ? 63.789  75.509  66.849  1.00 62.51  ? 95  VAL C CG2   1 
ATOM   5932 N N     . VAL E 2 96  ? 60.649  75.238  66.237  1.00 63.30  ? 96  VAL C N     1 
ATOM   5933 C CA    . VAL E 2 96  ? 59.626  76.268  66.107  1.00 63.64  ? 96  VAL C CA    1 
ATOM   5934 C C     . VAL E 2 96  ? 59.598  77.277  67.240  1.00 64.52  ? 96  VAL C C     1 
ATOM   5935 O O     . VAL E 2 96  ? 59.661  76.919  68.411  1.00 64.46  ? 96  VAL C O     1 
ATOM   5936 C CB    . VAL E 2 96  ? 58.198  75.651  65.941  1.00 62.88  ? 96  VAL C CB    1 
ATOM   5937 C CG1   . VAL E 2 96  ? 58.301  74.215  65.486  1.00 62.87  ? 96  VAL C CG1   1 
ATOM   5938 C CG2   . VAL E 2 96  ? 57.409  75.757  67.214  1.00 63.05  ? 96  VAL C CG2   1 
ATOM   5939 N N     . SER E 2 97  ? 59.506  78.550  66.874  1.00 65.56  ? 97  SER C N     1 
ATOM   5940 C CA    . SER E 2 97  ? 59.455  79.618  67.851  1.00 66.68  ? 97  SER C CA    1 
ATOM   5941 C C     . SER E 2 97  ? 58.029  80.144  67.861  1.00 67.44  ? 97  SER C C     1 
ATOM   5942 O O     . SER E 2 97  ? 57.517  80.615  66.852  1.00 67.32  ? 97  SER C O     1 
ATOM   5943 C CB    . SER E 2 97  ? 60.437  80.723  67.472  1.00 66.73  ? 97  SER C CB    1 
ATOM   5944 O OG    . SER E 2 97  ? 60.576  81.650  68.530  1.00 67.95  ? 97  SER C OG    1 
ATOM   5945 N N     . MET E 2 98  ? 57.384  80.044  69.009  1.00 68.68  ? 98  MET C N     1 
ATOM   5946 C CA    . MET E 2 98  ? 56.014  80.482  69.134  1.00 70.44  ? 98  MET C CA    1 
ATOM   5947 C C     . MET E 2 98  ? 55.960  81.943  69.560  1.00 72.14  ? 98  MET C C     1 
ATOM   5948 O O     . MET E 2 98  ? 56.602  82.337  70.527  1.00 72.63  ? 98  MET C O     1 
ATOM   5949 C CB    . MET E 2 98  ? 55.296  79.596  70.150  1.00 69.94  ? 98  MET C CB    1 
ATOM   5950 C CG    . MET E 2 98  ? 53.786  79.686  70.101  1.00 70.22  ? 98  MET C CG    1 
ATOM   5951 S SD    . MET E 2 98  ? 52.968  78.504  71.199  1.00 69.02  ? 98  MET C SD    1 
ATOM   5952 C CE    . MET E 2 98  ? 52.754  79.513  72.691  1.00 68.70  ? 98  MET C CE    1 
ATOM   5953 N N     . VAL E 2 99  ? 55.205  82.751  68.826  1.00 73.94  ? 99  VAL C N     1 
ATOM   5954 C CA    . VAL E 2 99  ? 55.085  84.161  69.154  1.00 75.83  ? 99  VAL C CA    1 
ATOM   5955 C C     . VAL E 2 99  ? 53.744  84.395  69.826  1.00 77.72  ? 99  VAL C C     1 
ATOM   5956 O O     . VAL E 2 99  ? 52.696  84.127  69.238  1.00 77.95  ? 99  VAL C O     1 
ATOM   5957 C CB    . VAL E 2 99  ? 55.163  85.037  67.888  1.00 75.70  ? 99  VAL C CB    1 
ATOM   5958 C CG1   . VAL E 2 99  ? 55.153  86.509  68.270  1.00 75.29  ? 99  VAL C CG1   1 
ATOM   5959 C CG2   . VAL E 2 99  ? 56.413  84.694  67.100  1.00 75.46  ? 99  VAL C CG2   1 
ATOM   5960 N N     . GLU E 2 100 ? 53.770  84.885  71.061  1.00 79.91  ? 100 GLU C N     1 
ATOM   5961 C CA    . GLU E 2 100 ? 52.527  85.150  71.778  1.00 82.31  ? 100 GLU C CA    1 
ATOM   5962 C C     . GLU E 2 100 ? 52.219  86.638  71.829  1.00 83.54  ? 100 GLU C C     1 
ATOM   5963 O O     . GLU E 2 100 ? 51.083  87.051  71.586  1.00 83.87  ? 100 GLU C O     1 
ATOM   5964 C CB    . GLU E 2 100 ? 52.595  84.597  73.197  1.00 82.75  ? 100 GLU C CB    1 
ATOM   5965 C CG    . GLU E 2 100 ? 52.516  83.093  73.272  1.00 83.69  ? 100 GLU C CG    1 
ATOM   5966 C CD    . GLU E 2 100 ? 52.739  82.586  74.680  1.00 84.60  ? 100 GLU C CD    1 
ATOM   5967 O OE1   . GLU E 2 100 ? 53.821  82.869  75.245  1.00 84.47  ? 100 GLU C OE1   1 
ATOM   5968 O OE2   . GLU E 2 100 ? 51.834  81.910  75.221  1.00 85.15  ? 100 GLU C OE2   1 
ATOM   5969 N N     . ARG E 2 101 ? 53.224  87.442  72.156  1.00 84.64  ? 101 ARG C N     1 
ATOM   5970 C CA    . ARG E 2 101 ? 53.022  88.879  72.214  1.00 85.77  ? 101 ARG C CA    1 
ATOM   5971 C C     . ARG E 2 101 ? 52.612  89.335  70.818  1.00 85.83  ? 101 ARG C C     1 
ATOM   5972 O O     . ARG E 2 101 ? 53.115  88.820  69.818  1.00 85.78  ? 101 ARG C O     1 
ATOM   5973 C CB    . ARG E 2 101 ? 54.312  89.580  72.645  1.00 86.92  ? 101 ARG C CB    1 
ATOM   5974 C CG    . ARG E 2 101 ? 54.795  89.167  74.029  1.00 88.98  ? 101 ARG C CG    1 
ATOM   5975 C CD    . ARG E 2 101 ? 56.184  89.707  74.330  1.00 90.41  ? 101 ARG C CD    1 
ATOM   5976 N NE    . ARG E 2 101 ? 57.147  89.316  73.304  1.00 92.04  ? 101 ARG C NE    1 
ATOM   5977 C CZ    . ARG E 2 101 ? 58.453  89.563  73.366  1.00 93.23  ? 101 ARG C CZ    1 
ATOM   5978 N NH1   . ARG E 2 101 ? 58.965  90.202  74.416  1.00 93.83  ? 101 ARG C NH1   1 
ATOM   5979 N NH2   . ARG E 2 101 ? 59.248  89.178  72.372  1.00 93.72  ? 101 ARG C NH2   1 
ATOM   5980 N N     . SER E 2 102 ? 51.672  90.272  70.751  1.00 85.74  ? 102 SER C N     1 
ATOM   5981 C CA    . SER E 2 102 ? 51.223  90.793  69.467  1.00 85.44  ? 102 SER C CA    1 
ATOM   5982 C C     . SER E 2 102 ? 52.214  91.866  69.048  1.00 85.00  ? 102 SER C C     1 
ATOM   5983 O O     . SER E 2 102 ? 52.638  92.677  69.873  1.00 85.14  ? 102 SER C O     1 
ATOM   5984 C CB    . SER E 2 102 ? 49.827  91.405  69.593  1.00 85.82  ? 102 SER C CB    1 
ATOM   5985 O OG    . SER E 2 102 ? 49.460  92.075  68.397  1.00 85.98  ? 102 SER C OG    1 
ATOM   5986 N N     . GLY E 2 103 ? 52.598  91.864  67.777  1.00 84.25  ? 103 GLY C N     1 
ATOM   5987 C CA    . GLY E 2 103 ? 53.538  92.868  67.317  1.00 83.50  ? 103 GLY C CA    1 
ATOM   5988 C C     . GLY E 2 103 ? 54.644  92.336  66.435  1.00 82.90  ? 103 GLY C C     1 
ATOM   5989 O O     . GLY E 2 103 ? 54.956  91.146  66.455  1.00 83.07  ? 103 GLY C O     1 
ATOM   5990 N N     . VAL E 2 104 ? 55.243  93.240  65.666  1.00 82.16  ? 104 VAL C N     1 
ATOM   5991 C CA    . VAL E 2 104 ? 56.319  92.901  64.746  1.00 81.34  ? 104 VAL C CA    1 
ATOM   5992 C C     . VAL E 2 104 ? 57.617  92.643  65.483  1.00 80.66  ? 104 VAL C C     1 
ATOM   5993 O O     . VAL E 2 104 ? 58.454  91.860  65.028  1.00 80.36  ? 104 VAL C O     1 
ATOM   5994 C CB    . VAL E 2 104 ? 56.550  94.040  63.740  1.00 81.44  ? 104 VAL C CB    1 
ATOM   5995 C CG1   . VAL E 2 104 ? 57.482  93.578  62.617  1.00 81.38  ? 104 VAL C CG1   1 
ATOM   5996 C CG2   . VAL E 2 104 ? 55.217  94.503  63.196  1.00 81.44  ? 104 VAL C CG2   1 
ATOM   5997 N N     . GLU E 2 105 ? 57.792  93.316  66.614  1.00 80.08  ? 105 GLU C N     1 
ATOM   5998 C CA    . GLU E 2 105 ? 59.003  93.137  67.402  1.00 79.48  ? 105 GLU C CA    1 
ATOM   5999 C C     . GLU E 2 105 ? 59.045  91.705  67.909  1.00 78.22  ? 105 GLU C C     1 
ATOM   6000 O O     . GLU E 2 105 ? 60.072  91.035  67.822  1.00 78.08  ? 105 GLU C O     1 
ATOM   6001 C CB    . GLU E 2 105 ? 59.032  94.137  68.558  1.00 80.46  ? 105 GLU C CB    1 
ATOM   6002 C CG    . GLU E 2 105 ? 59.320  95.564  68.089  1.00 82.22  ? 105 GLU C CG    1 
ATOM   6003 C CD    . GLU E 2 105 ? 60.665  95.681  67.359  1.00 83.38  ? 105 GLU C CD    1 
ATOM   6004 O OE1   . GLU E 2 105 ? 61.723  95.694  68.033  1.00 83.98  ? 105 GLU C OE1   1 
ATOM   6005 O OE2   . GLU E 2 105 ? 60.666  95.747  66.106  1.00 83.93  ? 105 GLU C OE2   1 
ATOM   6006 N N     . ALA E 2 106 ? 57.907  91.235  68.408  1.00 76.82  ? 106 ALA C N     1 
ATOM   6007 C CA    . ALA E 2 106 ? 57.794  89.877  68.914  1.00 75.21  ? 106 ALA C CA    1 
ATOM   6008 C C     . ALA E 2 106 ? 58.153  88.884  67.814  1.00 74.19  ? 106 ALA C C     1 
ATOM   6009 O O     . ALA E 2 106 ? 58.896  87.933  68.048  1.00 73.96  ? 106 ALA C O     1 
ATOM   6010 C CB    . ALA E 2 106 ? 56.382  89.625  69.401  1.00 75.42  ? 106 ALA C CB    1 
ATOM   6011 N N     . CYS E 2 107 ? 57.626  89.110  66.613  1.00 72.86  ? 107 CYS C N     1 
ATOM   6012 C CA    . CYS E 2 107 ? 57.905  88.223  65.494  1.00 71.80  ? 107 CYS C CA    1 
ATOM   6013 C C     . CYS E 2 107 ? 59.376  88.313  65.109  1.00 71.64  ? 107 CYS C C     1 
ATOM   6014 O O     . CYS E 2 107 ? 59.982  87.327  64.684  1.00 70.85  ? 107 CYS C O     1 
ATOM   6015 C CB    . CYS E 2 107 ? 57.032  88.581  64.287  1.00 71.26  ? 107 CYS C CB    1 
ATOM   6016 S SG    . CYS E 2 107 ? 57.195  87.418  62.898  1.00 69.93  ? 107 CYS C SG    1 
ATOM   6017 N N     . LYS E 2 108 ? 59.945  89.505  65.256  1.00 71.84  ? 108 LYS C N     1 
ATOM   6018 C CA    . LYS E 2 108 ? 61.351  89.707  64.934  1.00 72.02  ? 108 LYS C CA    1 
ATOM   6019 C C     . LYS E 2 108 ? 62.203  88.976  65.964  1.00 71.54  ? 108 LYS C C     1 
ATOM   6020 O O     . LYS E 2 108 ? 63.202  88.345  65.619  1.00 71.31  ? 108 LYS C O     1 
ATOM   6021 C CB    . LYS E 2 108 ? 61.694  91.201  64.913  1.00 72.82  ? 108 LYS C CB    1 
ATOM   6022 C CG    . LYS E 2 108 ? 61.166  91.947  63.686  1.00 73.27  ? 108 LYS C CG    1 
ATOM   6023 C CD    . LYS E 2 108 ? 61.692  93.373  63.638  1.00 73.92  ? 108 LYS C CD    1 
ATOM   6024 C CE    . LYS E 2 108 ? 61.290  94.074  62.351  1.00 74.61  ? 108 LYS C CE    1 
ATOM   6025 N NZ    . LYS E 2 108 ? 61.915  95.428  62.234  1.00 74.87  ? 108 LYS C NZ    1 
ATOM   6026 N N     . THR E 2 109 ? 61.800  89.060  67.227  1.00 71.16  ? 109 THR C N     1 
ATOM   6027 C CA    . THR E 2 109 ? 62.512  88.363  68.293  1.00 71.22  ? 109 THR C CA    1 
ATOM   6028 C C     . THR E 2 109 ? 62.534  86.876  67.934  1.00 71.37  ? 109 THR C C     1 
ATOM   6029 O O     . THR E 2 109 ? 63.570  86.220  68.008  1.00 71.21  ? 109 THR C O     1 
ATOM   6030 C CB    . THR E 2 109 ? 61.793  88.515  69.644  1.00 71.25  ? 109 THR C CB    1 
ATOM   6031 O OG1   . THR E 2 109 ? 61.798  89.888  70.048  1.00 71.19  ? 109 THR C OG1   1 
ATOM   6032 C CG2   . THR E 2 109 ? 62.484  87.686  70.701  1.00 71.15  ? 109 THR C CG2   1 
ATOM   6033 N N     . ALA E 2 110 ? 61.375  86.357  67.537  1.00 71.54  ? 110 ALA C N     1 
ATOM   6034 C CA    . ALA E 2 110 ? 61.240  84.959  67.158  1.00 71.89  ? 110 ALA C CA    1 
ATOM   6035 C C     . ALA E 2 110 ? 62.160  84.599  66.002  1.00 72.49  ? 110 ALA C C     1 
ATOM   6036 O O     . ALA E 2 110 ? 62.809  83.559  66.023  1.00 73.05  ? 110 ALA C O     1 
ATOM   6037 C CB    . ALA E 2 110 ? 59.802  84.658  66.785  1.00 71.58  ? 110 ALA C CB    1 
ATOM   6038 N N     . VAL E 2 111 ? 62.218  85.450  64.986  1.00 72.99  ? 111 VAL C N     1 
ATOM   6039 C CA    . VAL E 2 111 ? 63.080  85.168  63.846  1.00 73.77  ? 111 VAL C CA    1 
ATOM   6040 C C     . VAL E 2 111 ? 64.553  85.225  64.260  1.00 74.50  ? 111 VAL C C     1 
ATOM   6041 O O     . VAL E 2 111 ? 65.387  84.487  63.732  1.00 74.24  ? 111 VAL C O     1 
ATOM   6042 C CB    . VAL E 2 111 ? 62.816  86.164  62.690  1.00 73.62  ? 111 VAL C CB    1 
ATOM   6043 C CG1   . VAL E 2 111 ? 63.846  85.981  61.592  1.00 73.69  ? 111 VAL C CG1   1 
ATOM   6044 C CG2   . VAL E 2 111 ? 61.425  85.935  62.122  1.00 73.31  ? 111 VAL C CG2   1 
ATOM   6045 N N     . HIS E 2 112 ? 64.864  86.097  65.213  1.00 75.52  ? 112 HIS C N     1 
ATOM   6046 C CA    . HIS E 2 112 ? 66.228  86.246  65.705  1.00 76.50  ? 112 HIS C CA    1 
ATOM   6047 C C     . HIS E 2 112 ? 66.726  84.918  66.266  1.00 76.41  ? 112 HIS C C     1 
ATOM   6048 O O     . HIS E 2 112 ? 67.788  84.431  65.871  1.00 76.08  ? 112 HIS C O     1 
ATOM   6049 C CB    . HIS E 2 112 ? 66.272  87.316  66.798  1.00 78.64  ? 112 HIS C CB    1 
ATOM   6050 C CG    . HIS E 2 112 ? 67.654  87.645  67.276  1.00 81.08  ? 112 HIS C CG    1 
ATOM   6051 N ND1   . HIS E 2 112 ? 67.893  88.532  68.308  1.00 82.13  ? 112 HIS C ND1   1 
ATOM   6052 C CD2   . HIS E 2 112 ? 68.872  87.221  66.858  1.00 81.93  ? 112 HIS C CD2   1 
ATOM   6053 C CE1   . HIS E 2 112 ? 69.196  88.639  68.503  1.00 82.36  ? 112 HIS C CE1   1 
ATOM   6054 N NE2   . HIS E 2 112 ? 69.814  87.854  67.635  1.00 82.19  ? 112 HIS C NE2   1 
ATOM   6055 N N     . ASN E 2 113 ? 65.947  84.337  67.181  1.00 76.21  ? 113 ASN C N     1 
ATOM   6056 C CA    . ASN E 2 113 ? 66.293  83.063  67.810  1.00 75.87  ? 113 ASN C CA    1 
ATOM   6057 C C     . ASN E 2 113 ? 66.404  81.938  66.793  1.00 75.73  ? 113 ASN C C     1 
ATOM   6058 O O     . ASN E 2 113 ? 67.332  81.135  66.848  1.00 76.16  ? 113 ASN C O     1 
ATOM   6059 C CB    . ASN E 2 113 ? 65.253  82.672  68.864  1.00 76.16  ? 113 ASN C CB    1 
ATOM   6060 C CG    . ASN E 2 113 ? 65.117  83.702  69.969  1.00 76.61  ? 113 ASN C CG    1 
ATOM   6061 O OD1   . ASN E 2 113 ? 66.102  84.306  70.397  1.00 76.66  ? 113 ASN C OD1   1 
ATOM   6062 N ND2   . ASN E 2 113 ? 63.890  83.896  70.450  1.00 76.55  ? 113 ASN C ND2   1 
ATOM   6063 N N     . LEU E 2 114 ? 65.448  81.866  65.876  1.00 75.19  ? 114 LEU C N     1 
ATOM   6064 C CA    . LEU E 2 114 ? 65.475  80.829  64.854  1.00 75.01  ? 114 LEU C CA    1 
ATOM   6065 C C     . LEU E 2 114 ? 66.763  80.946  64.040  1.00 75.05  ? 114 LEU C C     1 
ATOM   6066 O O     . LEU E 2 114 ? 67.335  79.942  63.612  1.00 74.85  ? 114 LEU C O     1 
ATOM   6067 C CB    . LEU E 2 114 ? 64.261  80.969  63.932  1.00 74.73  ? 114 LEU C CB    1 
ATOM   6068 C CG    . LEU E 2 114 ? 63.111  79.978  64.088  1.00 74.66  ? 114 LEU C CG    1 
ATOM   6069 C CD1   . LEU E 2 114 ? 62.797  79.769  65.548  1.00 74.69  ? 114 LEU C CD1   1 
ATOM   6070 C CD2   . LEU E 2 114 ? 61.895  80.503  63.350  1.00 74.47  ? 114 LEU C CD2   1 
ATOM   6071 N N     . LEU E 2 115 ? 67.210  82.183  63.830  1.00 75.11  ? 115 LEU C N     1 
ATOM   6072 C CA    . LEU E 2 115 ? 68.430  82.450  63.070  1.00 75.30  ? 115 LEU C CA    1 
ATOM   6073 C C     . LEU E 2 115 ? 69.642  82.003  63.883  1.00 75.29  ? 115 LEU C C     1 
ATOM   6074 O O     . LEU E 2 115 ? 70.589  81.422  63.347  1.00 75.12  ? 115 LEU C O     1 
ATOM   6075 C CB    . LEU E 2 115 ? 68.520  83.947  62.745  1.00 75.41  ? 115 LEU C CB    1 
ATOM   6076 C CG    . LEU E 2 115 ? 68.270  84.411  61.298  1.00 75.36  ? 115 LEU C CG    1 
ATOM   6077 C CD1   . LEU E 2 115 ? 67.218  83.573  60.612  1.00 75.19  ? 115 LEU C CD1   1 
ATOM   6078 C CD2   . LEU E 2 115 ? 67.851  85.869  61.322  1.00 75.52  ? 115 LEU C CD2   1 
ATOM   6079 N N     . ALA E 2 116 ? 69.595  82.268  65.184  1.00 75.18  ? 116 ALA C N     1 
ATOM   6080 C CA    . ALA E 2 116 ? 70.668  81.878  66.084  1.00 74.92  ? 116 ALA C CA    1 
ATOM   6081 C C     . ALA E 2 116 ? 70.901  80.369  66.001  1.00 74.79  ? 116 ALA C C     1 
ATOM   6082 O O     . ALA E 2 116 ? 72.030  79.902  66.087  1.00 75.61  ? 116 ALA C O     1 
ATOM   6083 C CB    . ALA E 2 116 ? 70.316  82.280  67.511  1.00 74.72  ? 116 ALA C CB    1 
ATOM   6084 N N     . GLN E 2 117 ? 69.831  79.603  65.829  1.00 74.32  ? 117 GLN C N     1 
ATOM   6085 C CA    . GLN E 2 117 ? 69.960  78.159  65.739  1.00 73.61  ? 117 GLN C CA    1 
ATOM   6086 C C     . GLN E 2 117 ? 70.433  77.759  64.353  1.00 72.91  ? 117 GLN C C     1 
ATOM   6087 O O     . GLN E 2 117 ? 70.445  76.579  64.003  1.00 73.00  ? 117 GLN C O     1 
ATOM   6088 C CB    . GLN E 2 117 ? 68.623  77.496  66.063  1.00 74.27  ? 117 GLN C CB    1 
ATOM   6089 C CG    . GLN E 2 117 ? 68.118  77.844  67.454  1.00 75.39  ? 117 GLN C CG    1 
ATOM   6090 C CD    . GLN E 2 117 ? 66.815  77.166  67.782  1.00 76.19  ? 117 GLN C CD    1 
ATOM   6091 O OE1   . GLN E 2 117 ? 66.737  75.936  67.827  1.00 77.33  ? 117 GLN C OE1   1 
ATOM   6092 N NE2   . GLN E 2 117 ? 65.775  77.964  68.014  1.00 76.36  ? 117 GLN C NE2   1 
ATOM   6093 N N     . ARG E 2 118 ? 70.826  78.756  63.569  1.00 72.12  ? 118 ARG C N     1 
ATOM   6094 C CA    . ARG E 2 118 ? 71.320  78.536  62.215  1.00 71.40  ? 118 ARG C CA    1 
ATOM   6095 C C     . ARG E 2 118 ? 70.438  77.628  61.366  1.00 70.48  ? 118 ARG C C     1 
ATOM   6096 O O     . ARG E 2 118 ? 70.894  76.610  60.843  1.00 70.33  ? 118 ARG C O     1 
ATOM   6097 C CB    . ARG E 2 118 ? 72.746  77.974  62.259  1.00 72.05  ? 118 ARG C CB    1 
ATOM   6098 C CG    . ARG E 2 118 ? 73.771  78.958  62.819  1.00 72.94  ? 118 ARG C CG    1 
ATOM   6099 C CD    . ARG E 2 118 ? 73.932  80.167  61.898  1.00 73.59  ? 118 ARG C CD    1 
ATOM   6100 N NE    . ARG E 2 118 ? 74.831  81.188  62.441  1.00 74.64  ? 118 ARG C NE    1 
ATOM   6101 C CZ    . ARG E 2 118 ? 74.557  81.957  63.493  1.00 74.99  ? 118 ARG C CZ    1 
ATOM   6102 N NH1   . ARG E 2 118 ? 73.400  81.827  64.131  1.00 75.28  ? 118 ARG C NH1   1 
ATOM   6103 N NH2   . ARG E 2 118 ? 75.438  82.861  63.906  1.00 75.15  ? 118 ARG C NH2   1 
ATOM   6104 N N     . VAL E 2 119 ? 69.172  78.005  61.231  1.00 69.37  ? 119 VAL C N     1 
ATOM   6105 C CA    . VAL E 2 119 ? 68.229  77.244  60.421  1.00 68.17  ? 119 VAL C CA    1 
ATOM   6106 C C     . VAL E 2 119 ? 68.574  77.498  58.953  1.00 67.52  ? 119 VAL C C     1 
ATOM   6107 O O     . VAL E 2 119 ? 69.164  78.526  58.619  1.00 67.36  ? 119 VAL C O     1 
ATOM   6108 C CB    . VAL E 2 119 ? 66.788  77.708  60.685  1.00 68.16  ? 119 VAL C CB    1 
ATOM   6109 C CG1   . VAL E 2 119 ? 66.427  77.468  62.143  1.00 68.11  ? 119 VAL C CG1   1 
ATOM   6110 C CG2   . VAL E 2 119 ? 66.656  79.189  60.362  1.00 67.86  ? 119 VAL C CG2   1 
ATOM   6111 N N     . SER E 2 120 ? 68.216  76.571  58.075  1.00 66.53  ? 120 SER C N     1 
ATOM   6112 C CA    . SER E 2 120 ? 68.516  76.754  56.665  1.00 65.84  ? 120 SER C CA    1 
ATOM   6113 C C     . SER E 2 120 ? 67.363  77.438  55.940  1.00 65.67  ? 120 SER C C     1 
ATOM   6114 O O     . SER E 2 120 ? 67.427  77.655  54.730  1.00 66.14  ? 120 SER C O     1 
ATOM   6115 C CB    . SER E 2 120 ? 68.806  75.407  56.009  1.00 65.96  ? 120 SER C CB    1 
ATOM   6116 O OG    . SER E 2 120 ? 67.680  74.549  56.086  1.00 66.19  ? 120 SER C OG    1 
ATOM   6117 N N     . GLY E 2 121 ? 66.311  77.770  56.683  1.00 64.97  ? 121 GLY C N     1 
ATOM   6118 C CA    . GLY E 2 121 ? 65.149  78.420  56.097  1.00 63.99  ? 121 GLY C CA    1 
ATOM   6119 C C     . GLY E 2 121 ? 64.076  78.721  57.134  1.00 63.12  ? 121 GLY C C     1 
ATOM   6120 O O     . GLY E 2 121 ? 64.023  78.080  58.180  1.00 63.12  ? 121 GLY C O     1 
ATOM   6121 N N     . LEU E 2 122 ? 63.228  79.705  56.859  1.00 61.79  ? 122 LEU C N     1 
ATOM   6122 C CA    . LEU E 2 122 ? 62.169  80.048  57.788  1.00 60.49  ? 122 LEU C CA    1 
ATOM   6123 C C     . LEU E 2 122 ? 60.785  79.942  57.171  1.00 59.64  ? 122 LEU C C     1 
ATOM   6124 O O     . LEU E 2 122 ? 60.609  80.137  55.969  1.00 59.50  ? 122 LEU C O     1 
ATOM   6125 C CB    . LEU E 2 122 ? 62.340  81.474  58.314  1.00 60.55  ? 122 LEU C CB    1 
ATOM   6126 C CG    . LEU E 2 122 ? 63.489  81.788  59.261  1.00 61.38  ? 122 LEU C CG    1 
ATOM   6127 C CD1   . LEU E 2 122 ? 63.165  83.061  60.029  1.00 61.28  ? 122 LEU C CD1   1 
ATOM   6128 C CD2   . LEU E 2 122 ? 63.668  80.644  60.246  1.00 62.26  ? 122 LEU C CD2   1 
ATOM   6129 N N     . ILE E 2 123 ? 59.809  79.605  58.009  1.00 58.11  ? 123 ILE C N     1 
ATOM   6130 C CA    . ILE E 2 123 ? 58.416  79.546  57.600  1.00 56.55  ? 123 ILE C CA    1 
ATOM   6131 C C     . ILE E 2 123 ? 57.765  80.424  58.645  1.00 56.48  ? 123 ILE C C     1 
ATOM   6132 O O     . ILE E 2 123 ? 57.773  80.091  59.828  1.00 57.00  ? 123 ILE C O     1 
ATOM   6133 C CB    . ILE E 2 123 ? 57.819  78.138  57.677  1.00 55.51  ? 123 ILE C CB    1 
ATOM   6134 C CG1   . ILE E 2 123 ? 58.382  77.272  56.555  1.00 54.99  ? 123 ILE C CG1   1 
ATOM   6135 C CG2   . ILE E 2 123 ? 56.309  78.217  57.538  1.00 54.77  ? 123 ILE C CG2   1 
ATOM   6136 C CD1   . ILE E 2 123 ? 57.788  75.878  56.502  1.00 54.64  ? 123 ILE C CD1   1 
ATOM   6137 N N     . ILE E 2 124 ? 57.242  81.564  58.212  1.00 56.10  ? 124 ILE C N     1 
ATOM   6138 C CA    . ILE E 2 124 ? 56.607  82.508  59.121  1.00 55.53  ? 124 ILE C CA    1 
ATOM   6139 C C     . ILE E 2 124 ? 55.097  82.396  59.013  1.00 55.61  ? 124 ILE C C     1 
ATOM   6140 O O     . ILE E 2 124 ? 54.515  82.788  58.009  1.00 55.97  ? 124 ILE C O     1 
ATOM   6141 C CB    . ILE E 2 124 ? 57.004  83.965  58.786  1.00 54.95  ? 124 ILE C CB    1 
ATOM   6142 C CG1   . ILE E 2 124 ? 58.506  84.061  58.518  1.00 54.08  ? 124 ILE C CG1   1 
ATOM   6143 C CG2   . ILE E 2 124 ? 56.625  84.887  59.939  1.00 54.20  ? 124 ILE C CG2   1 
ATOM   6144 C CD1   . ILE E 2 124 ? 59.334  83.976  59.741  1.00 54.01  ? 124 ILE C CD1   1 
ATOM   6145 N N     . ASN E 2 125 ? 54.469  81.834  60.036  1.00 55.85  ? 125 ASN C N     1 
ATOM   6146 C CA    . ASN E 2 125 ? 53.020  81.705  60.057  1.00 56.17  ? 125 ASN C CA    1 
ATOM   6147 C C     . ASN E 2 125 ? 52.566  82.652  61.144  1.00 56.28  ? 125 ASN C C     1 
ATOM   6148 O O     . ASN E 2 125 ? 52.183  82.231  62.238  1.00 56.51  ? 125 ASN C O     1 
ATOM   6149 C CB    . ASN E 2 125 ? 52.593  80.291  60.411  1.00 56.49  ? 125 ASN C CB    1 
ATOM   6150 C CG    . ASN E 2 125 ? 51.093  80.145  60.485  1.00 57.64  ? 125 ASN C CG    1 
ATOM   6151 O OD1   . ASN E 2 125 ? 50.587  79.115  60.919  1.00 59.12  ? 125 ASN C OD1   1 
ATOM   6152 N ND2   . ASN E 2 125 ? 50.367  81.176  60.056  1.00 58.28  ? 125 ASN C ND2   1 
ATOM   6153 N N     . TYR E 2 126 ? 52.632  83.939  60.832  1.00 56.13  ? 126 TYR C N     1 
ATOM   6154 C CA    . TYR E 2 126 ? 52.266  84.983  61.768  1.00 56.06  ? 126 TYR C CA    1 
ATOM   6155 C C     . TYR E 2 126 ? 51.752  86.172  60.966  1.00 55.62  ? 126 TYR C C     1 
ATOM   6156 O O     . TYR E 2 126 ? 52.358  86.564  59.976  1.00 55.97  ? 126 TYR C O     1 
ATOM   6157 C CB    . TYR E 2 126 ? 53.501  85.356  62.592  1.00 56.22  ? 126 TYR C CB    1 
ATOM   6158 C CG    . TYR E 2 126 ? 53.248  86.358  63.679  1.00 56.99  ? 126 TYR C CG    1 
ATOM   6159 C CD1   . TYR E 2 126 ? 53.289  87.724  63.415  1.00 57.21  ? 126 TYR C CD1   1 
ATOM   6160 C CD2   . TYR E 2 126 ? 52.941  85.940  64.971  1.00 57.25  ? 126 TYR C CD2   1 
ATOM   6161 C CE1   . TYR E 2 126 ? 53.032  88.654  64.406  1.00 58.02  ? 126 TYR C CE1   1 
ATOM   6162 C CE2   . TYR E 2 126 ? 52.675  86.863  65.979  1.00 58.19  ? 126 TYR C CE2   1 
ATOM   6163 C CZ    . TYR E 2 126 ? 52.722  88.223  65.691  1.00 58.75  ? 126 TYR C CZ    1 
ATOM   6164 O OH    . TYR E 2 126 ? 52.455  89.152  66.678  1.00 59.22  ? 126 TYR C OH    1 
ATOM   6165 N N     . PRO E 2 127 ? 50.620  86.762  61.386  1.00 55.61  ? 127 PRO C N     1 
ATOM   6166 C CA    . PRO E 2 127 ? 50.017  87.911  60.697  1.00 55.02  ? 127 PRO C CA    1 
ATOM   6167 C C     . PRO E 2 127 ? 50.976  89.099  60.559  1.00 54.98  ? 127 PRO C C     1 
ATOM   6168 O O     . PRO E 2 127 ? 51.399  89.701  61.547  1.00 55.24  ? 127 PRO C O     1 
ATOM   6169 C CB    . PRO E 2 127 ? 48.798  88.214  61.559  1.00 54.33  ? 127 PRO C CB    1 
ATOM   6170 C CG    . PRO E 2 127 ? 49.277  87.859  62.922  1.00 54.20  ? 127 PRO C CG    1 
ATOM   6171 C CD    . PRO E 2 127 ? 49.972  86.546  62.691  1.00 54.89  ? 127 PRO C CD    1 
ATOM   6172 N N     . LEU E 2 128 ? 51.299  89.441  59.319  1.00 54.70  ? 128 LEU C N     1 
ATOM   6173 C CA    . LEU E 2 128 ? 52.232  90.523  59.043  1.00 54.09  ? 128 LEU C CA    1 
ATOM   6174 C C     . LEU E 2 128 ? 51.765  91.479  57.947  1.00 53.99  ? 128 LEU C C     1 
ATOM   6175 O O     . LEU E 2 128 ? 51.409  91.043  56.850  1.00 53.56  ? 128 LEU C O     1 
ATOM   6176 C CB    . LEU E 2 128 ? 53.565  89.908  58.625  1.00 53.66  ? 128 LEU C CB    1 
ATOM   6177 C CG    . LEU E 2 128 ? 54.771  89.950  59.559  1.00 53.21  ? 128 LEU C CG    1 
ATOM   6178 C CD1   . LEU E 2 128 ? 54.341  90.035  60.994  1.00 52.77  ? 128 LEU C CD1   1 
ATOM   6179 C CD2   . LEU E 2 128 ? 55.623  88.723  59.287  1.00 52.50  ? 128 LEU C CD2   1 
ATOM   6180 N N     . ASP E 2 129 ? 51.762  92.779  58.239  1.00 54.16  ? 129 ASP C N     1 
ATOM   6181 C CA    . ASP E 2 129 ? 51.393  93.763  57.221  1.00 54.37  ? 129 ASP C CA    1 
ATOM   6182 C C     . ASP E 2 129 ? 52.557  93.774  56.220  1.00 54.06  ? 129 ASP C C     1 
ATOM   6183 O O     . ASP E 2 129 ? 53.664  93.324  56.543  1.00 53.83  ? 129 ASP C O     1 
ATOM   6184 C CB    . ASP E 2 129 ? 51.183  95.152  57.844  1.00 54.32  ? 129 ASP C CB    1 
ATOM   6185 C CG    . ASP E 2 129 ? 49.797  95.305  58.493  1.00 56.26  ? 129 ASP C CG    1 
ATOM   6186 O OD1   . ASP E 2 129 ? 49.476  96.411  59.010  1.00 55.33  ? 129 ASP C OD1   1 
ATOM   6187 O OD2   . ASP E 2 129 ? 49.021  94.311  58.486  1.00 57.28  ? 129 ASP C OD2   1 
ATOM   6188 N N     . ASP E 2 130 ? 52.313  94.268  55.011  1.00 53.78  ? 130 ASP C N     1 
ATOM   6189 C CA    . ASP E 2 130 ? 53.335  94.279  53.969  1.00 54.17  ? 130 ASP C CA    1 
ATOM   6190 C C     . ASP E 2 130 ? 54.748  94.734  54.336  1.00 54.24  ? 130 ASP C C     1 
ATOM   6191 O O     . ASP E 2 130 ? 55.729  94.025  54.092  1.00 52.96  ? 130 ASP C O     1 
ATOM   6192 C CB    . ASP E 2 130 ? 52.845  95.097  52.773  1.00 54.85  ? 130 ASP C CB    1 
ATOM   6193 C CG    . ASP E 2 130 ? 51.728  94.406  52.019  1.00 55.69  ? 130 ASP C CG    1 
ATOM   6194 O OD1   . ASP E 2 130 ? 51.354  94.880  50.919  1.00 56.19  ? 130 ASP C OD1   1 
ATOM   6195 O OD2   . ASP E 2 130 ? 51.224  93.384  52.530  1.00 55.79  ? 130 ASP C OD2   1 
ATOM   6196 N N     . GLN E 2 131 ? 54.873  95.918  54.914  1.00 54.99  ? 131 GLN C N     1 
ATOM   6197 C CA    . GLN E 2 131 ? 56.204  96.399  55.241  1.00 56.02  ? 131 GLN C CA    1 
ATOM   6198 C C     . GLN E 2 131 ? 56.868  95.615  56.359  1.00 55.59  ? 131 GLN C C     1 
ATOM   6199 O O     . GLN E 2 131 ? 58.071  95.380  56.317  1.00 55.49  ? 131 GLN C O     1 
ATOM   6200 C CB    . GLN E 2 131 ? 56.152  97.907  55.509  1.00 56.90  ? 131 GLN C CB    1 
ATOM   6201 C CG    . GLN E 2 131 ? 55.756  98.658  54.226  1.00 58.44  ? 131 GLN C CG    1 
ATOM   6202 C CD    . GLN E 2 131 ? 55.743  100.159 54.368  1.00 59.77  ? 131 GLN C CD    1 
ATOM   6203 O OE1   . GLN E 2 131 ? 56.796  100.791 54.532  1.00 60.06  ? 131 GLN C OE1   1 
ATOM   6204 N NE2   . GLN E 2 131 ? 54.545  100.749 54.305  1.00 59.70  ? 131 GLN C NE2   1 
ATOM   6205 N N     . ASP E 2 132 ? 56.079  95.183  57.340  1.00 55.78  ? 132 ASP C N     1 
ATOM   6206 C CA    . ASP E 2 132 ? 56.594  94.368  58.444  1.00 55.41  ? 132 ASP C CA    1 
ATOM   6207 C C     . ASP E 2 132 ? 57.084  93.035  57.861  1.00 54.90  ? 132 ASP C C     1 
ATOM   6208 O O     . ASP E 2 132 ? 58.168  92.562  58.195  1.00 54.34  ? 132 ASP C O     1 
ATOM   6209 C CB    . ASP E 2 132 ? 55.491  94.134  59.478  1.00 56.10  ? 132 ASP C CB    1 
ATOM   6210 C CG    . ASP E 2 132 ? 55.194  95.385  60.304  1.00 57.46  ? 132 ASP C CG    1 
ATOM   6211 O OD1   . ASP E 2 132 ? 54.044  95.533  60.785  1.00 58.02  ? 132 ASP C OD1   1 
ATOM   6212 O OD2   . ASP E 2 132 ? 56.118  96.217  60.485  1.00 57.10  ? 132 ASP C OD2   1 
ATOM   6213 N N     . ALA E 2 133 ? 56.296  92.440  56.970  1.00 54.39  ? 133 ALA C N     1 
ATOM   6214 C CA    . ALA E 2 133 ? 56.705  91.194  56.340  1.00 54.16  ? 133 ALA C CA    1 
ATOM   6215 C C     . ALA E 2 133 ? 58.033  91.410  55.619  1.00 54.58  ? 133 ALA C C     1 
ATOM   6216 O O     . ALA E 2 133 ? 58.965  90.623  55.770  1.00 54.18  ? 133 ALA C O     1 
ATOM   6217 C CB    . ALA E 2 133 ? 55.651  90.730  55.363  1.00 53.23  ? 133 ALA C CB    1 
ATOM   6218 N N     . ILE E 2 134 ? 58.118  92.489  54.842  1.00 55.56  ? 134 ILE C N     1 
ATOM   6219 C CA    . ILE E 2 134 ? 59.334  92.804  54.092  1.00 55.92  ? 134 ILE C CA    1 
ATOM   6220 C C     . ILE E 2 134 ? 60.511  93.015  55.048  1.00 56.25  ? 134 ILE C C     1 
ATOM   6221 O O     . ILE E 2 134 ? 61.640  92.611  54.766  1.00 55.77  ? 134 ILE C O     1 
ATOM   6222 C CB    . ILE E 2 134 ? 59.125  94.063  53.205  1.00 56.15  ? 134 ILE C CB    1 
ATOM   6223 C CG1   . ILE E 2 134 ? 58.136  93.737  52.084  1.00 56.37  ? 134 ILE C CG1   1 
ATOM   6224 C CG2   . ILE E 2 134 ? 60.442  94.517  52.600  1.00 55.45  ? 134 ILE C CG2   1 
ATOM   6225 C CD1   . ILE E 2 134 ? 57.811  94.906  51.195  1.00 56.55  ? 134 ILE C CD1   1 
ATOM   6226 N N     . ALA E 2 135 ? 60.242  93.647  56.183  1.00 56.84  ? 135 ALA C N     1 
ATOM   6227 C CA    . ALA E 2 135 ? 61.280  93.874  57.176  1.00 58.13  ? 135 ALA C CA    1 
ATOM   6228 C C     . ALA E 2 135 ? 61.795  92.516  57.679  1.00 60.13  ? 135 ALA C C     1 
ATOM   6229 O O     . ALA E 2 135 ? 63.004  92.245  57.648  1.00 60.37  ? 135 ALA C O     1 
ATOM   6230 C CB    . ALA E 2 135 ? 60.723  94.680  58.320  1.00 56.64  ? 135 ALA C CB    1 
ATOM   6231 N N     . VAL E 2 136 ? 60.868  91.665  58.133  1.00 61.91  ? 136 VAL C N     1 
ATOM   6232 C CA    . VAL E 2 136 ? 61.211  90.333  58.630  1.00 62.96  ? 136 VAL C CA    1 
ATOM   6233 C C     . VAL E 2 136 ? 61.995  89.584  57.567  1.00 63.87  ? 136 VAL C C     1 
ATOM   6234 O O     . VAL E 2 136 ? 63.059  89.040  57.831  1.00 63.92  ? 136 VAL C O     1 
ATOM   6235 C CB    . VAL E 2 136 ? 59.946  89.522  58.990  1.00 62.76  ? 136 VAL C CB    1 
ATOM   6236 C CG1   . VAL E 2 136 ? 60.299  88.054  59.175  1.00 62.29  ? 136 VAL C CG1   1 
ATOM   6237 C CG2   . VAL E 2 136 ? 59.324  90.080  60.264  1.00 61.88  ? 136 VAL C CG2   1 
ATOM   6238 N N     . GLU E 2 137 ? 61.456  89.560  56.361  1.00 65.19  ? 137 GLU C N     1 
ATOM   6239 C CA    . GLU E 2 137 ? 62.123  88.896  55.257  1.00 67.27  ? 137 GLU C CA    1 
ATOM   6240 C C     . GLU E 2 137 ? 63.561  89.395  55.155  1.00 68.11  ? 137 GLU C C     1 
ATOM   6241 O O     . GLU E 2 137 ? 64.473  88.622  54.891  1.00 68.02  ? 137 GLU C O     1 
ATOM   6242 C CB    . GLU E 2 137 ? 61.367  89.196  53.965  1.00 68.48  ? 137 GLU C CB    1 
ATOM   6243 C CG    . GLU E 2 137 ? 62.235  89.318  52.734  1.00 70.50  ? 137 GLU C CG    1 
ATOM   6244 C CD    . GLU E 2 137 ? 62.735  87.985  52.259  1.00 71.66  ? 137 GLU C CD    1 
ATOM   6245 O OE1   . GLU E 2 137 ? 61.900  87.137  51.874  1.00 72.42  ? 137 GLU C OE1   1 
ATOM   6246 O OE2   . GLU E 2 137 ? 63.964  87.784  52.272  1.00 72.77  ? 137 GLU C OE2   1 
ATOM   6247 N N     . ALA E 2 138 ? 63.758  90.690  55.380  1.00 69.28  ? 138 ALA C N     1 
ATOM   6248 C CA    . ALA E 2 138 ? 65.086  91.284  55.294  1.00 70.55  ? 138 ALA C CA    1 
ATOM   6249 C C     . ALA E 2 138 ? 66.003  90.817  56.421  1.00 71.65  ? 138 ALA C C     1 
ATOM   6250 O O     . ALA E 2 138 ? 67.197  90.606  56.209  1.00 71.74  ? 138 ALA C O     1 
ATOM   6251 C CB    . ALA E 2 138 ? 64.977  92.801  55.302  1.00 69.77  ? 138 ALA C CB    1 
ATOM   6252 N N     . ALA E 2 139 ? 65.444  90.659  57.618  1.00 72.85  ? 139 ALA C N     1 
ATOM   6253 C CA    . ALA E 2 139 ? 66.222  90.218  58.771  1.00 73.94  ? 139 ALA C CA    1 
ATOM   6254 C C     . ALA E 2 139 ? 66.756  88.797  58.602  1.00 75.07  ? 139 ALA C C     1 
ATOM   6255 O O     . ALA E 2 139 ? 67.744  88.426  59.230  1.00 75.53  ? 139 ALA C O     1 
ATOM   6256 C CB    . ALA E 2 139 ? 65.379  90.308  60.033  1.00 73.56  ? 139 ALA C CB    1 
ATOM   6257 N N     . CYS E 2 140 ? 66.101  88.007  57.755  1.00 76.28  ? 140 CYS C N     1 
ATOM   6258 C CA    . CYS E 2 140 ? 66.511  86.628  57.515  1.00 77.74  ? 140 CYS C CA    1 
ATOM   6259 C C     . CYS E 2 140 ? 67.823  86.561  56.756  1.00 78.38  ? 140 CYS C C     1 
ATOM   6260 O O     . CYS E 2 140 ? 67.878  86.151  55.592  1.00 78.55  ? 140 CYS C O     1 
ATOM   6261 C CB    . CYS E 2 140 ? 65.424  85.879  56.751  1.00 78.20  ? 140 CYS C CB    1 
ATOM   6262 S SG    . CYS E 2 140 ? 63.894  85.719  57.696  1.00 80.72  ? 140 CYS C SG    1 
ATOM   6263 N N     . THR E 2 141 ? 68.881  86.955  57.452  1.00 79.10  ? 141 THR C N     1 
ATOM   6264 C CA    . THR E 2 141 ? 70.233  86.988  56.913  1.00 79.68  ? 141 THR C CA    1 
ATOM   6265 C C     . THR E 2 141 ? 70.592  85.808  56.014  1.00 79.14  ? 141 THR C C     1 
ATOM   6266 O O     . THR E 2 141 ? 70.912  84.726  56.507  1.00 79.46  ? 141 THR C O     1 
ATOM   6267 C CB    . THR E 2 141 ? 71.279  87.040  58.057  1.00 80.52  ? 141 THR C CB    1 
ATOM   6268 O OG1   . THR E 2 141 ? 70.829  87.933  59.089  1.00 81.21  ? 141 THR C OG1   1 
ATOM   6269 C CG2   . THR E 2 141 ? 72.622  87.533  57.519  1.00 80.85  ? 141 THR C CG2   1 
ATOM   6270 N N     . ASN E 2 142 ? 70.529  86.017  54.700  1.00 78.22  ? 142 ASN C N     1 
ATOM   6271 C CA    . ASN E 2 142 ? 70.902  84.987  53.728  1.00 76.92  ? 142 ASN C CA    1 
ATOM   6272 C C     . ASN E 2 142 ? 69.972  83.771  53.576  1.00 74.89  ? 142 ASN C C     1 
ATOM   6273 O O     . ASN E 2 142 ? 70.004  83.093  52.544  1.00 74.72  ? 142 ASN C O     1 
ATOM   6274 C CB    . ASN E 2 142 ? 72.328  84.501  54.039  1.00 78.49  ? 142 ASN C CB    1 
ATOM   6275 C CG    . ASN E 2 142 ? 72.977  83.782  52.862  1.00 80.48  ? 142 ASN C CG    1 
ATOM   6276 O OD1   . ASN E 2 142 ? 72.523  82.714  52.437  1.00 81.65  ? 142 ASN C OD1   1 
ATOM   6277 N ND2   . ASN E 2 142 ? 74.048  84.369  52.329  1.00 80.89  ? 142 ASN C ND2   1 
ATOM   6278 N N     . VAL E 2 143 ? 69.143  83.489  54.576  1.00 72.31  ? 143 VAL C N     1 
ATOM   6279 C CA    . VAL E 2 143 ? 68.244  82.332  54.492  1.00 69.38  ? 143 VAL C CA    1 
ATOM   6280 C C     . VAL E 2 143 ? 66.861  82.650  53.938  1.00 66.74  ? 143 VAL C C     1 
ATOM   6281 O O     . VAL E 2 143 ? 66.272  83.683  54.261  1.00 66.63  ? 143 VAL C O     1 
ATOM   6282 C CB    . VAL E 2 143 ? 68.065  81.663  55.865  1.00 69.62  ? 143 VAL C CB    1 
ATOM   6283 C CG1   . VAL E 2 143 ? 69.372  81.011  56.293  1.00 69.67  ? 143 VAL C CG1   1 
ATOM   6284 C CG2   . VAL E 2 143 ? 67.630  82.699  56.889  1.00 69.78  ? 143 VAL C CG2   1 
ATOM   6285 N N     . PRO E 2 144 ? 66.321  81.754  53.096  1.00 64.15  ? 144 PRO C N     1 
ATOM   6286 C CA    . PRO E 2 144 ? 64.996  81.939  52.492  1.00 62.23  ? 144 PRO C CA    1 
ATOM   6287 C C     . PRO E 2 144 ? 63.846  81.938  53.506  1.00 60.63  ? 144 PRO C C     1 
ATOM   6288 O O     . PRO E 2 144 ? 63.882  81.227  54.514  1.00 60.57  ? 144 PRO C O     1 
ATOM   6289 C CB    . PRO E 2 144 ? 64.904  80.781  51.496  1.00 61.97  ? 144 PRO C CB    1 
ATOM   6290 C CG    . PRO E 2 144 ? 65.750  79.729  52.127  1.00 62.45  ? 144 PRO C CG    1 
ATOM   6291 C CD    . PRO E 2 144 ? 66.939  80.500  52.634  1.00 62.89  ? 144 PRO C CD    1 
ATOM   6292 N N     . ALA E 2 145 ? 62.829  82.747  53.229  1.00 58.37  ? 145 ALA C N     1 
ATOM   6293 C CA    . ALA E 2 145 ? 61.671  82.849  54.101  1.00 56.09  ? 145 ALA C CA    1 
ATOM   6294 C C     . ALA E 2 145 ? 60.388  82.636  53.301  1.00 54.94  ? 145 ALA C C     1 
ATOM   6295 O O     . ALA E 2 145 ? 60.259  83.121  52.177  1.00 54.82  ? 145 ALA C O     1 
ATOM   6296 C CB    . ALA E 2 145 ? 61.644  84.206  54.775  1.00 55.60  ? 145 ALA C CB    1 
ATOM   6297 N N     . LEU E 2 146 ? 59.450  81.890  53.884  1.00 52.92  ? 146 LEU C N     1 
ATOM   6298 C CA    . LEU E 2 146 ? 58.164  81.613  53.252  1.00 50.94  ? 146 LEU C CA    1 
ATOM   6299 C C     . LEU E 2 146 ? 57.094  82.086  54.232  1.00 49.86  ? 146 LEU C C     1 
ATOM   6300 O O     . LEU E 2 146 ? 57.141  81.742  55.412  1.00 49.83  ? 146 LEU C O     1 
ATOM   6301 C CB    . LEU E 2 146 ? 58.022  80.119  52.992  1.00 50.77  ? 146 LEU C CB    1 
ATOM   6302 C CG    . LEU E 2 146 ? 56.820  79.689  52.165  1.00 50.53  ? 146 LEU C CG    1 
ATOM   6303 C CD1   . LEU E 2 146 ? 56.769  80.505  50.887  1.00 49.87  ? 146 LEU C CD1   1 
ATOM   6304 C CD2   . LEU E 2 146 ? 56.935  78.208  51.849  1.00 49.36  ? 146 LEU C CD2   1 
ATOM   6305 N N     . PHE E 2 147 ? 56.141  82.883  53.752  1.00 47.95  ? 147 PHE C N     1 
ATOM   6306 C CA    . PHE E 2 147 ? 55.099  83.426  54.615  1.00 45.40  ? 147 PHE C CA    1 
ATOM   6307 C C     . PHE E 2 147 ? 53.747  82.773  54.378  1.00 45.79  ? 147 PHE C C     1 
ATOM   6308 O O     . PHE E 2 147 ? 53.393  82.441  53.241  1.00 45.90  ? 147 PHE C O     1 
ATOM   6309 C CB    . PHE E 2 147 ? 55.000  84.946  54.415  1.00 42.95  ? 147 PHE C CB    1 
ATOM   6310 C CG    . PHE E 2 147 ? 56.244  85.700  54.827  1.00 39.66  ? 147 PHE C CG    1 
ATOM   6311 C CD1   . PHE E 2 147 ? 57.406  85.632  54.063  1.00 38.43  ? 147 PHE C CD1   1 
ATOM   6312 C CD2   . PHE E 2 147 ? 56.268  86.435  56.013  1.00 37.55  ? 147 PHE C CD2   1 
ATOM   6313 C CE1   . PHE E 2 147 ? 58.576  86.288  54.493  1.00 37.55  ? 147 PHE C CE1   1 
ATOM   6314 C CE2   . PHE E 2 147 ? 57.432  87.087  56.444  1.00 36.32  ? 147 PHE C CE2   1 
ATOM   6315 C CZ    . PHE E 2 147 ? 58.583  87.010  55.689  1.00 35.25  ? 147 PHE C CZ    1 
ATOM   6316 N N     . LEU E 2 148 ? 52.989  82.585  55.458  1.00 46.45  ? 148 LEU C N     1 
ATOM   6317 C CA    . LEU E 2 148 ? 51.672  81.955  55.372  1.00 46.97  ? 148 LEU C CA    1 
ATOM   6318 C C     . LEU E 2 148 ? 50.547  82.853  55.882  1.00 47.72  ? 148 LEU C C     1 
ATOM   6319 O O     . LEU E 2 148 ? 49.369  82.497  55.782  1.00 48.03  ? 148 LEU C O     1 
ATOM   6320 C CB    . LEU E 2 148 ? 51.657  80.640  56.151  1.00 46.83  ? 148 LEU C CB    1 
ATOM   6321 C CG    . LEU E 2 148 ? 52.746  79.599  55.869  1.00 46.88  ? 148 LEU C CG    1 
ATOM   6322 C CD1   . LEU E 2 148 ? 52.383  78.307  56.611  1.00 47.31  ? 148 LEU C CD1   1 
ATOM   6323 C CD2   . LEU E 2 148 ? 52.863  79.326  54.369  1.00 46.69  ? 148 LEU C CD2   1 
ATOM   6324 N N     . ASP E 2 149 ? 50.893  84.006  56.446  1.00 47.97  ? 149 ASP C N     1 
ATOM   6325 C CA    . ASP E 2 149 ? 49.855  84.914  56.914  1.00 48.37  ? 149 ASP C CA    1 
ATOM   6326 C C     . ASP E 2 149 ? 50.108  86.352  56.467  1.00 47.63  ? 149 ASP C C     1 
ATOM   6327 O O     . ASP E 2 149 ? 50.267  87.265  57.278  1.00 46.78  ? 149 ASP C O     1 
ATOM   6328 C CB    . ASP E 2 149 ? 49.698  84.857  58.436  1.00 50.20  ? 149 ASP C CB    1 
ATOM   6329 C CG    . ASP E 2 149 ? 48.342  85.408  58.905  1.00 53.36  ? 149 ASP C CG    1 
ATOM   6330 O OD1   . ASP E 2 149 ? 47.520  85.847  58.052  1.00 54.59  ? 149 ASP C OD1   1 
ATOM   6331 O OD2   . ASP E 2 149 ? 48.089  85.401  60.134  1.00 55.19  ? 149 ASP C OD2   1 
ATOM   6332 N N     . VAL E 2 150 ? 50.160  86.523  55.152  1.00 46.95  ? 150 VAL C N     1 
ATOM   6333 C CA    . VAL E 2 150 ? 50.350  87.816  54.529  1.00 46.39  ? 150 VAL C CA    1 
ATOM   6334 C C     . VAL E 2 150 ? 49.352  87.872  53.380  1.00 47.31  ? 150 VAL C C     1 
ATOM   6335 O O     . VAL E 2 150 ? 48.707  86.872  53.046  1.00 47.51  ? 150 VAL C O     1 
ATOM   6336 C CB    . VAL E 2 150 ? 51.770  87.980  53.945  1.00 44.92  ? 150 VAL C CB    1 
ATOM   6337 C CG1   . VAL E 2 150 ? 52.790  88.031  55.052  1.00 44.17  ? 150 VAL C CG1   1 
ATOM   6338 C CG2   . VAL E 2 150 ? 52.068  86.850  52.989  1.00 45.17  ? 150 VAL C CG2   1 
ATOM   6339 N N     . SER E 2 151 ? 49.222  89.045  52.781  1.00 47.73  ? 151 SER C N     1 
ATOM   6340 C CA    . SER E 2 151 ? 48.335  89.234  51.651  1.00 47.60  ? 151 SER C CA    1 
ATOM   6341 C C     . SER E 2 151 ? 48.980  88.628  50.426  1.00 47.56  ? 151 SER C C     1 
ATOM   6342 O O     . SER E 2 151 ? 50.190  88.465  50.383  1.00 47.33  ? 151 SER C O     1 
ATOM   6343 C CB    . SER E 2 151 ? 48.136  90.725  51.398  1.00 47.37  ? 151 SER C CB    1 
ATOM   6344 O OG    . SER E 2 151 ? 47.450  90.933  50.179  1.00 47.00  ? 151 SER C OG    1 
ATOM   6345 N N     . ASP E 2 152 ? 48.170  88.294  49.432  1.00 48.53  ? 152 ASP C N     1 
ATOM   6346 C CA    . ASP E 2 152 ? 48.687  87.764  48.181  1.00 50.29  ? 152 ASP C CA    1 
ATOM   6347 C C     . ASP E 2 152 ? 49.433  88.894  47.468  1.00 50.61  ? 152 ASP C C     1 
ATOM   6348 O O     . ASP E 2 152 ? 50.203  88.666  46.539  1.00 52.11  ? 152 ASP C O     1 
ATOM   6349 C CB    . ASP E 2 152 ? 47.543  87.273  47.293  1.00 51.71  ? 152 ASP C CB    1 
ATOM   6350 C CG    . ASP E 2 152 ? 46.336  88.218  47.302  1.00 54.03  ? 152 ASP C CG    1 
ATOM   6351 O OD1   . ASP E 2 152 ? 45.414  88.029  46.474  1.00 55.74  ? 152 ASP C OD1   1 
ATOM   6352 O OD2   . ASP E 2 152 ? 46.286  89.142  48.142  1.00 54.96  ? 152 ASP C OD2   1 
ATOM   6353 N N     . GLN E 2 153 ? 49.202  90.119  47.919  1.00 50.32  ? 153 GLN C N     1 
ATOM   6354 C CA    . GLN E 2 153 ? 49.826  91.298  47.336  1.00 49.83  ? 153 GLN C CA    1 
ATOM   6355 C C     . GLN E 2 153 ? 51.177  91.643  47.949  1.00 49.60  ? 153 GLN C C     1 
ATOM   6356 O O     . GLN E 2 153 ? 51.823  92.605  47.541  1.00 50.14  ? 153 GLN C O     1 
ATOM   6357 C CB    . GLN E 2 153 ? 48.901  92.498  47.503  1.00 49.77  ? 153 GLN C CB    1 
ATOM   6358 C CG    . GLN E 2 153 ? 47.600  92.407  46.739  1.00 49.87  ? 153 GLN C CG    1 
ATOM   6359 C CD    . GLN E 2 153 ? 46.595  93.441  47.210  1.00 50.87  ? 153 GLN C CD    1 
ATOM   6360 O OE1   . GLN E 2 153 ? 45.548  93.618  46.587  1.00 51.11  ? 153 GLN C OE1   1 
ATOM   6361 N NE2   . GLN E 2 153 ? 46.902  94.123  48.329  1.00 49.78  ? 153 GLN C NE2   1 
ATOM   6362 N N     . THR E 2 154 ? 51.612  90.883  48.938  1.00 49.14  ? 154 THR C N     1 
ATOM   6363 C CA    . THR E 2 154 ? 52.890  91.186  49.554  1.00 48.96  ? 154 THR C CA    1 
ATOM   6364 C C     . THR E 2 154 ? 54.025  90.717  48.649  1.00 48.83  ? 154 THR C C     1 
ATOM   6365 O O     . THR E 2 154 ? 53.989  89.629  48.100  1.00 49.01  ? 154 THR C O     1 
ATOM   6366 C CB    . THR E 2 154 ? 52.990  90.539  50.933  1.00 48.61  ? 154 THR C CB    1 
ATOM   6367 O OG1   . THR E 2 154 ? 51.783  90.799  51.655  1.00 48.32  ? 154 THR C OG1   1 
ATOM   6368 C CG2   . THR E 2 154 ? 54.143  91.138  51.713  1.00 48.67  ? 154 THR C CG2   1 
ATOM   6369 N N     . PRO E 2 155 ? 55.048  91.551  48.467  1.00 49.10  ? 155 PRO C N     1 
ATOM   6370 C CA    . PRO E 2 155 ? 56.153  91.143  47.597  1.00 49.03  ? 155 PRO C CA    1 
ATOM   6371 C C     . PRO E 2 155 ? 57.180  90.235  48.264  1.00 48.61  ? 155 PRO C C     1 
ATOM   6372 O O     . PRO E 2 155 ? 58.307  90.645  48.508  1.00 49.36  ? 155 PRO C O     1 
ATOM   6373 C CB    . PRO E 2 155 ? 56.745  92.481  47.167  1.00 48.77  ? 155 PRO C CB    1 
ATOM   6374 C CG    . PRO E 2 155 ? 56.594  93.313  48.425  1.00 48.19  ? 155 PRO C CG    1 
ATOM   6375 C CD    . PRO E 2 155 ? 55.193  92.957  48.901  1.00 48.86  ? 155 PRO C CD    1 
ATOM   6376 N N     . ILE E 2 156 ? 56.781  89.006  48.569  1.00 48.39  ? 156 ILE C N     1 
ATOM   6377 C CA    . ILE E 2 156 ? 57.666  88.018  49.201  1.00 46.68  ? 156 ILE C CA    1 
ATOM   6378 C C     . ILE E 2 156 ? 57.160  86.627  48.886  1.00 45.88  ? 156 ILE C C     1 
ATOM   6379 O O     . ILE E 2 156 ? 56.105  86.465  48.278  1.00 45.61  ? 156 ILE C O     1 
ATOM   6380 C CB    . ILE E 2 156 ? 57.679  88.143  50.719  1.00 46.64  ? 156 ILE C CB    1 
ATOM   6381 C CG1   . ILE E 2 156 ? 56.238  88.212  51.218  1.00 46.92  ? 156 ILE C CG1   1 
ATOM   6382 C CG2   . ILE E 2 156 ? 58.514  89.327  51.146  1.00 46.23  ? 156 ILE C CG2   1 
ATOM   6383 C CD1   . ILE E 2 156 ? 56.128  88.474  52.683  1.00 47.60  ? 156 ILE C CD1   1 
ATOM   6384 N N     . ASN E 2 157 ? 57.920  85.619  49.289  1.00 45.55  ? 157 ASN C N     1 
ATOM   6385 C CA    . ASN E 2 157 ? 57.503  84.247  49.060  1.00 45.01  ? 157 ASN C CA    1 
ATOM   6386 C C     . ASN E 2 157 ? 56.387  83.933  50.044  1.00 43.54  ? 157 ASN C C     1 
ATOM   6387 O O     . ASN E 2 157 ? 56.490  84.232  51.246  1.00 42.29  ? 157 ASN C O     1 
ATOM   6388 C CB    . ASN E 2 157 ? 58.681  83.306  49.235  1.00 46.77  ? 157 ASN C CB    1 
ATOM   6389 C CG    . ASN E 2 157 ? 59.777  83.615  48.260  1.00 48.62  ? 157 ASN C CG    1 
ATOM   6390 O OD1   . ASN E 2 157 ? 59.508  83.789  47.064  1.00 49.73  ? 157 ASN C OD1   1 
ATOM   6391 N ND2   . ASN E 2 157 ? 61.019  83.700  48.749  1.00 48.36  ? 157 ASN C ND2   1 
ATOM   6392 N N     . SER E 2 158 ? 55.311  83.352  49.527  1.00 42.02  ? 158 SER C N     1 
ATOM   6393 C CA    . SER E 2 158 ? 54.182  83.058  50.373  1.00 42.42  ? 158 SER C CA    1 
ATOM   6394 C C     . SER E 2 158 ? 53.272  81.978  49.814  1.00 42.85  ? 158 SER C C     1 
ATOM   6395 O O     . SER E 2 158 ? 53.261  81.701  48.607  1.00 42.69  ? 158 SER C O     1 
ATOM   6396 C CB    . SER E 2 158 ? 53.362  84.343  50.592  1.00 42.31  ? 158 SER C CB    1 
ATOM   6397 O OG    . SER E 2 158 ? 52.679  84.734  49.401  1.00 40.68  ? 158 SER C OG    1 
ATOM   6398 N N     . ILE E 2 159 ? 52.506  81.368  50.713  1.00 43.00  ? 159 ILE C N     1 
ATOM   6399 C CA    . ILE E 2 159 ? 51.536  80.360  50.319  1.00 43.43  ? 159 ILE C CA    1 
ATOM   6400 C C     . ILE E 2 159 ? 50.328  80.607  51.186  1.00 43.30  ? 159 ILE C C     1 
ATOM   6401 O O     . ILE E 2 159 ? 50.436  80.668  52.414  1.00 43.51  ? 159 ILE C O     1 
ATOM   6402 C CB    . ILE E 2 159 ? 51.996  78.917  50.575  1.00 43.43  ? 159 ILE C CB    1 
ATOM   6403 C CG1   . ILE E 2 159 ? 53.394  78.676  50.011  1.00 45.03  ? 159 ILE C CG1   1 
ATOM   6404 C CG2   . ILE E 2 159 ? 51.045  77.977  49.889  1.00 43.50  ? 159 ILE C CG2   1 
ATOM   6405 C CD1   . ILE E 2 159 ? 53.789  77.200  49.974  1.00 45.40  ? 159 ILE C CD1   1 
ATOM   6406 N N     . ILE E 2 160 ? 49.180  80.777  50.545  1.00 42.92  ? 160 ILE C N     1 
ATOM   6407 C CA    . ILE E 2 160 ? 47.953  81.009  51.276  1.00 42.54  ? 160 ILE C CA    1 
ATOM   6408 C C     . ILE E 2 160 ? 46.795  80.370  50.543  1.00 42.93  ? 160 ILE C C     1 
ATOM   6409 O O     . ILE E 2 160 ? 46.906  79.994  49.373  1.00 42.13  ? 160 ILE C O     1 
ATOM   6410 C CB    . ILE E 2 160 ? 47.646  82.508  51.422  1.00 42.08  ? 160 ILE C CB    1 
ATOM   6411 C CG1   . ILE E 2 160 ? 47.392  83.112  50.039  1.00 42.06  ? 160 ILE C CG1   1 
ATOM   6412 C CG2   . ILE E 2 160 ? 48.782  83.213  52.151  1.00 40.71  ? 160 ILE C CG2   1 
ATOM   6413 C CD1   . ILE E 2 160 ? 47.115  84.595  50.081  1.00 42.78  ? 160 ILE C CD1   1 
ATOM   6414 N N     . PHE E 2 161 ? 45.679  80.213  51.241  1.00 43.61  ? 161 PHE C N     1 
ATOM   6415 C CA    . PHE E 2 161 ? 44.534  79.645  50.575  1.00 44.74  ? 161 PHE C CA    1 
ATOM   6416 C C     . PHE E 2 161 ? 43.902  80.753  49.748  1.00 45.26  ? 161 PHE C C     1 
ATOM   6417 O O     . PHE E 2 161 ? 44.036  81.946  50.061  1.00 45.42  ? 161 PHE C O     1 
ATOM   6418 C CB    . PHE E 2 161 ? 43.547  79.059  51.584  1.00 44.36  ? 161 PHE C CB    1 
ATOM   6419 C CG    . PHE E 2 161 ? 43.991  77.741  52.157  1.00 44.88  ? 161 PHE C CG    1 
ATOM   6420 C CD1   . PHE E 2 161 ? 44.498  77.657  53.448  1.00 44.33  ? 161 PHE C CD1   1 
ATOM   6421 C CD2   . PHE E 2 161 ? 43.957  76.582  51.376  1.00 45.14  ? 161 PHE C CD2   1 
ATOM   6422 C CE1   . PHE E 2 161 ? 44.968  76.449  53.951  1.00 44.30  ? 161 PHE C CE1   1 
ATOM   6423 C CE2   . PHE E 2 161 ? 44.428  75.367  51.876  1.00 44.30  ? 161 PHE C CE2   1 
ATOM   6424 C CZ    . PHE E 2 161 ? 44.933  75.306  53.165  1.00 44.21  ? 161 PHE C CZ    1 
ATOM   6425 N N     . SER E 2 162 ? 43.245  80.359  48.671  1.00 45.85  ? 162 SER C N     1 
ATOM   6426 C CA    . SER E 2 162 ? 42.602  81.319  47.807  1.00 47.00  ? 162 SER C CA    1 
ATOM   6427 C C     . SER E 2 162 ? 41.363  81.917  48.462  1.00 47.20  ? 162 SER C C     1 
ATOM   6428 O O     . SER E 2 162 ? 40.257  81.403  48.297  1.00 47.14  ? 162 SER C O     1 
ATOM   6429 C CB    . SER E 2 162 ? 42.215  80.654  46.488  1.00 46.70  ? 162 SER C CB    1 
ATOM   6430 O OG    . SER E 2 162 ? 41.490  81.561  45.686  1.00 48.18  ? 162 SER C OG    1 
ATOM   6431 N N     . HIS E 2 163 ? 41.548  83.001  49.208  1.00 48.08  ? 163 HIS C N     1 
ATOM   6432 C CA    . HIS E 2 163 ? 40.422  83.671  49.855  1.00 49.31  ? 163 HIS C CA    1 
ATOM   6433 C C     . HIS E 2 163 ? 39.451  84.134  48.791  1.00 49.47  ? 163 HIS C C     1 
ATOM   6434 O O     . HIS E 2 163 ? 38.257  84.219  49.026  1.00 49.04  ? 163 HIS C O     1 
ATOM   6435 C CB    . HIS E 2 163 ? 40.907  84.869  50.654  1.00 50.35  ? 163 HIS C CB    1 
ATOM   6436 C CG    . HIS E 2 163 ? 41.781  85.797  49.873  1.00 53.41  ? 163 HIS C CG    1 
ATOM   6437 N ND1   . HIS E 2 163 ? 41.300  86.930  49.250  1.00 54.34  ? 163 HIS C ND1   1 
ATOM   6438 C CD2   . HIS E 2 163 ? 43.113  85.765  49.627  1.00 54.19  ? 163 HIS C CD2   1 
ATOM   6439 C CE1   . HIS E 2 163 ? 42.301  87.559  48.659  1.00 55.42  ? 163 HIS C CE1   1 
ATOM   6440 N NE2   . HIS E 2 163 ? 43.411  86.873  48.874  1.00 55.69  ? 163 HIS C NE2   1 
ATOM   6441 N N     . GLU E 2 164 ? 39.987  84.437  47.614  1.00 50.56  ? 164 GLU C N     1 
ATOM   6442 C CA    . GLU E 2 164 ? 39.190  84.882  46.490  1.00 50.94  ? 164 GLU C CA    1 
ATOM   6443 C C     . GLU E 2 164 ? 38.176  83.797  46.153  1.00 49.85  ? 164 GLU C C     1 
ATOM   6444 O O     . GLU E 2 164 ? 37.001  84.079  45.951  1.00 48.98  ? 164 GLU C O     1 
ATOM   6445 C CB    . GLU E 2 164 ? 40.094  85.129  45.291  1.00 53.34  ? 164 GLU C CB    1 
ATOM   6446 C CG    . GLU E 2 164 ? 39.566  86.183  44.346  1.00 57.04  ? 164 GLU C CG    1 
ATOM   6447 C CD    . GLU E 2 164 ? 39.928  87.581  44.789  1.00 58.44  ? 164 GLU C CD    1 
ATOM   6448 O OE1   . GLU E 2 164 ? 39.193  88.524  44.417  1.00 60.31  ? 164 GLU C OE1   1 
ATOM   6449 O OE2   . GLU E 2 164 ? 40.949  87.737  45.492  1.00 58.66  ? 164 GLU C OE2   1 
ATOM   6450 N N     . ASP E 2 165 ? 38.640  82.552  46.094  1.00 49.14  ? 165 ASP C N     1 
ATOM   6451 C CA    . ASP E 2 165 ? 37.767  81.424  45.791  1.00 48.79  ? 165 ASP C CA    1 
ATOM   6452 C C     . ASP E 2 165 ? 36.819  81.076  46.942  1.00 48.25  ? 165 ASP C C     1 
ATOM   6453 O O     . ASP E 2 165 ? 35.650  80.728  46.717  1.00 47.42  ? 165 ASP C O     1 
ATOM   6454 C CB    . ASP E 2 165 ? 38.601  80.195  45.438  1.00 50.15  ? 165 ASP C CB    1 
ATOM   6455 C CG    . ASP E 2 165 ? 39.209  80.274  44.040  1.00 51.48  ? 165 ASP C CG    1 
ATOM   6456 O OD1   . ASP E 2 165 ? 38.453  80.414  43.058  1.00 53.19  ? 165 ASP C OD1   1 
ATOM   6457 O OD2   . ASP E 2 165 ? 40.444  80.183  43.913  1.00 52.95  ? 165 ASP C OD2   1 
ATOM   6458 N N     . GLY E 2 166 ? 37.326  81.181  48.171  1.00 47.31  ? 166 GLY C N     1 
ATOM   6459 C CA    . GLY E 2 166 ? 36.527  80.862  49.340  1.00 46.70  ? 166 GLY C CA    1 
ATOM   6460 C C     . GLY E 2 166 ? 35.334  81.770  49.544  1.00 46.20  ? 166 GLY C C     1 
ATOM   6461 O O     . GLY E 2 166 ? 34.210  81.303  49.761  1.00 45.95  ? 166 GLY C O     1 
ATOM   6462 N N     . THR E 2 167 ? 35.580  83.075  49.473  1.00 45.85  ? 167 THR C N     1 
ATOM   6463 C CA    . THR E 2 167 ? 34.531  84.070  49.652  1.00 45.10  ? 167 THR C CA    1 
ATOM   6464 C C     . THR E 2 167 ? 33.548  84.067  48.494  1.00 45.32  ? 167 THR C C     1 
ATOM   6465 O O     . THR E 2 167 ? 32.348  84.271  48.689  1.00 44.85  ? 167 THR C O     1 
ATOM   6466 C CB    . THR E 2 167 ? 35.133  85.449  49.810  1.00 44.21  ? 167 THR C CB    1 
ATOM   6467 O OG1   . THR E 2 167 ? 36.038  85.693  48.733  1.00 42.71  ? 167 THR C OG1   1 
ATOM   6468 C CG2   . THR E 2 167 ? 35.896  85.541  51.130  1.00 43.61  ? 167 THR C CG2   1 
ATOM   6469 N N     . ARG E 2 168 ? 34.045  83.819  47.287  1.00 45.82  ? 168 ARG C N     1 
ATOM   6470 C CA    . ARG E 2 168 ? 33.163  83.783  46.134  1.00 46.39  ? 168 ARG C CA    1 
ATOM   6471 C C     . ARG E 2 168 ? 32.221  82.600  46.290  1.00 46.51  ? 168 ARG C C     1 
ATOM   6472 O O     . ARG E 2 168 ? 31.008  82.724  46.111  1.00 47.12  ? 168 ARG C O     1 
ATOM   6473 C CB    . ARG E 2 168 ? 33.956  83.632  44.847  1.00 47.17  ? 168 ARG C CB    1 
ATOM   6474 C CG    . ARG E 2 168 ? 33.079  83.711  43.592  1.00 49.62  ? 168 ARG C CG    1 
ATOM   6475 C CD    . ARG E 2 168 ? 33.761  83.040  42.434  1.00 50.56  ? 168 ARG C CD    1 
ATOM   6476 N NE    . ARG E 2 168 ? 33.914  81.627  42.731  1.00 54.73  ? 168 ARG C NE    1 
ATOM   6477 C CZ    . ARG E 2 168 ? 34.853  80.855  42.215  1.00 56.34  ? 168 ARG C CZ    1 
ATOM   6478 N NH1   . ARG E 2 168 ? 35.721  81.381  41.373  1.00 59.64  ? 168 ARG C NH1   1 
ATOM   6479 N NH2   . ARG E 2 168 ? 34.927  79.573  42.543  1.00 56.50  ? 168 ARG C NH2   1 
ATOM   6480 N N     . LEU E 2 169 ? 32.793  81.445  46.617  1.00 46.32  ? 169 LEU C N     1 
ATOM   6481 C CA    . LEU E 2 169 ? 32.023  80.225  46.827  1.00 45.55  ? 169 LEU C CA    1 
ATOM   6482 C C     . LEU E 2 169 ? 30.924  80.474  47.864  1.00 45.20  ? 169 LEU C C     1 
ATOM   6483 O O     . LEU E 2 169 ? 29.773  80.087  47.670  1.00 45.02  ? 169 LEU C O     1 
ATOM   6484 C CB    . LEU E 2 169 ? 32.961  79.123  47.306  1.00 45.42  ? 169 LEU C CB    1 
ATOM   6485 C CG    . LEU E 2 169 ? 33.276  77.905  46.430  1.00 45.44  ? 169 LEU C CG    1 
ATOM   6486 C CD1   . LEU E 2 169 ? 33.127  78.184  44.964  1.00 44.63  ? 169 LEU C CD1   1 
ATOM   6487 C CD2   . LEU E 2 169 ? 34.692  77.485  46.743  1.00 45.52  ? 169 LEU C CD2   1 
ATOM   6488 N N     . GLY E 2 170 ? 31.285  81.122  48.967  1.00 44.60  ? 170 GLY C N     1 
ATOM   6489 C CA    . GLY E 2 170 ? 30.304  81.416  49.989  1.00 44.88  ? 170 GLY C CA    1 
ATOM   6490 C C     . GLY E 2 170 ? 29.221  82.362  49.496  1.00 45.56  ? 170 GLY C C     1 
ATOM   6491 O O     . GLY E 2 170 ? 28.028  82.068  49.611  1.00 45.62  ? 170 GLY C O     1 
ATOM   6492 N N     . VAL E 2 171 ? 29.630  83.500  48.938  1.00 45.96  ? 171 VAL C N     1 
ATOM   6493 C CA    . VAL E 2 171 ? 28.674  84.482  48.431  1.00 46.26  ? 171 VAL C CA    1 
ATOM   6494 C C     . VAL E 2 171 ? 27.796  83.913  47.334  1.00 46.57  ? 171 VAL C C     1 
ATOM   6495 O O     . VAL E 2 171 ? 26.574  84.067  47.370  1.00 46.68  ? 171 VAL C O     1 
ATOM   6496 C CB    . VAL E 2 171 ? 29.374  85.754  47.873  1.00 46.34  ? 171 VAL C CB    1 
ATOM   6497 C CG1   . VAL E 2 171 ? 28.368  86.615  47.135  1.00 45.91  ? 171 VAL C CG1   1 
ATOM   6498 C CG2   . VAL E 2 171 ? 29.991  86.559  49.004  1.00 45.73  ? 171 VAL C CG2   1 
ATOM   6499 N N     . GLU E 2 172 ? 28.405  83.251  46.361  1.00 46.84  ? 172 GLU C N     1 
ATOM   6500 C CA    . GLU E 2 172 ? 27.622  82.699  45.270  1.00 48.35  ? 172 GLU C CA    1 
ATOM   6501 C C     . GLU E 2 172 ? 26.635  81.643  45.740  1.00 48.40  ? 172 GLU C C     1 
ATOM   6502 O O     . GLU E 2 172 ? 25.562  81.491  45.164  1.00 49.08  ? 172 GLU C O     1 
ATOM   6503 C CB    . GLU E 2 172 ? 28.542  82.150  44.180  1.00 49.01  ? 172 GLU C CB    1 
ATOM   6504 C CG    . GLU E 2 172 ? 29.241  83.271  43.414  1.00 51.86  ? 172 GLU C CG    1 
ATOM   6505 C CD    . GLU E 2 172 ? 30.087  82.797  42.248  1.00 53.28  ? 172 GLU C CD    1 
ATOM   6506 O OE1   . GLU E 2 172 ? 30.594  83.674  41.511  1.00 55.11  ? 172 GLU C OE1   1 
ATOM   6507 O OE2   . GLU E 2 172 ? 30.252  81.571  42.056  1.00 53.91  ? 172 GLU C OE2   1 
ATOM   6508 N N     . HIS E 2 173 ? 26.985  80.937  46.807  1.00 48.35  ? 173 HIS C N     1 
ATOM   6509 C CA    . HIS E 2 173 ? 26.116  79.902  47.348  1.00 47.69  ? 173 HIS C CA    1 
ATOM   6510 C C     . HIS E 2 173 ? 24.880  80.541  47.980  1.00 47.85  ? 173 HIS C C     1 
ATOM   6511 O O     . HIS E 2 173 ? 23.746  80.113  47.730  1.00 47.88  ? 173 HIS C O     1 
ATOM   6512 C CB    . HIS E 2 173 ? 26.881  79.076  48.380  1.00 47.01  ? 173 HIS C CB    1 
ATOM   6513 C CG    . HIS E 2 173 ? 26.085  77.961  48.977  1.00 45.38  ? 173 HIS C CG    1 
ATOM   6514 N ND1   . HIS E 2 173 ? 25.619  76.898  48.233  1.00 45.24  ? 173 HIS C ND1   1 
ATOM   6515 C CD2   . HIS E 2 173 ? 25.665  77.748  50.247  1.00 44.22  ? 173 HIS C CD2   1 
ATOM   6516 C CE1   . HIS E 2 173 ? 24.947  76.079  49.020  1.00 44.78  ? 173 HIS C CE1   1 
ATOM   6517 N NE2   . HIS E 2 173 ? 24.961  76.571  50.246  1.00 44.12  ? 173 HIS C NE2   1 
ATOM   6518 N N     . LEU E 2 174 ? 25.093  81.562  48.799  1.00 47.64  ? 174 LEU C N     1 
ATOM   6519 C CA    . LEU E 2 174 ? 23.973  82.245  49.426  1.00 48.00  ? 174 LEU C CA    1 
ATOM   6520 C C     . LEU E 2 174 ? 23.087  82.916  48.369  1.00 49.18  ? 174 LEU C C     1 
ATOM   6521 O O     . LEU E 2 174 ? 21.853  82.902  48.488  1.00 49.39  ? 174 LEU C O     1 
ATOM   6522 C CB    . LEU E 2 174 ? 24.477  83.288  50.425  1.00 47.17  ? 174 LEU C CB    1 
ATOM   6523 C CG    . LEU E 2 174 ? 25.142  82.726  51.683  1.00 46.85  ? 174 LEU C CG    1 
ATOM   6524 C CD1   . LEU E 2 174 ? 25.492  83.859  52.614  1.00 45.72  ? 174 LEU C CD1   1 
ATOM   6525 C CD2   . LEU E 2 174 ? 24.205  81.732  52.360  1.00 45.57  ? 174 LEU C CD2   1 
ATOM   6526 N N     . VAL E 2 175 ? 23.709  83.492  47.334  1.00 49.27  ? 175 VAL C N     1 
ATOM   6527 C CA    . VAL E 2 175 ? 22.959  84.157  46.274  1.00 49.12  ? 175 VAL C CA    1 
ATOM   6528 C C     . VAL E 2 175 ? 22.113  83.142  45.520  1.00 49.21  ? 175 VAL C C     1 
ATOM   6529 O O     . VAL E 2 175 ? 20.925  83.357  45.303  1.00 49.86  ? 175 VAL C O     1 
ATOM   6530 C CB    . VAL E 2 175 ? 23.900  84.896  45.271  1.00 49.23  ? 175 VAL C CB    1 
ATOM   6531 C CG1   . VAL E 2 175 ? 23.147  85.272  44.014  1.00 46.43  ? 175 VAL C CG1   1 
ATOM   6532 C CG2   . VAL E 2 175 ? 24.479  86.146  45.922  1.00 48.64  ? 175 VAL C CG2   1 
ATOM   6533 N N     . ALA E 2 176 ? 22.717  82.028  45.128  1.00 48.94  ? 176 ALA C N     1 
ATOM   6534 C CA    . ALA E 2 176 ? 21.976  81.000  44.403  1.00 49.07  ? 176 ALA C CA    1 
ATOM   6535 C C     . ALA E 2 176 ? 20.783  80.511  45.218  1.00 49.45  ? 176 ALA C C     1 
ATOM   6536 O O     . ALA E 2 176 ? 19.796  80.023  44.676  1.00 49.77  ? 176 ALA C O     1 
ATOM   6537 C CB    . ALA E 2 176 ? 22.887  79.841  44.056  1.00 47.44  ? 176 ALA C CB    1 
ATOM   6538 N N     . LEU E 2 177 ? 20.876  80.643  46.531  1.00 50.58  ? 177 LEU C N     1 
ATOM   6539 C CA    . LEU E 2 177 ? 19.792  80.217  47.398  1.00 51.62  ? 177 LEU C CA    1 
ATOM   6540 C C     . LEU E 2 177 ? 18.750  81.313  47.515  1.00 52.19  ? 177 LEU C C     1 
ATOM   6541 O O     . LEU E 2 177 ? 17.718  81.117  48.137  1.00 52.07  ? 177 LEU C O     1 
ATOM   6542 C CB    . LEU E 2 177 ? 20.335  79.871  48.781  1.00 52.00  ? 177 LEU C CB    1 
ATOM   6543 C CG    . LEU E 2 177 ? 20.478  78.401  49.191  1.00 51.65  ? 177 LEU C CG    1 
ATOM   6544 C CD1   . LEU E 2 177 ? 20.346  77.471  47.997  1.00 51.14  ? 177 LEU C CD1   1 
ATOM   6545 C CD2   . LEU E 2 177 ? 21.819  78.241  49.887  1.00 51.15  ? 177 LEU C CD2   1 
ATOM   6546 N N     . GLY E 2 178 ? 19.048  82.469  46.933  1.00 52.64  ? 178 GLY C N     1 
ATOM   6547 C CA    . GLY E 2 178 ? 18.122  83.576  46.964  1.00 52.99  ? 178 GLY C CA    1 
ATOM   6548 C C     . GLY E 2 178 ? 18.224  84.533  48.130  1.00 53.46  ? 178 GLY C C     1 
ATOM   6549 O O     . GLY E 2 178 ? 17.268  85.244  48.409  1.00 53.93  ? 178 GLY C O     1 
ATOM   6550 N N     . HIS E 2 179 ? 19.357  84.567  48.814  1.00 54.11  ? 179 HIS C N     1 
ATOM   6551 C CA    . HIS E 2 179 ? 19.517  85.481  49.935  1.00 55.44  ? 179 HIS C CA    1 
ATOM   6552 C C     . HIS E 2 179 ? 19.934  86.861  49.463  1.00 56.16  ? 179 HIS C C     1 
ATOM   6553 O O     . HIS E 2 179 ? 20.690  86.992  48.510  1.00 56.59  ? 179 HIS C O     1 
ATOM   6554 C CB    . HIS E 2 179 ? 20.561  84.939  50.910  1.00 56.03  ? 179 HIS C CB    1 
ATOM   6555 C CG    . HIS E 2 179 ? 20.130  83.690  51.615  1.00 56.52  ? 179 HIS C CG    1 
ATOM   6556 N ND1   . HIS E 2 179 ? 19.314  83.707  52.725  1.00 56.41  ? 179 HIS C ND1   1 
ATOM   6557 C CD2   . HIS E 2 179 ? 20.368  82.384  51.344  1.00 56.32  ? 179 HIS C CD2   1 
ATOM   6558 C CE1   . HIS E 2 179 ? 19.069  82.467  53.108  1.00 56.40  ? 179 HIS C CE1   1 
ATOM   6559 N NE2   . HIS E 2 179 ? 19.696  81.645  52.286  1.00 56.23  ? 179 HIS C NE2   1 
ATOM   6560 N N     . GLN E 2 180 ? 19.439  87.894  50.131  1.00 57.35  ? 180 GLN C N     1 
ATOM   6561 C CA    . GLN E 2 180 ? 19.788  89.263  49.784  1.00 58.10  ? 180 GLN C CA    1 
ATOM   6562 C C     . GLN E 2 180 ? 20.139  90.017  51.050  1.00 57.63  ? 180 GLN C C     1 
ATOM   6563 O O     . GLN E 2 180 ? 20.959  90.926  51.029  1.00 57.20  ? 180 GLN C O     1 
ATOM   6564 C CB    . GLN E 2 180 ? 18.625  89.933  49.069  1.00 60.19  ? 180 GLN C CB    1 
ATOM   6565 C CG    . GLN E 2 180 ? 18.223  89.215  47.799  1.00 63.40  ? 180 GLN C CG    1 
ATOM   6566 C CD    . GLN E 2 180 ? 17.105  89.927  47.049  1.00 65.85  ? 180 GLN C CD    1 
ATOM   6567 O OE1   . GLN E 2 180 ? 16.005  90.123  47.580  1.00 65.96  ? 180 GLN C OE1   1 
ATOM   6568 N NE2   . GLN E 2 180 ? 17.385  90.319  45.801  1.00 67.07  ? 180 GLN C NE2   1 
ATOM   6569 N N     . GLN E 2 181 ? 19.506  89.631  52.156  1.00 57.45  ? 181 GLN C N     1 
ATOM   6570 C CA    . GLN E 2 181 ? 19.764  90.243  53.456  1.00 57.52  ? 181 GLN C CA    1 
ATOM   6571 C C     . GLN E 2 181 ? 20.868  89.408  54.103  1.00 56.66  ? 181 GLN C C     1 
ATOM   6572 O O     . GLN E 2 181 ? 20.596  88.412  54.783  1.00 57.12  ? 181 GLN C O     1 
ATOM   6573 C CB    . GLN E 2 181 ? 18.494  90.208  54.310  1.00 59.36  ? 181 GLN C CB    1 
ATOM   6574 C CG    . GLN E 2 181 ? 17.352  91.043  53.756  1.00 61.41  ? 181 GLN C CG    1 
ATOM   6575 C CD    . GLN E 2 181 ? 17.702  92.522  53.684  1.00 63.45  ? 181 GLN C CD    1 
ATOM   6576 O OE1   . GLN E 2 181 ? 17.787  93.208  54.714  1.00 64.99  ? 181 GLN C OE1   1 
ATOM   6577 N NE2   . GLN E 2 181 ? 17.920  93.021  52.467  1.00 63.48  ? 181 GLN C NE2   1 
ATOM   6578 N N     . ILE E 2 182 ? 22.111  89.825  53.890  1.00 54.99  ? 182 ILE C N     1 
ATOM   6579 C CA    . ILE E 2 182 ? 23.270  89.102  54.383  1.00 53.09  ? 182 ILE C CA    1 
ATOM   6580 C C     . ILE E 2 182 ? 24.114  89.892  55.365  1.00 52.28  ? 182 ILE C C     1 
ATOM   6581 O O     . ILE E 2 182 ? 24.396  91.052  55.130  1.00 52.97  ? 182 ILE C O     1 
ATOM   6582 C CB    . ILE E 2 182 ? 24.158  88.688  53.191  1.00 52.57  ? 182 ILE C CB    1 
ATOM   6583 C CG1   . ILE E 2 182 ? 23.325  87.850  52.220  1.00 51.81  ? 182 ILE C CG1   1 
ATOM   6584 C CG2   . ILE E 2 182 ? 25.401  87.940  53.673  1.00 51.72  ? 182 ILE C CG2   1 
ATOM   6585 C CD1   . ILE E 2 182 ? 24.064  87.454  50.973  1.00 52.13  ? 182 ILE C CD1   1 
ATOM   6586 N N     . ALA E 2 183 ? 24.519  89.257  56.463  1.00 51.37  ? 183 ALA C N     1 
ATOM   6587 C CA    . ALA E 2 183 ? 25.361  89.913  57.463  1.00 50.18  ? 183 ALA C CA    1 
ATOM   6588 C C     . ALA E 2 183 ? 26.757  89.302  57.364  1.00 49.38  ? 183 ALA C C     1 
ATOM   6589 O O     . ALA E 2 183 ? 26.918  88.201  56.844  1.00 49.25  ? 183 ALA C O     1 
ATOM   6590 C CB    . ALA E 2 183 ? 24.786  89.702  58.859  1.00 49.83  ? 183 ALA C CB    1 
ATOM   6591 N N     . LEU E 2 184 ? 27.765  90.013  57.847  1.00 48.46  ? 184 LEU C N     1 
ATOM   6592 C CA    . LEU E 2 184 ? 29.129  89.505  57.796  1.00 47.53  ? 184 LEU C CA    1 
ATOM   6593 C C     . LEU E 2 184 ? 29.758  89.508  59.180  1.00 47.38  ? 184 LEU C C     1 
ATOM   6594 O O     . LEU E 2 184 ? 29.739  90.526  59.873  1.00 47.25  ? 184 LEU C O     1 
ATOM   6595 C CB    . LEU E 2 184 ? 29.995  90.362  56.874  1.00 47.21  ? 184 LEU C CB    1 
ATOM   6596 C CG    . LEU E 2 184 ? 29.601  90.567  55.412  1.00 47.11  ? 184 LEU C CG    1 
ATOM   6597 C CD1   . LEU E 2 184 ? 30.692  91.374  54.733  1.00 46.52  ? 184 LEU C CD1   1 
ATOM   6598 C CD2   . LEU E 2 184 ? 29.416  89.241  54.708  1.00 46.73  ? 184 LEU C CD2   1 
ATOM   6599 N N     . LEU E 2 185 ? 30.303  88.365  59.583  1.00 47.02  ? 185 LEU C N     1 
ATOM   6600 C CA    . LEU E 2 185 ? 30.973  88.248  60.874  1.00 46.79  ? 185 LEU C CA    1 
ATOM   6601 C C     . LEU E 2 185 ? 32.419  87.888  60.534  1.00 46.43  ? 185 LEU C C     1 
ATOM   6602 O O     . LEU E 2 185 ? 32.704  86.754  60.149  1.00 46.95  ? 185 LEU C O     1 
ATOM   6603 C CB    . LEU E 2 185 ? 30.310  87.147  61.707  1.00 46.77  ? 185 LEU C CB    1 
ATOM   6604 C CG    . LEU E 2 185 ? 30.909  86.827  63.080  1.00 46.71  ? 185 LEU C CG    1 
ATOM   6605 C CD1   . LEU E 2 185 ? 31.189  88.103  63.853  1.00 46.97  ? 185 LEU C CD1   1 
ATOM   6606 C CD2   . LEU E 2 185 ? 29.943  85.930  63.833  1.00 46.68  ? 185 LEU C CD2   1 
ATOM   6607 N N     . ALA E 2 186 ? 33.321  88.856  60.664  1.00 45.27  ? 186 ALA C N     1 
ATOM   6608 C CA    . ALA E 2 186 ? 34.725  88.646  60.313  1.00 44.58  ? 186 ALA C CA    1 
ATOM   6609 C C     . ALA E 2 186 ? 35.633  88.330  61.477  1.00 44.35  ? 186 ALA C C     1 
ATOM   6610 O O     . ALA E 2 186 ? 35.284  88.544  62.645  1.00 43.77  ? 186 ALA C O     1 
ATOM   6611 C CB    . ALA E 2 186 ? 35.264  89.875  59.596  1.00 44.84  ? 186 ALA C CB    1 
ATOM   6612 N N     . GLY E 2 187 ? 36.823  87.841  61.140  1.00 43.85  ? 187 GLY C N     1 
ATOM   6613 C CA    . GLY E 2 187 ? 37.796  87.522  62.163  1.00 43.96  ? 187 GLY C CA    1 
ATOM   6614 C C     . GLY E 2 187 ? 38.376  88.826  62.672  1.00 44.63  ? 187 GLY C C     1 
ATOM   6615 O O     . GLY E 2 187 ? 37.985  89.893  62.208  1.00 44.25  ? 187 GLY C O     1 
ATOM   6616 N N     . PRO E 2 188 ? 39.310  88.782  63.629  1.00 44.98  ? 188 PRO C N     1 
ATOM   6617 C CA    . PRO E 2 188 ? 39.895  90.020  64.143  1.00 45.15  ? 188 PRO C CA    1 
ATOM   6618 C C     . PRO E 2 188 ? 40.661  90.761  63.038  1.00 45.78  ? 188 PRO C C     1 
ATOM   6619 O O     . PRO E 2 188 ? 41.450  90.168  62.306  1.00 45.72  ? 188 PRO C O     1 
ATOM   6620 C CB    . PRO E 2 188 ? 40.789  89.521  65.273  1.00 44.70  ? 188 PRO C CB    1 
ATOM   6621 C CG    . PRO E 2 188 ? 41.230  88.186  64.777  1.00 44.39  ? 188 PRO C CG    1 
ATOM   6622 C CD    . PRO E 2 188 ? 39.960  87.600  64.226  1.00 44.74  ? 188 PRO C CD    1 
ATOM   6623 N N     . LEU E 2 189 ? 40.416  92.060  62.912  1.00 47.09  ? 189 LEU C N     1 
ATOM   6624 C CA    . LEU E 2 189 ? 41.063  92.855  61.876  1.00 47.67  ? 189 LEU C CA    1 
ATOM   6625 C C     . LEU E 2 189 ? 42.584  92.877  61.968  1.00 47.62  ? 189 LEU C C     1 
ATOM   6626 O O     . LEU E 2 189 ? 43.262  93.217  60.998  1.00 48.03  ? 189 LEU C O     1 
ATOM   6627 C CB    . LEU E 2 189 ? 40.502  94.273  61.891  1.00 48.58  ? 189 LEU C CB    1 
ATOM   6628 C CG    . LEU E 2 189 ? 39.357  94.565  60.912  1.00 49.57  ? 189 LEU C CG    1 
ATOM   6629 C CD1   . LEU E 2 189 ? 38.613  93.300  60.520  1.00 48.39  ? 189 LEU C CD1   1 
ATOM   6630 C CD2   . LEU E 2 189 ? 38.423  95.579  61.553  1.00 49.38  ? 189 LEU C CD2   1 
ATOM   6631 N N     . SER E 2 190 ? 43.125  92.496  63.117  1.00 47.01  ? 190 SER C N     1 
ATOM   6632 C CA    . SER E 2 190 ? 44.573  92.462  63.276  1.00 46.98  ? 190 SER C CA    1 
ATOM   6633 C C     . SER E 2 190 ? 45.137  91.262  62.519  1.00 46.86  ? 190 SER C C     1 
ATOM   6634 O O     . SER E 2 190 ? 46.353  91.073  62.441  1.00 47.22  ? 190 SER C O     1 
ATOM   6635 C CB    . SER E 2 190 ? 44.932  92.331  64.746  1.00 47.05  ? 190 SER C CB    1 
ATOM   6636 O OG    . SER E 2 190 ? 44.346  91.154  65.266  1.00 49.15  ? 190 SER C OG    1 
ATOM   6637 N N     . SER E 2 191 ? 44.244  90.450  61.963  1.00 46.37  ? 191 SER C N     1 
ATOM   6638 C CA    . SER E 2 191 ? 44.637  89.263  61.206  1.00 46.01  ? 191 SER C CA    1 
ATOM   6639 C C     . SER E 2 191 ? 44.569  89.488  59.695  1.00 45.15  ? 191 SER C C     1 
ATOM   6640 O O     . SER E 2 191 ? 43.504  89.794  59.168  1.00 45.62  ? 191 SER C O     1 
ATOM   6641 C CB    . SER E 2 191 ? 43.718  88.083  61.566  1.00 46.36  ? 191 SER C CB    1 
ATOM   6642 O OG    . SER E 2 191 ? 43.847  87.027  60.625  1.00 47.21  ? 191 SER C OG    1 
ATOM   6643 N N     . VAL E 2 192 ? 45.684  89.309  59.001  1.00 43.54  ? 192 VAL C N     1 
ATOM   6644 C CA    . VAL E 2 192 ? 45.692  89.492  57.556  1.00 43.51  ? 192 VAL C CA    1 
ATOM   6645 C C     . VAL E 2 192 ? 44.662  88.576  56.883  1.00 44.43  ? 192 VAL C C     1 
ATOM   6646 O O     . VAL E 2 192 ? 43.881  88.991  56.011  1.00 44.70  ? 192 VAL C O     1 
ATOM   6647 C CB    . VAL E 2 192 ? 47.076  89.170  56.965  1.00 42.85  ? 192 VAL C CB    1 
ATOM   6648 C CG1   . VAL E 2 192 ? 47.037  89.280  55.452  1.00 41.62  ? 192 VAL C CG1   1 
ATOM   6649 C CG2   . VAL E 2 192 ? 48.121  90.095  57.555  1.00 41.37  ? 192 VAL C CG2   1 
ATOM   6650 N N     . SER E 2 193 ? 44.667  87.318  57.294  1.00 44.67  ? 193 SER C N     1 
ATOM   6651 C CA    . SER E 2 193 ? 43.758  86.348  56.726  1.00 44.45  ? 193 SER C CA    1 
ATOM   6652 C C     . SER E 2 193 ? 42.324  86.814  56.922  1.00 44.12  ? 193 SER C C     1 
ATOM   6653 O O     . SER E 2 193 ? 41.499  86.711  56.008  1.00 43.48  ? 193 SER C O     1 
ATOM   6654 C CB    . SER E 2 193 ? 43.978  84.992  57.395  1.00 45.50  ? 193 SER C CB    1 
ATOM   6655 O OG    . SER E 2 193 ? 43.335  83.954  56.675  1.00 46.96  ? 193 SER C OG    1 
ATOM   6656 N N     . ALA E 2 194 ? 42.027  87.330  58.112  1.00 43.57  ? 194 ALA C N     1 
ATOM   6657 C CA    . ALA E 2 194 ? 40.673  87.803  58.393  1.00 43.70  ? 194 ALA C CA    1 
ATOM   6658 C C     . ALA E 2 194 ? 40.301  88.918  57.408  1.00 43.72  ? 194 ALA C C     1 
ATOM   6659 O O     . ALA E 2 194 ? 39.207  88.903  56.812  1.00 43.18  ? 194 ALA C O     1 
ATOM   6660 C CB    . ALA E 2 194 ? 40.571  88.312  59.832  1.00 43.38  ? 194 ALA C CB    1 
ATOM   6661 N N     . ARG E 2 195 ? 41.224  89.872  57.232  1.00 43.10  ? 195 ARG C N     1 
ATOM   6662 C CA    . ARG E 2 195 ? 41.002  90.995  56.331  1.00 42.35  ? 195 ARG C CA    1 
ATOM   6663 C C     . ARG E 2 195 ? 40.842  90.529  54.902  1.00 42.19  ? 195 ARG C C     1 
ATOM   6664 O O     . ARG E 2 195 ? 40.006  91.048  54.179  1.00 42.36  ? 195 ARG C O     1 
ATOM   6665 C CB    . ARG E 2 195 ? 42.140  92.002  56.436  1.00 42.09  ? 195 ARG C CB    1 
ATOM   6666 C CG    . ARG E 2 195 ? 42.299  92.560  57.840  1.00 42.60  ? 195 ARG C CG    1 
ATOM   6667 C CD    . ARG E 2 195 ? 43.208  93.751  57.875  1.00 41.50  ? 195 ARG C CD    1 
ATOM   6668 N NE    . ARG E 2 195 ? 44.515  93.491  57.288  1.00 41.00  ? 195 ARG C NE    1 
ATOM   6669 C CZ    . ARG E 2 195 ? 45.615  93.269  57.993  1.00 40.86  ? 195 ARG C CZ    1 
ATOM   6670 N NH1   . ARG E 2 195 ? 45.559  93.263  59.308  1.00 40.70  ? 195 ARG C NH1   1 
ATOM   6671 N NH2   . ARG E 2 195 ? 46.777  93.095  57.383  1.00 41.01  ? 195 ARG C NH2   1 
ATOM   6672 N N     . LEU E 2 196 ? 41.620  89.535  54.491  1.00 42.25  ? 196 LEU C N     1 
ATOM   6673 C CA    . LEU E 2 196 ? 41.483  89.037  53.133  1.00 43.13  ? 196 LEU C CA    1 
ATOM   6674 C C     . LEU E 2 196 ? 40.088  88.465  52.894  1.00 43.68  ? 196 LEU C C     1 
ATOM   6675 O O     . LEU E 2 196 ? 39.494  88.675  51.835  1.00 43.60  ? 196 LEU C O     1 
ATOM   6676 C CB    . LEU E 2 196 ? 42.522  87.962  52.844  1.00 43.46  ? 196 LEU C CB    1 
ATOM   6677 C CG    . LEU E 2 196 ? 43.979  88.408  52.875  1.00 43.91  ? 196 LEU C CG    1 
ATOM   6678 C CD1   . LEU E 2 196 ? 44.872  87.189  52.637  1.00 43.07  ? 196 LEU C CD1   1 
ATOM   6679 C CD2   . LEU E 2 196 ? 44.211  89.474  51.805  1.00 43.07  ? 196 LEU C CD2   1 
ATOM   6680 N N     . ARG E 2 197 ? 39.562  87.738  53.875  1.00 44.30  ? 197 ARG C N     1 
ATOM   6681 C CA    . ARG E 2 197 ? 38.235  87.157  53.726  1.00 44.77  ? 197 ARG C CA    1 
ATOM   6682 C C     . ARG E 2 197 ? 37.167  88.242  53.739  1.00 44.38  ? 197 ARG C C     1 
ATOM   6683 O O     . ARG E 2 197 ? 36.181  88.156  53.007  1.00 44.30  ? 197 ARG C O     1 
ATOM   6684 C CB    . ARG E 2 197 ? 37.960  86.137  54.839  1.00 46.16  ? 197 ARG C CB    1 
ATOM   6685 C CG    . ARG E 2 197 ? 38.852  84.905  54.764  1.00 48.07  ? 197 ARG C CG    1 
ATOM   6686 C CD    . ARG E 2 197 ? 38.680  83.964  55.949  1.00 48.37  ? 197 ARG C CD    1 
ATOM   6687 N NE    . ARG E 2 197 ? 39.875  83.132  56.110  1.00 49.72  ? 197 ARG C NE    1 
ATOM   6688 C CZ    . ARG E 2 197 ? 40.125  82.350  57.160  1.00 49.57  ? 197 ARG C CZ    1 
ATOM   6689 N NH1   . ARG E 2 197 ? 39.261  82.271  58.162  1.00 49.20  ? 197 ARG C NH1   1 
ATOM   6690 N NH2   . ARG E 2 197 ? 41.261  81.668  57.221  1.00 49.54  ? 197 ARG C NH2   1 
ATOM   6691 N N     . LEU E 2 198 ? 37.352  89.259  54.574  1.00 43.84  ? 198 LEU C N     1 
ATOM   6692 C CA    . LEU E 2 198 ? 36.380  90.344  54.633  1.00 43.65  ? 198 LEU C CA    1 
ATOM   6693 C C     . LEU E 2 198 ? 36.328  90.980  53.243  1.00 43.50  ? 198 LEU C C     1 
ATOM   6694 O O     . LEU E 2 198 ? 35.260  91.102  52.640  1.00 43.81  ? 198 LEU C O     1 
ATOM   6695 C CB    . LEU E 2 198 ? 36.798  91.399  55.663  1.00 42.50  ? 198 LEU C CB    1 
ATOM   6696 C CG    . LEU E 2 198 ? 35.668  92.039  56.480  1.00 41.17  ? 198 LEU C CG    1 
ATOM   6697 C CD1   . LEU E 2 198 ? 36.195  93.289  57.148  1.00 39.69  ? 198 LEU C CD1   1 
ATOM   6698 C CD2   . LEU E 2 198 ? 34.495  92.363  55.609  1.00 40.16  ? 198 LEU C CD2   1 
ATOM   6699 N N     . ALA E 2 199 ? 37.496  91.364  52.736  1.00 43.30  ? 199 ALA C N     1 
ATOM   6700 C CA    . ALA E 2 199 ? 37.601  91.973  51.417  1.00 43.07  ? 199 ALA C CA    1 
ATOM   6701 C C     . ALA E 2 199 ? 36.977  91.086  50.351  1.00 43.25  ? 199 ALA C C     1 
ATOM   6702 O O     . ALA E 2 199 ? 36.294  91.567  49.462  1.00 44.59  ? 199 ALA C O     1 
ATOM   6703 C CB    . ALA E 2 199 ? 39.055  92.232  51.088  1.00 42.50  ? 199 ALA C CB    1 
ATOM   6704 N N     . GLY E 2 200 ? 37.216  89.785  50.442  1.00 43.11  ? 200 GLY C N     1 
ATOM   6705 C CA    . GLY E 2 200 ? 36.660  88.870  49.471  1.00 42.83  ? 200 GLY C CA    1 
ATOM   6706 C C     . GLY E 2 200 ? 35.152  88.919  49.447  1.00 43.22  ? 200 GLY C C     1 
ATOM   6707 O O     . GLY E 2 200 ? 34.553  88.956  48.376  1.00 43.38  ? 200 GLY C O     1 
ATOM   6708 N N     . TRP E 2 201 ? 34.527  88.920  50.618  1.00 43.34  ? 201 TRP C N     1 
ATOM   6709 C CA    . TRP E 2 201 ? 33.071  88.956  50.670  1.00 44.05  ? 201 TRP C CA    1 
ATOM   6710 C C     . TRP E 2 201 ? 32.544  90.238  50.061  1.00 44.20  ? 201 TRP C C     1 
ATOM   6711 O O     . TRP E 2 201 ? 31.601  90.205  49.269  1.00 44.48  ? 201 TRP C O     1 
ATOM   6712 C CB    . TRP E 2 201 ? 32.549  88.859  52.103  1.00 44.15  ? 201 TRP C CB    1 
ATOM   6713 C CG    . TRP E 2 201 ? 32.783  87.544  52.772  1.00 44.82  ? 201 TRP C CG    1 
ATOM   6714 C CD1   . TRP E 2 201 ? 32.744  86.306  52.195  1.00 44.27  ? 201 TRP C CD1   1 
ATOM   6715 C CD2   . TRP E 2 201 ? 33.024  87.331  54.166  1.00 44.11  ? 201 TRP C CD2   1 
ATOM   6716 N NE1   . TRP E 2 201 ? 32.946  85.340  53.143  1.00 43.60  ? 201 TRP C NE1   1 
ATOM   6717 C CE2   . TRP E 2 201 ? 33.119  85.939  54.363  1.00 43.87  ? 201 TRP C CE2   1 
ATOM   6718 C CE3   . TRP E 2 201 ? 33.167  88.184  55.269  1.00 43.80  ? 201 TRP C CE3   1 
ATOM   6719 C CZ2   . TRP E 2 201 ? 33.349  85.372  55.623  1.00 43.84  ? 201 TRP C CZ2   1 
ATOM   6720 C CZ3   . TRP E 2 201 ? 33.396  87.618  56.528  1.00 44.58  ? 201 TRP C CZ3   1 
ATOM   6721 C CH2   . TRP E 2 201 ? 33.483  86.225  56.689  1.00 43.52  ? 201 TRP C CH2   1 
ATOM   6722 N N     . HIS E 2 202 ? 33.132  91.369  50.446  1.00 43.91  ? 202 HIS C N     1 
ATOM   6723 C CA    . HIS E 2 202 ? 32.694  92.654  49.904  1.00 44.41  ? 202 HIS C CA    1 
ATOM   6724 C C     . HIS E 2 202 ? 32.828  92.616  48.382  1.00 45.14  ? 202 HIS C C     1 
ATOM   6725 O O     . HIS E 2 202 ? 31.888  92.956  47.653  1.00 44.81  ? 202 HIS C O     1 
ATOM   6726 C CB    . HIS E 2 202 ? 33.512  93.788  50.510  1.00 42.86  ? 202 HIS C CB    1 
ATOM   6727 C CG    . HIS E 2 202 ? 33.030  94.201  51.865  1.00 43.14  ? 202 HIS C CG    1 
ATOM   6728 N ND1   . HIS E 2 202 ? 33.884  94.489  52.908  1.00 43.00  ? 202 HIS C ND1   1 
ATOM   6729 C CD2   . HIS E 2 202 ? 31.776  94.381  52.347  1.00 43.41  ? 202 HIS C CD2   1 
ATOM   6730 C CE1   . HIS E 2 202 ? 33.176  94.827  53.973  1.00 43.00  ? 202 HIS C CE1   1 
ATOM   6731 N NE2   . HIS E 2 202 ? 31.895  94.769  53.660  1.00 42.69  ? 202 HIS C NE2   1 
ATOM   6732 N N     . LYS E 2 203 ? 33.974  92.145  47.904  1.00 45.08  ? 203 LYS C N     1 
ATOM   6733 C CA    . LYS E 2 203 ? 34.170  92.069  46.479  1.00 45.87  ? 203 LYS C CA    1 
ATOM   6734 C C     . LYS E 2 203 ? 33.051  91.310  45.771  1.00 46.52  ? 203 LYS C C     1 
ATOM   6735 O O     . LYS E 2 203 ? 32.413  91.850  44.873  1.00 48.04  ? 203 LYS C O     1 
ATOM   6736 C CB    . LYS E 2 203 ? 35.515  91.432  46.140  1.00 45.13  ? 203 LYS C CB    1 
ATOM   6737 C CG    . LYS E 2 203 ? 35.609  91.099  44.672  1.00 44.64  ? 203 LYS C CG    1 
ATOM   6738 C CD    . LYS E 2 203 ? 36.966  90.612  44.259  1.00 44.85  ? 203 LYS C CD    1 
ATOM   6739 C CE    . LYS E 2 203 ? 36.903  90.177  42.802  1.00 46.18  ? 203 LYS C CE    1 
ATOM   6740 N NZ    . LYS E 2 203 ? 38.186  89.616  42.288  1.00 48.02  ? 203 LYS C NZ    1 
ATOM   6741 N N     . TYR E 2 204 ? 32.780  90.074  46.172  1.00 46.77  ? 204 TYR C N     1 
ATOM   6742 C CA    . TYR E 2 204 ? 31.746  89.307  45.486  1.00 46.79  ? 204 TYR C CA    1 
ATOM   6743 C C     . TYR E 2 204 ? 30.316  89.675  45.827  1.00 47.38  ? 204 TYR C C     1 
ATOM   6744 O O     . TYR E 2 204 ? 29.398  89.382  45.056  1.00 47.18  ? 204 TYR C O     1 
ATOM   6745 C CB    . TYR E 2 204 ? 31.986  87.806  45.657  1.00 45.71  ? 204 TYR C CB    1 
ATOM   6746 C CG    . TYR E 2 204 ? 33.267  87.384  45.003  1.00 45.09  ? 204 TYR C CG    1 
ATOM   6747 C CD1   . TYR E 2 204 ? 34.461  87.413  45.706  1.00 44.39  ? 204 TYR C CD1   1 
ATOM   6748 C CD2   . TYR E 2 204 ? 33.307  87.060  43.642  1.00 45.57  ? 204 TYR C CD2   1 
ATOM   6749 C CE1   . TYR E 2 204 ? 35.664  87.147  45.084  1.00 44.87  ? 204 TYR C CE1   1 
ATOM   6750 C CE2   . TYR E 2 204 ? 34.515  86.786  43.000  1.00 44.59  ? 204 TYR C CE2   1 
ATOM   6751 C CZ    . TYR E 2 204 ? 35.687  86.839  43.734  1.00 45.29  ? 204 TYR C CZ    1 
ATOM   6752 O OH    . TYR E 2 204 ? 36.897  86.637  43.128  1.00 46.55  ? 204 TYR C OH    1 
ATOM   6753 N N     . LEU E 2 205 ? 30.104  90.310  46.972  1.00 48.45  ? 205 LEU C N     1 
ATOM   6754 C CA    . LEU E 2 205 ? 28.747  90.742  47.292  1.00 49.94  ? 205 LEU C CA    1 
ATOM   6755 C C     . LEU E 2 205 ? 28.454  91.940  46.373  1.00 51.29  ? 205 LEU C C     1 
ATOM   6756 O O     . LEU E 2 205 ? 27.343  92.082  45.858  1.00 51.49  ? 205 LEU C O     1 
ATOM   6757 C CB    . LEU E 2 205 ? 28.626  91.154  48.760  1.00 49.23  ? 205 LEU C CB    1 
ATOM   6758 C CG    . LEU E 2 205 ? 28.452  90.014  49.765  1.00 49.05  ? 205 LEU C CG    1 
ATOM   6759 C CD1   . LEU E 2 205 ? 28.503  90.569  51.172  1.00 48.26  ? 205 LEU C CD1   1 
ATOM   6760 C CD2   . LEU E 2 205 ? 27.142  89.288  49.505  1.00 47.56  ? 205 LEU C CD2   1 
ATOM   6761 N N     . THR E 2 206 ? 29.466  92.787  46.157  1.00 51.82  ? 206 THR C N     1 
ATOM   6762 C CA    . THR E 2 206 ? 29.316  93.943  45.293  1.00 52.35  ? 206 THR C CA    1 
ATOM   6763 C C     . THR E 2 206 ? 28.991  93.488  43.878  1.00 52.98  ? 206 THR C C     1 
ATOM   6764 O O     . THR E 2 206 ? 28.098  94.030  43.249  1.00 53.47  ? 206 THR C O     1 
ATOM   6765 C CB    . THR E 2 206 ? 30.600  94.818  45.275  1.00 52.97  ? 206 THR C CB    1 
ATOM   6766 O OG1   . THR E 2 206 ? 30.658  95.626  46.458  1.00 51.89  ? 206 THR C OG1   1 
ATOM   6767 C CG2   . THR E 2 206 ? 30.619  95.730  44.055  1.00 52.52  ? 206 THR C CG2   1 
ATOM   6768 N N     . ARG E 2 207 ? 29.699  92.486  43.374  1.00 53.49  ? 207 ARG C N     1 
ATOM   6769 C CA    . ARG E 2 207 ? 29.423  91.996  42.025  1.00 54.04  ? 207 ARG C CA    1 
ATOM   6770 C C     . ARG E 2 207 ? 28.029  91.400  41.880  1.00 54.44  ? 207 ARG C C     1 
ATOM   6771 O O     . ARG E 2 207 ? 27.630  91.015  40.790  1.00 54.83  ? 207 ARG C O     1 
ATOM   6772 C CB    . ARG E 2 207 ? 30.432  90.934  41.603  1.00 54.38  ? 207 ARG C CB    1 
ATOM   6773 C CG    . ARG E 2 207 ? 31.820  91.448  41.332  1.00 55.76  ? 207 ARG C CG    1 
ATOM   6774 C CD    . ARG E 2 207 ? 32.605  90.426  40.543  1.00 57.23  ? 207 ARG C CD    1 
ATOM   6775 N NE    . ARG E 2 207 ? 33.991  90.834  40.356  1.00 58.56  ? 207 ARG C NE    1 
ATOM   6776 C CZ    . ARG E 2 207 ? 34.921  90.073  39.788  1.00 59.42  ? 207 ARG C CZ    1 
ATOM   6777 N NH1   . ARG E 2 207 ? 34.609  88.861  39.344  1.00 58.55  ? 207 ARG C NH1   1 
ATOM   6778 N NH2   . ARG E 2 207 ? 36.169  90.522  39.678  1.00 60.14  ? 207 ARG C NH2   1 
ATOM   6779 N N     . ASN E 2 208 ? 27.294  91.288  42.976  1.00 55.35  ? 208 ASN C N     1 
ATOM   6780 C CA    . ASN E 2 208 ? 25.948  90.737  42.909  1.00 55.87  ? 208 ASN C CA    1 
ATOM   6781 C C     . ASN E 2 208 ? 24.990  91.803  43.387  1.00 56.88  ? 208 ASN C C     1 
ATOM   6782 O O     . ASN E 2 208 ? 23.844  91.529  43.717  1.00 56.84  ? 208 ASN C O     1 
ATOM   6783 C CB    . ASN E 2 208 ? 25.816  89.482  43.776  1.00 55.18  ? 208 ASN C CB    1 
ATOM   6784 C CG    . ASN E 2 208 ? 26.544  88.285  43.190  1.00 54.19  ? 208 ASN C CG    1 
ATOM   6785 O OD1   . ASN E 2 208 ? 27.763  88.158  43.317  1.00 53.12  ? 208 ASN C OD1   1 
ATOM   6786 N ND2   . ASN E 2 208 ? 25.798  87.402  42.540  1.00 53.31  ? 208 ASN C ND2   1 
ATOM   6787 N N     . GLN E 2 209 ? 25.493  93.029  43.425  1.00 58.46  ? 209 GLN C N     1 
ATOM   6788 C CA    . GLN E 2 209 ? 24.700  94.174  43.833  1.00 60.46  ? 209 GLN C CA    1 
ATOM   6789 C C     . GLN E 2 209 ? 24.014  93.937  45.165  1.00 60.05  ? 209 GLN C C     1 
ATOM   6790 O O     . GLN E 2 209 ? 22.808  94.118  45.305  1.00 60.25  ? 209 GLN C O     1 
ATOM   6791 C CB    . GLN E 2 209 ? 23.668  94.493  42.748  1.00 62.56  ? 209 GLN C CB    1 
ATOM   6792 C CG    . GLN E 2 209 ? 24.298  94.702  41.383  1.00 65.62  ? 209 GLN C CG    1 
ATOM   6793 C CD    . GLN E 2 209 ? 23.609  93.883  40.322  1.00 68.12  ? 209 GLN C CD    1 
ATOM   6794 O OE1   . GLN E 2 209 ? 22.493  94.211  39.890  1.00 69.64  ? 209 GLN C OE1   1 
ATOM   6795 N NE2   . GLN E 2 209 ? 24.256  92.789  39.903  1.00 69.24  ? 209 GLN C NE2   1 
ATOM   6796 N N     . ILE E 2 210 ? 24.801  93.520  46.142  1.00 59.67  ? 210 ILE C N     1 
ATOM   6797 C CA    . ILE E 2 210 ? 24.290  93.273  47.470  1.00 59.35  ? 210 ILE C CA    1 
ATOM   6798 C C     . ILE E 2 210 ? 25.156  94.027  48.451  1.00 59.57  ? 210 ILE C C     1 
ATOM   6799 O O     . ILE E 2 210 ? 26.359  94.109  48.279  1.00 59.50  ? 210 ILE C O     1 
ATOM   6800 C CB    . ILE E 2 210 ? 24.342  91.772  47.822  1.00 58.96  ? 210 ILE C CB    1 
ATOM   6801 C CG1   . ILE E 2 210 ? 23.434  90.986  46.877  1.00 58.19  ? 210 ILE C CG1   1 
ATOM   6802 C CG2   . ILE E 2 210 ? 23.937  91.561  49.269  1.00 58.32  ? 210 ILE C CG2   1 
ATOM   6803 C CD1   . ILE E 2 210 ? 23.391  89.504  47.152  1.00 58.05  ? 210 ILE C CD1   1 
ATOM   6804 N N     . GLN E 2 211 ? 24.538  94.607  49.464  1.00 60.41  ? 211 GLN C N     1 
ATOM   6805 C CA    . GLN E 2 211 ? 25.289  95.308  50.484  1.00 61.61  ? 211 GLN C CA    1 
ATOM   6806 C C     . GLN E 2 211 ? 24.966  94.631  51.799  1.00 60.66  ? 211 GLN C C     1 
ATOM   6807 O O     . GLN E 2 211 ? 23.802  94.509  52.174  1.00 60.79  ? 211 GLN C O     1 
ATOM   6808 C CB    . GLN E 2 211 ? 24.879  96.771  50.561  1.00 63.95  ? 211 GLN C CB    1 
ATOM   6809 C CG    . GLN E 2 211 ? 25.220  97.577  49.330  1.00 68.00  ? 211 GLN C CG    1 
ATOM   6810 C CD    . GLN E 2 211 ? 24.713  99.004  49.442  1.00 70.51  ? 211 GLN C CD    1 
ATOM   6811 O OE1   . GLN E 2 211 ? 25.164  99.778  50.309  1.00 71.50  ? 211 GLN C OE1   1 
ATOM   6812 N NE2   . GLN E 2 211 ? 23.753  99.359  48.578  1.00 71.04  ? 211 GLN C NE2   1 
ATOM   6813 N N     . PRO E 2 212 ? 25.989  94.165  52.515  1.00 59.47  ? 212 PRO C N     1 
ATOM   6814 C CA    . PRO E 2 212 ? 25.704  93.509  53.788  1.00 58.99  ? 212 PRO C CA    1 
ATOM   6815 C C     . PRO E 2 212 ? 24.871  94.413  54.691  1.00 58.11  ? 212 PRO C C     1 
ATOM   6816 O O     . PRO E 2 212 ? 25.150  95.605  54.786  1.00 57.92  ? 212 PRO C O     1 
ATOM   6817 C CB    . PRO E 2 212 ? 27.099  93.237  54.350  1.00 59.40  ? 212 PRO C CB    1 
ATOM   6818 C CG    . PRO E 2 212 ? 27.942  94.323  53.724  1.00 59.57  ? 212 PRO C CG    1 
ATOM   6819 C CD    . PRO E 2 212 ? 27.435  94.330  52.313  1.00 59.17  ? 212 PRO C CD    1 
ATOM   6820 N N     . ILE E 2 213 ? 23.843  93.863  55.334  1.00 57.17  ? 213 ILE C N     1 
ATOM   6821 C CA    . ILE E 2 213 ? 23.024  94.673  56.226  1.00 56.96  ? 213 ILE C CA    1 
ATOM   6822 C C     . ILE E 2 213 ? 23.660  94.761  57.610  1.00 56.68  ? 213 ILE C C     1 
ATOM   6823 O O     . ILE E 2 213 ? 23.114  95.387  58.516  1.00 56.94  ? 213 ILE C O     1 
ATOM   6824 C CB    . ILE E 2 213 ? 21.594  94.122  56.382  1.00 57.18  ? 213 ILE C CB    1 
ATOM   6825 C CG1   . ILE E 2 213 ? 21.611  92.821  57.169  1.00 57.38  ? 213 ILE C CG1   1 
ATOM   6826 C CG2   . ILE E 2 213 ? 20.970  93.897  55.021  1.00 57.28  ? 213 ILE C CG2   1 
ATOM   6827 C CD1   . ILE E 2 213 ? 20.233  92.231  57.347  1.00 57.57  ? 213 ILE C CD1   1 
ATOM   6828 N N     . ALA E 2 214 ? 24.815  94.125  57.769  1.00 56.11  ? 214 ALA C N     1 
ATOM   6829 C CA    . ALA E 2 214 ? 25.549  94.152  59.030  1.00 55.77  ? 214 ALA C CA    1 
ATOM   6830 C C     . ALA E 2 214 ? 26.959  93.638  58.792  1.00 55.74  ? 214 ALA C C     1 
ATOM   6831 O O     . ALA E 2 214 ? 27.206  92.872  57.864  1.00 55.25  ? 214 ALA C O     1 
ATOM   6832 C CB    . ALA E 2 214 ? 24.849  93.309  60.074  1.00 55.63  ? 214 ALA C CB    1 
ATOM   6833 N N     . GLU E 2 215 ? 27.887  94.063  59.633  1.00 56.01  ? 215 GLU C N     1 
ATOM   6834 C CA    . GLU E 2 215 ? 29.270  93.661  59.485  1.00 56.71  ? 215 GLU C CA    1 
ATOM   6835 C C     . GLU E 2 215 ? 29.958  93.797  60.834  1.00 56.72  ? 215 GLU C C     1 
ATOM   6836 O O     . GLU E 2 215 ? 30.265  94.899  61.256  1.00 57.03  ? 215 GLU C O     1 
ATOM   6837 C CB    . GLU E 2 215 ? 29.921  94.553  58.424  1.00 57.29  ? 215 GLU C CB    1 
ATOM   6838 C CG    . GLU E 2 215 ? 31.440  94.562  58.393  1.00 59.87  ? 215 GLU C CG    1 
ATOM   6839 C CD    . GLU E 2 215 ? 31.999  95.178  57.103  1.00 61.24  ? 215 GLU C CD    1 
ATOM   6840 O OE1   . GLU E 2 215 ? 33.228  95.445  57.048  1.00 61.30  ? 215 GLU C OE1   1 
ATOM   6841 O OE2   . GLU E 2 215 ? 31.210  95.380  56.143  1.00 61.89  ? 215 GLU C OE2   1 
ATOM   6842 N N     . ARG E 2 216 ? 30.189  92.675  61.515  1.00 56.88  ? 216 ARG C N     1 
ATOM   6843 C CA    . ARG E 2 216 ? 30.825  92.700  62.831  1.00 56.52  ? 216 ARG C CA    1 
ATOM   6844 C C     . ARG E 2 216 ? 32.158  91.992  62.803  1.00 55.55  ? 216 ARG C C     1 
ATOM   6845 O O     . ARG E 2 216 ? 32.462  91.269  61.861  1.00 55.29  ? 216 ARG C O     1 
ATOM   6846 C CB    . ARG E 2 216 ? 29.938  92.020  63.868  1.00 57.68  ? 216 ARG C CB    1 
ATOM   6847 C CG    . ARG E 2 216 ? 28.476  92.067  63.533  1.00 59.72  ? 216 ARG C CG    1 
ATOM   6848 C CD    . ARG E 2 216 ? 27.870  93.386  63.900  1.00 62.16  ? 216 ARG C CD    1 
ATOM   6849 N NE    . ARG E 2 216 ? 27.752  93.533  65.346  1.00 64.02  ? 216 ARG C NE    1 
ATOM   6850 C CZ    . ARG E 2 216 ? 26.836  94.297  65.930  1.00 65.44  ? 216 ARG C CZ    1 
ATOM   6851 N NH1   . ARG E 2 216 ? 25.963  94.973  65.180  1.00 65.59  ? 216 ARG C NH1   1 
ATOM   6852 N NH2   . ARG E 2 216 ? 26.794  94.388  67.254  1.00 65.93  ? 216 ARG C NH2   1 
ATOM   6853 N N     . GLU E 2 217 ? 32.926  92.186  63.868  1.00 54.84  ? 217 GLU C N     1 
ATOM   6854 C CA    . GLU E 2 217 ? 34.249  91.601  64.003  1.00 54.50  ? 217 GLU C CA    1 
ATOM   6855 C C     . GLU E 2 217 ? 34.350  90.737  65.266  1.00 53.85  ? 217 GLU C C     1 
ATOM   6856 O O     . GLU E 2 217 ? 33.975  91.161  66.361  1.00 53.65  ? 217 GLU C O     1 
ATOM   6857 C CB    . GLU E 2 217 ? 35.291  92.727  64.066  1.00 55.57  ? 217 GLU C CB    1 
ATOM   6858 C CG    . GLU E 2 217 ? 36.745  92.272  64.163  1.00 58.34  ? 217 GLU C CG    1 
ATOM   6859 C CD    . GLU E 2 217 ? 37.722  93.428  64.414  1.00 59.85  ? 217 GLU C CD    1 
ATOM   6860 O OE1   . GLU E 2 217 ? 37.369  94.588  64.095  1.00 62.05  ? 217 GLU C OE1   1 
ATOM   6861 O OE2   . GLU E 2 217 ? 38.845  93.180  64.917  1.00 59.41  ? 217 GLU C OE2   1 
ATOM   6862 N N     . GLY E 2 218 ? 34.859  89.519  65.110  1.00 52.57  ? 218 GLY C N     1 
ATOM   6863 C CA    . GLY E 2 218 ? 35.025  88.643  66.255  1.00 50.45  ? 218 GLY C CA    1 
ATOM   6864 C C     . GLY E 2 218 ? 36.514  88.488  66.499  1.00 49.48  ? 218 GLY C C     1 
ATOM   6865 O O     . GLY E 2 218 ? 37.310  89.316  66.055  1.00 49.94  ? 218 GLY C O     1 
ATOM   6866 N N     . ASP E 2 219 ? 36.908  87.436  67.201  1.00 48.00  ? 219 ASP C N     1 
ATOM   6867 C CA    . ASP E 2 219 ? 38.317  87.210  67.457  1.00 46.43  ? 219 ASP C CA    1 
ATOM   6868 C C     . ASP E 2 219 ? 38.683  85.756  67.202  1.00 45.06  ? 219 ASP C C     1 
ATOM   6869 O O     . ASP E 2 219 ? 39.688  85.270  67.711  1.00 44.01  ? 219 ASP C O     1 
ATOM   6870 C CB    . ASP E 2 219 ? 38.660  87.584  68.891  1.00 46.86  ? 219 ASP C CB    1 
ATOM   6871 C CG    . ASP E 2 219 ? 37.864  86.799  69.897  1.00 48.26  ? 219 ASP C CG    1 
ATOM   6872 O OD1   . ASP E 2 219 ? 38.005  87.083  71.099  1.00 49.50  ? 219 ASP C OD1   1 
ATOM   6873 O OD2   . ASP E 2 219 ? 37.099  85.898  69.495  1.00 48.79  ? 219 ASP C OD2   1 
ATOM   6874 N N     . TRP E 2 220 ? 37.860  85.080  66.401  1.00 43.86  ? 220 TRP C N     1 
ATOM   6875 C CA    . TRP E 2 220 ? 38.062  83.671  66.044  1.00 43.14  ? 220 TRP C CA    1 
ATOM   6876 C C     . TRP E 2 220 ? 37.368  82.703  67.001  1.00 42.95  ? 220 TRP C C     1 
ATOM   6877 O O     . TRP E 2 220 ? 37.086  81.574  66.637  1.00 43.89  ? 220 TRP C O     1 
ATOM   6878 C CB    . TRP E 2 220 ? 39.545  83.315  66.009  1.00 41.66  ? 220 TRP C CB    1 
ATOM   6879 C CG    . TRP E 2 220 ? 40.339  83.985  64.940  1.00 41.05  ? 220 TRP C CG    1 
ATOM   6880 C CD1   . TRP E 2 220 ? 41.572  84.550  65.083  1.00 40.19  ? 220 TRP C CD1   1 
ATOM   6881 C CD2   . TRP E 2 220 ? 40.044  84.021  63.538  1.00 40.23  ? 220 TRP C CD2   1 
ATOM   6882 N NE1   . TRP E 2 220 ? 42.071  84.921  63.864  1.00 40.46  ? 220 TRP C NE1   1 
ATOM   6883 C CE2   . TRP E 2 220 ? 41.156  84.610  62.894  1.00 40.36  ? 220 TRP C CE2   1 
ATOM   6884 C CE3   . TRP E 2 220 ? 38.956  83.604  62.763  1.00 40.18  ? 220 TRP C CE3   1 
ATOM   6885 C CZ2   . TRP E 2 220 ? 41.214  84.794  61.506  1.00 39.10  ? 220 TRP C CZ2   1 
ATOM   6886 C CZ3   . TRP E 2 220 ? 39.010  83.785  61.377  1.00 40.04  ? 220 TRP C CZ3   1 
ATOM   6887 C CH2   . TRP E 2 220 ? 40.137  84.376  60.766  1.00 39.61  ? 220 TRP C CH2   1 
ATOM   6888 N N     . SER E 2 221 ? 37.092  83.144  68.219  1.00 42.31  ? 221 SER C N     1 
ATOM   6889 C CA    . SER E 2 221 ? 36.454  82.291  69.208  1.00 41.74  ? 221 SER C CA    1 
ATOM   6890 C C     . SER E 2 221 ? 34.941  82.177  69.024  1.00 42.35  ? 221 SER C C     1 
ATOM   6891 O O     . SER E 2 221 ? 34.293  83.098  68.545  1.00 42.42  ? 221 SER C O     1 
ATOM   6892 C CB    . SER E 2 221 ? 36.738  82.832  70.595  1.00 39.64  ? 221 SER C CB    1 
ATOM   6893 O OG    . SER E 2 221 ? 35.791  83.827  70.903  1.00 39.25  ? 221 SER C OG    1 
ATOM   6894 N N     . ALA E 2 222 ? 34.383  81.042  69.420  1.00 43.23  ? 222 ALA C N     1 
ATOM   6895 C CA    . ALA E 2 222 ? 32.942  80.833  69.316  1.00 44.97  ? 222 ALA C CA    1 
ATOM   6896 C C     . ALA E 2 222 ? 32.172  81.854  70.157  1.00 45.87  ? 222 ALA C C     1 
ATOM   6897 O O     . ALA E 2 222 ? 31.090  82.304  69.772  1.00 45.42  ? 222 ALA C O     1 
ATOM   6898 C CB    . ALA E 2 222 ? 32.584  79.421  69.769  1.00 44.02  ? 222 ALA C CB    1 
ATOM   6899 N N     . MET E 2 223 ? 32.724  82.204  71.313  1.00 47.70  ? 223 MET C N     1 
ATOM   6900 C CA    . MET E 2 223 ? 32.072  83.158  72.197  1.00 49.78  ? 223 MET C CA    1 
ATOM   6901 C C     . MET E 2 223 ? 31.918  84.514  71.499  1.00 49.82  ? 223 MET C C     1 
ATOM   6902 O O     . MET E 2 223 ? 30.883  85.177  71.631  1.00 49.42  ? 223 MET C O     1 
ATOM   6903 C CB    . MET E 2 223 ? 32.876  83.313  73.491  1.00 51.90  ? 223 MET C CB    1 
ATOM   6904 C CG    . MET E 2 223 ? 32.091  83.945  74.641  1.00 55.28  ? 223 MET C CG    1 
ATOM   6905 S SD    . MET E 2 223 ? 30.546  83.048  75.013  1.00 60.03  ? 223 MET C SD    1 
ATOM   6906 C CE    . MET E 2 223 ? 29.438  84.416  75.346  1.00 59.08  ? 223 MET C CE    1 
ATOM   6907 N N     . SER E 2 224 ? 32.945  84.930  70.756  1.00 49.50  ? 224 SER C N     1 
ATOM   6908 C CA    . SER E 2 224 ? 32.852  86.201  70.044  1.00 48.66  ? 224 SER C CA    1 
ATOM   6909 C C     . SER E 2 224 ? 31.757  86.069  68.991  1.00 48.43  ? 224 SER C C     1 
ATOM   6910 O O     . SER E 2 224 ? 30.974  86.981  68.791  1.00 48.86  ? 224 SER C O     1 
ATOM   6911 C CB    . SER E 2 224 ? 34.191  86.582  69.397  1.00 47.64  ? 224 SER C CB    1 
ATOM   6912 O OG    . SER E 2 224 ? 34.535  85.734  68.326  1.00 47.42  ? 224 SER C OG    1 
ATOM   6913 N N     . GLY E 2 225 ? 31.680  84.919  68.339  1.00 48.59  ? 225 GLY C N     1 
ATOM   6914 C CA    . GLY E 2 225 ? 30.643  84.723  67.344  1.00 49.61  ? 225 GLY C CA    1 
ATOM   6915 C C     . GLY E 2 225 ? 29.272  84.821  67.987  1.00 50.37  ? 225 GLY C C     1 
ATOM   6916 O O     . GLY E 2 225 ? 28.350  85.384  67.417  1.00 51.07  ? 225 GLY C O     1 
ATOM   6917 N N     . PHE E 2 226 ? 29.139  84.277  69.191  1.00 51.09  ? 226 PHE C N     1 
ATOM   6918 C CA    . PHE E 2 226 ? 27.870  84.305  69.914  1.00 51.18  ? 226 PHE C CA    1 
ATOM   6919 C C     . PHE E 2 226 ? 27.490  85.725  70.320  1.00 52.16  ? 226 PHE C C     1 
ATOM   6920 O O     . PHE E 2 226 ? 26.385  86.183  70.062  1.00 52.22  ? 226 PHE C O     1 
ATOM   6921 C CB    . PHE E 2 226 ? 27.964  83.436  71.164  1.00 49.23  ? 226 PHE C CB    1 
ATOM   6922 C CG    . PHE E 2 226 ? 26.743  83.496  72.035  1.00 47.14  ? 226 PHE C CG    1 
ATOM   6923 C CD1   . PHE E 2 226 ? 25.568  82.858  71.653  1.00 45.93  ? 226 PHE C CD1   1 
ATOM   6924 C CD2   . PHE E 2 226 ? 26.771  84.191  73.240  1.00 45.79  ? 226 PHE C CD2   1 
ATOM   6925 C CE1   . PHE E 2 226 ? 24.433  82.911  72.465  1.00 45.30  ? 226 PHE C CE1   1 
ATOM   6926 C CE2   . PHE E 2 226 ? 25.649  84.248  74.052  1.00 44.82  ? 226 PHE C CE2   1 
ATOM   6927 C CZ    . PHE E 2 226 ? 24.477  83.607  73.665  1.00 44.54  ? 226 PHE C CZ    1 
ATOM   6928 N N     . GLN E 2 227 ? 28.420  86.411  70.969  1.00 53.67  ? 227 GLN C N     1 
ATOM   6929 C CA    . GLN E 2 227 ? 28.207  87.779  71.411  1.00 55.02  ? 227 GLN C CA    1 
ATOM   6930 C C     . GLN E 2 227 ? 27.915  88.744  70.269  1.00 55.07  ? 227 GLN C C     1 
ATOM   6931 O O     . GLN E 2 227 ? 26.959  89.516  70.339  1.00 55.33  ? 227 GLN C O     1 
ATOM   6932 C CB    . GLN E 2 227 ? 29.425  88.246  72.190  1.00 56.84  ? 227 GLN C CB    1 
ATOM   6933 C CG    . GLN E 2 227 ? 29.463  87.693  73.598  1.00 60.50  ? 227 GLN C CG    1 
ATOM   6934 C CD    . GLN E 2 227 ? 30.841  87.793  74.205  1.00 63.73  ? 227 GLN C CD    1 
ATOM   6935 O OE1   . GLN E 2 227 ? 31.019  87.583  75.408  1.00 66.17  ? 227 GLN C OE1   1 
ATOM   6936 N NE2   . GLN E 2 227 ? 31.837  88.104  73.373  1.00 65.18  ? 227 GLN C NE2   1 
ATOM   6937 N N     . GLN E 2 228 ? 28.728  88.703  69.216  1.00 54.61  ? 228 GLN C N     1 
ATOM   6938 C CA    . GLN E 2 228 ? 28.511  89.589  68.083  1.00 54.05  ? 228 GLN C CA    1 
ATOM   6939 C C     . GLN E 2 228 ? 27.155  89.351  67.436  1.00 54.18  ? 228 GLN C C     1 
ATOM   6940 O O     . GLN E 2 228 ? 26.436  90.295  67.146  1.00 54.35  ? 228 GLN C O     1 
ATOM   6941 C CB    . GLN E 2 228 ? 29.613  89.420  67.044  1.00 53.60  ? 228 GLN C CB    1 
ATOM   6942 C CG    . GLN E 2 228 ? 30.958  89.971  67.477  1.00 53.51  ? 228 GLN C CG    1 
ATOM   6943 C CD    . GLN E 2 228 ? 30.905  91.457  67.791  1.00 53.49  ? 228 GLN C CD    1 
ATOM   6944 O OE1   . GLN E 2 228 ? 30.364  92.248  67.017  1.00 54.54  ? 228 GLN C OE1   1 
ATOM   6945 N NE2   . GLN E 2 228 ? 31.476  91.843  68.922  1.00 52.04  ? 228 GLN C NE2   1 
ATOM   6946 N N     . THR E 2 229 ? 26.793  88.095  67.214  1.00 54.45  ? 229 THR C N     1 
ATOM   6947 C CA    . THR E 2 229 ? 25.514  87.809  66.589  1.00 54.78  ? 229 THR C CA    1 
ATOM   6948 C C     . THR E 2 229 ? 24.356  88.151  67.519  1.00 56.30  ? 229 THR C C     1 
ATOM   6949 O O     . THR E 2 229 ? 23.240  88.384  67.059  1.00 56.22  ? 229 THR C O     1 
ATOM   6950 C CB    . THR E 2 229 ? 25.425  86.337  66.145  1.00 53.97  ? 229 THR C CB    1 
ATOM   6951 O OG1   . THR E 2 229 ? 26.455  86.068  65.189  1.00 53.49  ? 229 THR C OG1   1 
ATOM   6952 C CG2   . THR E 2 229 ? 24.095  86.050  65.496  1.00 52.68  ? 229 THR C CG2   1 
ATOM   6953 N N     . MET E 2 230 ? 24.612  88.186  68.826  1.00 57.99  ? 230 MET C N     1 
ATOM   6954 C CA    . MET E 2 230 ? 23.560  88.538  69.778  1.00 59.64  ? 230 MET C CA    1 
ATOM   6955 C C     . MET E 2 230 ? 23.315  90.036  69.723  1.00 59.70  ? 230 MET C C     1 
ATOM   6956 O O     . MET E 2 230 ? 22.172  90.475  69.660  1.00 58.98  ? 230 MET C O     1 
ATOM   6957 C CB    . MET E 2 230 ? 23.935  88.136  71.207  1.00 61.59  ? 230 MET C CB    1 
ATOM   6958 C CG    . MET E 2 230 ? 23.501  86.734  71.592  1.00 64.39  ? 230 MET C CG    1 
ATOM   6959 S SD    . MET E 2 230 ? 21.709  86.511  71.484  1.00 68.68  ? 230 MET C SD    1 
ATOM   6960 C CE    . MET E 2 230 ? 21.234  87.209  73.095  1.00 68.44  ? 230 MET C CE    1 
ATOM   6961 N N     . GLN E 2 231 ? 24.397  90.811  69.747  1.00 60.14  ? 231 GLN C N     1 
ATOM   6962 C CA    . GLN E 2 231 ? 24.302  92.262  69.677  1.00 61.12  ? 231 GLN C CA    1 
ATOM   6963 C C     . GLN E 2 231 ? 23.570  92.640  68.400  1.00 61.08  ? 231 GLN C C     1 
ATOM   6964 O O     . GLN E 2 231 ? 22.660  93.470  68.419  1.00 61.31  ? 231 GLN C O     1 
ATOM   6965 C CB    . GLN E 2 231 ? 25.694  92.900  69.679  1.00 62.26  ? 231 GLN C CB    1 
ATOM   6966 C CG    . GLN E 2 231 ? 26.471  92.710  70.977  1.00 64.88  ? 231 GLN C CG    1 
ATOM   6967 C CD    . GLN E 2 231 ? 27.910  93.204  70.888  1.00 66.71  ? 231 GLN C CD    1 
ATOM   6968 O OE1   . GLN E 2 231 ? 28.715  92.986  71.808  1.00 67.98  ? 231 GLN C OE1   1 
ATOM   6969 N NE2   . GLN E 2 231 ? 28.243  93.876  69.781  1.00 67.35  ? 231 GLN C NE2   1 
ATOM   6970 N N     . MET E 2 232 ? 23.961  92.015  67.294  1.00 60.79  ? 232 MET C N     1 
ATOM   6971 C CA    . MET E 2 232 ? 23.333  92.281  66.008  1.00 60.45  ? 232 MET C CA    1 
ATOM   6972 C C     . MET E 2 232 ? 21.827  92.058  66.061  1.00 61.02  ? 232 MET C C     1 
ATOM   6973 O O     . MET E 2 232 ? 21.048  92.911  65.626  1.00 61.45  ? 232 MET C O     1 
ATOM   6974 C CB    . MET E 2 232 ? 23.934  91.391  64.919  1.00 59.50  ? 232 MET C CB    1 
ATOM   6975 C CG    . MET E 2 232 ? 23.191  91.487  63.596  1.00 58.38  ? 232 MET C CG    1 
ATOM   6976 S SD    . MET E 2 232 ? 23.865  90.450  62.299  1.00 57.82  ? 232 MET C SD    1 
ATOM   6977 C CE    . MET E 2 232 ? 23.075  88.888  62.648  1.00 58.37  ? 232 MET C CE    1 
ATOM   6978 N N     . LEU E 2 233 ? 21.416  90.909  66.587  1.00 61.49  ? 233 LEU C N     1 
ATOM   6979 C CA    . LEU E 2 233 ? 19.996  90.587  66.684  1.00 61.79  ? 233 LEU C CA    1 
ATOM   6980 C C     . LEU E 2 233 ? 19.278  91.479  67.691  1.00 62.46  ? 233 LEU C C     1 
ATOM   6981 O O     . LEU E 2 233 ? 18.098  91.777  67.526  1.00 62.60  ? 233 LEU C O     1 
ATOM   6982 C CB    . LEU E 2 233 ? 19.803  89.117  67.068  1.00 60.93  ? 233 LEU C CB    1 
ATOM   6983 C CG    . LEU E 2 233 ? 20.222  88.091  66.012  1.00 60.75  ? 233 LEU C CG    1 
ATOM   6984 C CD1   . LEU E 2 233 ? 20.198  86.685  66.615  1.00 59.39  ? 233 LEU C CD1   1 
ATOM   6985 C CD2   . LEU E 2 233 ? 19.298  88.206  64.800  1.00 59.39  ? 233 LEU C CD2   1 
ATOM   6986 N N     . ASN E 2 234 ? 19.981  91.903  68.734  1.00 63.06  ? 234 ASN C N     1 
ATOM   6987 C CA    . ASN E 2 234 ? 19.358  92.760  69.727  1.00 64.09  ? 234 ASN C CA    1 
ATOM   6988 C C     . ASN E 2 234 ? 19.132  94.154  69.163  1.00 64.67  ? 234 ASN C C     1 
ATOM   6989 O O     . ASN E 2 234 ? 18.309  94.902  69.678  1.00 65.23  ? 234 ASN C O     1 
ATOM   6990 C CB    . ASN E 2 234 ? 20.210  92.852  70.992  1.00 64.59  ? 234 ASN C CB    1 
ATOM   6991 C CG    . ASN E 2 234 ? 20.221  91.558  71.783  1.00 65.13  ? 234 ASN C CG    1 
ATOM   6992 O OD1   . ASN E 2 234 ? 19.200  90.878  71.901  1.00 65.19  ? 234 ASN C OD1   1 
ATOM   6993 N ND2   . ASN E 2 234 ? 21.377  91.220  72.347  1.00 65.49  ? 234 ASN C ND2   1 
ATOM   6994 N N     . GLU E 2 235 ? 19.868  94.503  68.111  1.00 64.57  ? 235 GLU C N     1 
ATOM   6995 C CA    . GLU E 2 235 ? 19.716  95.805  67.472  1.00 64.24  ? 235 GLU C CA    1 
ATOM   6996 C C     . GLU E 2 235 ? 18.625  95.720  66.423  1.00 63.35  ? 235 GLU C C     1 
ATOM   6997 O O     . GLU E 2 235 ? 18.502  96.604  65.585  1.00 63.72  ? 235 GLU C O     1 
ATOM   6998 C CB    . GLU E 2 235 ? 21.006  96.236  66.773  1.00 65.82  ? 235 GLU C CB    1 
ATOM   6999 C CG    . GLU E 2 235 ? 22.167  96.578  67.690  1.00 68.45  ? 235 GLU C CG    1 
ATOM   7000 C CD    . GLU E 2 235 ? 23.444  96.856  66.905  1.00 70.16  ? 235 GLU C CD    1 
ATOM   7001 O OE1   . GLU E 2 235 ? 24.517  97.026  67.529  1.00 71.18  ? 235 GLU C OE1   1 
ATOM   7002 O OE2   . GLU E 2 235 ? 23.372  96.898  65.655  1.00 70.96  ? 235 GLU C OE2   1 
ATOM   7003 N N     . GLY E 2 236 ? 17.849  94.647  66.446  1.00 62.02  ? 236 GLY C N     1 
ATOM   7004 C CA    . GLY E 2 236 ? 16.786  94.514  65.468  1.00 60.78  ? 236 GLY C CA    1 
ATOM   7005 C C     . GLY E 2 236 ? 17.229  94.159  64.059  1.00 60.16  ? 236 GLY C C     1 
ATOM   7006 O O     . GLY E 2 236 ? 16.390  94.008  63.167  1.00 59.88  ? 236 GLY C O     1 
ATOM   7007 N N     . ILE E 2 237 ? 18.535  94.027  63.840  1.00 59.42  ? 237 ILE C N     1 
ATOM   7008 C CA    . ILE E 2 237 ? 19.039  93.661  62.519  1.00 58.63  ? 237 ILE C CA    1 
ATOM   7009 C C     . ILE E 2 237 ? 19.010  92.147  62.402  1.00 58.27  ? 237 ILE C C     1 
ATOM   7010 O O     . ILE E 2 237 ? 19.827  91.469  63.010  1.00 59.25  ? 237 ILE C O     1 
ATOM   7011 C CB    . ILE E 2 237 ? 20.485  94.110  62.320  1.00 58.87  ? 237 ILE C CB    1 
ATOM   7012 C CG1   . ILE E 2 237 ? 20.589  95.625  62.507  1.00 58.75  ? 237 ILE C CG1   1 
ATOM   7013 C CG2   . ILE E 2 237 ? 20.965  93.694  60.932  1.00 58.87  ? 237 ILE C CG2   1 
ATOM   7014 C CD1   . ILE E 2 237 ? 22.005  96.147  62.453  1.00 58.82  ? 237 ILE C CD1   1 
ATOM   7015 N N     . VAL E 2 238 ? 18.080  91.610  61.624  1.00 57.19  ? 238 VAL C N     1 
ATOM   7016 C CA    . VAL E 2 238 ? 17.981  90.165  61.482  1.00 56.12  ? 238 VAL C CA    1 
ATOM   7017 C C     . VAL E 2 238 ? 18.038  89.733  60.008  1.00 55.31  ? 238 VAL C C     1 
ATOM   7018 O O     . VAL E 2 238 ? 17.024  89.745  59.304  1.00 55.45  ? 238 VAL C O     1 
ATOM   7019 C CB    . VAL E 2 238 ? 16.677  89.647  62.168  1.00 55.74  ? 238 VAL C CB    1 
ATOM   7020 C CG1   . VAL E 2 238 ? 15.506  90.479  61.739  1.00 56.36  ? 238 VAL C CG1   1 
ATOM   7021 C CG2   . VAL E 2 238 ? 16.426  88.199  61.818  1.00 55.56  ? 238 VAL C CG2   1 
ATOM   7022 N N     . PRO E 2 239 ? 19.236  89.329  59.532  1.00 54.05  ? 239 PRO C N     1 
ATOM   7023 C CA    . PRO E 2 239 ? 19.498  88.883  58.158  1.00 52.80  ? 239 PRO C CA    1 
ATOM   7024 C C     . PRO E 2 239 ? 18.915  87.519  57.888  1.00 52.17  ? 239 PRO C C     1 
ATOM   7025 O O     . PRO E 2 239 ? 18.373  86.887  58.787  1.00 52.36  ? 239 PRO C O     1 
ATOM   7026 C CB    . PRO E 2 239 ? 21.009  88.836  58.104  1.00 52.61  ? 239 PRO C CB    1 
ATOM   7027 C CG    . PRO E 2 239 ? 21.337  88.319  59.446  1.00 52.96  ? 239 PRO C CG    1 
ATOM   7028 C CD    . PRO E 2 239 ? 20.446  89.154  60.355  1.00 53.83  ? 239 PRO C CD    1 
ATOM   7029 N N     . THR E 2 240 ? 19.035  87.053  56.653  1.00 51.20  ? 240 THR C N     1 
ATOM   7030 C CA    . THR E 2 240 ? 18.524  85.727  56.324  1.00 50.31  ? 240 THR C CA    1 
ATOM   7031 C C     . THR E 2 240 ? 19.698  84.772  56.109  1.00 49.38  ? 240 THR C C     1 
ATOM   7032 O O     . THR E 2 240 ? 19.510  83.582  55.871  1.00 48.91  ? 240 THR C O     1 
ATOM   7033 C CB    . THR E 2 240 ? 17.688  85.737  55.047  1.00 50.00  ? 240 THR C CB    1 
ATOM   7034 O OG1   . THR E 2 240 ? 18.517  86.133  53.955  1.00 50.19  ? 240 THR C OG1   1 
ATOM   7035 C CG2   . THR E 2 240 ? 16.533  86.690  55.178  1.00 49.68  ? 240 THR C CG2   1 
ATOM   7036 N N     . ALA E 2 241 ? 20.910  85.309  56.183  1.00 47.87  ? 241 ALA C N     1 
ATOM   7037 C CA    . ALA E 2 241 ? 22.099  84.506  55.995  1.00 47.00  ? 241 ALA C CA    1 
ATOM   7038 C C     . ALA E 2 241 ? 23.307  85.251  56.520  1.00 46.76  ? 241 ALA C C     1 
ATOM   7039 O O     . ALA E 2 241 ? 23.347  86.484  56.492  1.00 46.79  ? 241 ALA C O     1 
ATOM   7040 C CB    . ALA E 2 241 ? 22.284  84.178  54.531  1.00 46.49  ? 241 ALA C CB    1 
ATOM   7041 N N     . MET E 2 242 ? 24.286  84.493  57.007  1.00 45.85  ? 242 MET C N     1 
ATOM   7042 C CA    . MET E 2 242 ? 25.518  85.064  57.538  1.00 45.34  ? 242 MET C CA    1 
ATOM   7043 C C     . MET E 2 242 ? 26.748  84.352  56.971  1.00 44.89  ? 242 MET C C     1 
ATOM   7044 O O     . MET E 2 242 ? 26.752  83.138  56.796  1.00 45.19  ? 242 MET C O     1 
ATOM   7045 C CB    . MET E 2 242 ? 25.557  84.949  59.065  1.00 44.91  ? 242 MET C CB    1 
ATOM   7046 C CG    . MET E 2 242 ? 24.542  85.780  59.812  1.00 44.98  ? 242 MET C CG    1 
ATOM   7047 S SD    . MET E 2 242 ? 24.675  85.522  61.618  1.00 45.63  ? 242 MET C SD    1 
ATOM   7048 C CE    . MET E 2 242 ? 26.183  86.364  62.022  1.00 44.10  ? 242 MET C CE    1 
ATOM   7049 N N     . LEU E 2 243 ? 27.783  85.123  56.665  1.00 44.02  ? 243 LEU C N     1 
ATOM   7050 C CA    . LEU E 2 243 ? 29.039  84.578  56.181  1.00 42.78  ? 243 LEU C CA    1 
ATOM   7051 C C     . LEU E 2 243 ? 29.950  84.816  57.373  1.00 42.39  ? 243 LEU C C     1 
ATOM   7052 O O     . LEU E 2 243 ? 30.126  85.964  57.803  1.00 42.28  ? 243 LEU C O     1 
ATOM   7053 C CB    . LEU E 2 243 ? 29.534  85.359  54.964  1.00 42.53  ? 243 LEU C CB    1 
ATOM   7054 C CG    . LEU E 2 243 ? 28.715  85.107  53.695  1.00 42.67  ? 243 LEU C CG    1 
ATOM   7055 C CD1   . LEU E 2 243 ? 28.921  86.240  52.686  1.00 42.51  ? 243 LEU C CD1   1 
ATOM   7056 C CD2   . LEU E 2 243 ? 29.105  83.771  53.101  1.00 40.95  ? 243 LEU C CD2   1 
ATOM   7057 N N     . VAL E 2 244 ? 30.501  83.739  57.934  1.00 41.50  ? 244 VAL C N     1 
ATOM   7058 C CA    . VAL E 2 244 ? 31.367  83.866  59.098  1.00 40.22  ? 244 VAL C CA    1 
ATOM   7059 C C     . VAL E 2 244 ? 32.798  83.487  58.738  1.00 39.77  ? 244 VAL C C     1 
ATOM   7060 O O     . VAL E 2 244 ? 33.016  82.582  57.955  1.00 40.08  ? 244 VAL C O     1 
ATOM   7061 C CB    . VAL E 2 244 ? 30.813  83.018  60.256  1.00 39.70  ? 244 VAL C CB    1 
ATOM   7062 C CG1   . VAL E 2 244 ? 31.433  83.460  61.564  1.00 38.70  ? 244 VAL C CG1   1 
ATOM   7063 C CG2   . VAL E 2 244 ? 29.293  83.171  60.317  1.00 38.15  ? 244 VAL C CG2   1 
ATOM   7064 N N     . ALA E 2 245 ? 33.766  84.205  59.296  1.00 39.88  ? 245 ALA C N     1 
ATOM   7065 C CA    . ALA E 2 245 ? 35.178  83.996  58.990  1.00 39.86  ? 245 ALA C CA    1 
ATOM   7066 C C     . ALA E 2 245 ? 35.768  82.633  59.353  1.00 40.63  ? 245 ALA C C     1 
ATOM   7067 O O     . ALA E 2 245 ? 36.817  82.269  58.822  1.00 41.49  ? 245 ALA C O     1 
ATOM   7068 C CB    . ALA E 2 245 ? 36.003  85.098  59.615  1.00 39.00  ? 245 ALA C CB    1 
ATOM   7069 N N     . ASN E 2 246 ? 35.139  81.900  60.271  1.00 39.84  ? 246 ASN C N     1 
ATOM   7070 C CA    . ASN E 2 246 ? 35.614  80.560  60.631  1.00 39.61  ? 246 ASN C CA    1 
ATOM   7071 C C     . ASN E 2 246 ? 34.504  79.749  61.284  1.00 39.07  ? 246 ASN C C     1 
ATOM   7072 O O     . ASN E 2 246 ? 33.504  80.311  61.728  1.00 38.86  ? 246 ASN C O     1 
ATOM   7073 C CB    . ASN E 2 246 ? 36.860  80.625  61.531  1.00 39.10  ? 246 ASN C CB    1 
ATOM   7074 C CG    . ASN E 2 246 ? 36.543  80.979  62.979  1.00 39.52  ? 246 ASN C CG    1 
ATOM   7075 O OD1   . ASN E 2 246 ? 35.473  81.498  63.300  1.00 39.45  ? 246 ASN C OD1   1 
ATOM   7076 N ND2   . ASN E 2 246 ? 37.499  80.710  63.862  1.00 38.99  ? 246 ASN C ND2   1 
ATOM   7077 N N     . ASP E 2 247 ? 34.679  78.431  61.313  1.00 38.90  ? 247 ASP C N     1 
ATOM   7078 C CA    . ASP E 2 247 ? 33.697  77.513  61.885  1.00 38.27  ? 247 ASP C CA    1 
ATOM   7079 C C     . ASP E 2 247 ? 33.421  77.786  63.361  1.00 37.81  ? 247 ASP C C     1 
ATOM   7080 O O     . ASP E 2 247 ? 32.278  77.713  63.797  1.00 37.69  ? 247 ASP C O     1 
ATOM   7081 C CB    . ASP E 2 247 ? 34.169  76.075  61.704  1.00 38.51  ? 247 ASP C CB    1 
ATOM   7082 C CG    . ASP E 2 247 ? 34.234  75.661  60.242  1.00 40.31  ? 247 ASP C CG    1 
ATOM   7083 O OD1   . ASP E 2 247 ? 34.900  74.636  59.958  1.00 41.07  ? 247 ASP C OD1   1 
ATOM   7084 O OD2   . ASP E 2 247 ? 33.618  76.341  59.379  1.00 39.02  ? 247 ASP C OD2   1 
ATOM   7085 N N     . GLN E 2 248 ? 34.444  78.129  64.132  1.00 37.04  ? 248 GLN C N     1 
ATOM   7086 C CA    . GLN E 2 248 ? 34.200  78.385  65.537  1.00 38.10  ? 248 GLN C CA    1 
ATOM   7087 C C     . GLN E 2 248 ? 33.252  79.558  65.780  1.00 38.88  ? 248 GLN C C     1 
ATOM   7088 O O     . GLN E 2 248 ? 32.320  79.457  66.594  1.00 38.41  ? 248 GLN C O     1 
ATOM   7089 C CB    . GLN E 2 248 ? 35.526  78.550  66.269  1.00 37.69  ? 248 GLN C CB    1 
ATOM   7090 C CG    . GLN E 2 248 ? 36.203  77.204  66.451  1.00 39.28  ? 248 GLN C CG    1 
ATOM   7091 C CD    . GLN E 2 248 ? 37.677  77.308  66.727  1.00 40.94  ? 248 GLN C CD    1 
ATOM   7092 O OE1   . GLN E 2 248 ? 38.498  77.431  65.795  1.00 41.84  ? 248 GLN C OE1   1 
ATOM   7093 N NE2   . GLN E 2 248 ? 38.039  77.267  68.010  1.00 39.86  ? 248 GLN C NE2   1 
ATOM   7094 N N     . MET E 2 249 ? 33.451  80.670  65.074  1.00 39.70  ? 249 MET C N     1 
ATOM   7095 C CA    . MET E 2 249 ? 32.538  81.798  65.261  1.00 39.66  ? 249 MET C CA    1 
ATOM   7096 C C     . MET E 2 249 ? 31.170  81.435  64.704  1.00 39.10  ? 249 MET C C     1 
ATOM   7097 O O     . MET E 2 249 ? 30.155  81.878  65.217  1.00 38.70  ? 249 MET C O     1 
ATOM   7098 C CB    . MET E 2 249 ? 33.066  83.060  64.582  1.00 39.46  ? 249 MET C CB    1 
ATOM   7099 C CG    . MET E 2 249 ? 34.317  83.567  65.242  1.00 40.43  ? 249 MET C CG    1 
ATOM   7100 S SD    . MET E 2 249 ? 34.791  85.208  64.719  1.00 41.52  ? 249 MET C SD    1 
ATOM   7101 C CE    . MET E 2 249 ? 35.210  84.898  62.910  1.00 38.41  ? 249 MET C CE    1 
ATOM   7102 N N     . ALA E 2 250 ? 31.145  80.621  63.658  1.00 38.94  ? 250 ALA C N     1 
ATOM   7103 C CA    . ALA E 2 250 ? 29.883  80.208  63.085  1.00 40.03  ? 250 ALA C CA    1 
ATOM   7104 C C     . ALA E 2 250 ? 29.124  79.448  64.165  1.00 41.22  ? 250 ALA C C     1 
ATOM   7105 O O     . ALA E 2 250 ? 27.894  79.567  64.277  1.00 42.05  ? 250 ALA C O     1 
ATOM   7106 C CB    . ALA E 2 250 ? 30.115  79.317  61.876  1.00 39.47  ? 250 ALA C CB    1 
ATOM   7107 N N     . LEU E 2 251 ? 29.855  78.675  64.968  1.00 41.43  ? 251 LEU C N     1 
ATOM   7108 C CA    . LEU E 2 251 ? 29.232  77.914  66.046  1.00 42.36  ? 251 LEU C CA    1 
ATOM   7109 C C     . LEU E 2 251 ? 28.558  78.876  67.019  1.00 42.33  ? 251 LEU C C     1 
ATOM   7110 O O     . LEU E 2 251 ? 27.417  78.666  67.434  1.00 42.12  ? 251 LEU C O     1 
ATOM   7111 C CB    . LEU E 2 251 ? 30.273  77.077  66.799  1.00 42.78  ? 251 LEU C CB    1 
ATOM   7112 C CG    . LEU E 2 251 ? 29.714  76.280  67.981  1.00 42.73  ? 251 LEU C CG    1 
ATOM   7113 C CD1   . LEU E 2 251 ? 28.892  75.118  67.451  1.00 43.06  ? 251 LEU C CD1   1 
ATOM   7114 C CD2   . LEU E 2 251 ? 30.845  75.775  68.851  1.00 43.11  ? 251 LEU C CD2   1 
ATOM   7115 N N     . GLY E 2 252 ? 29.275  79.928  67.388  1.00 42.58  ? 252 GLY C N     1 
ATOM   7116 C CA    . GLY E 2 252 ? 28.710  80.910  68.296  1.00 43.94  ? 252 GLY C CA    1 
ATOM   7117 C C     . GLY E 2 252 ? 27.490  81.609  67.697  1.00 44.84  ? 252 GLY C C     1 
ATOM   7118 O O     . GLY E 2 252 ? 26.488  81.872  68.390  1.00 44.22  ? 252 GLY C O     1 
ATOM   7119 N N     . ALA E 2 253 ? 27.568  81.906  66.401  1.00 44.88  ? 253 ALA C N     1 
ATOM   7120 C CA    . ALA E 2 253 ? 26.476  82.576  65.717  1.00 44.76  ? 253 ALA C CA    1 
ATOM   7121 C C     . ALA E 2 253 ? 25.263  81.676  65.758  1.00 44.40  ? 253 ALA C C     1 
ATOM   7122 O O     . ALA E 2 253 ? 24.170  82.124  66.075  1.00 44.46  ? 253 ALA C O     1 
ATOM   7123 C CB    . ALA E 2 253 ? 26.859  82.895  64.274  1.00 44.62  ? 253 ALA C CB    1 
ATOM   7124 N N     . MET E 2 254 ? 25.461  80.405  65.442  1.00 44.52  ? 254 MET C N     1 
ATOM   7125 C CA    . MET E 2 254 ? 24.363  79.453  65.454  1.00 45.00  ? 254 MET C CA    1 
ATOM   7126 C C     . MET E 2 254 ? 23.705  79.382  66.830  1.00 45.32  ? 254 MET C C     1 
ATOM   7127 O O     . MET E 2 254 ? 22.488  79.278  66.931  1.00 45.13  ? 254 MET C O     1 
ATOM   7128 C CB    . MET E 2 254 ? 24.877  78.085  65.031  1.00 45.02  ? 254 MET C CB    1 
ATOM   7129 C CG    . MET E 2 254 ? 25.349  78.079  63.602  1.00 46.27  ? 254 MET C CG    1 
ATOM   7130 S SD    . MET E 2 254 ? 26.271  76.603  63.200  1.00 46.75  ? 254 MET C SD    1 
ATOM   7131 C CE    . MET E 2 254 ? 24.994  75.326  63.290  1.00 47.26  ? 254 MET C CE    1 
ATOM   7132 N N     . ARG E 2 255 ? 24.502  79.451  67.893  1.00 45.81  ? 255 ARG C N     1 
ATOM   7133 C CA    . ARG E 2 255 ? 23.941  79.396  69.236  1.00 46.63  ? 255 ARG C CA    1 
ATOM   7134 C C     . ARG E 2 255 ? 23.026  80.596  69.423  1.00 47.53  ? 255 ARG C C     1 
ATOM   7135 O O     . ARG E 2 255 ? 21.874  80.449  69.845  1.00 47.82  ? 255 ARG C O     1 
ATOM   7136 C CB    . ARG E 2 255 ? 25.049  79.425  70.289  1.00 46.92  ? 255 ARG C CB    1 
ATOM   7137 C CG    . ARG E 2 255 ? 24.720  78.646  71.548  1.00 46.99  ? 255 ARG C CG    1 
ATOM   7138 C CD    . ARG E 2 255 ? 24.363  79.495  72.732  1.00 46.43  ? 255 ARG C CD    1 
ATOM   7139 N NE    . ARG E 2 255 ? 25.517  79.849  73.548  1.00 47.32  ? 255 ARG C NE    1 
ATOM   7140 C CZ    . ARG E 2 255 ? 25.431  80.462  74.729  1.00 47.78  ? 255 ARG C CZ    1 
ATOM   7141 N NH1   . ARG E 2 255 ? 24.248  80.776  75.235  1.00 46.15  ? 255 ARG C NH1   1 
ATOM   7142 N NH2   . ARG E 2 255 ? 26.532  80.805  75.384  1.00 48.63  ? 255 ARG C NH2   1 
ATOM   7143 N N     . ALA E 2 256 ? 23.548  81.781  69.107  1.00 47.75  ? 256 ALA C N     1 
ATOM   7144 C CA    . ALA E 2 256 ? 22.791  83.026  69.223  1.00 48.24  ? 256 ALA C CA    1 
ATOM   7145 C C     . ALA E 2 256 ? 21.510  82.980  68.387  1.00 48.58  ? 256 ALA C C     1 
ATOM   7146 O O     . ALA E 2 256 ? 20.439  83.370  68.847  1.00 48.95  ? 256 ALA C O     1 
ATOM   7147 C CB    . ALA E 2 256 ? 23.651  84.204  68.795  1.00 47.96  ? 256 ALA C CB    1 
ATOM   7148 N N     . ILE E 2 257 ? 21.609  82.508  67.157  1.00 48.53  ? 257 ILE C N     1 
ATOM   7149 C CA    . ILE E 2 257 ? 20.428  82.422  66.330  1.00 49.23  ? 257 ILE C CA    1 
ATOM   7150 C C     . ILE E 2 257 ? 19.395  81.527  67.004  1.00 50.61  ? 257 ILE C C     1 
ATOM   7151 O O     . ILE E 2 257 ? 18.241  81.918  67.188  1.00 51.08  ? 257 ILE C O     1 
ATOM   7152 C CB    . ILE E 2 257 ? 20.766  81.835  64.963  1.00 49.05  ? 257 ILE C CB    1 
ATOM   7153 C CG1   . ILE E 2 257 ? 21.649  82.812  64.184  1.00 48.38  ? 257 ILE C CG1   1 
ATOM   7154 C CG2   . ILE E 2 257 ? 19.492  81.504  64.206  1.00 48.34  ? 257 ILE C CG2   1 
ATOM   7155 C CD1   . ILE E 2 257 ? 22.055  82.288  62.825  1.00 48.33  ? 257 ILE C CD1   1 
ATOM   7156 N N     . THR E 2 258 ? 19.820  80.327  67.385  1.00 51.83  ? 258 THR C N     1 
ATOM   7157 C CA    . THR E 2 258 ? 18.934  79.363  68.018  1.00 52.56  ? 258 THR C CA    1 
ATOM   7158 C C     . THR E 2 258 ? 18.353  79.844  69.330  1.00 53.56  ? 258 THR C C     1 
ATOM   7159 O O     . THR E 2 258 ? 17.152  79.717  69.552  1.00 53.71  ? 258 THR C O     1 
ATOM   7160 C CB    . THR E 2 258 ? 19.647  78.032  68.252  1.00 52.34  ? 258 THR C CB    1 
ATOM   7161 O OG1   . THR E 2 258 ? 20.123  77.536  66.999  1.00 53.15  ? 258 THR C OG1   1 
ATOM   7162 C CG2   . THR E 2 258 ? 18.696  77.010  68.842  1.00 51.71  ? 258 THR C CG2   1 
ATOM   7163 N N     . GLU E 2 259 ? 19.185  80.397  70.203  1.00 54.55  ? 259 GLU C N     1 
ATOM   7164 C CA    . GLU E 2 259 ? 18.674  80.863  71.484  1.00 56.34  ? 259 GLU C CA    1 
ATOM   7165 C C     . GLU E 2 259 ? 17.810  82.096  71.342  1.00 57.55  ? 259 GLU C C     1 
ATOM   7166 O O     . GLU E 2 259 ? 17.350  82.651  72.335  1.00 58.93  ? 259 GLU C O     1 
ATOM   7167 C CB    . GLU E 2 259 ? 19.814  81.141  72.459  1.00 55.76  ? 259 GLU C CB    1 
ATOM   7168 C CG    . GLU E 2 259 ? 20.516  79.885  72.890  1.00 56.37  ? 259 GLU C CG    1 
ATOM   7169 C CD    . GLU E 2 259 ? 21.533  80.141  73.962  1.00 57.04  ? 259 GLU C CD    1 
ATOM   7170 O OE1   . GLU E 2 259 ? 22.174  79.166  74.414  1.00 57.17  ? 259 GLU C OE1   1 
ATOM   7171 O OE2   . GLU E 2 259 ? 21.690  81.321  74.354  1.00 57.84  ? 259 GLU C OE2   1 
ATOM   7172 N N     . SER E 2 260 ? 17.594  82.528  70.107  1.00 58.14  ? 260 SER C N     1 
ATOM   7173 C CA    . SER E 2 260 ? 16.759  83.689  69.842  1.00 58.36  ? 260 SER C CA    1 
ATOM   7174 C C     . SER E 2 260 ? 15.402  83.264  69.300  1.00 58.42  ? 260 SER C C     1 
ATOM   7175 O O     . SER E 2 260 ? 14.559  84.104  69.025  1.00 59.18  ? 260 SER C O     1 
ATOM   7176 C CB    . SER E 2 260 ? 17.431  84.619  68.838  1.00 58.60  ? 260 SER C CB    1 
ATOM   7177 O OG    . SER E 2 260 ? 18.528  85.269  69.440  1.00 59.93  ? 260 SER C OG    1 
ATOM   7178 N N     . GLY E 2 261 ? 15.193  81.966  69.133  1.00 58.00  ? 261 GLY C N     1 
ATOM   7179 C CA    . GLY E 2 261 ? 13.918  81.505  68.628  1.00 58.06  ? 261 GLY C CA    1 
ATOM   7180 C C     . GLY E 2 261 ? 13.919  81.294  67.132  1.00 58.35  ? 261 GLY C C     1 
ATOM   7181 O O     . GLY E 2 261 ? 12.893  80.915  66.554  1.00 58.69  ? 261 GLY C O     1 
ATOM   7182 N N     . LEU E 2 262 ? 15.063  81.533  66.498  1.00 58.02  ? 262 LEU C N     1 
ATOM   7183 C CA    . LEU E 2 262 ? 15.167  81.354  65.056  1.00 57.80  ? 262 LEU C CA    1 
ATOM   7184 C C     . LEU E 2 262 ? 15.832  80.024  64.724  1.00 57.79  ? 262 LEU C C     1 
ATOM   7185 O O     . LEU E 2 262 ? 16.630  79.513  65.501  1.00 58.21  ? 262 LEU C O     1 
ATOM   7186 C CB    . LEU E 2 262 ? 15.952  82.513  64.442  1.00 57.35  ? 262 LEU C CB    1 
ATOM   7187 C CG    . LEU E 2 262 ? 15.321  83.888  64.675  1.00 57.97  ? 262 LEU C CG    1 
ATOM   7188 C CD1   . LEU E 2 262 ? 16.135  84.956  63.952  1.00 57.85  ? 262 LEU C CD1   1 
ATOM   7189 C CD2   . LEU E 2 262 ? 13.883  83.889  64.170  1.00 56.48  ? 262 LEU C CD2   1 
ATOM   7190 N N     . ARG E 2 263 ? 15.494  79.463  63.571  1.00 57.61  ? 263 ARG C N     1 
ATOM   7191 C CA    . ARG E 2 263 ? 16.058  78.193  63.138  1.00 57.37  ? 263 ARG C CA    1 
ATOM   7192 C C     . ARG E 2 263 ? 17.242  78.393  62.191  1.00 56.92  ? 263 ARG C C     1 
ATOM   7193 O O     . ARG E 2 263 ? 17.088  78.976  61.119  1.00 56.80  ? 263 ARG C O     1 
ATOM   7194 C CB    . ARG E 2 263 ? 14.998  77.366  62.409  1.00 58.23  ? 263 ARG C CB    1 
ATOM   7195 C CG    . ARG E 2 263 ? 13.677  77.305  63.109  1.00 59.68  ? 263 ARG C CG    1 
ATOM   7196 C CD    . ARG E 2 263 ? 12.785  76.242  62.500  1.00 61.77  ? 263 ARG C CD    1 
ATOM   7197 N NE    . ARG E 2 263 ? 12.326  76.571  61.152  1.00 64.30  ? 263 ARG C NE    1 
ATOM   7198 C CZ    . ARG E 2 263 ? 11.700  77.699  60.825  1.00 65.07  ? 263 ARG C CZ    1 
ATOM   7199 N NH1   . ARG E 2 263 ? 11.466  78.621  61.750  1.00 66.18  ? 263 ARG C NH1   1 
ATOM   7200 N NH2   . ARG E 2 263 ? 11.280  77.895  59.582  1.00 64.89  ? 263 ARG C NH2   1 
ATOM   7201 N N     . VAL E 2 264 ? 18.417  77.907  62.579  1.00 56.31  ? 264 VAL C N     1 
ATOM   7202 C CA    . VAL E 2 264 ? 19.582  78.018  61.714  1.00 55.34  ? 264 VAL C CA    1 
ATOM   7203 C C     . VAL E 2 264 ? 19.229  77.267  60.441  1.00 55.83  ? 264 VAL C C     1 
ATOM   7204 O O     . VAL E 2 264 ? 18.757  76.126  60.493  1.00 55.75  ? 264 VAL C O     1 
ATOM   7205 C CB    . VAL E 2 264 ? 20.820  77.378  62.343  1.00 54.47  ? 264 VAL C CB    1 
ATOM   7206 C CG1   . VAL E 2 264 ? 21.931  77.282  61.313  1.00 53.19  ? 264 VAL C CG1   1 
ATOM   7207 C CG2   . VAL E 2 264 ? 21.268  78.195  63.542  1.00 53.66  ? 264 VAL C CG2   1 
ATOM   7208 N N     . GLY E 2 265 ? 19.444  77.911  59.299  1.00 55.93  ? 265 GLY C N     1 
ATOM   7209 C CA    . GLY E 2 265 ? 19.118  77.284  58.036  1.00 56.39  ? 265 GLY C CA    1 
ATOM   7210 C C     . GLY E 2 265 ? 17.805  77.837  57.527  1.00 57.05  ? 265 GLY C C     1 
ATOM   7211 O O     . GLY E 2 265 ? 17.789  78.675  56.627  1.00 58.20  ? 265 GLY C O     1 
ATOM   7212 N N     . ALA E 2 266 ? 16.703  77.389  58.121  1.00 56.98  ? 266 ALA C N     1 
ATOM   7213 C CA    . ALA E 2 266 ? 15.370  77.828  57.717  1.00 56.66  ? 266 ALA C CA    1 
ATOM   7214 C C     . ALA E 2 266 ? 15.104  79.322  57.888  1.00 56.19  ? 266 ALA C C     1 
ATOM   7215 O O     . ALA E 2 266 ? 14.471  79.925  57.034  1.00 56.62  ? 266 ALA C O     1 
ATOM   7216 C CB    . ALA E 2 266 ? 14.316  77.031  58.464  1.00 56.45  ? 266 ALA C CB    1 
ATOM   7217 N N     . ASP E 2 267 ? 15.570  79.921  58.978  1.00 55.65  ? 267 ASP C N     1 
ATOM   7218 C CA    . ASP E 2 267 ? 15.340  81.346  59.193  1.00 55.14  ? 267 ASP C CA    1 
ATOM   7219 C C     . ASP E 2 267 ? 16.577  82.161  58.860  1.00 54.06  ? 267 ASP C C     1 
ATOM   7220 O O     . ASP E 2 267 ? 16.493  83.143  58.130  1.00 54.54  ? 267 ASP C O     1 
ATOM   7221 C CB    . ASP E 2 267 ? 14.901  81.619  60.636  1.00 56.81  ? 267 ASP C CB    1 
ATOM   7222 C CG    . ASP E 2 267 ? 13.658  80.821  61.035  1.00 58.63  ? 267 ASP C CG    1 
ATOM   7223 O OD1   . ASP E 2 267 ? 12.782  80.583  60.164  1.00 59.80  ? 267 ASP C OD1   1 
ATOM   7224 O OD2   . ASP E 2 267 ? 13.545  80.442  62.225  1.00 58.73  ? 267 ASP C OD2   1 
ATOM   7225 N N     . ILE E 2 268 ? 17.722  81.763  59.401  1.00 52.27  ? 268 ILE C N     1 
ATOM   7226 C CA    . ILE E 2 268 ? 18.974  82.452  59.112  1.00 50.25  ? 268 ILE C CA    1 
ATOM   7227 C C     . ILE E 2 268 ? 20.012  81.417  58.708  1.00 49.26  ? 268 ILE C C     1 
ATOM   7228 O O     . ILE E 2 268 ? 20.455  80.637  59.542  1.00 50.19  ? 268 ILE C O     1 
ATOM   7229 C CB    . ILE E 2 268 ? 19.523  83.188  60.332  1.00 50.07  ? 268 ILE C CB    1 
ATOM   7230 C CG1   . ILE E 2 268 ? 18.500  84.195  60.851  1.00 49.51  ? 268 ILE C CG1   1 
ATOM   7231 C CG2   . ILE E 2 268 ? 20.822  83.865  59.968  1.00 49.04  ? 268 ILE C CG2   1 
ATOM   7232 C CD1   . ILE E 2 268 ? 19.036  85.054  61.983  1.00 48.56  ? 268 ILE C CD1   1 
ATOM   7233 N N     . SER E 2 269 ? 20.381  81.391  57.434  1.00 47.31  ? 269 SER C N     1 
ATOM   7234 C CA    . SER E 2 269 ? 21.388  80.459  56.960  1.00 45.32  ? 269 SER C CA    1 
ATOM   7235 C C     . SER E 2 269 ? 22.750  80.919  57.461  1.00 44.15  ? 269 SER C C     1 
ATOM   7236 O O     . SER E 2 269 ? 22.930  82.096  57.769  1.00 43.06  ? 269 SER C O     1 
ATOM   7237 C CB    . SER E 2 269 ? 21.387  80.397  55.434  1.00 45.13  ? 269 SER C CB    1 
ATOM   7238 O OG    . SER E 2 269 ? 20.248  79.694  54.975  1.00 45.48  ? 269 SER C OG    1 
ATOM   7239 N N     . VAL E 2 270 ? 23.701  79.990  57.560  1.00 42.98  ? 270 VAL C N     1 
ATOM   7240 C CA    . VAL E 2 270 ? 25.043  80.322  58.032  1.00 41.36  ? 270 VAL C CA    1 
ATOM   7241 C C     . VAL E 2 270 ? 26.120  79.593  57.252  1.00 40.40  ? 270 VAL C C     1 
ATOM   7242 O O     . VAL E 2 270 ? 25.954  78.445  56.874  1.00 39.97  ? 270 VAL C O     1 
ATOM   7243 C CB    . VAL E 2 270 ? 25.208  79.960  59.511  1.00 41.29  ? 270 VAL C CB    1 
ATOM   7244 C CG1   . VAL E 2 270 ? 26.612  80.309  59.972  1.00 41.19  ? 270 VAL C CG1   1 
ATOM   7245 C CG2   . VAL E 2 270 ? 24.178  80.693  60.339  1.00 40.59  ? 270 VAL C CG2   1 
ATOM   7246 N N     . VAL E 2 271 ? 27.222  80.277  56.997  1.00 40.16  ? 271 VAL C N     1 
ATOM   7247 C CA    . VAL E 2 271 ? 28.339  79.677  56.289  1.00 39.71  ? 271 VAL C CA    1 
ATOM   7248 C C     . VAL E 2 271 ? 29.585  79.945  57.115  1.00 40.02  ? 271 VAL C C     1 
ATOM   7249 O O     . VAL E 2 271 ? 29.785  81.051  57.615  1.00 39.65  ? 271 VAL C O     1 
ATOM   7250 C CB    . VAL E 2 271 ? 28.505  80.257  54.866  1.00 39.47  ? 271 VAL C CB    1 
ATOM   7251 C CG1   . VAL E 2 271 ? 29.683  79.577  54.155  1.00 39.18  ? 271 VAL C CG1   1 
ATOM   7252 C CG2   . VAL E 2 271 ? 27.228  80.035  54.070  1.00 39.06  ? 271 VAL C CG2   1 
ATOM   7253 N N     . GLY E 2 272 ? 30.409  78.917  57.290  1.00 40.58  ? 272 GLY C N     1 
ATOM   7254 C CA    . GLY E 2 272 ? 31.618  79.086  58.072  1.00 41.54  ? 272 GLY C CA    1 
ATOM   7255 C C     . GLY E 2 272 ? 32.854  79.028  57.206  1.00 42.62  ? 272 GLY C C     1 
ATOM   7256 O O     . GLY E 2 272 ? 32.764  79.052  55.977  1.00 42.85  ? 272 GLY C O     1 
ATOM   7257 N N     . TYR E 2 273 ? 34.011  78.933  57.843  1.00 43.54  ? 273 TYR C N     1 
ATOM   7258 C CA    . TYR E 2 273 ? 35.265  78.883  57.107  1.00 44.71  ? 273 TYR C CA    1 
ATOM   7259 C C     . TYR E 2 273 ? 36.249  77.973  57.859  1.00 45.10  ? 273 TYR C C     1 
ATOM   7260 O O     . TYR E 2 273 ? 36.386  78.104  59.076  1.00 45.06  ? 273 TYR C O     1 
ATOM   7261 C CB    . TYR E 2 273 ? 35.808  80.312  56.990  1.00 45.06  ? 273 TYR C CB    1 
ATOM   7262 C CG    . TYR E 2 273 ? 36.467  80.634  55.669  1.00 45.93  ? 273 TYR C CG    1 
ATOM   7263 C CD1   . TYR E 2 273 ? 37.796  80.285  55.429  1.00 45.99  ? 273 TYR C CD1   1 
ATOM   7264 C CD2   . TYR E 2 273 ? 35.762  81.282  54.652  1.00 45.70  ? 273 TYR C CD2   1 
ATOM   7265 C CE1   . TYR E 2 273 ? 38.401  80.569  54.228  1.00 46.23  ? 273 TYR C CE1   1 
ATOM   7266 C CE2   . TYR E 2 273 ? 36.368  81.572  53.431  1.00 45.98  ? 273 TYR C CE2   1 
ATOM   7267 C CZ    . TYR E 2 273 ? 37.683  81.212  53.231  1.00 46.27  ? 273 TYR C CZ    1 
ATOM   7268 O OH    . TYR E 2 273 ? 38.305  81.480  52.041  1.00 46.45  ? 273 TYR C OH    1 
ATOM   7269 N N     . ASP E 2 274 ? 36.906  77.063  57.125  1.00 45.42  ? 274 ASP C N     1 
ATOM   7270 C CA    . ASP E 2 274 ? 37.900  76.091  57.638  1.00 46.06  ? 274 ASP C CA    1 
ATOM   7271 C C     . ASP E 2 274 ? 37.544  74.649  57.318  1.00 45.96  ? 274 ASP C C     1 
ATOM   7272 O O     . ASP E 2 274 ? 38.359  73.893  56.797  1.00 46.66  ? 274 ASP C O     1 
ATOM   7273 C CB    . ASP E 2 274 ? 38.047  76.111  59.166  1.00 46.76  ? 274 ASP C CB    1 
ATOM   7274 C CG    . ASP E 2 274 ? 38.902  77.248  59.677  1.00 48.00  ? 274 ASP C CG    1 
ATOM   7275 O OD1   . ASP E 2 274 ? 39.580  77.908  58.861  1.00 47.58  ? 274 ASP C OD1   1 
ATOM   7276 O OD2   . ASP E 2 274 ? 38.890  77.466  60.916  1.00 48.17  ? 274 ASP C OD2   1 
ATOM   7277 N N     . ASP E 2 275 ? 36.309  74.287  57.649  1.00 45.58  ? 275 ASP C N     1 
ATOM   7278 C CA    . ASP E 2 275 ? 35.802  72.925  57.533  1.00 45.74  ? 275 ASP C CA    1 
ATOM   7279 C C     . ASP E 2 275 ? 36.547  72.084  58.568  1.00 45.23  ? 275 ASP C C     1 
ATOM   7280 O O     . ASP E 2 275 ? 37.134  71.072  58.232  1.00 43.87  ? 275 ASP C O     1 
ATOM   7281 C CB    . ASP E 2 275 ? 36.011  72.293  56.157  1.00 45.58  ? 275 ASP C CB    1 
ATOM   7282 C CG    . ASP E 2 275 ? 35.456  70.852  56.101  1.00 46.78  ? 275 ASP C CG    1 
ATOM   7283 O OD1   . ASP E 2 275 ? 34.541  70.546  56.903  1.00 46.08  ? 275 ASP C OD1   1 
ATOM   7284 O OD2   . ASP E 2 275 ? 35.909  70.023  55.272  1.00 46.89  ? 275 ASP C OD2   1 
ATOM   7285 N N     . THR E 2 276 ? 36.542  72.538  59.819  1.00 45.18  ? 276 THR C N     1 
ATOM   7286 C CA    . THR E 2 276 ? 37.200  71.825  60.903  1.00 45.55  ? 276 THR C CA    1 
ATOM   7287 C C     . THR E 2 276 ? 36.495  70.489  61.105  1.00 46.70  ? 276 THR C C     1 
ATOM   7288 O O     . THR E 2 276 ? 35.366  70.307  60.643  1.00 46.66  ? 276 THR C O     1 
ATOM   7289 C CB    . THR E 2 276 ? 37.095  72.594  62.212  1.00 45.02  ? 276 THR C CB    1 
ATOM   7290 O OG1   . THR E 2 276 ? 35.713  72.789  62.530  1.00 45.41  ? 276 THR C OG1   1 
ATOM   7291 C CG2   . THR E 2 276 ? 37.780  73.927  62.107  1.00 44.65  ? 276 THR C CG2   1 
ATOM   7292 N N     . GLU E 2 277 ? 37.156  69.558  61.796  1.00 47.81  ? 277 GLU C N     1 
ATOM   7293 C CA    . GLU E 2 277 ? 36.573  68.242  62.056  1.00 48.45  ? 277 GLU C CA    1 
ATOM   7294 C C     . GLU E 2 277 ? 35.228  68.343  62.762  1.00 47.59  ? 277 GLU C C     1 
ATOM   7295 O O     . GLU E 2 277 ? 34.264  67.691  62.371  1.00 47.61  ? 277 GLU C O     1 
ATOM   7296 C CB    . GLU E 2 277 ? 37.527  67.398  62.895  1.00 50.95  ? 277 GLU C CB    1 
ATOM   7297 C CG    . GLU E 2 277 ? 38.691  66.822  62.108  1.00 55.69  ? 277 GLU C CG    1 
ATOM   7298 C CD    . GLU E 2 277 ? 38.283  65.613  61.266  1.00 59.34  ? 277 GLU C CD    1 
ATOM   7299 O OE1   . GLU E 2 277 ? 38.015  64.535  61.862  1.00 62.29  ? 277 GLU C OE1   1 
ATOM   7300 O OE2   . GLU E 2 277 ? 38.219  65.728  60.013  1.00 60.19  ? 277 GLU C OE2   1 
ATOM   7301 N N     . ASP E 2 278 ? 35.148  69.175  63.787  1.00 46.95  ? 278 ASP C N     1 
ATOM   7302 C CA    . ASP E 2 278 ? 33.898  69.313  64.520  1.00 47.22  ? 278 ASP C CA    1 
ATOM   7303 C C     . ASP E 2 278 ? 32.730  69.877  63.693  1.00 47.52  ? 278 ASP C C     1 
ATOM   7304 O O     . ASP E 2 278 ? 31.579  69.514  63.941  1.00 47.13  ? 278 ASP C O     1 
ATOM   7305 C CB    . ASP E 2 278 ? 34.078  70.207  65.762  1.00 47.98  ? 278 ASP C CB    1 
ATOM   7306 C CG    . ASP E 2 278 ? 35.078  69.647  66.787  1.00 49.61  ? 278 ASP C CG    1 
ATOM   7307 O OD1   . ASP E 2 278 ? 35.591  68.513  66.622  1.00 49.88  ? 278 ASP C OD1   1 
ATOM   7308 O OD2   . ASP E 2 278 ? 35.347  70.361  67.783  1.00 49.91  ? 278 ASP C OD2   1 
ATOM   7309 N N     . SER E 2 279 ? 33.009  70.752  62.721  1.00 47.22  ? 279 SER C N     1 
ATOM   7310 C CA    . SER E 2 279 ? 31.935  71.377  61.939  1.00 47.21  ? 279 SER C CA    1 
ATOM   7311 C C     . SER E 2 279 ? 30.916  70.412  61.340  1.00 46.79  ? 279 SER C C     1 
ATOM   7312 O O     . SER E 2 279 ? 29.760  70.777  61.141  1.00 46.41  ? 279 SER C O     1 
ATOM   7313 C CB    . SER E 2 279 ? 32.497  72.290  60.831  1.00 47.67  ? 279 SER C CB    1 
ATOM   7314 O OG    . SER E 2 279 ? 33.163  71.559  59.815  1.00 48.56  ? 279 SER C OG    1 
ATOM   7315 N N     . SER E 2 280 ? 31.321  69.184  61.055  1.00 46.04  ? 280 SER C N     1 
ATOM   7316 C CA    . SER E 2 280 ? 30.370  68.221  60.509  1.00 45.50  ? 280 SER C CA    1 
ATOM   7317 C C     . SER E 2 280 ? 29.378  67.741  61.572  1.00 44.90  ? 280 SER C C     1 
ATOM   7318 O O     . SER E 2 280 ? 28.414  67.068  61.246  1.00 44.82  ? 280 SER C O     1 
ATOM   7319 C CB    . SER E 2 280 ? 31.099  67.013  59.949  1.00 45.59  ? 280 SER C CB    1 
ATOM   7320 O OG    . SER E 2 280 ? 31.704  66.287  61.005  1.00 49.33  ? 280 SER C OG    1 
ATOM   7321 N N     . CYS E 2 281 ? 29.598  68.084  62.836  1.00 44.66  ? 281 CYS C N     1 
ATOM   7322 C CA    . CYS E 2 281 ? 28.687  67.635  63.872  1.00 45.05  ? 281 CYS C CA    1 
ATOM   7323 C C     . CYS E 2 281 ? 28.041  68.741  64.690  1.00 46.34  ? 281 CYS C C     1 
ATOM   7324 O O     . CYS E 2 281 ? 27.605  68.511  65.826  1.00 46.73  ? 281 CYS C O     1 
ATOM   7325 C CB    . CYS E 2 281 ? 29.384  66.627  64.798  1.00 45.56  ? 281 CYS C CB    1 
ATOM   7326 S SG    . CYS E 2 281 ? 29.691  64.987  64.011  1.00 44.76  ? 281 CYS C SG    1 
ATOM   7327 N N     . TYR E 2 282 ? 27.984  69.948  64.125  1.00 46.76  ? 282 TYR C N     1 
ATOM   7328 C CA    . TYR E 2 282 ? 27.315  71.059  64.794  1.00 46.20  ? 282 TYR C CA    1 
ATOM   7329 C C     . TYR E 2 282 ? 25.807  70.799  64.629  1.00 46.27  ? 282 TYR C C     1 
ATOM   7330 O O     . TYR E 2 282 ? 25.403  69.971  63.809  1.00 45.97  ? 282 TYR C O     1 
ATOM   7331 C CB    . TYR E 2 282 ? 27.674  72.384  64.130  1.00 47.28  ? 282 TYR C CB    1 
ATOM   7332 C CG    . TYR E 2 282 ? 29.069  72.907  64.404  1.00 48.43  ? 282 TYR C CG    1 
ATOM   7333 C CD1   . TYR E 2 282 ? 29.917  72.275  65.313  1.00 49.15  ? 282 TYR C CD1   1 
ATOM   7334 C CD2   . TYR E 2 282 ? 29.529  74.067  63.772  1.00 48.48  ? 282 TYR C CD2   1 
ATOM   7335 C CE1   . TYR E 2 282 ? 31.185  72.784  65.588  1.00 49.23  ? 282 TYR C CE1   1 
ATOM   7336 C CE2   . TYR E 2 282 ? 30.786  74.587  64.040  1.00 48.70  ? 282 TYR C CE2   1 
ATOM   7337 C CZ    . TYR E 2 282 ? 31.612  73.944  64.952  1.00 49.63  ? 282 TYR C CZ    1 
ATOM   7338 O OH    . TYR E 2 282 ? 32.854  74.471  65.250  1.00 49.48  ? 282 TYR C OH    1 
ATOM   7339 N N     . ILE E 2 283 ? 24.976  71.489  65.404  1.00 46.21  ? 283 ILE C N     1 
ATOM   7340 C CA    . ILE E 2 283 ? 23.532  71.308  65.303  1.00 46.08  ? 283 ILE C CA    1 
ATOM   7341 C C     . ILE E 2 283 ? 22.923  72.542  64.632  1.00 46.08  ? 283 ILE C C     1 
ATOM   7342 O O     . ILE E 2 283 ? 22.679  73.551  65.296  1.00 46.96  ? 283 ILE C O     1 
ATOM   7343 C CB    . ILE E 2 283 ? 22.866  71.197  66.690  1.00 47.01  ? 283 ILE C CB    1 
ATOM   7344 C CG1   . ILE E 2 283 ? 23.720  70.369  67.644  1.00 48.94  ? 283 ILE C CG1   1 
ATOM   7345 C CG2   . ILE E 2 283 ? 21.501  70.565  66.553  1.00 46.23  ? 283 ILE C CG2   1 
ATOM   7346 C CD1   . ILE E 2 283 ? 23.809  68.907  67.278  1.00 50.53  ? 283 ILE C CD1   1 
ATOM   7347 N N     . PRO E 2 284 ? 22.646  72.486  63.322  1.00 45.27  ? 284 PRO C N     1 
ATOM   7348 C CA    . PRO E 2 284 ? 22.846  71.396  62.367  1.00 44.94  ? 284 PRO C CA    1 
ATOM   7349 C C     . PRO E 2 284 ? 24.210  71.481  61.700  1.00 44.91  ? 284 PRO C C     1 
ATOM   7350 O O     . PRO E 2 284 ? 24.880  72.510  61.777  1.00 44.86  ? 284 PRO C O     1 
ATOM   7351 C CB    . PRO E 2 284 ? 21.713  71.605  61.377  1.00 44.64  ? 284 PRO C CB    1 
ATOM   7352 C CG    . PRO E 2 284 ? 21.618  73.086  61.317  1.00 45.28  ? 284 PRO C CG    1 
ATOM   7353 C CD    . PRO E 2 284 ? 21.774  73.527  62.753  1.00 44.65  ? 284 PRO C CD    1 
ATOM   7354 N N     . PRO E 2 285 ? 24.635  70.395  61.036  1.00 44.92  ? 285 PRO C N     1 
ATOM   7355 C CA    . PRO E 2 285 ? 25.932  70.363  60.357  1.00 44.63  ? 285 PRO C CA    1 
ATOM   7356 C C     . PRO E 2 285 ? 26.151  71.644  59.561  1.00 44.22  ? 285 PRO C C     1 
ATOM   7357 O O     . PRO E 2 285 ? 25.297  72.049  58.765  1.00 43.90  ? 285 PRO C O     1 
ATOM   7358 C CB    . PRO E 2 285 ? 25.818  69.126  59.473  1.00 45.05  ? 285 PRO C CB    1 
ATOM   7359 C CG    . PRO E 2 285 ? 24.986  68.221  60.308  1.00 44.54  ? 285 PRO C CG    1 
ATOM   7360 C CD    . PRO E 2 285 ? 23.889  69.152  60.777  1.00 44.78  ? 285 PRO C CD    1 
ATOM   7361 N N     . LEU E 2 286 ? 27.311  72.257  59.793  1.00 43.37  ? 286 LEU C N     1 
ATOM   7362 C CA    . LEU E 2 286 ? 27.721  73.525  59.194  1.00 41.84  ? 286 LEU C CA    1 
ATOM   7363 C C     . LEU E 2 286 ? 28.268  73.538  57.778  1.00 41.50  ? 286 LEU C C     1 
ATOM   7364 O O     . LEU E 2 286 ? 29.259  72.883  57.480  1.00 41.24  ? 286 LEU C O     1 
ATOM   7365 C CB    . LEU E 2 286 ? 28.752  74.187  60.110  1.00 41.62  ? 286 LEU C CB    1 
ATOM   7366 C CG    . LEU E 2 286 ? 29.370  75.501  59.640  1.00 41.70  ? 286 LEU C CG    1 
ATOM   7367 C CD1   . LEU E 2 286 ? 28.267  76.566  59.490  1.00 40.70  ? 286 LEU C CD1   1 
ATOM   7368 C CD2   . LEU E 2 286 ? 30.428  75.940  60.629  1.00 40.23  ? 286 LEU C CD2   1 
ATOM   7369 N N     . THR E 2 287 ? 27.613  74.301  56.906  1.00 41.88  ? 287 THR C N     1 
ATOM   7370 C CA    . THR E 2 287 ? 28.069  74.474  55.523  1.00 41.91  ? 287 THR C CA    1 
ATOM   7371 C C     . THR E 2 287 ? 29.325  75.341  55.686  1.00 41.68  ? 287 THR C C     1 
ATOM   7372 O O     . THR E 2 287 ? 29.309  76.341  56.425  1.00 41.02  ? 287 THR C O     1 
ATOM   7373 C CB    . THR E 2 287 ? 27.019  75.223  54.675  1.00 42.20  ? 287 THR C CB    1 
ATOM   7374 O OG1   . THR E 2 287 ? 25.869  74.390  54.497  1.00 44.00  ? 287 THR C OG1   1 
ATOM   7375 C CG2   . THR E 2 287 ? 27.571  75.576  53.321  1.00 42.50  ? 287 THR C CG2   1 
ATOM   7376 N N     . THR E 2 288 ? 30.405  74.980  55.006  1.00 40.80  ? 288 THR C N     1 
ATOM   7377 C CA    . THR E 2 288 ? 31.633  75.721  55.212  1.00 41.14  ? 288 THR C CA    1 
ATOM   7378 C C     . THR E 2 288 ? 32.595  75.656  54.025  1.00 41.42  ? 288 THR C C     1 
ATOM   7379 O O     . THR E 2 288 ? 32.339  74.986  53.025  1.00 42.32  ? 288 THR C O     1 
ATOM   7380 C CB    . THR E 2 288 ? 32.320  75.181  56.502  1.00 40.75  ? 288 THR C CB    1 
ATOM   7381 O OG1   . THR E 2 288 ? 33.436  75.999  56.851  1.00 41.23  ? 288 THR C OG1   1 
ATOM   7382 C CG2   . THR E 2 288 ? 32.794  73.748  56.294  1.00 40.69  ? 288 THR C CG2   1 
ATOM   7383 N N     . ILE E 2 289 ? 33.694  76.378  54.139  1.00 41.03  ? 289 ILE C N     1 
ATOM   7384 C CA    . ILE E 2 289 ? 34.703  76.400  53.101  1.00 41.50  ? 289 ILE C CA    1 
ATOM   7385 C C     . ILE E 2 289 ? 35.872  75.581  53.636  1.00 42.34  ? 289 ILE C C     1 
ATOM   7386 O O     . ILE E 2 289 ? 36.429  75.878  54.696  1.00 42.02  ? 289 ILE C O     1 
ATOM   7387 C CB    . ILE E 2 289 ? 35.204  77.848  52.817  1.00 41.12  ? 289 ILE C CB    1 
ATOM   7388 C CG1   . ILE E 2 289 ? 34.025  78.759  52.453  1.00 39.46  ? 289 ILE C CG1   1 
ATOM   7389 C CG2   . ILE E 2 289 ? 36.279  77.817  51.735  1.00 39.90  ? 289 ILE C CG2   1 
ATOM   7390 C CD1   . ILE E 2 289 ? 33.277  78.353  51.190  1.00 39.19  ? 289 ILE C CD1   1 
ATOM   7391 N N     . LYS E 2 290 ? 36.256  74.564  52.882  1.00 43.59  ? 290 LYS C N     1 
ATOM   7392 C CA    . LYS E 2 290 ? 37.335  73.688  53.277  1.00 44.52  ? 290 LYS C CA    1 
ATOM   7393 C C     . LYS E 2 290 ? 38.744  74.178  52.999  1.00 44.95  ? 290 LYS C C     1 
ATOM   7394 O O     . LYS E 2 290 ? 39.112  74.420  51.858  1.00 44.59  ? 290 LYS C O     1 
ATOM   7395 C CB    . LYS E 2 290 ? 37.139  72.329  52.611  1.00 45.35  ? 290 LYS C CB    1 
ATOM   7396 C CG    . LYS E 2 290 ? 38.258  71.351  52.878  1.00 46.57  ? 290 LYS C CG    1 
ATOM   7397 C CD    . LYS E 2 290 ? 37.984  70.030  52.198  1.00 48.20  ? 290 LYS C CD    1 
ATOM   7398 C CE    . LYS E 2 290 ? 39.081  69.038  52.513  1.00 49.87  ? 290 LYS C CE    1 
ATOM   7399 N NZ    . LYS E 2 290 ? 38.934  67.777  51.739  1.00 51.37  ? 290 LYS C NZ    1 
ATOM   7400 N N     . GLN E 2 291 ? 39.526  74.314  54.062  1.00 46.00  ? 291 GLN C N     1 
ATOM   7401 C CA    . GLN E 2 291 ? 40.921  74.709  53.953  1.00 47.84  ? 291 GLN C CA    1 
ATOM   7402 C C     . GLN E 2 291 ? 41.752  73.524  54.431  1.00 48.39  ? 291 GLN C C     1 
ATOM   7403 O O     . GLN E 2 291 ? 41.847  73.262  55.636  1.00 49.49  ? 291 GLN C O     1 
ATOM   7404 C CB    . GLN E 2 291 ? 41.225  75.913  54.835  1.00 48.66  ? 291 GLN C CB    1 
ATOM   7405 C CG    . GLN E 2 291 ? 40.521  77.164  54.418  1.00 50.19  ? 291 GLN C CG    1 
ATOM   7406 C CD    . GLN E 2 291 ? 41.121  78.367  55.075  1.00 51.10  ? 291 GLN C CD    1 
ATOM   7407 O OE1   . GLN E 2 291 ? 41.717  79.213  54.415  1.00 52.16  ? 291 GLN C OE1   1 
ATOM   7408 N NE2   . GLN E 2 291 ? 40.990  78.447  56.392  1.00 51.73  ? 291 GLN C NE2   1 
ATOM   7409 N N     . ASP E 2 292 ? 42.352  72.809  53.490  1.00 48.35  ? 292 ASP C N     1 
ATOM   7410 C CA    . ASP E 2 292 ? 43.157  71.645  53.824  1.00 47.98  ? 292 ASP C CA    1 
ATOM   7411 C C     . ASP E 2 292 ? 44.493  72.014  54.458  1.00 47.46  ? 292 ASP C C     1 
ATOM   7412 O O     . ASP E 2 292 ? 45.497  72.188  53.772  1.00 46.42  ? 292 ASP C O     1 
ATOM   7413 C CB    . ASP E 2 292 ? 43.384  70.808  52.568  1.00 48.91  ? 292 ASP C CB    1 
ATOM   7414 C CG    . ASP E 2 292 ? 44.037  69.468  52.866  1.00 50.62  ? 292 ASP C CG    1 
ATOM   7415 O OD1   . ASP E 2 292 ? 43.989  68.592  51.976  1.00 51.75  ? 292 ASP C OD1   1 
ATOM   7416 O OD2   . ASP E 2 292 ? 44.608  69.284  53.974  1.00 50.87  ? 292 ASP C OD2   1 
ATOM   7417 N N     . PHE E 2 293 ? 44.506  72.103  55.779  1.00 47.37  ? 293 PHE C N     1 
ATOM   7418 C CA    . PHE E 2 293 ? 45.722  72.458  56.493  1.00 48.58  ? 293 PHE C CA    1 
ATOM   7419 C C     . PHE E 2 293 ? 46.873  71.490  56.298  1.00 49.45  ? 293 PHE C C     1 
ATOM   7420 O O     . PHE E 2 293 ? 48.026  71.893  56.372  1.00 49.58  ? 293 PHE C O     1 
ATOM   7421 C CB    . PHE E 2 293 ? 45.438  72.602  57.979  1.00 48.10  ? 293 PHE C CB    1 
ATOM   7422 C CG    . PHE E 2 293 ? 44.415  73.633  58.288  1.00 48.45  ? 293 PHE C CG    1 
ATOM   7423 C CD1   . PHE E 2 293 ? 43.245  73.286  58.934  1.00 48.76  ? 293 PHE C CD1   1 
ATOM   7424 C CD2   . PHE E 2 293 ? 44.613  74.956  57.928  1.00 48.66  ? 293 PHE C CD2   1 
ATOM   7425 C CE1   . PHE E 2 293 ? 42.278  74.240  59.224  1.00 49.56  ? 293 PHE C CE1   1 
ATOM   7426 C CE2   . PHE E 2 293 ? 43.650  75.916  58.214  1.00 49.85  ? 293 PHE C CE2   1 
ATOM   7427 C CZ    . PHE E 2 293 ? 42.481  75.558  58.864  1.00 50.01  ? 293 PHE C CZ    1 
ATOM   7428 N N     . ARG E 2 294 ? 46.575  70.216  56.064  1.00 50.71  ? 294 ARG C N     1 
ATOM   7429 C CA    . ARG E 2 294 ? 47.640  69.241  55.855  1.00 51.66  ? 294 ARG C CA    1 
ATOM   7430 C C     . ARG E 2 294 ? 48.393  69.674  54.607  1.00 51.10  ? 294 ARG C C     1 
ATOM   7431 O O     . ARG E 2 294 ? 49.626  69.769  54.603  1.00 50.41  ? 294 ARG C O     1 
ATOM   7432 C CB    . ARG E 2 294 ? 47.063  67.845  55.631  1.00 53.83  ? 294 ARG C CB    1 
ATOM   7433 C CG    . ARG E 2 294 ? 46.551  67.159  56.877  1.00 57.32  ? 294 ARG C CG    1 
ATOM   7434 C CD    . ARG E 2 294 ? 47.490  66.041  57.243  1.00 60.65  ? 294 ARG C CD    1 
ATOM   7435 N NE    . ARG E 2 294 ? 48.333  66.343  58.385  1.00 63.45  ? 294 ARG C NE    1 
ATOM   7436 C CZ    . ARG E 2 294 ? 49.492  65.757  58.676  1.00 64.21  ? 294 ARG C CZ    1 
ATOM   7437 N NH1   . ARG E 2 294 ? 50.014  64.805  57.898  1.00 64.21  ? 294 ARG C NH1   1 
ATOM   7438 N NH2   . ARG E 2 294 ? 50.113  66.117  59.792  1.00 64.49  ? 294 ARG C NH2   1 
ATOM   7439 N N     . LEU E 2 295 ? 47.629  69.944  53.550  1.00 50.12  ? 295 LEU C N     1 
ATOM   7440 C CA    . LEU E 2 295 ? 48.192  70.369  52.279  1.00 49.11  ? 295 LEU C CA    1 
ATOM   7441 C C     . LEU E 2 295 ? 49.038  71.633  52.412  1.00 48.55  ? 295 LEU C C     1 
ATOM   7442 O O     . LEU E 2 295 ? 50.080  71.749  51.793  1.00 48.01  ? 295 LEU C O     1 
ATOM   7443 C CB    . LEU E 2 295 ? 47.070  70.602  51.278  1.00 49.21  ? 295 LEU C CB    1 
ATOM   7444 C CG    . LEU E 2 295 ? 47.513  71.156  49.925  1.00 49.77  ? 295 LEU C CG    1 
ATOM   7445 C CD1   . LEU E 2 295 ? 48.399  70.154  49.221  1.00 48.77  ? 295 LEU C CD1   1 
ATOM   7446 C CD2   . LEU E 2 295 ? 46.275  71.458  49.092  1.00 49.85  ? 295 LEU C CD2   1 
ATOM   7447 N N     . LEU E 2 296 ? 48.592  72.577  53.228  1.00 48.26  ? 296 LEU C N     1 
ATOM   7448 C CA    . LEU E 2 296 ? 49.342  73.804  53.404  1.00 48.95  ? 296 LEU C CA    1 
ATOM   7449 C C     . LEU E 2 296 ? 50.697  73.500  54.035  1.00 49.56  ? 296 LEU C C     1 
ATOM   7450 O O     . LEU E 2 296 ? 51.727  73.959  53.543  1.00 49.75  ? 296 LEU C O     1 
ATOM   7451 C CB    . LEU E 2 296 ? 48.554  74.811  54.265  1.00 47.91  ? 296 LEU C CB    1 
ATOM   7452 C CG    . LEU E 2 296 ? 49.339  76.059  54.691  1.00 47.45  ? 296 LEU C CG    1 
ATOM   7453 C CD1   . LEU E 2 296 ? 49.827  76.814  53.452  1.00 47.56  ? 296 LEU C CD1   1 
ATOM   7454 C CD2   . LEU E 2 296 ? 48.474  76.948  55.566  1.00 46.81  ? 296 LEU C CD2   1 
ATOM   7455 N N     . GLY E 2 297 ? 50.693  72.726  55.117  1.00 50.45  ? 297 GLY C N     1 
ATOM   7456 C CA    . GLY E 2 297 ? 51.934  72.373  55.789  1.00 51.43  ? 297 GLY C CA    1 
ATOM   7457 C C     . GLY E 2 297 ? 52.846  71.532  54.910  1.00 52.13  ? 297 GLY C C     1 
ATOM   7458 O O     . GLY E 2 297 ? 54.051  71.754  54.864  1.00 51.80  ? 297 GLY C O     1 
ATOM   7459 N N     . GLN E 2 298 ? 52.274  70.562  54.206  1.00 53.38  ? 298 GLN C N     1 
ATOM   7460 C CA    . GLN E 2 298 ? 53.049  69.701  53.319  1.00 54.44  ? 298 GLN C CA    1 
ATOM   7461 C C     . GLN E 2 298 ? 53.719  70.544  52.246  1.00 55.09  ? 298 GLN C C     1 
ATOM   7462 O O     . GLN E 2 298 ? 54.922  70.422  52.000  1.00 55.28  ? 298 GLN C O     1 
ATOM   7463 C CB    . GLN E 2 298 ? 52.133  68.663  52.668  1.00 55.64  ? 298 GLN C CB    1 
ATOM   7464 C CG    . GLN E 2 298 ? 52.794  67.796  51.608  1.00 58.19  ? 298 GLN C CG    1 
ATOM   7465 C CD    . GLN E 2 298 ? 52.716  68.408  50.212  1.00 60.52  ? 298 GLN C CD    1 
ATOM   7466 O OE1   . GLN E 2 298 ? 51.647  68.431  49.591  1.00 61.07  ? 298 GLN C OE1   1 
ATOM   7467 N NE2   . GLN E 2 298 ? 53.848  68.917  49.716  1.00 60.72  ? 298 GLN C NE2   1 
ATOM   7468 N N     . THR E 2 299 ? 52.932  71.415  51.617  1.00 55.50  ? 299 THR C N     1 
ATOM   7469 C CA    . THR E 2 299 ? 53.425  72.286  50.564  1.00 54.94  ? 299 THR C CA    1 
ATOM   7470 C C     . THR E 2 299 ? 54.448  73.278  51.086  1.00 55.25  ? 299 THR C C     1 
ATOM   7471 O O     . THR E 2 299 ? 55.428  73.569  50.415  1.00 55.13  ? 299 THR C O     1 
ATOM   7472 C CB    . THR E 2 299 ? 52.277  73.045  49.909  1.00 54.95  ? 299 THR C CB    1 
ATOM   7473 O OG1   . THR E 2 299 ? 51.309  72.116  49.408  1.00 54.43  ? 299 THR C OG1   1 
ATOM   7474 C CG2   . THR E 2 299 ? 52.792  73.867  48.753  1.00 56.42  ? 299 THR C CG2   1 
ATOM   7475 N N     . SER E 2 300 ? 54.232  73.797  52.286  1.00 55.93  ? 300 SER C N     1 
ATOM   7476 C CA    . SER E 2 300 ? 55.170  74.752  52.855  1.00 57.19  ? 300 SER C CA    1 
ATOM   7477 C C     . SER E 2 300 ? 56.564  74.187  52.994  1.00 58.05  ? 300 SER C C     1 
ATOM   7478 O O     . SER E 2 300 ? 57.540  74.860  52.683  1.00 58.41  ? 300 SER C O     1 
ATOM   7479 C CB    . SER E 2 300 ? 54.707  75.210  54.222  1.00 57.10  ? 300 SER C CB    1 
ATOM   7480 O OG    . SER E 2 300 ? 53.476  75.866  54.093  1.00 59.88  ? 300 SER C OG    1 
ATOM   7481 N N     . VAL E 2 301 ? 56.666  72.958  53.482  1.00 59.10  ? 301 VAL C N     1 
ATOM   7482 C CA    . VAL E 2 301 ? 57.971  72.341  53.661  1.00 59.57  ? 301 VAL C CA    1 
ATOM   7483 C C     . VAL E 2 301 ? 58.626  72.087  52.313  1.00 59.85  ? 301 VAL C C     1 
ATOM   7484 O O     . VAL E 2 301 ? 59.774  72.455  52.098  1.00 59.34  ? 301 VAL C O     1 
ATOM   7485 C CB    . VAL E 2 301 ? 57.862  71.014  54.446  1.00 59.57  ? 301 VAL C CB    1 
ATOM   7486 C CG1   . VAL E 2 301 ? 59.189  70.266  54.407  1.00 59.09  ? 301 VAL C CG1   1 
ATOM   7487 C CG2   . VAL E 2 301 ? 57.475  71.307  55.884  1.00 59.32  ? 301 VAL C CG2   1 
ATOM   7488 N N     . ASP E 2 302 ? 57.892  71.464  51.404  1.00 60.51  ? 302 ASP C N     1 
ATOM   7489 C CA    . ASP E 2 302 ? 58.421  71.185  50.087  1.00 61.94  ? 302 ASP C CA    1 
ATOM   7490 C C     . ASP E 2 302 ? 58.945  72.463  49.447  1.00 62.76  ? 302 ASP C C     1 
ATOM   7491 O O     . ASP E 2 302 ? 60.040  72.482  48.884  1.00 62.94  ? 302 ASP C O     1 
ATOM   7492 C CB    . ASP E 2 302 ? 57.331  70.567  49.216  1.00 62.71  ? 302 ASP C CB    1 
ATOM   7493 C CG    . ASP E 2 302 ? 56.981  69.152  49.644  1.00 64.38  ? 302 ASP C CG    1 
ATOM   7494 O OD1   . ASP E 2 302 ? 57.405  68.748  50.751  1.00 65.44  ? 302 ASP C OD1   1 
ATOM   7495 O OD2   . ASP E 2 302 ? 56.288  68.439  48.880  1.00 64.96  ? 302 ASP C OD2   1 
ATOM   7496 N N     . ARG E 2 303 ? 58.164  73.535  49.556  1.00 63.40  ? 303 ARG C N     1 
ATOM   7497 C CA    . ARG E 2 303 ? 58.530  74.825  48.982  1.00 63.37  ? 303 ARG C CA    1 
ATOM   7498 C C     . ARG E 2 303 ? 59.735  75.471  49.643  1.00 63.11  ? 303 ARG C C     1 
ATOM   7499 O O     . ARG E 2 303 ? 60.592  76.014  48.962  1.00 62.86  ? 303 ARG C O     1 
ATOM   7500 C CB    . ARG E 2 303 ? 57.355  75.803  49.055  1.00 64.76  ? 303 ARG C CB    1 
ATOM   7501 C CG    . ARG E 2 303 ? 57.743  77.208  48.625  1.00 65.59  ? 303 ARG C CG    1 
ATOM   7502 C CD    . ARG E 2 303 ? 57.530  77.441  47.149  1.00 66.46  ? 303 ARG C CD    1 
ATOM   7503 N NE    . ARG E 2 303 ? 56.184  77.943  46.969  1.00 68.45  ? 303 ARG C NE    1 
ATOM   7504 C CZ    . ARG E 2 303 ? 55.799  79.223  46.971  1.00 68.94  ? 303 ARG C CZ    1 
ATOM   7505 N NH1   . ARG E 2 303 ? 56.652  80.233  47.115  1.00 67.94  ? 303 ARG C NH1   1 
ATOM   7506 N NH2   . ARG E 2 303 ? 54.504  79.469  46.913  1.00 68.68  ? 303 ARG C NH2   1 
ATOM   7507 N N     . LEU E 2 304 ? 59.800  75.437  50.966  1.00 62.98  ? 304 LEU C N     1 
ATOM   7508 C CA    . LEU E 2 304 ? 60.928  76.043  51.647  1.00 63.79  ? 304 LEU C CA    1 
ATOM   7509 C C     . LEU E 2 304 ? 62.217  75.327  51.287  1.00 65.08  ? 304 LEU C C     1 
ATOM   7510 O O     . LEU E 2 304 ? 63.280  75.935  51.262  1.00 65.64  ? 304 LEU C O     1 
ATOM   7511 C CB    . LEU E 2 304 ? 60.752  76.008  53.159  1.00 62.97  ? 304 LEU C CB    1 
ATOM   7512 C CG    . LEU E 2 304 ? 61.906  76.706  53.871  1.00 62.78  ? 304 LEU C CG    1 
ATOM   7513 C CD1   . LEU E 2 304 ? 61.798  78.195  53.635  1.00 63.28  ? 304 LEU C CD1   1 
ATOM   7514 C CD2   . LEU E 2 304 ? 61.873  76.428  55.344  1.00 63.21  ? 304 LEU C CD2   1 
ATOM   7515 N N     . LEU E 2 305 ? 62.128  74.032  51.009  1.00 66.35  ? 305 LEU C N     1 
ATOM   7516 C CA    . LEU E 2 305 ? 63.318  73.277  50.658  1.00 67.89  ? 305 LEU C CA    1 
ATOM   7517 C C     . LEU E 2 305 ? 63.745  73.647  49.245  1.00 69.04  ? 305 LEU C C     1 
ATOM   7518 O O     . LEU E 2 305 ? 64.931  73.859  48.996  1.00 69.34  ? 305 LEU C O     1 
ATOM   7519 C CB    . LEU E 2 305 ? 63.058  71.770  50.780  1.00 67.59  ? 305 LEU C CB    1 
ATOM   7520 C CG    . LEU E 2 305 ? 62.783  71.267  52.207  1.00 67.70  ? 305 LEU C CG    1 
ATOM   7521 C CD1   . LEU E 2 305 ? 62.482  69.777  52.177  1.00 67.31  ? 305 LEU C CD1   1 
ATOM   7522 C CD2   . LEU E 2 305 ? 63.972  71.557  53.110  1.00 67.08  ? 305 LEU C CD2   1 
ATOM   7523 N N     . GLN E 2 306 ? 62.783  73.739  48.328  1.00 70.18  ? 306 GLN C N     1 
ATOM   7524 C CA    . GLN E 2 306 ? 63.079  74.108  46.948  1.00 71.59  ? 306 GLN C CA    1 
ATOM   7525 C C     . GLN E 2 306 ? 63.799  75.450  46.962  1.00 72.65  ? 306 GLN C C     1 
ATOM   7526 O O     . GLN E 2 306 ? 64.829  75.617  46.310  1.00 73.22  ? 306 GLN C O     1 
ATOM   7527 C CB    . GLN E 2 306 ? 61.796  74.238  46.130  1.00 72.03  ? 306 GLN C CB    1 
ATOM   7528 C CG    . GLN E 2 306 ? 61.012  72.950  45.955  1.00 73.46  ? 306 GLN C CG    1 
ATOM   7529 C CD    . GLN E 2 306 ? 59.574  73.193  45.490  1.00 74.69  ? 306 GLN C CD    1 
ATOM   7530 O OE1   . GLN E 2 306 ? 58.777  72.255  45.383  1.00 75.14  ? 306 GLN C OE1   1 
ATOM   7531 N NE2   . GLN E 2 306 ? 59.236  74.456  45.217  1.00 74.63  ? 306 GLN C NE2   1 
ATOM   7532 N N     . LEU E 2 307 ? 63.254  76.405  47.711  1.00 73.53  ? 307 LEU C N     1 
ATOM   7533 C CA    . LEU E 2 307 ? 63.855  77.731  47.814  1.00 74.45  ? 307 LEU C CA    1 
ATOM   7534 C C     . LEU E 2 307 ? 65.268  77.610  48.338  1.00 75.24  ? 307 LEU C C     1 
ATOM   7535 O O     . LEU E 2 307 ? 66.188  78.242  47.823  1.00 75.62  ? 307 LEU C O     1 
ATOM   7536 C CB    . LEU E 2 307 ? 63.049  78.630  48.752  1.00 74.27  ? 307 LEU C CB    1 
ATOM   7537 C CG    . LEU E 2 307 ? 61.684  79.096  48.241  1.00 74.23  ? 307 LEU C CG    1 
ATOM   7538 C CD1   . LEU E 2 307 ? 60.952  79.834  49.341  1.00 74.01  ? 307 LEU C CD1   1 
ATOM   7539 C CD2   . LEU E 2 307 ? 61.864  79.993  47.033  1.00 74.44  ? 307 LEU C CD2   1 
ATOM   7540 N N     . SER E 2 308 ? 65.439  76.786  49.362  1.00 76.41  ? 308 SER C N     1 
ATOM   7541 C CA    . SER E 2 308 ? 66.750  76.585  49.963  1.00 77.55  ? 308 SER C CA    1 
ATOM   7542 C C     . SER E 2 308 ? 67.740  76.119  48.897  1.00 77.94  ? 308 SER C C     1 
ATOM   7543 O O     . SER E 2 308 ? 68.936  76.386  48.981  1.00 77.65  ? 308 SER C O     1 
ATOM   7544 C CB    . SER E 2 308 ? 66.654  75.554  51.091  1.00 77.76  ? 308 SER C CB    1 
ATOM   7545 O OG    . SER E 2 308 ? 67.667  75.769  52.061  1.00 79.09  ? 308 SER C OG    1 
ATOM   7546 N N     . GLN E 2 309 ? 67.222  75.427  47.890  1.00 78.79  ? 309 GLN C N     1 
ATOM   7547 C CA    . GLN E 2 309 ? 68.039  74.926  46.797  1.00 80.16  ? 309 GLN C CA    1 
ATOM   7548 C C     . GLN E 2 309 ? 68.041  75.880  45.607  1.00 80.82  ? 309 GLN C C     1 
ATOM   7549 O O     . GLN E 2 309 ? 68.192  75.449  44.460  1.00 80.75  ? 309 GLN C O     1 
ATOM   7550 C CB    . GLN E 2 309 ? 67.522  73.569  46.344  1.00 80.82  ? 309 GLN C CB    1 
ATOM   7551 C CG    . GLN E 2 309 ? 67.848  72.433  47.288  1.00 82.66  ? 309 GLN C CG    1 
ATOM   7552 C CD    . GLN E 2 309 ? 67.169  71.146  46.865  1.00 84.16  ? 309 GLN C CD    1 
ATOM   7553 O OE1   . GLN E 2 309 ? 66.807  70.980  45.696  1.00 85.00  ? 309 GLN C OE1   1 
ATOM   7554 N NE2   . GLN E 2 309 ? 66.998  70.222  47.808  1.00 84.91  ? 309 GLN C NE2   1 
ATOM   7555 N N     . GLY E 2 310 ? 67.864  77.171  45.882  1.00 81.16  ? 310 GLY C N     1 
ATOM   7556 C CA    . GLY E 2 310 ? 67.852  78.168  44.827  1.00 81.14  ? 310 GLY C CA    1 
ATOM   7557 C C     . GLY E 2 310 ? 66.951  77.838  43.651  1.00 81.49  ? 310 GLY C C     1 
ATOM   7558 O O     . GLY E 2 310 ? 67.170  78.329  42.547  1.00 81.81  ? 310 GLY C O     1 
ATOM   7559 N N     . GLN E 2 311 ? 65.939  77.005  43.870  1.00 81.65  ? 311 GLN C N     1 
ATOM   7560 C CA    . GLN E 2 311 ? 65.017  76.643  42.796  1.00 81.73  ? 311 GLN C CA    1 
ATOM   7561 C C     . GLN E 2 311 ? 64.176  77.891  42.472  1.00 81.18  ? 311 GLN C C     1 
ATOM   7562 O O     . GLN E 2 311 ? 63.766  78.624  43.380  1.00 81.23  ? 311 GLN C O     1 
ATOM   7563 C CB    . GLN E 2 311 ? 64.129  75.479  43.253  1.00 82.64  ? 311 GLN C CB    1 
ATOM   7564 C CG    . GLN E 2 311 ? 63.506  74.654  42.130  1.00 84.40  ? 311 GLN C CG    1 
ATOM   7565 C CD    . GLN E 2 311 ? 62.859  73.359  42.637  1.00 85.39  ? 311 GLN C CD    1 
ATOM   7566 O OE1   . GLN E 2 311 ? 63.487  72.579  43.360  1.00 86.00  ? 311 GLN C OE1   1 
ATOM   7567 N NE2   . GLN E 2 311 ? 61.605  73.125  42.252  1.00 85.54  ? 311 GLN C NE2   1 
ATOM   7568 N N     . ALA E 2 312 ? 63.935  78.144  41.185  1.00 80.20  ? 312 ALA C N     1 
ATOM   7569 C CA    . ALA E 2 312 ? 63.159  79.322  40.763  1.00 78.67  ? 312 ALA C CA    1 
ATOM   7570 C C     . ALA E 2 312 ? 61.656  79.180  41.015  1.00 77.26  ? 312 ALA C C     1 
ATOM   7571 O O     . ALA E 2 312 ? 60.881  78.926  40.088  1.00 77.45  ? 312 ALA C O     1 
ATOM   7572 C CB    . ALA E 2 312 ? 63.411  79.614  39.275  1.00 78.82  ? 312 ALA C CB    1 
ATOM   7573 N N     . VAL E 2 313 ? 61.249  79.365  42.266  1.00 75.07  ? 313 VAL C N     1 
ATOM   7574 C CA    . VAL E 2 313 ? 59.844  79.247  42.644  1.00 72.99  ? 313 VAL C CA    1 
ATOM   7575 C C     . VAL E 2 313 ? 59.434  80.386  43.585  1.00 71.23  ? 313 VAL C C     1 
ATOM   7576 O O     . VAL E 2 313 ? 58.609  80.207  44.477  1.00 70.71  ? 313 VAL C O     1 
ATOM   7577 C CB    . VAL E 2 313 ? 59.599  77.902  43.345  1.00 73.37  ? 313 VAL C CB    1 
ATOM   7578 C CG1   . VAL E 2 313 ? 59.690  76.767  42.341  1.00 73.11  ? 313 VAL C CG1   1 
ATOM   7579 C CG2   . VAL E 2 313 ? 60.639  77.709  44.456  1.00 73.12  ? 313 VAL C CG2   1 
ATOM   7580 N N     . LYS E 2 314 ? 60.029  81.557  43.369  1.00 69.37  ? 314 LYS C N     1 
ATOM   7581 C CA    . LYS E 2 314 ? 59.765  82.743  44.176  1.00 66.79  ? 314 LYS C CA    1 
ATOM   7582 C C     . LYS E 2 314 ? 58.345  83.265  43.964  1.00 64.56  ? 314 LYS C C     1 
ATOM   7583 O O     . LYS E 2 314 ? 57.693  82.927  42.977  1.00 63.81  ? 314 LYS C O     1 
ATOM   7584 C CB    . LYS E 2 314 ? 60.774  83.845  43.819  1.00 67.54  ? 314 LYS C CB    1 
ATOM   7585 C CG    . LYS E 2 314 ? 62.214  83.624  44.305  1.00 68.73  ? 314 LYS C CG    1 
ATOM   7586 C CD    . LYS E 2 314 ? 62.317  83.810  45.823  1.00 70.23  ? 314 LYS C CD    1 
ATOM   7587 C CE    . LYS E 2 314 ? 63.760  83.726  46.340  1.00 71.58  ? 314 LYS C CE    1 
ATOM   7588 N NZ    . LYS E 2 314 ? 63.868  83.690  47.848  1.00 70.71  ? 314 LYS C NZ    1 
ATOM   7589 N N     . GLY E 2 315 ? 57.862  84.076  44.903  1.00 62.41  ? 315 GLY C N     1 
ATOM   7590 C CA    . GLY E 2 315 ? 56.532  84.648  44.764  1.00 60.18  ? 315 GLY C CA    1 
ATOM   7591 C C     . GLY E 2 315 ? 55.428  84.197  45.704  1.00 58.81  ? 315 GLY C C     1 
ATOM   7592 O O     . GLY E 2 315 ? 55.673  83.743  46.814  1.00 59.15  ? 315 GLY C O     1 
ATOM   7593 N N     . ASN E 2 316 ? 54.191  84.334  45.243  1.00 57.14  ? 316 ASN C N     1 
ATOM   7594 C CA    . ASN E 2 316 ? 53.031  83.949  46.022  1.00 55.63  ? 316 ASN C CA    1 
ATOM   7595 C C     . ASN E 2 316 ? 52.297  82.793  45.374  1.00 54.83  ? 316 ASN C C     1 
ATOM   7596 O O     . ASN E 2 316 ? 52.097  82.778  44.161  1.00 54.35  ? 316 ASN C O     1 
ATOM   7597 C CB    . ASN E 2 316 ? 52.060  85.118  46.170  1.00 54.88  ? 316 ASN C CB    1 
ATOM   7598 C CG    . ASN E 2 316 ? 50.670  84.663  46.597  1.00 55.12  ? 316 ASN C CG    1 
ATOM   7599 O OD1   . ASN E 2 316 ? 49.821  84.367  45.762  1.00 54.50  ? 316 ASN C OD1   1 
ATOM   7600 N ND2   . ASN E 2 316 ? 50.446  84.576  47.903  1.00 54.68  ? 316 ASN C ND2   1 
ATOM   7601 N N     . GLN E 2 317 ? 51.886  81.829  46.193  1.00 54.15  ? 317 GLN C N     1 
ATOM   7602 C CA    . GLN E 2 317 ? 51.159  80.669  45.695  1.00 53.33  ? 317 GLN C CA    1 
ATOM   7603 C C     . GLN E 2 317 ? 49.805  80.628  46.375  1.00 51.18  ? 317 GLN C C     1 
ATOM   7604 O O     . GLN E 2 317 ? 49.680  80.957  47.552  1.00 50.24  ? 317 GLN C O     1 
ATOM   7605 C CB    . GLN E 2 317 ? 51.925  79.378  45.991  1.00 55.55  ? 317 GLN C CB    1 
ATOM   7606 C CG    . GLN E 2 317 ? 51.340  78.131  45.323  1.00 59.21  ? 317 GLN C CG    1 
ATOM   7607 C CD    . GLN E 2 317 ? 52.125  76.870  45.672  1.00 62.01  ? 317 GLN C CD    1 
ATOM   7608 O OE1   . GLN E 2 317 ? 53.304  76.956  46.066  1.00 63.07  ? 317 GLN C OE1   1 
ATOM   7609 N NE2   . GLN E 2 317 ? 51.490  75.693  45.516  1.00 62.12  ? 317 GLN C NE2   1 
ATOM   7610 N N     . LEU E 2 318 ? 48.793  80.231  45.624  1.00 49.42  ? 318 LEU C N     1 
ATOM   7611 C CA    . LEU E 2 318 ? 47.444  80.145  46.145  1.00 49.18  ? 318 LEU C CA    1 
ATOM   7612 C C     . LEU E 2 318 ? 47.032  78.683  46.195  1.00 49.19  ? 318 LEU C C     1 
ATOM   7613 O O     . LEU E 2 318 ? 47.186  77.967  45.204  1.00 49.78  ? 318 LEU C O     1 
ATOM   7614 C CB    . LEU E 2 318 ? 46.484  80.913  45.233  1.00 48.46  ? 318 LEU C CB    1 
ATOM   7615 C CG    . LEU E 2 318 ? 46.073  82.352  45.558  1.00 48.36  ? 318 LEU C CG    1 
ATOM   7616 C CD1   . LEU E 2 318 ? 47.176  83.118  46.269  1.00 48.05  ? 318 LEU C CD1   1 
ATOM   7617 C CD2   . LEU E 2 318 ? 45.683  83.023  44.260  1.00 46.60  ? 318 LEU C CD2   1 
ATOM   7618 N N     . LEU E 2 319 ? 46.521  78.237  47.341  1.00 48.34  ? 319 LEU C N     1 
ATOM   7619 C CA    . LEU E 2 319 ? 46.066  76.853  47.489  1.00 47.17  ? 319 LEU C CA    1 
ATOM   7620 C C     . LEU E 2 319 ? 44.564  76.794  47.264  1.00 46.39  ? 319 LEU C C     1 
ATOM   7621 O O     . LEU E 2 319 ? 43.827  77.680  47.670  1.00 46.82  ? 319 LEU C O     1 
ATOM   7622 C CB    . LEU E 2 319 ? 46.393  76.338  48.886  1.00 47.39  ? 319 LEU C CB    1 
ATOM   7623 C CG    . LEU E 2 319 ? 47.645  75.481  49.084  1.00 47.84  ? 319 LEU C CG    1 
ATOM   7624 C CD1   . LEU E 2 319 ? 48.690  75.797  48.039  1.00 47.49  ? 319 LEU C CD1   1 
ATOM   7625 C CD2   . LEU E 2 319 ? 48.182  75.711  50.496  1.00 47.67  ? 319 LEU C CD2   1 
ATOM   7626 N N     . PRO E 2 320 ? 44.084  75.742  46.615  1.00 45.74  ? 320 PRO C N     1 
ATOM   7627 C CA    . PRO E 2 320 ? 42.643  75.644  46.374  1.00 45.34  ? 320 PRO C CA    1 
ATOM   7628 C C     . PRO E 2 320 ? 41.818  75.451  47.640  1.00 45.04  ? 320 PRO C C     1 
ATOM   7629 O O     . PRO E 2 320 ? 42.345  75.071  48.679  1.00 45.59  ? 320 PRO C O     1 
ATOM   7630 C CB    . PRO E 2 320 ? 42.539  74.450  45.433  1.00 44.87  ? 320 PRO C CB    1 
ATOM   7631 C CG    . PRO E 2 320 ? 43.666  73.580  45.888  1.00 45.73  ? 320 PRO C CG    1 
ATOM   7632 C CD    . PRO E 2 320 ? 44.796  74.566  46.090  1.00 45.78  ? 320 PRO C CD    1 
ATOM   7633 N N     . VAL E 2 321 ? 40.524  75.750  47.545  1.00 44.42  ? 321 VAL C N     1 
ATOM   7634 C CA    . VAL E 2 321 ? 39.585  75.576  48.645  1.00 43.26  ? 321 VAL C CA    1 
ATOM   7635 C C     . VAL E 2 321 ? 38.308  75.072  48.001  1.00 43.30  ? 321 VAL C C     1 
ATOM   7636 O O     . VAL E 2 321 ? 38.216  74.999  46.788  1.00 43.14  ? 321 VAL C O     1 
ATOM   7637 C CB    . VAL E 2 321 ? 39.284  76.889  49.385  1.00 43.23  ? 321 VAL C CB    1 
ATOM   7638 C CG1   . VAL E 2 321 ? 40.560  77.450  50.001  1.00 42.65  ? 321 VAL C CG1   1 
ATOM   7639 C CG2   . VAL E 2 321 ? 38.639  77.877  48.441  1.00 43.10  ? 321 VAL C CG2   1 
ATOM   7640 N N     . SER E 2 322 ? 37.314  74.707  48.789  1.00 43.86  ? 322 SER C N     1 
ATOM   7641 C CA    . SER E 2 322 ? 36.090  74.205  48.182  1.00 44.36  ? 322 SER C CA    1 
ATOM   7642 C C     . SER E 2 322 ? 34.928  74.413  49.110  1.00 44.71  ? 322 SER C C     1 
ATOM   7643 O O     . SER E 2 322 ? 35.124  74.621  50.303  1.00 45.12  ? 322 SER C O     1 
ATOM   7644 C CB    . SER E 2 322 ? 36.232  72.720  47.851  1.00 43.94  ? 322 SER C CB    1 
ATOM   7645 O OG    . SER E 2 322 ? 36.603  71.978  48.999  1.00 44.21  ? 322 SER C OG    1 
ATOM   7646 N N     . LEU E 2 323 ? 33.720  74.378  48.560  1.00 45.01  ? 323 LEU C N     1 
ATOM   7647 C CA    . LEU E 2 323 ? 32.525  74.569  49.363  1.00 45.53  ? 323 LEU C CA    1 
ATOM   7648 C C     . LEU E 2 323 ? 31.988  73.226  49.849  1.00 45.52  ? 323 LEU C C     1 
ATOM   7649 O O     . LEU E 2 323 ? 31.811  72.300  49.066  1.00 45.03  ? 323 LEU C O     1 
ATOM   7650 C CB    . LEU E 2 323 ? 31.446  75.293  48.550  1.00 45.87  ? 323 LEU C CB    1 
ATOM   7651 C CG    . LEU E 2 323 ? 30.057  75.353  49.197  1.00 47.21  ? 323 LEU C CG    1 
ATOM   7652 C CD1   . LEU E 2 323 ? 30.088  76.196  50.472  1.00 47.33  ? 323 LEU C CD1   1 
ATOM   7653 C CD2   . LEU E 2 323 ? 29.077  75.945  48.210  1.00 47.56  ? 323 LEU C CD2   1 
ATOM   7654 N N     . VAL E 2 324 ? 31.738  73.120  51.148  1.00 45.41  ? 324 VAL C N     1 
ATOM   7655 C CA    . VAL E 2 324 ? 31.206  71.888  51.691  1.00 45.80  ? 324 VAL C CA    1 
ATOM   7656 C C     . VAL E 2 324 ? 29.773  72.203  52.094  1.00 46.16  ? 324 VAL C C     1 
ATOM   7657 O O     . VAL E 2 324 ? 29.534  72.915  53.053  1.00 45.78  ? 324 VAL C O     1 
ATOM   7658 C CB    . VAL E 2 324 ? 32.032  71.397  52.915  1.00 45.57  ? 324 VAL C CB    1 
ATOM   7659 C CG1   . VAL E 2 324 ? 31.520  70.048  53.382  1.00 43.36  ? 324 VAL C CG1   1 
ATOM   7660 C CG2   . VAL E 2 324 ? 33.511  71.306  52.549  1.00 44.78  ? 324 VAL C CG2   1 
ATOM   7661 N N     . LYS E 2 325 ? 28.823  71.693  51.327  1.00 47.51  ? 325 LYS C N     1 
ATOM   7662 C CA    . LYS E 2 325 ? 27.416  71.927  51.606  1.00 49.29  ? 325 LYS C CA    1 
ATOM   7663 C C     . LYS E 2 325 ? 26.890  71.018  52.688  1.00 49.50  ? 325 LYS C C     1 
ATOM   7664 O O     . LYS E 2 325 ? 26.920  69.797  52.561  1.00 49.45  ? 325 LYS C O     1 
ATOM   7665 C CB    . LYS E 2 325 ? 26.582  71.707  50.360  1.00 51.12  ? 325 LYS C CB    1 
ATOM   7666 C CG    . LYS E 2 325 ? 26.762  72.755  49.295  1.00 54.47  ? 325 LYS C CG    1 
ATOM   7667 C CD    . LYS E 2 325 ? 25.751  72.548  48.200  1.00 58.03  ? 325 LYS C CD    1 
ATOM   7668 C CE    . LYS E 2 325 ? 25.836  71.135  47.655  1.00 60.58  ? 325 LYS C CE    1 
ATOM   7669 N NZ    . LYS E 2 325 ? 24.906  70.946  46.507  1.00 64.46  ? 325 LYS C NZ    1 
ATOM   7670 N N     . ARG E 2 326 ? 26.379  71.623  53.746  1.00 49.47  ? 326 ARG C N     1 
ATOM   7671 C CA    . ARG E 2 326 ? 25.862  70.859  54.845  1.00 49.43  ? 326 ARG C CA    1 
ATOM   7672 C C     . ARG E 2 326 ? 24.418  71.285  55.134  1.00 49.95  ? 326 ARG C C     1 
ATOM   7673 O O     . ARG E 2 326 ? 23.653  71.476  54.205  1.00 50.45  ? 326 ARG C O     1 
ATOM   7674 C CB    . ARG E 2 326 ? 26.799  71.012  56.051  1.00 48.63  ? 326 ARG C CB    1 
ATOM   7675 C CG    . ARG E 2 326 ? 27.346  69.681  56.560  1.00 48.66  ? 326 ARG C CG    1 
ATOM   7676 C CD    . ARG E 2 326 ? 28.795  69.366  56.207  1.00 46.75  ? 326 ARG C CD    1 
ATOM   7677 N NE    . ARG E 2 326 ? 29.703  70.084  57.085  1.00 46.68  ? 326 ARG C NE    1 
ATOM   7678 C CZ    . ARG E 2 326 ? 30.992  69.818  57.241  1.00 45.44  ? 326 ARG C CZ    1 
ATOM   7679 N NH1   . ARG E 2 326 ? 31.569  68.824  56.588  1.00 44.17  ? 326 ARG C NH1   1 
ATOM   7680 N NH2   . ARG E 2 326 ? 31.711  70.591  58.030  1.00 45.73  ? 326 ARG C NH2   1 
ATOM   7681 N N     . LYS E 2 327 ? 24.031  71.463  56.389  1.00 50.79  ? 327 LYS C N     1 
ATOM   7682 C CA    . LYS E 2 327 ? 22.631  71.796  56.677  1.00 51.40  ? 327 LYS C CA    1 
ATOM   7683 C C     . LYS E 2 327 ? 22.299  73.207  57.127  1.00 51.42  ? 327 LYS C C     1 
ATOM   7684 O O     . LYS E 2 327 ? 21.134  73.536  57.264  1.00 51.42  ? 327 LYS C O     1 
ATOM   7685 C CB    . LYS E 2 327 ? 22.071  70.835  57.733  1.00 52.44  ? 327 LYS C CB    1 
ATOM   7686 C CG    . LYS E 2 327 ? 22.166  69.364  57.406  1.00 53.81  ? 327 LYS C CG    1 
ATOM   7687 C CD    . LYS E 2 327 ? 21.312  69.028  56.220  1.00 55.68  ? 327 LYS C CD    1 
ATOM   7688 C CE    . LYS E 2 327 ? 21.438  67.559  55.858  1.00 57.61  ? 327 LYS C CE    1 
ATOM   7689 N NZ    . LYS E 2 327 ? 20.731  67.234  54.566  1.00 59.75  ? 327 LYS C NZ    1 
ATOM   7690 N N     . THR E 2 328 ? 23.307  74.029  57.377  1.00 52.07  ? 328 THR C N     1 
ATOM   7691 C CA    . THR E 2 328 ? 23.072  75.398  57.810  1.00 52.01  ? 328 THR C CA    1 
ATOM   7692 C C     . THR E 2 328 ? 22.647  76.383  56.713  1.00 52.60  ? 328 THR C C     1 
ATOM   7693 O O     . THR E 2 328 ? 22.358  77.534  57.013  1.00 52.09  ? 328 THR C O     1 
ATOM   7694 C CB    . THR E 2 328 ? 24.310  75.966  58.520  1.00 51.92  ? 328 THR C CB    1 
ATOM   7695 O OG1   . THR E 2 328 ? 25.480  75.729  57.727  1.00 51.59  ? 328 THR C OG1   1 
ATOM   7696 C CG2   . THR E 2 328 ? 24.465  75.318  59.879  1.00 51.78  ? 328 THR C CG2   1 
ATOM   7697 N N     . THR E 2 329 ? 22.609  75.949  55.452  1.00 53.52  ? 329 THR C N     1 
ATOM   7698 C CA    . THR E 2 329 ? 22.194  76.837  54.377  1.00 54.73  ? 329 THR C CA    1 
ATOM   7699 C C     . THR E 2 329 ? 21.042  76.294  53.549  1.00 56.17  ? 329 THR C C     1 
ATOM   7700 O O     . THR E 2 329 ? 21.222  75.473  52.668  1.00 56.04  ? 329 THR C O     1 
ATOM   7701 C CB    . THR E 2 329 ? 23.361  77.202  53.409  1.00 54.06  ? 329 THR C CB    1 
ATOM   7702 O OG1   . THR E 2 329 ? 23.902  76.014  52.824  1.00 53.39  ? 329 THR C OG1   1 
ATOM   7703 C CG2   . THR E 2 329 ? 24.442  77.958  54.144  1.00 52.59  ? 329 THR C CG2   1 
ATOM   7704 N N     . LEU E 2 330 ? 19.850  76.793  53.832  1.00 58.36  ? 330 LEU C N     1 
ATOM   7705 C CA    . LEU E 2 330 ? 18.674  76.381  53.080  1.00 60.28  ? 330 LEU C CA    1 
ATOM   7706 C C     . LEU E 2 330 ? 18.151  77.544  52.257  1.00 61.61  ? 330 LEU C C     1 
ATOM   7707 O O     . LEU E 2 330 ? 18.668  78.665  52.362  1.00 62.08  ? 330 LEU C O     1 
ATOM   7708 C CB    . LEU E 2 330 ? 17.586  75.866  54.023  1.00 60.70  ? 330 LEU C CB    1 
ATOM   7709 C CG    . LEU E 2 330 ? 18.040  74.643  54.819  1.00 60.66  ? 330 LEU C CG    1 
ATOM   7710 C CD1   . LEU E 2 330 ? 17.003  74.294  55.838  1.00 60.78  ? 330 LEU C CD1   1 
ATOM   7711 C CD2   . LEU E 2 330 ? 18.333  73.471  53.881  1.00 60.82  ? 330 LEU C CD2   1 
ATOM   7712 N N     . ALA E 2 331 ? 17.151  77.277  51.426  1.00 62.79  ? 331 ALA C N     1 
ATOM   7713 C CA    . ALA E 2 331 ? 16.572  78.331  50.606  1.00 64.06  ? 331 ALA C CA    1 
ATOM   7714 C C     . ALA E 2 331 ? 16.169  79.517  51.504  1.00 64.89  ? 331 ALA C C     1 
ATOM   7715 O O     . ALA E 2 331 ? 15.543  80.481  51.019  1.00 66.34  ? 331 ALA C O     1 
ATOM   7716 C CB    . ALA E 2 331 ? 15.340  77.800  49.838  1.00 63.65  ? 331 ALA C CB    1 
HETATM 7717 C C1A   . NPF F 3 .   ? -13.446 87.461  32.376  1.00 58.71  ? 901 NPF A C1A   1 
HETATM 7718 C C2A   . NPF F 3 .   ? -12.756 88.680  32.106  1.00 59.04  ? 901 NPF A C2A   1 
HETATM 7719 C C3A   . NPF F 3 .   ? -11.445 88.969  32.504  1.00 59.92  ? 901 NPF A C3A   1 
HETATM 7720 C C4A   . NPF F 3 .   ? -10.751 87.967  33.211  1.00 61.02  ? 901 NPF A C4A   1 
HETATM 7721 C C5A   . NPF F 3 .   ? -11.380 86.739  33.519  1.00 60.27  ? 901 NPF A C5A   1 
HETATM 7722 C C6A   . NPF F 3 .   ? -12.730 86.485  33.121  1.00 59.69  ? 901 NPF A C6A   1 
HETATM 7723 N N6    . NPF F 3 .   ? -13.276 85.231  33.485  1.00 60.39  ? 901 NPF A N6    1 
HETATM 7724 O O6A   . NPF F 3 .   ? -14.416 84.879  33.170  1.00 58.55  ? 901 NPF A O6A   1 
HETATM 7725 O O6B   . NPF F 3 .   ? -12.537 84.482  34.127  1.00 59.91  ? 901 NPF A O6B   1 
HETATM 7726 O O1    . NPF F 3 .   ? -14.351 86.910  31.413  1.00 58.81  ? 901 NPF A O1    1 
HETATM 7727 C C1    . NPF F 3 .   ? -15.717 87.262  31.079  1.00 61.31  ? 901 NPF A C1    1 
HETATM 7728 C C2    . NPF F 3 .   ? -16.017 88.625  30.375  1.00 62.55  ? 901 NPF A C2    1 
HETATM 7729 O O2    . NPF F 3 .   ? -16.036 89.735  31.303  1.00 63.96  ? 901 NPF A O2    1 
HETATM 7730 C C3    . NPF F 3 .   ? -17.349 88.636  29.633  1.00 63.64  ? 901 NPF A C3    1 
HETATM 7731 O O3    . NPF F 3 .   ? -17.443 89.920  28.976  1.00 64.55  ? 901 NPF A O3    1 
HETATM 7732 C C4    . NPF F 3 .   ? -17.382 87.507  28.604  1.00 63.45  ? 901 NPF A C4    1 
HETATM 7733 O O4    . NPF F 3 .   ? -16.371 87.845  27.635  1.00 65.77  ? 901 NPF A O4    1 
HETATM 7734 C C5    . NPF F 3 .   ? -17.126 86.155  29.306  1.00 62.71  ? 901 NPF A C5    1 
HETATM 7735 C C6    . NPF F 3 .   ? -17.015 85.048  28.283  1.00 61.17  ? 901 NPF A C6    1 
HETATM 7736 O O5    . NPF F 3 .   ? -15.937 86.184  30.131  1.00 61.57  ? 901 NPF A O5    1 
HETATM 7737 C C1A   . NPF G 3 .   ? 5.785   81.059  25.467  1.00 58.29  ? 902 NPF B C1A   1 
HETATM 7738 C C2A   . NPF G 3 .   ? 5.025   80.907  24.263  1.00 58.52  ? 902 NPF B C2A   1 
HETATM 7739 C C3A   . NPF G 3 .   ? 3.776   80.274  24.186  1.00 59.13  ? 902 NPF B C3A   1 
HETATM 7740 C C4A   . NPF G 3 .   ? 3.230   79.772  25.385  1.00 60.32  ? 902 NPF B C4A   1 
HETATM 7741 C C5A   . NPF G 3 .   ? 3.942   79.886  26.602  1.00 59.27  ? 902 NPF B C5A   1 
HETATM 7742 C C6A   . NPF G 3 .   ? 5.216   80.508  26.651  1.00 58.92  ? 902 NPF B C6A   1 
HETATM 7743 N N6    . NPF G 3 .   ? 5.844   80.577  27.913  1.00 59.80  ? 902 NPF B N6    1 
HETATM 7744 O O6A   . NPF G 3 .   ? 6.943   81.116  28.090  1.00 57.74  ? 902 NPF B O6A   1 
HETATM 7745 O O6B   . NPF G 3 .   ? 5.231   80.067  28.853  1.00 59.92  ? 902 NPF B O6B   1 
HETATM 7746 O O1    . NPF G 3 .   ? 6.596   82.220  25.697  1.00 58.31  ? 902 NPF B O1    1 
HETATM 7747 C C1    . NPF G 3 .   ? 7.885   82.626  25.166  1.00 60.49  ? 902 NPF B C1    1 
HETATM 7748 C C2    . NPF G 3 .   ? 8.033   82.971  23.645  1.00 61.84  ? 902 NPF B C2    1 
HETATM 7749 O O2    . NPF G 3 .   ? 8.094   81.803  22.797  1.00 62.73  ? 902 NPF B O2    1 
HETATM 7750 C C3    . NPF G 3 .   ? 9.238   83.851  23.356  1.00 62.62  ? 902 NPF B C3    1 
HETATM 7751 O O3    . NPF G 3 .   ? 9.193   84.176  21.959  1.00 64.25  ? 902 NPF B O3    1 
HETATM 7752 C C4    . NPF G 3 .   ? 9.141   85.138  24.158  1.00 62.60  ? 902 NPF B C4    1 
HETATM 7753 O O4    . NPF G 3 .   ? 7.980   85.826  23.646  1.00 65.35  ? 902 NPF B O4    1 
HETATM 7754 C C5    . NPF G 3 .   ? 9.053   84.810  25.659  1.00 61.53  ? 902 NPF B C5    1 
HETATM 7755 C C6    . NPF G 3 .   ? 8.846   86.079  26.452  1.00 59.59  ? 902 NPF B C6    1 
HETATM 7756 O O5    . NPF G 3 .   ? 7.990   83.866  25.921  1.00 60.27  ? 902 NPF B O5    1 
HETATM 7757 C C1A   . NPF H 3 .   ? 43.127  81.233  61.935  1.00 59.17  ? 903 NPF C C1A   1 
HETATM 7758 C C2A   . NPF H 3 .   ? 44.128  81.670  62.875  1.00 58.83  ? 903 NPF C C2A   1 
HETATM 7759 C C3A   . NPF H 3 .   ? 43.999  81.588  64.261  1.00 59.38  ? 903 NPF C C3A   1 
HETATM 7760 C C4A   . NPF H 3 .   ? 42.814  81.009  64.756  1.00 60.86  ? 903 NPF C C4A   1 
HETATM 7761 C C5A   . NPF H 3 .   ? 41.790  80.590  63.885  1.00 59.65  ? 903 NPF C C5A   1 
HETATM 7762 C C6A   . NPF H 3 .   ? 41.923  80.711  62.483  1.00 59.22  ? 903 NPF C C6A   1 
HETATM 7763 N N6    . NPF H 3 .   ? 40.827  80.259  61.706  1.00 60.13  ? 903 NPF C N6    1 
HETATM 7764 O O6A   . NPF H 3 .   ? 40.804  80.363  60.504  1.00 57.69  ? 903 NPF C O6A   1 
HETATM 7765 O O6B   . NPF H 3 .   ? 39.822  79.791  62.255  1.00 59.72  ? 903 NPF C O6B   1 
HETATM 7766 O O1    . NPF H 3 .   ? 43.475  80.658  60.652  1.00 58.94  ? 903 NPF C O1    1 
HETATM 7767 C C1    . NPF H 3 .   ? 44.041  81.281  59.452  1.00 61.40  ? 903 NPF C C1    1 
HETATM 7768 C C2    . NPF H 3 .   ? 45.460  81.949  59.441  1.00 62.64  ? 903 NPF C C2    1 
HETATM 7769 O O2    . NPF H 3 .   ? 45.465  83.275  60.023  1.00 64.52  ? 903 NPF C O2    1 
HETATM 7770 C C3    . NPF H 3 .   ? 46.060  82.057  58.048  1.00 63.21  ? 903 NPF C C3    1 
HETATM 7771 O O3    . NPF H 3 .   ? 47.368  82.612  58.221  1.00 64.78  ? 903 NPF C O3    1 
HETATM 7772 C C4    . NPF H 3 .   ? 46.152  80.698  57.378  1.00 62.92  ? 903 NPF C C4    1 
HETATM 7773 O O4    . NPF H 3 .   ? 47.114  79.951  58.129  1.00 64.99  ? 903 NPF C O4    1 
HETATM 7774 C C5    . NPF H 3 .   ? 44.762  80.040  57.355  1.00 62.17  ? 903 NPF C C5    1 
HETATM 7775 C C6    . NPF H 3 .   ? 44.902  78.625  56.853  1.00 60.57  ? 903 NPF C C6    1 
HETATM 7776 O O5    . NPF H 3 .   ? 44.107  80.069  58.650  1.00 61.40  ? 903 NPF C O5    1 
HETATM 7777 O O     . HOH I 4 .   ? -9.255  78.430  27.609  1.00 37.51  ? 902 HOH A O     1 
HETATM 7778 O O     . HOH I 4 .   ? -13.197 93.357  33.682  1.00 50.38  ? 903 HOH A O     1 
HETATM 7779 O O     . HOH I 4 .   ? -11.769 90.592  23.398  1.00 44.83  ? 904 HOH A O     1 
HETATM 7780 O O     . HOH I 4 .   ? -7.960  86.527  33.988  1.00 42.58  ? 905 HOH A O     1 
HETATM 7781 O O     . HOH I 4 .   ? -28.420 83.382  31.512  1.00 51.37  ? 906 HOH A O     1 
HETATM 7782 O O     . HOH I 4 .   ? -25.118 96.044  30.710  1.00 62.69  ? 907 HOH A O     1 
HETATM 7783 O O     . HOH I 4 .   ? -14.710 91.981  32.803  1.00 44.54  ? 908 HOH A O     1 
HETATM 7784 O O     . HOH I 4 .   ? -20.872 101.139 31.935  1.00 51.82  ? 909 HOH A O     1 
HETATM 7785 O O     . HOH J 4 .   ? 1.628   87.097  33.699  1.00 35.03  ? 903 HOH B O     1 
HETATM 7786 O O     . HOH J 4 .   ? 19.535  88.773  34.304  1.00 56.61  ? 904 HOH B O     1 
HETATM 7787 O O     . HOH J 4 .   ? 5.450   78.085  20.892  1.00 38.15  ? 905 HOH B O     1 
HETATM 7788 O O     . HOH J 4 .   ? -5.267  94.655  14.991  1.00 58.04  ? 906 HOH B O     1 
HETATM 7789 O O     . HOH J 4 .   ? 20.808  84.641  27.521  1.00 39.79  ? 907 HOH B O     1 
HETATM 7790 O O     . HOH J 4 .   ? 15.265  71.277  47.853  1.00 45.54  ? 908 HOH B O     1 
HETATM 7791 O O     . HOH J 4 .   ? 12.335  74.067  26.906  1.00 41.38  ? 909 HOH B O     1 
HETATM 7792 O O     . HOH J 4 .   ? 15.524  74.449  51.501  1.00 61.60  ? 910 HOH B O     1 
HETATM 7793 O O     . HOH J 4 .   ? 11.379  87.824  23.182  1.00 42.91  ? 911 HOH B O     1 
HETATM 7794 O O     . HOH J 4 .   ? 26.864  77.604  36.740  1.00 48.58  ? 912 HOH B O     1 
HETATM 7795 O O     . HOH J 4 .   ? 12.907  76.510  35.020  1.00 34.60  ? 913 HOH B O     1 
HETATM 7796 O O     . HOH J 4 .   ? 4.340   91.108  32.842  1.00 39.36  ? 914 HOH B O     1 
HETATM 7797 O O     . HOH J 4 .   ? 5.924   86.481  45.018  1.00 51.18  ? 915 HOH B O     1 
HETATM 7798 O O     . HOH J 4 .   ? 6.846   79.932  20.885  1.00 56.87  ? 916 HOH B O     1 
HETATM 7799 O O     . HOH J 4 .   ? 13.337  85.322  45.259  1.00 56.35  ? 917 HOH B O     1 
HETATM 7800 O O     . HOH J 4 .   ? 12.324  86.098  24.890  1.00 38.56  ? 918 HOH B O     1 
HETATM 7801 O O     . HOH J 4 .   ? -1.430  83.850  35.589  1.00 45.01  ? 919 HOH B O     1 
HETATM 7802 O O     . HOH J 4 .   ? 17.400  86.474  40.315  1.00 41.50  ? 920 HOH B O     1 
HETATM 7803 O O     . HOH J 4 .   ? 11.563  78.073  11.291  1.00 45.20  ? 921 HOH B O     1 
HETATM 7804 O O     . HOH J 4 .   ? 18.099  72.922  22.799  1.00 55.28  ? 922 HOH B O     1 
HETATM 7805 O O     . HOH J 4 .   ? 19.255  87.370  17.447  1.00 38.67  ? 923 HOH B O     1 
HETATM 7806 O O     . HOH J 4 .   ? 2.989   79.436  31.955  1.00 49.11  ? 924 HOH B O     1 
HETATM 7807 O O     . HOH J 4 .   ? 1.985   91.240  31.677  1.00 43.55  ? 925 HOH B O     1 
HETATM 7808 O O     . HOH J 4 .   ? -6.277  63.912  33.960  1.00 56.57  ? 926 HOH B O     1 
HETATM 7809 O O     . HOH J 4 .   ? 28.658  78.776  34.808  1.00 55.14  ? 927 HOH B O     1 
HETATM 7810 O O     . HOH J 4 .   ? 15.435  77.403  34.915  1.00 46.97  ? 928 HOH B O     1 
HETATM 7811 O O     . HOH J 4 .   ? 12.036  89.884  33.140  1.00 39.60  ? 929 HOH B O     1 
HETATM 7812 O O     . HOH J 4 .   ? 20.044  86.025  41.752  1.00 42.53  ? 930 HOH B O     1 
HETATM 7813 O O     . HOH J 4 .   ? -4.210  85.376  38.584  1.00 41.90  ? 931 HOH B O     1 
HETATM 7814 O O     . HOH J 4 .   ? 20.573  64.469  36.971  1.00 47.14  ? 932 HOH B O     1 
HETATM 7815 O O     . HOH J 4 .   ? -1.523  74.055  42.645  1.00 53.45  ? 933 HOH B O     1 
HETATM 7816 O O     . HOH J 4 .   ? 6.264   83.276  19.516  1.00 42.49  ? 934 HOH B O     1 
HETATM 7817 O O     . HOH K 4 .   ? 40.717  70.246  60.972  1.00 38.24  ? 904 HOH C O     1 
HETATM 7818 O O     . HOH K 4 .   ? 26.414  76.399  45.637  1.00 28.44  ? 905 HOH C O     1 
HETATM 7819 O O     . HOH K 4 .   ? 40.695  78.893  66.442  1.00 33.49  ? 906 HOH C O     1 
HETATM 7820 O O     . HOH K 4 .   ? 60.340  72.584  68.264  0.5  44.30  ? 907 HOH C O     1 
HETATM 7821 O O     . HOH K 4 .   ? 45.202  85.695  64.326  1.00 40.69  ? 908 HOH C O     1 
HETATM 7822 O O     . HOH K 4 .   ? 60.008  85.600  50.875  1.00 53.97  ? 909 HOH C O     1 
HETATM 7823 O O     . HOH K 4 .   ? 48.783  80.282  54.594  1.00 51.08  ? 910 HOH C O     1 
HETATM 7824 O O     . HOH K 4 .   ? 45.982  85.308  61.884  1.00 49.19  ? 911 HOH C O     1 
HETATM 7825 O O     . HOH K 4 .   ? 41.673  77.608  63.427  1.00 82.01  ? 912 HOH C O     1 
HETATM 7826 O O     . HOH K 4 .   ? 13.956  87.038  66.937  1.00 52.53  ? 913 HOH C O     1 
HETATM 7827 O O     . HOH K 4 .   ? 37.146  88.008  57.989  1.00 38.33  ? 914 HOH C O     1 
HETATM 7828 O O     . HOH K 4 .   ? 54.754  74.832  46.297  1.00 80.42  ? 915 HOH C O     1 
HETATM 7829 O O     . HOH K 4 .   ? 48.893  83.015  61.882  1.00 47.05  ? 916 HOH C O     1 
HETATM 7830 O O     . HOH K 4 .   ? 36.034  66.116  65.952  1.00 45.51  ? 917 HOH C O     1 
HETATM 7831 O O     . HOH K 4 .   ? 37.269  77.288  63.218  1.00 46.75  ? 918 HOH C O     1 
HETATM 7832 O O     . HOH K 4 .   ? 25.694  72.821  67.514  1.00 52.36  ? 919 HOH C O     1 
HETATM 7833 O O     . HOH K 4 .   ? 28.212  74.444  44.562  1.00 46.03  ? 920 HOH C O     1 
HETATM 7834 O O     . HOH K 4 .   ? 17.658  87.857  52.045  1.00 47.07  ? 921 HOH C O     1 
HETATM 7835 O O     . HOH K 4 .   ? 26.965  72.663  45.853  1.00 50.25  ? 922 HOH C O     1 
HETATM 7836 O O     . HOH K 4 .   ? 52.038  93.726  60.804  1.00 44.34  ? 923 HOH C O     1 
HETATM 7837 O O     . HOH K 4 .   ? 41.629  73.362  50.781  1.00 38.95  ? 924 HOH C O     1 
HETATM 7838 O O     . HOH K 4 .   ? 32.502  87.397  39.893  1.00 52.85  ? 925 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   ?   ?   ?   D . n 
A 1 2   DA  2   2   ?   ?   ?   D . n 
A 1 3   DA  3   3   ?   ?   ?   D . n 
A 1 4   DT  4   4   ?   ?   ?   D . n 
A 1 5   DT  5   5   5   DT  T   D . n 
A 1 6   DG  6   6   6   DG  G   D . n 
A 1 7   DT  7   7   7   DT  T   D . n 
A 1 8   DG  8   8   8   DG  G   D . n 
A 1 9   DA  9   9   9   DA  A   D . n 
A 1 10  DG  10  10  10  DG  G   D . n 
A 1 11  DC  11  11  11  DC  C   D . n 
A 1 12  DG  12  12  12  DG  G   D . n 
A 1 13  DC  13  13  13  DC  C   D . n 
A 1 14  DT  14  14  14  DT  T   D . n 
A 1 15  DC  15  15  15  DC  C   D . n 
A 1 16  DA  16  16  16  DA  A   D . n 
A 1 17  DC  17  17  17  DC  C   D . n 
A 1 18  DA  18  18  18  DA  A   D . n 
A 1 19  DA  19  19  19  DA  A   D . n 
A 1 20  DT  20  20  20  DT  T   D . n 
A 1 21  DT  21  21  21  DT  T   D . n 
B 1 1   DG  1   1   ?   ?   ?   E . n 
B 1 2   DA  2   2   2   DA  A   E . n 
B 1 3   DA  3   3   3   DA  A   E . n 
B 1 4   DT  4   4   4   DT  T   E . n 
B 1 5   DT  5   5   5   DT  T   E . n 
B 1 6   DG  6   6   6   DG  G   E . n 
B 1 7   DT  7   7   7   DT  T   E . n 
B 1 8   DG  8   8   8   DG  G   E . n 
B 1 9   DA  9   9   9   DA  A   E . n 
B 1 10  DG  10  10  10  DG  G   E . n 
B 1 11  DC  11  11  11  DC  C   E . n 
B 1 12  DG  12  12  12  DG  G   E . n 
B 1 13  DC  13  13  13  DC  C   E . n 
B 1 14  DT  14  14  14  DT  T   E . n 
B 1 15  DC  15  15  15  DC  C   E . n 
B 1 16  DA  16  16  16  DA  A   E . n 
B 1 17  DC  17  17  17  DC  C   E . n 
B 1 18  DA  18  18  18  DA  A   E . n 
B 1 19  DA  19  19  ?   ?   ?   E . n 
B 1 20  DT  20  20  ?   ?   ?   E . n 
B 1 21  DT  21  21  ?   ?   ?   E . n 
C 2 1   MET 1   1   ?   ?   ?   A . n 
C 2 2   LYS 2   2   2   LYS LYS A . n 
C 2 3   PRO 3   3   3   PRO PRO A . n 
C 2 4   VAL 4   4   4   VAL VAL A . n 
C 2 5   THR 5   5   5   THR THR A . n 
C 2 6   LEU 6   6   6   LEU LEU A . n 
C 2 7   TYR 7   7   7   TYR TYR A . n 
C 2 8   ASP 8   8   8   ASP ASP A . n 
C 2 9   VAL 9   9   9   VAL VAL A . n 
C 2 10  ALA 10  10  10  ALA ALA A . n 
C 2 11  GLU 11  11  11  GLU GLU A . n 
C 2 12  TYR 12  12  12  TYR TYR A . n 
C 2 13  ALA 13  13  13  ALA ALA A . n 
C 2 14  GLY 14  14  14  GLY GLY A . n 
C 2 15  VAL 15  15  15  VAL VAL A . n 
C 2 16  SER 16  16  16  SER SER A . n 
C 2 17  TYR 17  17  17  TYR TYR A . n 
C 2 18  GLN 18  18  18  GLN GLN A . n 
C 2 19  THR 19  19  19  THR THR A . n 
C 2 20  VAL 20  20  20  VAL VAL A . n 
C 2 21  SER 21  21  21  SER SER A . n 
C 2 22  ARG 22  22  22  ARG ARG A . n 
C 2 23  VAL 23  23  23  VAL VAL A . n 
C 2 24  VAL 24  24  24  VAL VAL A . n 
C 2 25  ASN 25  25  25  ASN ASN A . n 
C 2 26  GLN 26  26  26  GLN GLN A . n 
C 2 27  ALA 27  27  27  ALA ALA A . n 
C 2 28  SER 28  28  28  SER SER A . n 
C 2 29  HIS 29  29  29  HIS HIS A . n 
C 2 30  VAL 30  30  30  VAL VAL A . n 
C 2 31  SER 31  31  31  SER SER A . n 
C 2 32  ALA 32  32  32  ALA ALA A . n 
C 2 33  LYS 33  33  33  LYS LYS A . n 
C 2 34  THR 34  34  34  THR THR A . n 
C 2 35  ARG 35  35  35  ARG ARG A . n 
C 2 36  GLU 36  36  36  GLU GLU A . n 
C 2 37  LYS 37  37  37  LYS LYS A . n 
C 2 38  VAL 38  38  38  VAL VAL A . n 
C 2 39  GLU 39  39  39  GLU GLU A . n 
C 2 40  ALA 40  40  40  ALA ALA A . n 
C 2 41  ALA 41  41  41  ALA ALA A . n 
C 2 42  MET 42  42  42  MET MET A . n 
C 2 43  ALA 43  43  43  ALA ALA A . n 
C 2 44  GLU 44  44  44  GLU GLU A . n 
C 2 45  LEU 45  45  45  LEU LEU A . n 
C 2 46  ASN 46  46  46  ASN ASN A . n 
C 2 47  TYR 47  47  47  TYR TYR A . n 
C 2 48  ILE 48  48  48  ILE ILE A . n 
C 2 49  PRO 49  49  49  PRO PRO A . n 
C 2 50  ASN 50  50  50  ASN ASN A . n 
C 2 51  ARG 51  51  51  ARG ARG A . n 
C 2 52  VAL 52  52  52  VAL VAL A . n 
C 2 53  ALA 53  53  53  ALA ALA A . n 
C 2 54  GLN 54  54  54  GLN GLN A . n 
C 2 55  GLN 55  55  55  GLN GLN A . n 
C 2 56  LEU 56  56  56  LEU LEU A . n 
C 2 57  ALA 57  57  57  ALA ALA A . n 
C 2 58  GLY 58  58  58  GLY GLY A . n 
C 2 59  LYS 59  59  59  LYS LYS A . n 
C 2 60  GLN 60  60  60  GLN GLN A . n 
C 2 61  SER 61  61  61  SER SER A . n 
C 2 62  LEU 62  62  62  LEU LEU A . n 
C 2 63  LEU 63  63  63  LEU LEU A . n 
C 2 64  ILE 64  64  64  ILE ILE A . n 
C 2 65  GLY 65  65  65  GLY GLY A . n 
C 2 66  VAL 66  66  66  VAL VAL A . n 
C 2 67  ALA 67  67  67  ALA ALA A . n 
C 2 68  THR 68  68  68  THR THR A . n 
C 2 69  SER 69  69  69  SER SER A . n 
C 2 70  SER 70  70  70  SER SER A . n 
C 2 71  LEU 71  71  71  LEU LEU A . n 
C 2 72  ALA 72  72  72  ALA ALA A . n 
C 2 73  LEU 73  73  73  LEU LEU A . n 
C 2 74  HIS 74  74  74  HIS HIS A . n 
C 2 75  ALA 75  75  75  ALA ALA A . n 
C 2 76  PRO 76  76  76  PRO PRO A . n 
C 2 77  SER 77  77  77  SER SER A . n 
C 2 78  GLN 78  78  78  GLN GLN A . n 
C 2 79  ILE 79  79  79  ILE ILE A . n 
C 2 80  VAL 80  80  80  VAL VAL A . n 
C 2 81  ALA 81  81  81  ALA ALA A . n 
C 2 82  ALA 82  82  82  ALA ALA A . n 
C 2 83  ILE 83  83  83  ILE ILE A . n 
C 2 84  LYS 84  84  84  LYS LYS A . n 
C 2 85  SER 85  85  85  SER SER A . n 
C 2 86  ARG 86  86  86  ARG ARG A . n 
C 2 87  ALA 87  87  87  ALA ALA A . n 
C 2 88  ASP 88  88  88  ASP ASP A . n 
C 2 89  GLN 89  89  89  GLN GLN A . n 
C 2 90  LEU 90  90  90  LEU LEU A . n 
C 2 91  GLY 91  91  91  GLY GLY A . n 
C 2 92  ALA 92  92  92  ALA ALA A . n 
C 2 93  SER 93  93  93  SER SER A . n 
C 2 94  VAL 94  94  94  VAL VAL A . n 
C 2 95  VAL 95  95  95  VAL VAL A . n 
C 2 96  VAL 96  96  96  VAL VAL A . n 
C 2 97  SER 97  97  97  SER SER A . n 
C 2 98  MET 98  98  98  MET MET A . n 
C 2 99  VAL 99  99  99  VAL VAL A . n 
C 2 100 GLU 100 100 100 GLU GLU A . n 
C 2 101 ARG 101 101 101 ARG ARG A . n 
C 2 102 SER 102 102 102 SER SER A . n 
C 2 103 GLY 103 103 103 GLY GLY A . n 
C 2 104 VAL 104 104 104 VAL VAL A . n 
C 2 105 GLU 105 105 105 GLU GLU A . n 
C 2 106 ALA 106 106 106 ALA ALA A . n 
C 2 107 CYS 107 107 107 CYS CYS A . n 
C 2 108 LYS 108 108 108 LYS LYS A . n 
C 2 109 THR 109 109 109 THR THR A . n 
C 2 110 ALA 110 110 110 ALA ALA A . n 
C 2 111 VAL 111 111 111 VAL VAL A . n 
C 2 112 HIS 112 112 112 HIS HIS A . n 
C 2 113 ASN 113 113 113 ASN ASN A . n 
C 2 114 LEU 114 114 114 LEU LEU A . n 
C 2 115 LEU 115 115 115 LEU LEU A . n 
C 2 116 ALA 116 116 116 ALA ALA A . n 
C 2 117 GLN 117 117 117 GLN GLN A . n 
C 2 118 ARG 118 118 118 ARG ARG A . n 
C 2 119 VAL 119 119 119 VAL VAL A . n 
C 2 120 SER 120 120 120 SER SER A . n 
C 2 121 GLY 121 121 121 GLY GLY A . n 
C 2 122 LEU 122 122 122 LEU LEU A . n 
C 2 123 ILE 123 123 123 ILE ILE A . n 
C 2 124 ILE 124 124 124 ILE ILE A . n 
C 2 125 ASN 125 125 125 ASN ASN A . n 
C 2 126 TYR 126 126 126 TYR TYR A . n 
C 2 127 PRO 127 127 127 PRO PRO A . n 
C 2 128 LEU 128 128 128 LEU LEU A . n 
C 2 129 ASP 129 129 129 ASP ASP A . n 
C 2 130 ASP 130 130 130 ASP ASP A . n 
C 2 131 GLN 131 131 131 GLN GLN A . n 
C 2 132 ASP 132 132 132 ASP ASP A . n 
C 2 133 ALA 133 133 133 ALA ALA A . n 
C 2 134 ILE 134 134 134 ILE ILE A . n 
C 2 135 ALA 135 135 135 ALA ALA A . n 
C 2 136 VAL 136 136 136 VAL VAL A . n 
C 2 137 GLU 137 137 137 GLU GLU A . n 
C 2 138 ALA 138 138 138 ALA ALA A . n 
C 2 139 ALA 139 139 139 ALA ALA A . n 
C 2 140 CYS 140 140 140 CYS CYS A . n 
C 2 141 THR 141 141 141 THR THR A . n 
C 2 142 ASN 142 142 142 ASN ASN A . n 
C 2 143 VAL 143 143 143 VAL VAL A . n 
C 2 144 PRO 144 144 144 PRO PRO A . n 
C 2 145 ALA 145 145 145 ALA ALA A . n 
C 2 146 LEU 146 146 146 LEU LEU A . n 
C 2 147 PHE 147 147 147 PHE PHE A . n 
C 2 148 LEU 148 148 148 LEU LEU A . n 
C 2 149 ASP 149 149 149 ASP ASP A . n 
C 2 150 VAL 150 150 150 VAL VAL A . n 
C 2 151 SER 151 151 151 SER SER A . n 
C 2 152 ASP 152 152 152 ASP ASP A . n 
C 2 153 GLN 153 153 153 GLN GLN A . n 
C 2 154 THR 154 154 154 THR THR A . n 
C 2 155 PRO 155 155 155 PRO PRO A . n 
C 2 156 ILE 156 156 156 ILE ILE A . n 
C 2 157 ASN 157 157 157 ASN ASN A . n 
C 2 158 SER 158 158 158 SER SER A . n 
C 2 159 ILE 159 159 159 ILE ILE A . n 
C 2 160 ILE 160 160 160 ILE ILE A . n 
C 2 161 PHE 161 161 161 PHE PHE A . n 
C 2 162 SER 162 162 162 SER SER A . n 
C 2 163 HIS 163 163 163 HIS HIS A . n 
C 2 164 GLU 164 164 164 GLU GLU A . n 
C 2 165 ASP 165 165 165 ASP ASP A . n 
C 2 166 GLY 166 166 166 GLY GLY A . n 
C 2 167 THR 167 167 167 THR THR A . n 
C 2 168 ARG 168 168 168 ARG ARG A . n 
C 2 169 LEU 169 169 169 LEU LEU A . n 
C 2 170 GLY 170 170 170 GLY GLY A . n 
C 2 171 VAL 171 171 171 VAL VAL A . n 
C 2 172 GLU 172 172 172 GLU GLU A . n 
C 2 173 HIS 173 173 173 HIS HIS A . n 
C 2 174 LEU 174 174 174 LEU LEU A . n 
C 2 175 VAL 175 175 175 VAL VAL A . n 
C 2 176 ALA 176 176 176 ALA ALA A . n 
C 2 177 LEU 177 177 177 LEU LEU A . n 
C 2 178 GLY 178 178 178 GLY GLY A . n 
C 2 179 HIS 179 179 179 HIS HIS A . n 
C 2 180 GLN 180 180 180 GLN GLN A . n 
C 2 181 GLN 181 181 181 GLN GLN A . n 
C 2 182 ILE 182 182 182 ILE ILE A . n 
C 2 183 ALA 183 183 183 ALA ALA A . n 
C 2 184 LEU 184 184 184 LEU LEU A . n 
C 2 185 LEU 185 185 185 LEU LEU A . n 
C 2 186 ALA 186 186 186 ALA ALA A . n 
C 2 187 GLY 187 187 187 GLY GLY A . n 
C 2 188 PRO 188 188 188 PRO PRO A . n 
C 2 189 LEU 189 189 189 LEU LEU A . n 
C 2 190 SER 190 190 190 SER SER A . n 
C 2 191 SER 191 191 191 SER SER A . n 
C 2 192 VAL 192 192 192 VAL VAL A . n 
C 2 193 SER 193 193 193 SER SER A . n 
C 2 194 ALA 194 194 194 ALA ALA A . n 
C 2 195 ARG 195 195 195 ARG ARG A . n 
C 2 196 LEU 196 196 196 LEU LEU A . n 
C 2 197 ARG 197 197 197 ARG ARG A . n 
C 2 198 LEU 198 198 198 LEU LEU A . n 
C 2 199 ALA 199 199 199 ALA ALA A . n 
C 2 200 GLY 200 200 200 GLY GLY A . n 
C 2 201 TRP 201 201 201 TRP TRP A . n 
C 2 202 HIS 202 202 202 HIS HIS A . n 
C 2 203 LYS 203 203 203 LYS LYS A . n 
C 2 204 TYR 204 204 204 TYR TYR A . n 
C 2 205 LEU 205 205 205 LEU LEU A . n 
C 2 206 THR 206 206 206 THR THR A . n 
C 2 207 ARG 207 207 207 ARG ARG A . n 
C 2 208 ASN 208 208 208 ASN ASN A . n 
C 2 209 GLN 209 209 209 GLN GLN A . n 
C 2 210 ILE 210 210 210 ILE ILE A . n 
C 2 211 GLN 211 211 211 GLN GLN A . n 
C 2 212 PRO 212 212 212 PRO PRO A . n 
C 2 213 ILE 213 213 213 ILE ILE A . n 
C 2 214 ALA 214 214 214 ALA ALA A . n 
C 2 215 GLU 215 215 215 GLU GLU A . n 
C 2 216 ARG 216 216 216 ARG ARG A . n 
C 2 217 GLU 217 217 217 GLU GLU A . n 
C 2 218 GLY 218 218 218 GLY GLY A . n 
C 2 219 ASP 219 219 219 ASP ASP A . n 
C 2 220 TRP 220 220 220 TRP TRP A . n 
C 2 221 SER 221 221 221 SER SER A . n 
C 2 222 ALA 222 222 222 ALA ALA A . n 
C 2 223 MET 223 223 223 MET MET A . n 
C 2 224 SER 224 224 224 SER SER A . n 
C 2 225 GLY 225 225 225 GLY GLY A . n 
C 2 226 PHE 226 226 226 PHE PHE A . n 
C 2 227 GLN 227 227 227 GLN GLN A . n 
C 2 228 GLN 228 228 228 GLN GLN A . n 
C 2 229 THR 229 229 229 THR THR A . n 
C 2 230 MET 230 230 230 MET MET A . n 
C 2 231 GLN 231 231 231 GLN GLN A . n 
C 2 232 MET 232 232 232 MET MET A . n 
C 2 233 LEU 233 233 233 LEU LEU A . n 
C 2 234 ASN 234 234 234 ASN ASN A . n 
C 2 235 GLU 235 235 235 GLU GLU A . n 
C 2 236 GLY 236 236 236 GLY GLY A . n 
C 2 237 ILE 237 237 237 ILE ILE A . n 
C 2 238 VAL 238 238 238 VAL VAL A . n 
C 2 239 PRO 239 239 239 PRO PRO A . n 
C 2 240 THR 240 240 240 THR THR A . n 
C 2 241 ALA 241 241 241 ALA ALA A . n 
C 2 242 MET 242 242 242 MET MET A . n 
C 2 243 LEU 243 243 243 LEU LEU A . n 
C 2 244 VAL 244 244 244 VAL VAL A . n 
C 2 245 ALA 245 245 245 ALA ALA A . n 
C 2 246 ASN 246 246 246 ASN ASN A . n 
C 2 247 ASP 247 247 247 ASP ASP A . n 
C 2 248 GLN 248 248 248 GLN GLN A . n 
C 2 249 MET 249 249 249 MET MET A . n 
C 2 250 ALA 250 250 250 ALA ALA A . n 
C 2 251 LEU 251 251 251 LEU LEU A . n 
C 2 252 GLY 252 252 252 GLY GLY A . n 
C 2 253 ALA 253 253 253 ALA ALA A . n 
C 2 254 MET 254 254 254 MET MET A . n 
C 2 255 ARG 255 255 255 ARG ARG A . n 
C 2 256 ALA 256 256 256 ALA ALA A . n 
C 2 257 ILE 257 257 257 ILE ILE A . n 
C 2 258 THR 258 258 258 THR THR A . n 
C 2 259 GLU 259 259 259 GLU GLU A . n 
C 2 260 SER 260 260 260 SER SER A . n 
C 2 261 GLY 261 261 261 GLY GLY A . n 
C 2 262 LEU 262 262 262 LEU LEU A . n 
C 2 263 ARG 263 263 263 ARG ARG A . n 
C 2 264 VAL 264 264 264 VAL VAL A . n 
C 2 265 GLY 265 265 265 GLY GLY A . n 
C 2 266 ALA 266 266 266 ALA ALA A . n 
C 2 267 ASP 267 267 267 ASP ASP A . n 
C 2 268 ILE 268 268 268 ILE ILE A . n 
C 2 269 SER 269 269 269 SER SER A . n 
C 2 270 VAL 270 270 270 VAL VAL A . n 
C 2 271 VAL 271 271 271 VAL VAL A . n 
C 2 272 GLY 272 272 272 GLY GLY A . n 
C 2 273 TYR 273 273 273 TYR TYR A . n 
C 2 274 ASP 274 274 274 ASP ASP A . n 
C 2 275 ASP 275 275 275 ASP ASP A . n 
C 2 276 THR 276 276 276 THR THR A . n 
C 2 277 GLU 277 277 277 GLU GLU A . n 
C 2 278 ASP 278 278 278 ASP ASP A . n 
C 2 279 SER 279 279 279 SER SER A . n 
C 2 280 SER 280 280 280 SER SER A . n 
C 2 281 CYS 281 281 281 CYS CYS A . n 
C 2 282 TYR 282 282 282 TYR TYR A . n 
C 2 283 ILE 283 283 283 ILE ILE A . n 
C 2 284 PRO 284 284 284 PRO PRO A . n 
C 2 285 PRO 285 285 285 PRO PRO A . n 
C 2 286 LEU 286 286 286 LEU LEU A . n 
C 2 287 THR 287 287 287 THR THR A . n 
C 2 288 THR 288 288 288 THR THR A . n 
C 2 289 ILE 289 289 289 ILE ILE A . n 
C 2 290 LYS 290 290 290 LYS LYS A . n 
C 2 291 GLN 291 291 291 GLN GLN A . n 
C 2 292 ASP 292 292 292 ASP ASP A . n 
C 2 293 PHE 293 293 293 PHE PHE A . n 
C 2 294 ARG 294 294 294 ARG ARG A . n 
C 2 295 LEU 295 295 295 LEU LEU A . n 
C 2 296 LEU 296 296 296 LEU LEU A . n 
C 2 297 GLY 297 297 297 GLY GLY A . n 
C 2 298 GLN 298 298 298 GLN GLN A . n 
C 2 299 THR 299 299 299 THR THR A . n 
C 2 300 SER 300 300 300 SER SER A . n 
C 2 301 VAL 301 301 301 VAL VAL A . n 
C 2 302 ASP 302 302 302 ASP ASP A . n 
C 2 303 ARG 303 303 303 ARG ARG A . n 
C 2 304 LEU 304 304 304 LEU LEU A . n 
C 2 305 LEU 305 305 305 LEU LEU A . n 
C 2 306 GLN 306 306 306 GLN GLN A . n 
C 2 307 LEU 307 307 307 LEU LEU A . n 
C 2 308 SER 308 308 308 SER SER A . n 
C 2 309 GLN 309 309 309 GLN GLN A . n 
C 2 310 GLY 310 310 310 GLY GLY A . n 
C 2 311 GLN 311 311 311 GLN GLN A . n 
C 2 312 ALA 312 312 312 ALA ALA A . n 
C 2 313 VAL 313 313 313 VAL VAL A . n 
C 2 314 LYS 314 314 314 LYS LYS A . n 
C 2 315 GLY 315 315 315 GLY GLY A . n 
C 2 316 ASN 316 316 316 ASN ASN A . n 
C 2 317 GLN 317 317 317 GLN GLN A . n 
C 2 318 LEU 318 318 318 LEU LEU A . n 
C 2 319 LEU 319 319 319 LEU LEU A . n 
C 2 320 PRO 320 320 320 PRO PRO A . n 
C 2 321 VAL 321 321 321 VAL VAL A . n 
C 2 322 SER 322 322 322 SER SER A . n 
C 2 323 LEU 323 323 323 LEU LEU A . n 
C 2 324 VAL 324 324 324 VAL VAL A . n 
C 2 325 LYS 325 325 325 LYS LYS A . n 
C 2 326 ARG 326 326 326 ARG ARG A . n 
C 2 327 LYS 327 327 327 LYS LYS A . n 
C 2 328 THR 328 328 328 THR THR A . n 
C 2 329 THR 329 329 329 THR THR A . n 
C 2 330 LEU 330 330 ?   ?   ?   A . n 
C 2 331 ALA 331 331 ?   ?   ?   A . n 
C 2 332 PRO 332 332 ?   ?   ?   A . n 
C 2 333 ASN 333 333 ?   ?   ?   A . n 
D 2 1   MET 1   1   ?   ?   ?   B . n 
D 2 2   LYS 2   2   2   LYS LYS B . n 
D 2 3   PRO 3   3   3   PRO PRO B . n 
D 2 4   VAL 4   4   4   VAL VAL B . n 
D 2 5   THR 5   5   5   THR THR B . n 
D 2 6   LEU 6   6   6   LEU LEU B . n 
D 2 7   TYR 7   7   7   TYR TYR B . n 
D 2 8   ASP 8   8   8   ASP ASP B . n 
D 2 9   VAL 9   9   9   VAL VAL B . n 
D 2 10  ALA 10  10  10  ALA ALA B . n 
D 2 11  GLU 11  11  11  GLU GLU B . n 
D 2 12  TYR 12  12  12  TYR TYR B . n 
D 2 13  ALA 13  13  13  ALA ALA B . n 
D 2 14  GLY 14  14  14  GLY GLY B . n 
D 2 15  VAL 15  15  15  VAL VAL B . n 
D 2 16  SER 16  16  16  SER SER B . n 
D 2 17  TYR 17  17  17  TYR TYR B . n 
D 2 18  GLN 18  18  18  GLN GLN B . n 
D 2 19  THR 19  19  19  THR THR B . n 
D 2 20  VAL 20  20  20  VAL VAL B . n 
D 2 21  SER 21  21  21  SER SER B . n 
D 2 22  ARG 22  22  22  ARG ARG B . n 
D 2 23  VAL 23  23  23  VAL VAL B . n 
D 2 24  VAL 24  24  24  VAL VAL B . n 
D 2 25  ASN 25  25  25  ASN ASN B . n 
D 2 26  GLN 26  26  26  GLN GLN B . n 
D 2 27  ALA 27  27  27  ALA ALA B . n 
D 2 28  SER 28  28  28  SER SER B . n 
D 2 29  HIS 29  29  29  HIS HIS B . n 
D 2 30  VAL 30  30  30  VAL VAL B . n 
D 2 31  SER 31  31  31  SER SER B . n 
D 2 32  ALA 32  32  32  ALA ALA B . n 
D 2 33  LYS 33  33  33  LYS LYS B . n 
D 2 34  THR 34  34  34  THR THR B . n 
D 2 35  ARG 35  35  35  ARG ARG B . n 
D 2 36  GLU 36  36  36  GLU GLU B . n 
D 2 37  LYS 37  37  37  LYS LYS B . n 
D 2 38  VAL 38  38  38  VAL VAL B . n 
D 2 39  GLU 39  39  39  GLU GLU B . n 
D 2 40  ALA 40  40  40  ALA ALA B . n 
D 2 41  ALA 41  41  41  ALA ALA B . n 
D 2 42  MET 42  42  42  MET MET B . n 
D 2 43  ALA 43  43  43  ALA ALA B . n 
D 2 44  GLU 44  44  44  GLU GLU B . n 
D 2 45  LEU 45  45  45  LEU LEU B . n 
D 2 46  ASN 46  46  46  ASN ASN B . n 
D 2 47  TYR 47  47  47  TYR TYR B . n 
D 2 48  ILE 48  48  48  ILE ILE B . n 
D 2 49  PRO 49  49  49  PRO PRO B . n 
D 2 50  ASN 50  50  50  ASN ASN B . n 
D 2 51  ARG 51  51  51  ARG ARG B . n 
D 2 52  VAL 52  52  52  VAL VAL B . n 
D 2 53  ALA 53  53  53  ALA ALA B . n 
D 2 54  GLN 54  54  54  GLN GLN B . n 
D 2 55  GLN 55  55  55  GLN GLN B . n 
D 2 56  LEU 56  56  56  LEU LEU B . n 
D 2 57  ALA 57  57  57  ALA ALA B . n 
D 2 58  GLY 58  58  58  GLY GLY B . n 
D 2 59  LYS 59  59  59  LYS LYS B . n 
D 2 60  GLN 60  60  60  GLN GLN B . n 
D 2 61  SER 61  61  61  SER SER B . n 
D 2 62  LEU 62  62  62  LEU LEU B . n 
D 2 63  LEU 63  63  63  LEU LEU B . n 
D 2 64  ILE 64  64  64  ILE ILE B . n 
D 2 65  GLY 65  65  65  GLY GLY B . n 
D 2 66  VAL 66  66  66  VAL VAL B . n 
D 2 67  ALA 67  67  67  ALA ALA B . n 
D 2 68  THR 68  68  68  THR THR B . n 
D 2 69  SER 69  69  69  SER SER B . n 
D 2 70  SER 70  70  70  SER SER B . n 
D 2 71  LEU 71  71  71  LEU LEU B . n 
D 2 72  ALA 72  72  72  ALA ALA B . n 
D 2 73  LEU 73  73  73  LEU LEU B . n 
D 2 74  HIS 74  74  74  HIS HIS B . n 
D 2 75  ALA 75  75  75  ALA ALA B . n 
D 2 76  PRO 76  76  76  PRO PRO B . n 
D 2 77  SER 77  77  77  SER SER B . n 
D 2 78  GLN 78  78  78  GLN GLN B . n 
D 2 79  ILE 79  79  79  ILE ILE B . n 
D 2 80  VAL 80  80  80  VAL VAL B . n 
D 2 81  ALA 81  81  81  ALA ALA B . n 
D 2 82  ALA 82  82  82  ALA ALA B . n 
D 2 83  ILE 83  83  83  ILE ILE B . n 
D 2 84  LYS 84  84  84  LYS LYS B . n 
D 2 85  SER 85  85  85  SER SER B . n 
D 2 86  ARG 86  86  86  ARG ARG B . n 
D 2 87  ALA 87  87  87  ALA ALA B . n 
D 2 88  ASP 88  88  88  ASP ASP B . n 
D 2 89  GLN 89  89  89  GLN GLN B . n 
D 2 90  LEU 90  90  90  LEU LEU B . n 
D 2 91  GLY 91  91  91  GLY GLY B . n 
D 2 92  ALA 92  92  92  ALA ALA B . n 
D 2 93  SER 93  93  93  SER SER B . n 
D 2 94  VAL 94  94  94  VAL VAL B . n 
D 2 95  VAL 95  95  95  VAL VAL B . n 
D 2 96  VAL 96  96  96  VAL VAL B . n 
D 2 97  SER 97  97  97  SER SER B . n 
D 2 98  MET 98  98  98  MET MET B . n 
D 2 99  VAL 99  99  99  VAL VAL B . n 
D 2 100 GLU 100 100 100 GLU GLU B . n 
D 2 101 ARG 101 101 101 ARG ARG B . n 
D 2 102 SER 102 102 102 SER SER B . n 
D 2 103 GLY 103 103 103 GLY GLY B . n 
D 2 104 VAL 104 104 104 VAL VAL B . n 
D 2 105 GLU 105 105 105 GLU GLU B . n 
D 2 106 ALA 106 106 106 ALA ALA B . n 
D 2 107 CYS 107 107 107 CYS CYS B . n 
D 2 108 LYS 108 108 108 LYS LYS B . n 
D 2 109 THR 109 109 109 THR THR B . n 
D 2 110 ALA 110 110 110 ALA ALA B . n 
D 2 111 VAL 111 111 111 VAL VAL B . n 
D 2 112 HIS 112 112 112 HIS HIS B . n 
D 2 113 ASN 113 113 113 ASN ASN B . n 
D 2 114 LEU 114 114 114 LEU LEU B . n 
D 2 115 LEU 115 115 115 LEU LEU B . n 
D 2 116 ALA 116 116 116 ALA ALA B . n 
D 2 117 GLN 117 117 117 GLN GLN B . n 
D 2 118 ARG 118 118 118 ARG ARG B . n 
D 2 119 VAL 119 119 119 VAL VAL B . n 
D 2 120 SER 120 120 120 SER SER B . n 
D 2 121 GLY 121 121 121 GLY GLY B . n 
D 2 122 LEU 122 122 122 LEU LEU B . n 
D 2 123 ILE 123 123 123 ILE ILE B . n 
D 2 124 ILE 124 124 124 ILE ILE B . n 
D 2 125 ASN 125 125 125 ASN ASN B . n 
D 2 126 TYR 126 126 126 TYR TYR B . n 
D 2 127 PRO 127 127 127 PRO PRO B . n 
D 2 128 LEU 128 128 128 LEU LEU B . n 
D 2 129 ASP 129 129 129 ASP ASP B . n 
D 2 130 ASP 130 130 130 ASP ASP B . n 
D 2 131 GLN 131 131 131 GLN GLN B . n 
D 2 132 ASP 132 132 132 ASP ASP B . n 
D 2 133 ALA 133 133 133 ALA ALA B . n 
D 2 134 ILE 134 134 134 ILE ILE B . n 
D 2 135 ALA 135 135 135 ALA ALA B . n 
D 2 136 VAL 136 136 136 VAL VAL B . n 
D 2 137 GLU 137 137 137 GLU GLU B . n 
D 2 138 ALA 138 138 138 ALA ALA B . n 
D 2 139 ALA 139 139 139 ALA ALA B . n 
D 2 140 CYS 140 140 140 CYS CYS B . n 
D 2 141 THR 141 141 141 THR THR B . n 
D 2 142 ASN 142 142 142 ASN ASN B . n 
D 2 143 VAL 143 143 143 VAL VAL B . n 
D 2 144 PRO 144 144 144 PRO PRO B . n 
D 2 145 ALA 145 145 145 ALA ALA B . n 
D 2 146 LEU 146 146 146 LEU LEU B . n 
D 2 147 PHE 147 147 147 PHE PHE B . n 
D 2 148 LEU 148 148 148 LEU LEU B . n 
D 2 149 ASP 149 149 149 ASP ASP B . n 
D 2 150 VAL 150 150 150 VAL VAL B . n 
D 2 151 SER 151 151 151 SER SER B . n 
D 2 152 ASP 152 152 152 ASP ASP B . n 
D 2 153 GLN 153 153 153 GLN GLN B . n 
D 2 154 THR 154 154 154 THR THR B . n 
D 2 155 PRO 155 155 155 PRO PRO B . n 
D 2 156 ILE 156 156 156 ILE ILE B . n 
D 2 157 ASN 157 157 157 ASN ASN B . n 
D 2 158 SER 158 158 158 SER SER B . n 
D 2 159 ILE 159 159 159 ILE ILE B . n 
D 2 160 ILE 160 160 160 ILE ILE B . n 
D 2 161 PHE 161 161 161 PHE PHE B . n 
D 2 162 SER 162 162 162 SER SER B . n 
D 2 163 HIS 163 163 163 HIS HIS B . n 
D 2 164 GLU 164 164 164 GLU GLU B . n 
D 2 165 ASP 165 165 165 ASP ASP B . n 
D 2 166 GLY 166 166 166 GLY GLY B . n 
D 2 167 THR 167 167 167 THR THR B . n 
D 2 168 ARG 168 168 168 ARG ARG B . n 
D 2 169 LEU 169 169 169 LEU LEU B . n 
D 2 170 GLY 170 170 170 GLY GLY B . n 
D 2 171 VAL 171 171 171 VAL VAL B . n 
D 2 172 GLU 172 172 172 GLU GLU B . n 
D 2 173 HIS 173 173 173 HIS HIS B . n 
D 2 174 LEU 174 174 174 LEU LEU B . n 
D 2 175 VAL 175 175 175 VAL VAL B . n 
D 2 176 ALA 176 176 176 ALA ALA B . n 
D 2 177 LEU 177 177 177 LEU LEU B . n 
D 2 178 GLY 178 178 178 GLY GLY B . n 
D 2 179 HIS 179 179 179 HIS HIS B . n 
D 2 180 GLN 180 180 180 GLN GLN B . n 
D 2 181 GLN 181 181 181 GLN GLN B . n 
D 2 182 ILE 182 182 182 ILE ILE B . n 
D 2 183 ALA 183 183 183 ALA ALA B . n 
D 2 184 LEU 184 184 184 LEU LEU B . n 
D 2 185 LEU 185 185 185 LEU LEU B . n 
D 2 186 ALA 186 186 186 ALA ALA B . n 
D 2 187 GLY 187 187 187 GLY GLY B . n 
D 2 188 PRO 188 188 188 PRO PRO B . n 
D 2 189 LEU 189 189 189 LEU LEU B . n 
D 2 190 SER 190 190 190 SER SER B . n 
D 2 191 SER 191 191 191 SER SER B . n 
D 2 192 VAL 192 192 192 VAL VAL B . n 
D 2 193 SER 193 193 193 SER SER B . n 
D 2 194 ALA 194 194 194 ALA ALA B . n 
D 2 195 ARG 195 195 195 ARG ARG B . n 
D 2 196 LEU 196 196 196 LEU LEU B . n 
D 2 197 ARG 197 197 197 ARG ARG B . n 
D 2 198 LEU 198 198 198 LEU LEU B . n 
D 2 199 ALA 199 199 199 ALA ALA B . n 
D 2 200 GLY 200 200 200 GLY GLY B . n 
D 2 201 TRP 201 201 201 TRP TRP B . n 
D 2 202 HIS 202 202 202 HIS HIS B . n 
D 2 203 LYS 203 203 203 LYS LYS B . n 
D 2 204 TYR 204 204 204 TYR TYR B . n 
D 2 205 LEU 205 205 205 LEU LEU B . n 
D 2 206 THR 206 206 206 THR THR B . n 
D 2 207 ARG 207 207 207 ARG ARG B . n 
D 2 208 ASN 208 208 208 ASN ASN B . n 
D 2 209 GLN 209 209 209 GLN GLN B . n 
D 2 210 ILE 210 210 210 ILE ILE B . n 
D 2 211 GLN 211 211 211 GLN GLN B . n 
D 2 212 PRO 212 212 212 PRO PRO B . n 
D 2 213 ILE 213 213 213 ILE ILE B . n 
D 2 214 ALA 214 214 214 ALA ALA B . n 
D 2 215 GLU 215 215 215 GLU GLU B . n 
D 2 216 ARG 216 216 216 ARG ARG B . n 
D 2 217 GLU 217 217 217 GLU GLU B . n 
D 2 218 GLY 218 218 218 GLY GLY B . n 
D 2 219 ASP 219 219 219 ASP ASP B . n 
D 2 220 TRP 220 220 220 TRP TRP B . n 
D 2 221 SER 221 221 221 SER SER B . n 
D 2 222 ALA 222 222 222 ALA ALA B . n 
D 2 223 MET 223 223 223 MET MET B . n 
D 2 224 SER 224 224 224 SER SER B . n 
D 2 225 GLY 225 225 225 GLY GLY B . n 
D 2 226 PHE 226 226 226 PHE PHE B . n 
D 2 227 GLN 227 227 227 GLN GLN B . n 
D 2 228 GLN 228 228 228 GLN GLN B . n 
D 2 229 THR 229 229 229 THR THR B . n 
D 2 230 MET 230 230 230 MET MET B . n 
D 2 231 GLN 231 231 231 GLN GLN B . n 
D 2 232 MET 232 232 232 MET MET B . n 
D 2 233 LEU 233 233 233 LEU LEU B . n 
D 2 234 ASN 234 234 234 ASN ASN B . n 
D 2 235 GLU 235 235 235 GLU GLU B . n 
D 2 236 GLY 236 236 236 GLY GLY B . n 
D 2 237 ILE 237 237 237 ILE ILE B . n 
D 2 238 VAL 238 238 238 VAL VAL B . n 
D 2 239 PRO 239 239 239 PRO PRO B . n 
D 2 240 THR 240 240 240 THR THR B . n 
D 2 241 ALA 241 241 241 ALA ALA B . n 
D 2 242 MET 242 242 242 MET MET B . n 
D 2 243 LEU 243 243 243 LEU LEU B . n 
D 2 244 VAL 244 244 244 VAL VAL B . n 
D 2 245 ALA 245 245 245 ALA ALA B . n 
D 2 246 ASN 246 246 246 ASN ASN B . n 
D 2 247 ASP 247 247 247 ASP ASP B . n 
D 2 248 GLN 248 248 248 GLN GLN B . n 
D 2 249 MET 249 249 249 MET MET B . n 
D 2 250 ALA 250 250 250 ALA ALA B . n 
D 2 251 LEU 251 251 251 LEU LEU B . n 
D 2 252 GLY 252 252 252 GLY GLY B . n 
D 2 253 ALA 253 253 253 ALA ALA B . n 
D 2 254 MET 254 254 254 MET MET B . n 
D 2 255 ARG 255 255 255 ARG ARG B . n 
D 2 256 ALA 256 256 256 ALA ALA B . n 
D 2 257 ILE 257 257 257 ILE ILE B . n 
D 2 258 THR 258 258 258 THR THR B . n 
D 2 259 GLU 259 259 259 GLU GLU B . n 
D 2 260 SER 260 260 260 SER SER B . n 
D 2 261 GLY 261 261 261 GLY GLY B . n 
D 2 262 LEU 262 262 262 LEU LEU B . n 
D 2 263 ARG 263 263 263 ARG ARG B . n 
D 2 264 VAL 264 264 264 VAL VAL B . n 
D 2 265 GLY 265 265 265 GLY GLY B . n 
D 2 266 ALA 266 266 266 ALA ALA B . n 
D 2 267 ASP 267 267 267 ASP ASP B . n 
D 2 268 ILE 268 268 268 ILE ILE B . n 
D 2 269 SER 269 269 269 SER SER B . n 
D 2 270 VAL 270 270 270 VAL VAL B . n 
D 2 271 VAL 271 271 271 VAL VAL B . n 
D 2 272 GLY 272 272 272 GLY GLY B . n 
D 2 273 TYR 273 273 273 TYR TYR B . n 
D 2 274 ASP 274 274 274 ASP ASP B . n 
D 2 275 ASP 275 275 275 ASP ASP B . n 
D 2 276 THR 276 276 276 THR THR B . n 
D 2 277 GLU 277 277 277 GLU GLU B . n 
D 2 278 ASP 278 278 278 ASP ASP B . n 
D 2 279 SER 279 279 279 SER SER B . n 
D 2 280 SER 280 280 280 SER SER B . n 
D 2 281 CYS 281 281 281 CYS CYS B . n 
D 2 282 TYR 282 282 282 TYR TYR B . n 
D 2 283 ILE 283 283 283 ILE ILE B . n 
D 2 284 PRO 284 284 284 PRO PRO B . n 
D 2 285 PRO 285 285 285 PRO PRO B . n 
D 2 286 LEU 286 286 286 LEU LEU B . n 
D 2 287 THR 287 287 287 THR THR B . n 
D 2 288 THR 288 288 288 THR THR B . n 
D 2 289 ILE 289 289 289 ILE ILE B . n 
D 2 290 LYS 290 290 290 LYS LYS B . n 
D 2 291 GLN 291 291 291 GLN GLN B . n 
D 2 292 ASP 292 292 292 ASP ASP B . n 
D 2 293 PHE 293 293 293 PHE PHE B . n 
D 2 294 ARG 294 294 294 ARG ARG B . n 
D 2 295 LEU 295 295 295 LEU LEU B . n 
D 2 296 LEU 296 296 296 LEU LEU B . n 
D 2 297 GLY 297 297 297 GLY GLY B . n 
D 2 298 GLN 298 298 298 GLN GLN B . n 
D 2 299 THR 299 299 299 THR THR B . n 
D 2 300 SER 300 300 300 SER SER B . n 
D 2 301 VAL 301 301 301 VAL VAL B . n 
D 2 302 ASP 302 302 302 ASP ASP B . n 
D 2 303 ARG 303 303 303 ARG ARG B . n 
D 2 304 LEU 304 304 304 LEU LEU B . n 
D 2 305 LEU 305 305 305 LEU LEU B . n 
D 2 306 GLN 306 306 306 GLN GLN B . n 
D 2 307 LEU 307 307 307 LEU LEU B . n 
D 2 308 SER 308 308 308 SER SER B . n 
D 2 309 GLN 309 309 309 GLN GLN B . n 
D 2 310 GLY 310 310 310 GLY GLY B . n 
D 2 311 GLN 311 311 311 GLN GLN B . n 
D 2 312 ALA 312 312 312 ALA ALA B . n 
D 2 313 VAL 313 313 313 VAL VAL B . n 
D 2 314 LYS 314 314 314 LYS LYS B . n 
D 2 315 GLY 315 315 315 GLY GLY B . n 
D 2 316 ASN 316 316 316 ASN ASN B . n 
D 2 317 GLN 317 317 317 GLN GLN B . n 
D 2 318 LEU 318 318 318 LEU LEU B . n 
D 2 319 LEU 319 319 319 LEU LEU B . n 
D 2 320 PRO 320 320 320 PRO PRO B . n 
D 2 321 VAL 321 321 321 VAL VAL B . n 
D 2 322 SER 322 322 322 SER SER B . n 
D 2 323 LEU 323 323 323 LEU LEU B . n 
D 2 324 VAL 324 324 324 VAL VAL B . n 
D 2 325 LYS 325 325 325 LYS LYS B . n 
D 2 326 ARG 326 326 326 ARG ARG B . n 
D 2 327 LYS 327 327 327 LYS LYS B . n 
D 2 328 THR 328 328 328 THR THR B . n 
D 2 329 THR 329 329 329 THR THR B . n 
D 2 330 LEU 330 330 330 LEU LEU B . n 
D 2 331 ALA 331 331 331 ALA ALA B . n 
D 2 332 PRO 332 332 ?   ?   ?   B . n 
D 2 333 ASN 333 333 ?   ?   ?   B . n 
E 2 1   MET 1   1   ?   ?   ?   C . n 
E 2 2   LYS 2   2   ?   ?   ?   C . n 
E 2 3   PRO 3   3   ?   ?   ?   C . n 
E 2 4   VAL 4   4   ?   ?   ?   C . n 
E 2 5   THR 5   5   ?   ?   ?   C . n 
E 2 6   LEU 6   6   ?   ?   ?   C . n 
E 2 7   TYR 7   7   ?   ?   ?   C . n 
E 2 8   ASP 8   8   ?   ?   ?   C . n 
E 2 9   VAL 9   9   ?   ?   ?   C . n 
E 2 10  ALA 10  10  ?   ?   ?   C . n 
E 2 11  GLU 11  11  ?   ?   ?   C . n 
E 2 12  TYR 12  12  ?   ?   ?   C . n 
E 2 13  ALA 13  13  ?   ?   ?   C . n 
E 2 14  GLY 14  14  ?   ?   ?   C . n 
E 2 15  VAL 15  15  ?   ?   ?   C . n 
E 2 16  SER 16  16  ?   ?   ?   C . n 
E 2 17  TYR 17  17  ?   ?   ?   C . n 
E 2 18  GLN 18  18  ?   ?   ?   C . n 
E 2 19  THR 19  19  ?   ?   ?   C . n 
E 2 20  VAL 20  20  ?   ?   ?   C . n 
E 2 21  SER 21  21  ?   ?   ?   C . n 
E 2 22  ARG 22  22  ?   ?   ?   C . n 
E 2 23  VAL 23  23  ?   ?   ?   C . n 
E 2 24  VAL 24  24  ?   ?   ?   C . n 
E 2 25  ASN 25  25  ?   ?   ?   C . n 
E 2 26  GLN 26  26  ?   ?   ?   C . n 
E 2 27  ALA 27  27  ?   ?   ?   C . n 
E 2 28  SER 28  28  ?   ?   ?   C . n 
E 2 29  HIS 29  29  ?   ?   ?   C . n 
E 2 30  VAL 30  30  ?   ?   ?   C . n 
E 2 31  SER 31  31  ?   ?   ?   C . n 
E 2 32  ALA 32  32  ?   ?   ?   C . n 
E 2 33  LYS 33  33  ?   ?   ?   C . n 
E 2 34  THR 34  34  ?   ?   ?   C . n 
E 2 35  ARG 35  35  ?   ?   ?   C . n 
E 2 36  GLU 36  36  ?   ?   ?   C . n 
E 2 37  LYS 37  37  ?   ?   ?   C . n 
E 2 38  VAL 38  38  ?   ?   ?   C . n 
E 2 39  GLU 39  39  ?   ?   ?   C . n 
E 2 40  ALA 40  40  ?   ?   ?   C . n 
E 2 41  ALA 41  41  ?   ?   ?   C . n 
E 2 42  MET 42  42  ?   ?   ?   C . n 
E 2 43  ALA 43  43  ?   ?   ?   C . n 
E 2 44  GLU 44  44  ?   ?   ?   C . n 
E 2 45  LEU 45  45  ?   ?   ?   C . n 
E 2 46  ASN 46  46  46  ASN ASN C . n 
E 2 47  TYR 47  47  47  TYR TYR C . n 
E 2 48  ILE 48  48  48  ILE ILE C . n 
E 2 49  PRO 49  49  49  PRO PRO C . n 
E 2 50  ASN 50  50  50  ASN ASN C . n 
E 2 51  ARG 51  51  51  ARG ARG C . n 
E 2 52  VAL 52  52  52  VAL VAL C . n 
E 2 53  ALA 53  53  53  ALA ALA C . n 
E 2 54  GLN 54  54  54  GLN GLN C . n 
E 2 55  GLN 55  55  55  GLN GLN C . n 
E 2 56  LEU 56  56  56  LEU LEU C . n 
E 2 57  ALA 57  57  57  ALA ALA C . n 
E 2 58  GLY 58  58  58  GLY GLY C . n 
E 2 59  LYS 59  59  59  LYS LYS C . n 
E 2 60  GLN 60  60  60  GLN GLN C . n 
E 2 61  SER 61  61  61  SER SER C . n 
E 2 62  LEU 62  62  62  LEU LEU C . n 
E 2 63  LEU 63  63  63  LEU LEU C . n 
E 2 64  ILE 64  64  64  ILE ILE C . n 
E 2 65  GLY 65  65  65  GLY GLY C . n 
E 2 66  VAL 66  66  66  VAL VAL C . n 
E 2 67  ALA 67  67  67  ALA ALA C . n 
E 2 68  THR 68  68  68  THR THR C . n 
E 2 69  SER 69  69  69  SER SER C . n 
E 2 70  SER 70  70  70  SER SER C . n 
E 2 71  LEU 71  71  71  LEU LEU C . n 
E 2 72  ALA 72  72  72  ALA ALA C . n 
E 2 73  LEU 73  73  73  LEU LEU C . n 
E 2 74  HIS 74  74  74  HIS HIS C . n 
E 2 75  ALA 75  75  75  ALA ALA C . n 
E 2 76  PRO 76  76  76  PRO PRO C . n 
E 2 77  SER 77  77  77  SER SER C . n 
E 2 78  GLN 78  78  78  GLN GLN C . n 
E 2 79  ILE 79  79  79  ILE ILE C . n 
E 2 80  VAL 80  80  80  VAL VAL C . n 
E 2 81  ALA 81  81  81  ALA ALA C . n 
E 2 82  ALA 82  82  82  ALA ALA C . n 
E 2 83  ILE 83  83  83  ILE ILE C . n 
E 2 84  LYS 84  84  84  LYS LYS C . n 
E 2 85  SER 85  85  85  SER SER C . n 
E 2 86  ARG 86  86  86  ARG ARG C . n 
E 2 87  ALA 87  87  87  ALA ALA C . n 
E 2 88  ASP 88  88  88  ASP ASP C . n 
E 2 89  GLN 89  89  89  GLN GLN C . n 
E 2 90  LEU 90  90  90  LEU LEU C . n 
E 2 91  GLY 91  91  91  GLY GLY C . n 
E 2 92  ALA 92  92  92  ALA ALA C . n 
E 2 93  SER 93  93  93  SER SER C . n 
E 2 94  VAL 94  94  94  VAL VAL C . n 
E 2 95  VAL 95  95  95  VAL VAL C . n 
E 2 96  VAL 96  96  96  VAL VAL C . n 
E 2 97  SER 97  97  97  SER SER C . n 
E 2 98  MET 98  98  98  MET MET C . n 
E 2 99  VAL 99  99  99  VAL VAL C . n 
E 2 100 GLU 100 100 100 GLU GLU C . n 
E 2 101 ARG 101 101 101 ARG ARG C . n 
E 2 102 SER 102 102 102 SER SER C . n 
E 2 103 GLY 103 103 103 GLY GLY C . n 
E 2 104 VAL 104 104 104 VAL VAL C . n 
E 2 105 GLU 105 105 105 GLU GLU C . n 
E 2 106 ALA 106 106 106 ALA ALA C . n 
E 2 107 CYS 107 107 107 CYS CYS C . n 
E 2 108 LYS 108 108 108 LYS LYS C . n 
E 2 109 THR 109 109 109 THR THR C . n 
E 2 110 ALA 110 110 110 ALA ALA C . n 
E 2 111 VAL 111 111 111 VAL VAL C . n 
E 2 112 HIS 112 112 112 HIS HIS C . n 
E 2 113 ASN 113 113 113 ASN ASN C . n 
E 2 114 LEU 114 114 114 LEU LEU C . n 
E 2 115 LEU 115 115 115 LEU LEU C . n 
E 2 116 ALA 116 116 116 ALA ALA C . n 
E 2 117 GLN 117 117 117 GLN GLN C . n 
E 2 118 ARG 118 118 118 ARG ARG C . n 
E 2 119 VAL 119 119 119 VAL VAL C . n 
E 2 120 SER 120 120 120 SER SER C . n 
E 2 121 GLY 121 121 121 GLY GLY C . n 
E 2 122 LEU 122 122 122 LEU LEU C . n 
E 2 123 ILE 123 123 123 ILE ILE C . n 
E 2 124 ILE 124 124 124 ILE ILE C . n 
E 2 125 ASN 125 125 125 ASN ASN C . n 
E 2 126 TYR 126 126 126 TYR TYR C . n 
E 2 127 PRO 127 127 127 PRO PRO C . n 
E 2 128 LEU 128 128 128 LEU LEU C . n 
E 2 129 ASP 129 129 129 ASP ASP C . n 
E 2 130 ASP 130 130 130 ASP ASP C . n 
E 2 131 GLN 131 131 131 GLN GLN C . n 
E 2 132 ASP 132 132 132 ASP ASP C . n 
E 2 133 ALA 133 133 133 ALA ALA C . n 
E 2 134 ILE 134 134 134 ILE ILE C . n 
E 2 135 ALA 135 135 135 ALA ALA C . n 
E 2 136 VAL 136 136 136 VAL VAL C . n 
E 2 137 GLU 137 137 137 GLU GLU C . n 
E 2 138 ALA 138 138 138 ALA ALA C . n 
E 2 139 ALA 139 139 139 ALA ALA C . n 
E 2 140 CYS 140 140 140 CYS CYS C . n 
E 2 141 THR 141 141 141 THR THR C . n 
E 2 142 ASN 142 142 142 ASN ASN C . n 
E 2 143 VAL 143 143 143 VAL VAL C . n 
E 2 144 PRO 144 144 144 PRO PRO C . n 
E 2 145 ALA 145 145 145 ALA ALA C . n 
E 2 146 LEU 146 146 146 LEU LEU C . n 
E 2 147 PHE 147 147 147 PHE PHE C . n 
E 2 148 LEU 148 148 148 LEU LEU C . n 
E 2 149 ASP 149 149 149 ASP ASP C . n 
E 2 150 VAL 150 150 150 VAL VAL C . n 
E 2 151 SER 151 151 151 SER SER C . n 
E 2 152 ASP 152 152 152 ASP ASP C . n 
E 2 153 GLN 153 153 153 GLN GLN C . n 
E 2 154 THR 154 154 154 THR THR C . n 
E 2 155 PRO 155 155 155 PRO PRO C . n 
E 2 156 ILE 156 156 156 ILE ILE C . n 
E 2 157 ASN 157 157 157 ASN ASN C . n 
E 2 158 SER 158 158 158 SER SER C . n 
E 2 159 ILE 159 159 159 ILE ILE C . n 
E 2 160 ILE 160 160 160 ILE ILE C . n 
E 2 161 PHE 161 161 161 PHE PHE C . n 
E 2 162 SER 162 162 162 SER SER C . n 
E 2 163 HIS 163 163 163 HIS HIS C . n 
E 2 164 GLU 164 164 164 GLU GLU C . n 
E 2 165 ASP 165 165 165 ASP ASP C . n 
E 2 166 GLY 166 166 166 GLY GLY C . n 
E 2 167 THR 167 167 167 THR THR C . n 
E 2 168 ARG 168 168 168 ARG ARG C . n 
E 2 169 LEU 169 169 169 LEU LEU C . n 
E 2 170 GLY 170 170 170 GLY GLY C . n 
E 2 171 VAL 171 171 171 VAL VAL C . n 
E 2 172 GLU 172 172 172 GLU GLU C . n 
E 2 173 HIS 173 173 173 HIS HIS C . n 
E 2 174 LEU 174 174 174 LEU LEU C . n 
E 2 175 VAL 175 175 175 VAL VAL C . n 
E 2 176 ALA 176 176 176 ALA ALA C . n 
E 2 177 LEU 177 177 177 LEU LEU C . n 
E 2 178 GLY 178 178 178 GLY GLY C . n 
E 2 179 HIS 179 179 179 HIS HIS C . n 
E 2 180 GLN 180 180 180 GLN GLN C . n 
E 2 181 GLN 181 181 181 GLN GLN C . n 
E 2 182 ILE 182 182 182 ILE ILE C . n 
E 2 183 ALA 183 183 183 ALA ALA C . n 
E 2 184 LEU 184 184 184 LEU LEU C . n 
E 2 185 LEU 185 185 185 LEU LEU C . n 
E 2 186 ALA 186 186 186 ALA ALA C . n 
E 2 187 GLY 187 187 187 GLY GLY C . n 
E 2 188 PRO 188 188 188 PRO PRO C . n 
E 2 189 LEU 189 189 189 LEU LEU C . n 
E 2 190 SER 190 190 190 SER SER C . n 
E 2 191 SER 191 191 191 SER SER C . n 
E 2 192 VAL 192 192 192 VAL VAL C . n 
E 2 193 SER 193 193 193 SER SER C . n 
E 2 194 ALA 194 194 194 ALA ALA C . n 
E 2 195 ARG 195 195 195 ARG ARG C . n 
E 2 196 LEU 196 196 196 LEU LEU C . n 
E 2 197 ARG 197 197 197 ARG ARG C . n 
E 2 198 LEU 198 198 198 LEU LEU C . n 
E 2 199 ALA 199 199 199 ALA ALA C . n 
E 2 200 GLY 200 200 200 GLY GLY C . n 
E 2 201 TRP 201 201 201 TRP TRP C . n 
E 2 202 HIS 202 202 202 HIS HIS C . n 
E 2 203 LYS 203 203 203 LYS LYS C . n 
E 2 204 TYR 204 204 204 TYR TYR C . n 
E 2 205 LEU 205 205 205 LEU LEU C . n 
E 2 206 THR 206 206 206 THR THR C . n 
E 2 207 ARG 207 207 207 ARG ARG C . n 
E 2 208 ASN 208 208 208 ASN ASN C . n 
E 2 209 GLN 209 209 209 GLN GLN C . n 
E 2 210 ILE 210 210 210 ILE ILE C . n 
E 2 211 GLN 211 211 211 GLN GLN C . n 
E 2 212 PRO 212 212 212 PRO PRO C . n 
E 2 213 ILE 213 213 213 ILE ILE C . n 
E 2 214 ALA 214 214 214 ALA ALA C . n 
E 2 215 GLU 215 215 215 GLU GLU C . n 
E 2 216 ARG 216 216 216 ARG ARG C . n 
E 2 217 GLU 217 217 217 GLU GLU C . n 
E 2 218 GLY 218 218 218 GLY GLY C . n 
E 2 219 ASP 219 219 219 ASP ASP C . n 
E 2 220 TRP 220 220 220 TRP TRP C . n 
E 2 221 SER 221 221 221 SER SER C . n 
E 2 222 ALA 222 222 222 ALA ALA C . n 
E 2 223 MET 223 223 223 MET MET C . n 
E 2 224 SER 224 224 224 SER SER C . n 
E 2 225 GLY 225 225 225 GLY GLY C . n 
E 2 226 PHE 226 226 226 PHE PHE C . n 
E 2 227 GLN 227 227 227 GLN GLN C . n 
E 2 228 GLN 228 228 228 GLN GLN C . n 
E 2 229 THR 229 229 229 THR THR C . n 
E 2 230 MET 230 230 230 MET MET C . n 
E 2 231 GLN 231 231 231 GLN GLN C . n 
E 2 232 MET 232 232 232 MET MET C . n 
E 2 233 LEU 233 233 233 LEU LEU C . n 
E 2 234 ASN 234 234 234 ASN ASN C . n 
E 2 235 GLU 235 235 235 GLU GLU C . n 
E 2 236 GLY 236 236 236 GLY GLY C . n 
E 2 237 ILE 237 237 237 ILE ILE C . n 
E 2 238 VAL 238 238 238 VAL VAL C . n 
E 2 239 PRO 239 239 239 PRO PRO C . n 
E 2 240 THR 240 240 240 THR THR C . n 
E 2 241 ALA 241 241 241 ALA ALA C . n 
E 2 242 MET 242 242 242 MET MET C . n 
E 2 243 LEU 243 243 243 LEU LEU C . n 
E 2 244 VAL 244 244 244 VAL VAL C . n 
E 2 245 ALA 245 245 245 ALA ALA C . n 
E 2 246 ASN 246 246 246 ASN ASN C . n 
E 2 247 ASP 247 247 247 ASP ASP C . n 
E 2 248 GLN 248 248 248 GLN GLN C . n 
E 2 249 MET 249 249 249 MET MET C . n 
E 2 250 ALA 250 250 250 ALA ALA C . n 
E 2 251 LEU 251 251 251 LEU LEU C . n 
E 2 252 GLY 252 252 252 GLY GLY C . n 
E 2 253 ALA 253 253 253 ALA ALA C . n 
E 2 254 MET 254 254 254 MET MET C . n 
E 2 255 ARG 255 255 255 ARG ARG C . n 
E 2 256 ALA 256 256 256 ALA ALA C . n 
E 2 257 ILE 257 257 257 ILE ILE C . n 
E 2 258 THR 258 258 258 THR THR C . n 
E 2 259 GLU 259 259 259 GLU GLU C . n 
E 2 260 SER 260 260 260 SER SER C . n 
E 2 261 GLY 261 261 261 GLY GLY C . n 
E 2 262 LEU 262 262 262 LEU LEU C . n 
E 2 263 ARG 263 263 263 ARG ARG C . n 
E 2 264 VAL 264 264 264 VAL VAL C . n 
E 2 265 GLY 265 265 265 GLY GLY C . n 
E 2 266 ALA 266 266 266 ALA ALA C . n 
E 2 267 ASP 267 267 267 ASP ASP C . n 
E 2 268 ILE 268 268 268 ILE ILE C . n 
E 2 269 SER 269 269 269 SER SER C . n 
E 2 270 VAL 270 270 270 VAL VAL C . n 
E 2 271 VAL 271 271 271 VAL VAL C . n 
E 2 272 GLY 272 272 272 GLY GLY C . n 
E 2 273 TYR 273 273 273 TYR TYR C . n 
E 2 274 ASP 274 274 274 ASP ASP C . n 
E 2 275 ASP 275 275 275 ASP ASP C . n 
E 2 276 THR 276 276 276 THR THR C . n 
E 2 277 GLU 277 277 277 GLU GLU C . n 
E 2 278 ASP 278 278 278 ASP ASP C . n 
E 2 279 SER 279 279 279 SER SER C . n 
E 2 280 SER 280 280 280 SER SER C . n 
E 2 281 CYS 281 281 281 CYS CYS C . n 
E 2 282 TYR 282 282 282 TYR TYR C . n 
E 2 283 ILE 283 283 283 ILE ILE C . n 
E 2 284 PRO 284 284 284 PRO PRO C . n 
E 2 285 PRO 285 285 285 PRO PRO C . n 
E 2 286 LEU 286 286 286 LEU LEU C . n 
E 2 287 THR 287 287 287 THR THR C . n 
E 2 288 THR 288 288 288 THR THR C . n 
E 2 289 ILE 289 289 289 ILE ILE C . n 
E 2 290 LYS 290 290 290 LYS LYS C . n 
E 2 291 GLN 291 291 291 GLN GLN C . n 
E 2 292 ASP 292 292 292 ASP ASP C . n 
E 2 293 PHE 293 293 293 PHE PHE C . n 
E 2 294 ARG 294 294 294 ARG ARG C . n 
E 2 295 LEU 295 295 295 LEU LEU C . n 
E 2 296 LEU 296 296 296 LEU LEU C . n 
E 2 297 GLY 297 297 297 GLY GLY C . n 
E 2 298 GLN 298 298 298 GLN GLN C . n 
E 2 299 THR 299 299 299 THR THR C . n 
E 2 300 SER 300 300 300 SER SER C . n 
E 2 301 VAL 301 301 301 VAL VAL C . n 
E 2 302 ASP 302 302 302 ASP ASP C . n 
E 2 303 ARG 303 303 303 ARG ARG C . n 
E 2 304 LEU 304 304 304 LEU LEU C . n 
E 2 305 LEU 305 305 305 LEU LEU C . n 
E 2 306 GLN 306 306 306 GLN GLN C . n 
E 2 307 LEU 307 307 307 LEU LEU C . n 
E 2 308 SER 308 308 308 SER SER C . n 
E 2 309 GLN 309 309 309 GLN GLN C . n 
E 2 310 GLY 310 310 310 GLY GLY C . n 
E 2 311 GLN 311 311 311 GLN GLN C . n 
E 2 312 ALA 312 312 312 ALA ALA C . n 
E 2 313 VAL 313 313 313 VAL VAL C . n 
E 2 314 LYS 314 314 314 LYS LYS C . n 
E 2 315 GLY 315 315 315 GLY GLY C . n 
E 2 316 ASN 316 316 316 ASN ASN C . n 
E 2 317 GLN 317 317 317 GLN GLN C . n 
E 2 318 LEU 318 318 318 LEU LEU C . n 
E 2 319 LEU 319 319 319 LEU LEU C . n 
E 2 320 PRO 320 320 320 PRO PRO C . n 
E 2 321 VAL 321 321 321 VAL VAL C . n 
E 2 322 SER 322 322 322 SER SER C . n 
E 2 323 LEU 323 323 323 LEU LEU C . n 
E 2 324 VAL 324 324 324 VAL VAL C . n 
E 2 325 LYS 325 325 325 LYS LYS C . n 
E 2 326 ARG 326 326 326 ARG ARG C . n 
E 2 327 LYS 327 327 327 LYS LYS C . n 
E 2 328 THR 328 328 328 THR THR C . n 
E 2 329 THR 329 329 329 THR THR C . n 
E 2 330 LEU 330 330 330 LEU LEU C . n 
E 2 331 ALA 331 331 331 ALA ALA C . n 
E 2 332 PRO 332 332 ?   ?   ?   C . n 
E 2 333 ASN 333 333 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 3 NPF 1  901 901 NPF NPF A . 
G 3 NPF 1  902 902 NPF NPF B . 
H 3 NPF 1  903 903 NPF NPF C . 
I 4 HOH 1  902 2   HOH WAT A . 
I 4 HOH 2  903 8   HOH WAT A . 
I 4 HOH 3  904 11  HOH WAT A . 
I 4 HOH 4  905 14  HOH WAT A . 
I 4 HOH 5  906 16  HOH WAT A . 
I 4 HOH 6  907 26  HOH WAT A . 
I 4 HOH 7  908 34  HOH WAT A . 
I 4 HOH 8  909 58  HOH WAT A . 
J 4 HOH 1  903 1   HOH WAT B . 
J 4 HOH 2  904 5   HOH WAT B . 
J 4 HOH 3  905 6   HOH WAT B . 
J 4 HOH 4  906 12  HOH WAT B . 
J 4 HOH 5  907 13  HOH WAT B . 
J 4 HOH 6  908 17  HOH WAT B . 
J 4 HOH 7  909 18  HOH WAT B . 
J 4 HOH 8  910 20  HOH WAT B . 
J 4 HOH 9  911 21  HOH WAT B . 
J 4 HOH 10 912 22  HOH WAT B . 
J 4 HOH 11 913 23  HOH WAT B . 
J 4 HOH 12 914 24  HOH WAT B . 
J 4 HOH 13 915 25  HOH WAT B . 
J 4 HOH 14 916 27  HOH WAT B . 
J 4 HOH 15 917 28  HOH WAT B . 
J 4 HOH 16 918 30  HOH WAT B . 
J 4 HOH 17 919 32  HOH WAT B . 
J 4 HOH 18 920 38  HOH WAT B . 
J 4 HOH 19 921 40  HOH WAT B . 
J 4 HOH 20 922 41  HOH WAT B . 
J 4 HOH 21 923 42  HOH WAT B . 
J 4 HOH 22 924 45  HOH WAT B . 
J 4 HOH 23 925 46  HOH WAT B . 
J 4 HOH 24 926 47  HOH WAT B . 
J 4 HOH 25 927 48  HOH WAT B . 
J 4 HOH 26 928 53  HOH WAT B . 
J 4 HOH 27 929 54  HOH WAT B . 
J 4 HOH 28 930 55  HOH WAT B . 
J 4 HOH 29 931 57  HOH WAT B . 
J 4 HOH 30 932 59  HOH WAT B . 
J 4 HOH 31 933 60  HOH WAT B . 
J 4 HOH 32 934 61  HOH WAT B . 
K 4 HOH 1  904 3   HOH WAT C . 
K 4 HOH 2  905 4   HOH WAT C . 
K 4 HOH 3  906 7   HOH WAT C . 
K 4 HOH 4  907 9   HOH WAT C . 
K 4 HOH 5  908 10  HOH WAT C . 
K 4 HOH 6  909 15  HOH WAT C . 
K 4 HOH 7  910 19  HOH WAT C . 
K 4 HOH 8  911 29  HOH WAT C . 
K 4 HOH 9  912 31  HOH WAT C . 
K 4 HOH 10 913 33  HOH WAT C . 
K 4 HOH 11 914 35  HOH WAT C . 
K 4 HOH 12 915 36  HOH WAT C . 
K 4 HOH 13 916 37  HOH WAT C . 
K 4 HOH 14 917 39  HOH WAT C . 
K 4 HOH 15 918 43  HOH WAT C . 
K 4 HOH 16 919 44  HOH WAT C . 
K 4 HOH 17 920 49  HOH WAT C . 
K 4 HOH 18 921 50  HOH WAT C . 
K 4 HOH 19 922 51  HOH WAT C . 
K 4 HOH 20 923 52  HOH WAT C . 
K 4 HOH 21 924 56  HOH WAT C . 
K 4 HOH 22 925 62  HOH WAT C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? monomeric  1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,F,G,I,J 
2 1 E,H,K           
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    C 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     907 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   K 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-03-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 5 'Structure model' 'Atomic model'              
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' atom_site                 
2 5 'Structure model' chem_comp                 
3 5 'Structure model' entity                    
4 5 'Structure model' pdbx_chem_comp_identifier 
5 5 'Structure model' pdbx_entity_nonpoly       
6 5 'Structure model' struct_site               
7 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_atom_site.auth_atom_id'   
2 5 'Structure model' '_atom_site.label_atom_id'  
3 5 'Structure model' '_chem_comp.mon_nstd_flag'  
4 5 'Structure model' '_chem_comp.name'           
5 5 'Structure model' '_chem_comp.type'           
6 5 'Structure model' '_entity.pdbx_description'  
7 5 'Structure model' '_pdbx_entity_nonpoly.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.9 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    C 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     919 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     919 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   17_555 
_pdbx_validate_symm_contact.dist              1.57 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 303 ? ? CZ A ARG 303 ? ? NH2 A ARG 303 ? ? 117.30 120.30 -3.00 0.50 N 
2 1 NE B ARG 294 ? ? CZ B ARG 294 ? ? NH1 B ARG 294 ? ? 116.41 120.30 -3.89 0.50 N 
3 1 NE B ARG 294 ? ? CZ B ARG 294 ? ? NH2 B ARG 294 ? ? 123.56 120.30 3.26  0.50 N 
4 1 NE B ARG 303 ? ? CZ B ARG 303 ? ? NH1 B ARG 303 ? ? 115.49 120.30 -4.81 0.50 N 
5 1 NE B ARG 303 ? ? CZ B ARG 303 ? ? NH2 B ARG 303 ? ? 124.37 120.30 4.07  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 3   ? ? -42.40  156.47  
2  1 ALA A 13  ? ? -149.78 -7.72   
3  1 VAL A 15  ? ? -118.10 -169.42 
4  1 ALA A 27  ? ? -58.14  173.92  
5  1 HIS A 29  ? ? 96.95   65.00   
6  1 SER A 31  ? ? -70.76  31.07   
7  1 ALA A 32  ? ? 52.17   -87.79  
8  1 ASN A 50  ? ? -67.13  88.92   
9  1 GLN A 60  ? ? -68.40  93.25   
10 1 HIS A 74  ? ? -49.90  -71.16  
11 1 ASN A 125 ? ? -110.88 75.03   
12 1 CYS A 140 ? ? -69.19  71.64   
13 1 THR A 141 ? ? -41.70  99.24   
14 1 ASN A 142 ? ? 71.59   -21.39  
15 1 GLN A 180 ? ? -133.05 -30.46  
16 1 TRP A 220 ? ? 89.56   -25.70  
17 1 ASP A 274 ? ? 125.12  -51.86  
18 1 ARG A 326 ? ? -124.20 -135.13 
19 1 PRO B 3   ? ? -45.30  156.56  
20 1 ALA B 13  ? ? -149.23 -6.04   
21 1 ALA B 27  ? ? -53.13  171.43  
22 1 HIS B 29  ? ? 89.74   66.89   
23 1 SER B 31  ? ? -73.84  32.84   
24 1 ALA B 32  ? ? 53.54   -86.64  
25 1 ASN B 50  ? ? -69.22  92.59   
26 1 HIS B 74  ? ? -50.16  -71.40  
27 1 ASN B 125 ? ? -114.40 73.06   
28 1 THR B 141 ? ? -40.20  97.78   
29 1 ASN B 142 ? ? 72.23   -21.76  
30 1 TRP B 220 ? ? 92.70   -23.78  
31 1 ASP B 274 ? ? 126.64  -51.58  
32 1 ARG B 326 ? ? -125.39 -130.02 
33 1 ASN C 50  ? ? -66.89  86.72   
34 1 HIS C 74  ? ? -50.62  -71.05  
35 1 ASN C 125 ? ? -111.27 73.64   
36 1 CYS C 140 ? ? -69.65  69.60   
37 1 THR C 141 ? ? -39.58  99.71   
38 1 ASN C 142 ? ? 70.74   -20.87  
39 1 GLN C 180 ? ? -133.27 -31.05  
40 1 TRP C 220 ? ? 90.72   -22.75  
41 1 ASP C 274 ? ? 123.79  -50.95  
42 1 ARG C 326 ? ? -125.55 -136.39 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D DT  5  ? P   ? A DT  5  P   
2  1 Y 1 D DT  5  ? OP1 ? A DT  5  OP1 
3  1 Y 1 D DT  5  ? OP2 ? A DT  5  OP2 
4  1 Y 1 A LYS 2  ? CB  ? C LYS 2  CB  
5  1 Y 1 A LYS 2  ? CG  ? C LYS 2  CG  
6  1 Y 1 A LYS 2  ? CD  ? C LYS 2  CD  
7  1 Y 1 A LYS 2  ? CE  ? C LYS 2  CE  
8  1 Y 1 A LYS 2  ? NZ  ? C LYS 2  NZ  
9  1 Y 1 A GLN 26 ? CB  ? C GLN 26 CB  
10 1 Y 1 A GLN 26 ? CG  ? C GLN 26 CG  
11 1 Y 1 A GLN 26 ? CD  ? C GLN 26 CD  
12 1 Y 1 A GLN 26 ? OE1 ? C GLN 26 OE1 
13 1 Y 1 A GLN 26 ? NE2 ? C GLN 26 NE2 
14 1 Y 1 A ALA 27 ? CB  ? C ALA 27 CB  
15 1 Y 1 A SER 28 ? CB  ? C SER 28 CB  
16 1 Y 1 A SER 28 ? OG  ? C SER 28 OG  
17 1 Y 1 A HIS 29 ? CB  ? C HIS 29 CB  
18 1 Y 1 A HIS 29 ? CG  ? C HIS 29 CG  
19 1 Y 1 A HIS 29 ? ND1 ? C HIS 29 ND1 
20 1 Y 1 A HIS 29 ? CD2 ? C HIS 29 CD2 
21 1 Y 1 A HIS 29 ? CE1 ? C HIS 29 CE1 
22 1 Y 1 A HIS 29 ? NE2 ? C HIS 29 NE2 
23 1 Y 1 A VAL 30 ? CB  ? C VAL 30 CB  
24 1 Y 1 A VAL 30 ? CG1 ? C VAL 30 CG1 
25 1 Y 1 A VAL 30 ? CG2 ? C VAL 30 CG2 
26 1 Y 1 A SER 31 ? CB  ? C SER 31 CB  
27 1 Y 1 A SER 31 ? OG  ? C SER 31 OG  
28 1 Y 1 A ALA 32 ? CB  ? C ALA 32 CB  
29 1 Y 1 A LYS 33 ? CB  ? C LYS 33 CB  
30 1 Y 1 A LYS 33 ? CG  ? C LYS 33 CG  
31 1 Y 1 A LYS 33 ? CD  ? C LYS 33 CD  
32 1 Y 1 A LYS 33 ? CE  ? C LYS 33 CE  
33 1 Y 1 A LYS 33 ? NZ  ? C LYS 33 NZ  
34 1 Y 1 A THR 34 ? CB  ? C THR 34 CB  
35 1 Y 1 A THR 34 ? OG1 ? C THR 34 OG1 
36 1 Y 1 A THR 34 ? CG2 ? C THR 34 CG2 
37 1 Y 1 A ARG 35 ? CB  ? C ARG 35 CB  
38 1 Y 1 A ARG 35 ? CG  ? C ARG 35 CG  
39 1 Y 1 A ARG 35 ? CD  ? C ARG 35 CD  
40 1 Y 1 A ARG 35 ? NE  ? C ARG 35 NE  
41 1 Y 1 A ARG 35 ? CZ  ? C ARG 35 CZ  
42 1 Y 1 A ARG 35 ? NH1 ? C ARG 35 NH1 
43 1 Y 1 A ARG 35 ? NH2 ? C ARG 35 NH2 
44 1 Y 1 A GLU 36 ? CB  ? C GLU 36 CB  
45 1 Y 1 A GLU 36 ? CG  ? C GLU 36 CG  
46 1 Y 1 A GLU 36 ? CD  ? C GLU 36 CD  
47 1 Y 1 A GLU 36 ? OE1 ? C GLU 36 OE1 
48 1 Y 1 A GLU 36 ? OE2 ? C GLU 36 OE2 
49 1 Y 1 A LYS 37 ? CB  ? C LYS 37 CB  
50 1 Y 1 A LYS 37 ? CG  ? C LYS 37 CG  
51 1 Y 1 A LYS 37 ? CD  ? C LYS 37 CD  
52 1 Y 1 A LYS 37 ? CE  ? C LYS 37 CE  
53 1 Y 1 A LYS 37 ? NZ  ? C LYS 37 NZ  
54 1 Y 1 B LYS 2  ? CB  ? D LYS 2  CB  
55 1 Y 1 B LYS 2  ? CG  ? D LYS 2  CG  
56 1 Y 1 B LYS 2  ? CD  ? D LYS 2  CD  
57 1 Y 1 B LYS 2  ? CE  ? D LYS 2  CE  
58 1 Y 1 B LYS 2  ? NZ  ? D LYS 2  NZ  
59 1 Y 1 B SER 31 ? CB  ? D SER 31 CB  
60 1 Y 1 B SER 31 ? OG  ? D SER 31 OG  
61 1 Y 1 B GLU 36 ? CB  ? D GLU 36 CB  
62 1 Y 1 B GLU 36 ? CG  ? D GLU 36 CG  
63 1 Y 1 B GLU 36 ? CD  ? D GLU 36 CD  
64 1 Y 1 B GLU 36 ? OE1 ? D GLU 36 OE1 
65 1 Y 1 B GLU 36 ? OE2 ? D GLU 36 OE2 
66 1 Y 1 B LYS 37 ? CB  ? D LYS 37 CB  
67 1 Y 1 B LYS 37 ? CG  ? D LYS 37 CG  
68 1 Y 1 B LYS 37 ? CD  ? D LYS 37 CD  
69 1 Y 1 B LYS 37 ? CE  ? D LYS 37 CE  
70 1 Y 1 B LYS 37 ? NZ  ? D LYS 37 NZ  
71 1 Y 1 B GLU 44 ? CB  ? D GLU 44 CB  
72 1 Y 1 B GLU 44 ? CG  ? D GLU 44 CG  
73 1 Y 1 B GLU 44 ? CD  ? D GLU 44 CD  
74 1 Y 1 B GLU 44 ? OE1 ? D GLU 44 OE1 
75 1 Y 1 B GLU 44 ? OE2 ? D GLU 44 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D DG  1   ? A DG  1   
2  1 Y 1 D DA  2   ? A DA  2   
3  1 Y 1 D DA  3   ? A DA  3   
4  1 Y 1 D DT  4   ? A DT  4   
5  1 Y 1 E DG  1   ? B DG  1   
6  1 Y 1 E DA  19  ? B DA  19  
7  1 Y 1 E DT  20  ? B DT  20  
8  1 Y 1 E DT  21  ? B DT  21  
9  1 Y 1 A MET 1   ? C MET 1   
10 1 Y 1 A LEU 330 ? C LEU 330 
11 1 Y 1 A ALA 331 ? C ALA 331 
12 1 Y 1 A PRO 332 ? C PRO 332 
13 1 Y 1 A ASN 333 ? C ASN 333 
14 1 Y 1 B MET 1   ? D MET 1   
15 1 Y 1 B PRO 332 ? D PRO 332 
16 1 Y 1 B ASN 333 ? D ASN 333 
17 1 Y 1 C MET 1   ? E MET 1   
18 1 Y 1 C LYS 2   ? E LYS 2   
19 1 Y 1 C PRO 3   ? E PRO 3   
20 1 Y 1 C VAL 4   ? E VAL 4   
21 1 Y 1 C THR 5   ? E THR 5   
22 1 Y 1 C LEU 6   ? E LEU 6   
23 1 Y 1 C TYR 7   ? E TYR 7   
24 1 Y 1 C ASP 8   ? E ASP 8   
25 1 Y 1 C VAL 9   ? E VAL 9   
26 1 Y 1 C ALA 10  ? E ALA 10  
27 1 Y 1 C GLU 11  ? E GLU 11  
28 1 Y 1 C TYR 12  ? E TYR 12  
29 1 Y 1 C ALA 13  ? E ALA 13  
30 1 Y 1 C GLY 14  ? E GLY 14  
31 1 Y 1 C VAL 15  ? E VAL 15  
32 1 Y 1 C SER 16  ? E SER 16  
33 1 Y 1 C TYR 17  ? E TYR 17  
34 1 Y 1 C GLN 18  ? E GLN 18  
35 1 Y 1 C THR 19  ? E THR 19  
36 1 Y 1 C VAL 20  ? E VAL 20  
37 1 Y 1 C SER 21  ? E SER 21  
38 1 Y 1 C ARG 22  ? E ARG 22  
39 1 Y 1 C VAL 23  ? E VAL 23  
40 1 Y 1 C VAL 24  ? E VAL 24  
41 1 Y 1 C ASN 25  ? E ASN 25  
42 1 Y 1 C GLN 26  ? E GLN 26  
43 1 Y 1 C ALA 27  ? E ALA 27  
44 1 Y 1 C SER 28  ? E SER 28  
45 1 Y 1 C HIS 29  ? E HIS 29  
46 1 Y 1 C VAL 30  ? E VAL 30  
47 1 Y 1 C SER 31  ? E SER 31  
48 1 Y 1 C ALA 32  ? E ALA 32  
49 1 Y 1 C LYS 33  ? E LYS 33  
50 1 Y 1 C THR 34  ? E THR 34  
51 1 Y 1 C ARG 35  ? E ARG 35  
52 1 Y 1 C GLU 36  ? E GLU 36  
53 1 Y 1 C LYS 37  ? E LYS 37  
54 1 Y 1 C VAL 38  ? E VAL 38  
55 1 Y 1 C GLU 39  ? E GLU 39  
56 1 Y 1 C ALA 40  ? E ALA 40  
57 1 Y 1 C ALA 41  ? E ALA 41  
58 1 Y 1 C MET 42  ? E MET 42  
59 1 Y 1 C ALA 43  ? E ALA 43  
60 1 Y 1 C GLU 44  ? E GLU 44  
61 1 Y 1 C LEU 45  ? E LEU 45  
62 1 Y 1 C PRO 332 ? E PRO 332 
63 1 Y 1 C ASN 333 ? E ASN 333 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1EFA 'double helix'        
1EFA 'a-form double helix' 
1EFA 'quadruple helix'     
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 5  1_555 B DA 18 1_555 -0.336 -0.458 1.288 0.630   -25.977 -4.164  1  D_DT5:DA18_E  D 5  ? E 18 ? 20 1 
1 A DG 6  1_555 B DC 17 1_555 -0.108 -0.342 1.014 -9.755  -25.124 -6.161  2  D_DG6:DC17_E  D 6  ? E 17 ? 19 1 
1 A DT 7  1_555 B DA 16 1_555 -0.260 -0.281 1.098 -12.217 -26.247 -0.323  3  D_DT7:DA16_E  D 7  ? E 16 ? 20 1 
1 A DG 8  1_555 B DC 15 1_555 -0.009 -0.197 0.596 -12.865 -32.811 -5.242  4  D_DG8:DC15_E  D 8  ? E 15 ? 19 1 
1 A DA 9  1_555 B DT 14 1_555 0.080  -0.129 0.559 -8.202  -22.139 0.244   5  D_DA9:DT14_E  D 9  ? E 14 ? 20 1 
1 A DG 10 1_555 B DC 13 1_555 -0.072 -0.114 0.891 10.448  -14.020 0.372   6  D_DG10:DC13_E D 10 ? E 13 ? 19 1 
1 A DC 11 1_555 B DG 12 1_555 0.168  -0.047 0.024 23.240  -27.133 0.837   7  D_DC11:DG12_E D 11 ? E 12 ? 19 1 
1 A DG 12 1_555 B DC 11 1_555 -0.138 -0.041 0.093 -23.109 -27.738 0.799   8  D_DG12:DC11_E D 12 ? E 11 ? 19 1 
1 A DC 13 1_555 B DG 10 1_555 0.042  -0.179 1.011 -11.002 -14.147 -0.161  9  D_DC13:DG10_E D 13 ? E 10 ? 19 1 
1 A DT 14 1_555 B DA 9  1_555 -0.129 -0.187 0.633 7.953   -22.354 -0.041  10 D_DT14:DA9_E  D 14 ? E 9  ? 20 1 
1 A DC 15 1_555 B DG 8  1_555 -0.028 -0.241 0.689 13.207  -33.555 -5.853  11 D_DC15:DG8_E  D 15 ? E 8  ? 19 1 
1 A DA 16 1_555 B DT 7  1_555 0.209  -0.271 1.097 10.903  -24.912 0.069   12 D_DA16:DT7_E  D 16 ? E 7  ? 20 1 
1 A DC 17 1_555 B DG 6  1_555 0.107  -0.273 0.991 10.456  -25.475 -5.987  13 D_DC17:DG6_E  D 17 ? E 6  ? 19 1 
1 A DA 18 1_555 B DT 5  1_555 0.070  -0.368 1.021 -0.327  -25.287 2.272   14 D_DA18:DT5_E  D 18 ? E 5  ? 20 1 
1 A DA 19 1_555 B DT 4  1_555 0.432  0.326  1.815 2.900   -45.581 11.319  15 D_DA19:DT4_E  D 19 ? E 4  ? ?  ? 
1 A DT 20 1_555 B DA 3  1_555 -1.516 -0.454 1.010 -7.452  -53.747 -13.064 16 D_DT20:DA3_E  D 20 ? E 3  ? ?  ? 
1 A DT 21 1_555 B DA 2  1_555 -0.264 0.532  1.085 -16.980 -40.189 22.439  17 D_DT21:DA2_E  D 21 ? E 2  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 5  1_555 B DA 18 1_555 A DG 6  1_555 B DC 17 1_555 -0.271 -1.096 3.268 0.648   -9.991  39.975 -0.434 0.458  3.429 -14.344 
-0.931  41.160 1  DD_DT5DG6:DC17DA18_EE   D 5  ? E 18 ? D 6  ? E 17 ? 
1 A DG 6  1_555 B DC 17 1_555 A DT 7  1_555 B DA 16 1_555 -0.928 -1.594 3.280 -2.061  -8.655  31.944 -1.226 1.255  3.627 -15.357 
3.657   33.129 2  DD_DG6DT7:DA16DC17_EE   D 6  ? E 17 ? D 7  ? E 16 ? 
1 A DT 7  1_555 B DA 16 1_555 A DG 8  1_555 B DC 15 1_555 -0.322 -0.593 3.182 -1.650  -0.348  39.441 -0.839 0.288  3.197 -0.516  
2.444   39.475 3  DD_DT7DG8:DC15DA16_EE   D 7  ? E 16 ? D 8  ? E 15 ? 
1 A DG 8  1_555 B DC 15 1_555 A DA 9  1_555 B DT 14 1_555 0.121  -0.983 3.105 2.862   -6.400  31.809 -0.659 0.274  3.234 -11.503 
-5.143  32.553 4  DD_DG8DA9:DT14DC15_EE   D 8  ? E 15 ? D 9  ? E 14 ? 
1 A DA 9  1_555 B DT 14 1_555 A DG 10 1_555 B DC 13 1_555 0.960  -0.483 2.896 -0.888  -7.578  33.583 0.244  -1.746 2.907 -12.909 
1.512   34.414 5  DD_DA9DG10:DC13DT14_EE  D 9  ? E 14 ? D 10 ? E 13 ? 
1 A DG 10 1_555 B DC 13 1_555 A DC 11 1_555 B DG 12 1_555 -0.716 -0.087 3.087 11.689  -4.908  33.299 0.511  2.728  2.679 -8.205  
-19.539 35.567 6  DD_DG10DC11:DG12DC13_EE D 10 ? E 13 ? D 11 ? E 12 ? 
1 A DC 11 1_555 B DG 12 1_555 A DG 12 1_555 B DC 11 1_555 -0.049 1.551  5.410 -0.149  60.126  13.235 -4.817 0.033  2.732 78.740  
0.195   61.433 7  DD_DC11DG12:DC11DG12_EE D 11 ? E 12 ? D 12 ? E 11 ? 
1 A DG 12 1_555 B DC 11 1_555 A DC 13 1_555 B DG 10 1_555 0.676  -0.123 3.126 -12.525 -5.648  33.201 0.550  -2.762 2.691 -9.399  
20.844  35.858 8  DD_DG12DC13:DG10DC11_EE D 12 ? E 11 ? D 13 ? E 10 ? 
1 A DC 13 1_555 B DG 10 1_555 A DT 14 1_555 B DA 9  1_555 -0.929 -0.528 2.879 1.175   -8.552  33.485 0.297  1.726  2.889 -14.544 
-1.998  34.549 9  DD_DC13DT14:DA9DG10_EE  D 13 ? E 10 ? D 14 ? E 9  ? 
1 A DT 14 1_555 B DA 9  1_555 A DC 15 1_555 B DG 8  1_555 -0.134 -1.017 3.050 -2.601  -6.082  32.108 -0.795 -0.194 3.184 -10.852 
4.641   32.765 10 DD_DT14DC15:DG8DA9_EE   D 14 ? E 9  ? D 15 ? E 8  ? 
1 A DC 15 1_555 B DG 8  1_555 A DA 16 1_555 B DT 7  1_555 0.377  -0.596 3.225 2.128   -0.596  39.444 -0.812 -0.311 3.249 -0.882  
-3.149  39.503 11 DD_DC15DA16:DT7DG8_EE   D 15 ? E 8  ? D 16 ? E 7  ? 
1 A DA 16 1_555 B DT 7  1_555 A DC 17 1_555 B DG 6  1_555 0.904  -1.566 3.207 2.300   -8.207  32.149 -1.296 -1.177 3.542 -14.503 
-4.064  33.230 12 DD_DA16DC17:DG6DT7_EE   D 16 ? E 7  ? D 17 ? E 6  ? 
1 A DC 17 1_555 B DG 6  1_555 A DA 18 1_555 B DT 5  1_555 0.529  -0.913 3.457 1.686   -11.732 37.477 0.186  -0.565 3.592 -17.725 
-2.547  39.243 13 DD_DC17DA18:DT5DG6_EE   D 17 ? E 6  ? D 18 ? E 5  ? 
1 A DA 18 1_555 B DT 5  1_555 A DA 19 1_555 B DT 4  1_555 0.264  -1.036 3.076 0.280   -11.043 37.727 -0.243 -0.360 3.244 -16.646 
-0.422  39.254 14 DD_DA18DA19:DT4DT5_EE   D 18 ? E 5  ? D 19 ? E 4  ? 
1 A DA 19 1_555 B DT 4  1_555 A DT 20 1_555 B DA 3  1_555 -1.400 -1.588 3.116 -1.078  1.462   23.775 -4.296 3.056  3.074 3.541   
2.611   23.843 15 DD_DA19DT20:DA3DT4_EE   D 19 ? E 4  ? D 20 ? E 3  ? 
1 A DT 20 1_555 B DA 3  1_555 A DT 21 1_555 B DA 2  1_555 1.432  0.088  3.632 7.390   2.910   39.672 -0.249 -1.117 3.824 4.236   
-10.758 40.427 16 DD_DT20DT21:DA2DA3_EE   D 20 ? E 3  ? D 21 ? E 2  ? 
# 
_pdbx_chem_comp_identifier.comp_id           NPF 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        orthonitrophenyl-b-D-fucopyranoside 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '2-nitrophenyl beta-D-fucopyranoside' NPF 
4 water                                 HOH 
#